(data stored in ACNUC7421 zone)

EMBL: CP000922

ID   CP000922; SV 1; circular; genomic DNA; STD; PRO; 2846746 BP.
XX
AC   CP000922;
XX
PR   Project:PRJNA28245;
XX
DT   16-DEC-2008 (Rel. 98, Created)
DT   16-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Anoxybacillus flavithermus WK1, complete genome.
XX
KW   .
XX
OS   Anoxybacillus flavithermus WK1
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Anoxybacillus.
XX
RN   [1]
RP   1-2846746
RX   DOI; 10.1186/gb-2008-9-11-r161.
RX   PUBMED; 19014707.
RA   Saw J.H., Mountain B.W., Feng L., Omelchenko M.V., Hou S., Saito J.A.,
RA   Stott M.B., Li D., Zhao G., Wu J., Galperin M.Y., Koonin E.V.,
RA   Makarova K.S., Wolf Y.I., Rigden D.J., Dunfield P.F., Wang L., Alam M.;
RT   "Encapsulated in silica: genome, proteome and physiology of the
RT   thermophilic bacterium Anoxybacillus flavithermus WK1";
RL   Genome Biol. 9(11):R161-R161(2008).
XX
RN   [2]
RP   1-2846746
RA   Saw J.H., Mountain B., Omelchenko M.V., Hou S., Saito J.A., Li D., Zhao G.,
RA   Feng L., Galperin M.Y., Koonin E.V., Makarova K.S., Wolf Y.I., Rigden D.J.,
RA   Stott M., Dunfield P., Wang L., Alam M.;
RT   ;
RL   Submitted (17-DEC-2007) to the INSDC.
RL   Microbiology, University of Hawaii, 2538 McCarthy Mall, Snyder Hall,
RL   Honolulu, HI 96822, USA
XX
DR   MD5; 856b3bb83c4a11a625675a53c57f5aba.
DR   BioSample; SAMN02604185.
DR   EnsemblGenomes-Gn; Aflv_R001.
DR   EnsemblGenomes-Gn; Aflv_R002.
DR   EnsemblGenomes-Gn; Aflv_R003.
DR   EnsemblGenomes-Gn; Aflv_R004.
DR   EnsemblGenomes-Gn; Aflv_R005.
DR   EnsemblGenomes-Gn; Aflv_R007.
DR   EnsemblGenomes-Gn; Aflv_R008.
DR   EnsemblGenomes-Gn; Aflv_R009.
DR   EnsemblGenomes-Gn; Aflv_R010.
DR   EnsemblGenomes-Gn; Aflv_R011.
DR   EnsemblGenomes-Gn; Aflv_R012.
DR   EnsemblGenomes-Gn; Aflv_R013.
DR   EnsemblGenomes-Gn; Aflv_R014.
DR   EnsemblGenomes-Gn; Aflv_R015.
DR   EnsemblGenomes-Gn; Aflv_R016.
DR   EnsemblGenomes-Gn; Aflv_R017.
DR   EnsemblGenomes-Gn; Aflv_R018.
DR   EnsemblGenomes-Gn; Aflv_R019.
DR   EnsemblGenomes-Gn; Aflv_R020.
DR   EnsemblGenomes-Gn; Aflv_R021.
DR   EnsemblGenomes-Gn; Aflv_R022.
DR   EnsemblGenomes-Gn; Aflv_R023.
DR   EnsemblGenomes-Gn; Aflv_R024.
DR   EnsemblGenomes-Gn; Aflv_R025.
DR   EnsemblGenomes-Gn; Aflv_R026.
DR   EnsemblGenomes-Gn; Aflv_R027.
DR   EnsemblGenomes-Gn; Aflv_R028.
DR   EnsemblGenomes-Gn; Aflv_R029.
DR   EnsemblGenomes-Gn; Aflv_R030.
DR   EnsemblGenomes-Gn; Aflv_R031.
DR   EnsemblGenomes-Gn; Aflv_R032.
DR   EnsemblGenomes-Gn; Aflv_R033.
DR   EnsemblGenomes-Gn; Aflv_R034.
DR   EnsemblGenomes-Gn; Aflv_R035.
DR   EnsemblGenomes-Gn; Aflv_R036.
DR   EnsemblGenomes-Gn; Aflv_R037.
DR   EnsemblGenomes-Gn; Aflv_R038.
DR   EnsemblGenomes-Gn; Aflv_R039.
DR   EnsemblGenomes-Gn; Aflv_R040.
DR   EnsemblGenomes-Gn; Aflv_R041.
DR   EnsemblGenomes-Gn; Aflv_R042.
DR   EnsemblGenomes-Gn; Aflv_R043.
DR   EnsemblGenomes-Gn; Aflv_R044.
DR   EnsemblGenomes-Gn; Aflv_R045.
DR   EnsemblGenomes-Gn; Aflv_R046.
DR   EnsemblGenomes-Gn; Aflv_R047.
DR   EnsemblGenomes-Gn; Aflv_R048.
DR   EnsemblGenomes-Gn; Aflv_R050.
DR   EnsemblGenomes-Gn; Aflv_R051.
DR   EnsemblGenomes-Gn; Aflv_R052.
DR   EnsemblGenomes-Gn; Aflv_R054.
DR   EnsemblGenomes-Gn; Aflv_R055.
DR   EnsemblGenomes-Gn; Aflv_R056.
DR   EnsemblGenomes-Gn; Aflv_R057.
DR   EnsemblGenomes-Gn; Aflv_R058.
DR   EnsemblGenomes-Gn; Aflv_R059.
DR   EnsemblGenomes-Gn; Aflv_R060.
DR   EnsemblGenomes-Gn; Aflv_R061.
DR   EnsemblGenomes-Gn; Aflv_R062.
DR   EnsemblGenomes-Gn; Aflv_R063.
DR   EnsemblGenomes-Gn; Aflv_R064.
DR   EnsemblGenomes-Gn; Aflv_R065.
DR   EnsemblGenomes-Gn; Aflv_R066.
DR   EnsemblGenomes-Gn; Aflv_R067.
DR   EnsemblGenomes-Gn; Aflv_R068.
DR   EnsemblGenomes-Gn; Aflv_R069.
DR   EnsemblGenomes-Gn; Aflv_R070.
DR   EnsemblGenomes-Gn; Aflv_R071.
DR   EnsemblGenomes-Gn; Aflv_R072.
DR   EnsemblGenomes-Gn; Aflv_R073.
DR   EnsemblGenomes-Gn; Aflv_R074.
DR   EnsemblGenomes-Gn; Aflv_R075.
DR   EnsemblGenomes-Gn; Aflv_R076.
DR   EnsemblGenomes-Gn; Aflv_R077.
DR   EnsemblGenomes-Gn; Aflv_R078.
DR   EnsemblGenomes-Gn; Aflv_R081.
DR   EnsemblGenomes-Gn; Aflv_R082.
DR   EnsemblGenomes-Gn; Aflv_R085.
DR   EnsemblGenomes-Gn; Aflv_R086.
DR   EnsemblGenomes-Gn; Aflv_R093.
DR   EnsemblGenomes-Gn; Aflv_R098.
DR   EnsemblGenomes-Gn; Aflv_R099.
DR   EnsemblGenomes-Gn; Aflv_R100.
DR   EnsemblGenomes-Gn; Aflv_R101.
DR   EnsemblGenomes-Gn; Aflv_R102.
DR   EnsemblGenomes-Gn; Aflv_R103.
DR   EnsemblGenomes-Gn; Aflv_R104.
DR   EnsemblGenomes-Gn; Aflv_R105.
DR   EnsemblGenomes-Gn; Aflv_R106.
DR   EnsemblGenomes-Gn; Aflv_R107.
DR   EnsemblGenomes-Gn; Aflv_R108.
DR   EnsemblGenomes-Gn; Aflv_R109.
DR   EnsemblGenomes-Gn; Aflv_R110.
DR   EnsemblGenomes-Gn; Aflv_R111.
DR   EnsemblGenomes-Gn; Aflv_R112.
DR   EnsemblGenomes-Gn; Aflv_R113.
DR   EnsemblGenomes-Gn; Aflv_R114.
DR   EnsemblGenomes-Gn; Aflv_R115.
DR   EnsemblGenomes-Gn; Aflv_R116.
DR   EnsemblGenomes-Gn; Aflv_R117.
DR   EnsemblGenomes-Gn; Aflv_R118.
DR   EnsemblGenomes-Gn; Aflv_R120.
DR   EnsemblGenomes-Gn; Aflv_R121.
DR   EnsemblGenomes-Gn; Aflv_R122.
DR   EnsemblGenomes-Gn; Aflv_R123.
DR   EnsemblGenomes-Gn; EBG00001104774.
DR   EnsemblGenomes-Gn; EBG00001104775.
DR   EnsemblGenomes-Gn; EBG00001104776.
DR   EnsemblGenomes-Gn; EBG00001104777.
DR   EnsemblGenomes-Gn; EBG00001104778.
DR   EnsemblGenomes-Gn; EBG00001104779.
DR   EnsemblGenomes-Gn; EBG00001104780.
DR   EnsemblGenomes-Gn; EBG00001104781.
DR   EnsemblGenomes-Gn; EBG00001104782.
DR   EnsemblGenomes-Gn; EBG00001104783.
DR   EnsemblGenomes-Gn; EBG00001104784.
DR   EnsemblGenomes-Gn; EBG00001104785.
DR   EnsemblGenomes-Gn; EBG00001104786.
DR   EnsemblGenomes-Gn; EBG00001104787.
DR   EnsemblGenomes-Gn; EBG00001104788.
DR   EnsemblGenomes-Gn; EBG00001104789.
DR   EnsemblGenomes-Gn; EBG00001104790.
DR   EnsemblGenomes-Gn; EBG00001104791.
DR   EnsemblGenomes-Gn; EBG00001104792.
DR   EnsemblGenomes-Gn; EBG00001104793.
DR   EnsemblGenomes-Gn; EBG00001104794.
DR   EnsemblGenomes-Gn; EBG00001104795.
DR   EnsemblGenomes-Gn; EBG00001104796.
DR   EnsemblGenomes-Gn; EBG00001104797.
DR   EnsemblGenomes-Gn; EBG00001104798.
DR   EnsemblGenomes-Gn; EBG00001104799.
DR   EnsemblGenomes-Gn; EBG00001104800.
DR   EnsemblGenomes-Gn; EBG00001104801.
DR   EnsemblGenomes-Gn; EBG00001104802.
DR   EnsemblGenomes-Gn; EBG00001104803.
DR   EnsemblGenomes-Gn; EBG00001104804.
DR   EnsemblGenomes-Gn; EBG00001104805.
DR   EnsemblGenomes-Gn; EBG00001104806.
DR   EnsemblGenomes-Gn; EBG00001104807.
DR   EnsemblGenomes-Gn; EBG00001104808.
DR   EnsemblGenomes-Gn; EBG00001104809.
DR   EnsemblGenomes-Gn; EBG00001104810.
DR   EnsemblGenomes-Gn; EBG00001104811.
DR   EnsemblGenomes-Gn; EBG00001104812.
DR   EnsemblGenomes-Gn; EBG00001104813.
DR   EnsemblGenomes-Gn; EBG00001104814.
DR   EnsemblGenomes-Gn; EBG00001104815.
DR   EnsemblGenomes-Gn; EBG00001104816.
DR   EnsemblGenomes-Gn; EBG00001104817.
DR   EnsemblGenomes-Gn; EBG00001104818.
DR   EnsemblGenomes-Gn; EBG00001104819.
DR   EnsemblGenomes-Gn; EBG00001104820.
DR   EnsemblGenomes-Gn; EBG00001104821.
DR   EnsemblGenomes-Gn; EBG00001104822.
DR   EnsemblGenomes-Gn; EBG00001104823.
DR   EnsemblGenomes-Gn; EBG00001104824.
DR   EnsemblGenomes-Gn; EBG00001104825.
DR   EnsemblGenomes-Gn; EBG00001104826.
DR   EnsemblGenomes-Gn; EBG00001104827.
DR   EnsemblGenomes-Gn; EBG00001104828.
DR   EnsemblGenomes-Gn; EBG00001104829.
DR   EnsemblGenomes-Gn; EBG00001104830.
DR   EnsemblGenomes-Gn; EBG00001104831.
DR   EnsemblGenomes-Gn; EBG00001104832.
DR   EnsemblGenomes-Gn; EBG00001104833.
DR   EnsemblGenomes-Gn; EBG00001104834.
DR   EnsemblGenomes-Gn; EBG00001104835.
DR   EnsemblGenomes-Gn; EBG00001104836.
DR   EnsemblGenomes-Gn; EBG00001104837.
DR   EnsemblGenomes-Gn; EBG00001104838.
DR   EnsemblGenomes-Gn; EBG00001104839.
DR   EnsemblGenomes-Gn; EBG00001104840.
DR   EnsemblGenomes-Gn; EBG00001104841.
DR   EnsemblGenomes-Gn; EBG00001104842.
DR   EnsemblGenomes-Gn; EBG00001104843.
DR   EnsemblGenomes-Gn; EBG00001104844.
DR   EnsemblGenomes-Gn; EBG00001104845.
DR   EnsemblGenomes-Gn; EBG00001104846.
DR   EnsemblGenomes-Gn; EBG00001104847.
DR   EnsemblGenomes-Gn; EBG00001104848.
DR   EnsemblGenomes-Gn; EBG00001104849.
DR   EnsemblGenomes-Gn; EBG00001104850.
DR   EnsemblGenomes-Gn; EBG00001104851.
DR   EnsemblGenomes-Gn; EBG00001104852.
DR   EnsemblGenomes-Gn; EBG00001104853.
DR   EnsemblGenomes-Gn; EBG00001104854.
DR   EnsemblGenomes-Gn; EBG00001104855.
DR   EnsemblGenomes-Gn; EBG00001104856.
DR   EnsemblGenomes-Gn; EBG00001104857.
DR   EnsemblGenomes-Gn; EBG00001104858.
DR   EnsemblGenomes-Gn; EBG00001104859.
DR   EnsemblGenomes-Gn; EBG00001104860.
DR   EnsemblGenomes-Gn; EBG00001104861.
DR   EnsemblGenomes-Gn; EBG00001104862.
DR   EnsemblGenomes-Gn; EBG00001104863.
DR   EnsemblGenomes-Gn; EBG00001104864.
DR   EnsemblGenomes-Gn; EBG00001104865.
DR   EnsemblGenomes-Gn; EBG00001104866.
DR   EnsemblGenomes-Gn; EBG00001104867.
DR   EnsemblGenomes-Gn; EBG00001104868.
DR   EnsemblGenomes-Gn; EBG00001104869.
DR   EnsemblGenomes-Gn; EBG00001104870.
DR   EnsemblGenomes-Gn; EBG00001104871.
DR   EnsemblGenomes-Gn; EBG00001104872.
DR   EnsemblGenomes-Gn; EBG00001104873.
DR   EnsemblGenomes-Gn; EBG00001104874.
DR   EnsemblGenomes-Gn; EBG00001104875.
DR   EnsemblGenomes-Gn; EBG00001104876.
DR   EnsemblGenomes-Gn; EBG00001104877.
DR   EnsemblGenomes-Gn; EBG00001104878.
DR   EnsemblGenomes-Gn; EBG00001104879.
DR   EnsemblGenomes-Gn; EBG00001104880.
DR   EnsemblGenomes-Gn; EBG00001104881.
DR   EnsemblGenomes-Gn; EBG00001104882.
DR   EnsemblGenomes-Gn; EBG00001104883.
DR   EnsemblGenomes-Gn; EBG00001104884.
DR   EnsemblGenomes-Gn; EBG00001104885.
DR   EnsemblGenomes-Gn; EBG00001104886.
DR   EnsemblGenomes-Gn; EBG00001104887.
DR   EnsemblGenomes-Gn; EBG00001104888.
DR   EnsemblGenomes-Gn; EBG00001104889.
DR   EnsemblGenomes-Gn; EBG00001104890.
DR   EnsemblGenomes-Gn; EBG00001104891.
DR   EnsemblGenomes-Gn; EBG00001104892.
DR   EnsemblGenomes-Gn; EBG00001104893.
DR   EnsemblGenomes-Gn; EBG00001104894.
DR   EnsemblGenomes-Gn; EBG00001104895.
DR   EnsemblGenomes-Gn; EBG00001104896.
DR   EnsemblGenomes-Gn; EBG00001104897.
DR   EnsemblGenomes-Gn; EBG00001104898.
DR   EnsemblGenomes-Gn; EBG00001104899.
DR   EnsemblGenomes-Gn; EBG00001104900.
DR   EnsemblGenomes-Gn; EBG00001104901.
DR   EnsemblGenomes-Gn; EBG00001104902.
DR   EnsemblGenomes-Gn; EBG00001104903.
DR   EnsemblGenomes-Gn; EBG00001104904.
DR   EnsemblGenomes-Gn; EBG00001104905.
DR   EnsemblGenomes-Gn; EBG00001104906.
DR   EnsemblGenomes-Gn; EBG00001104907.
DR   EnsemblGenomes-Gn; EBG00001104908.
DR   EnsemblGenomes-Gn; EBG00001104909.
DR   EnsemblGenomes-Gn; EBG00001104910.
DR   EnsemblGenomes-Gn; EBG00001104911.
DR   EnsemblGenomes-Gn; EBG00001104912.
DR   EnsemblGenomes-Gn; EBG00001104913.
DR   EnsemblGenomes-Gn; EBG00001104914.
DR   EnsemblGenomes-Gn; EBG00001104915.
DR   EnsemblGenomes-Gn; EBG00001104916.
DR   EnsemblGenomes-Gn; EBG00001104917.
DR   EnsemblGenomes-Gn; EBG00001104918.
DR   EnsemblGenomes-Gn; EBG00001104919.
DR   EnsemblGenomes-Gn; EBG00001104920.
DR   EnsemblGenomes-Gn; EBG00001104921.
DR   EnsemblGenomes-Gn; EBG00001104922.
DR   EnsemblGenomes-Gn; EBG00001104923.
DR   EnsemblGenomes-Gn; EBG00001104924.
DR   EnsemblGenomes-Gn; EBG00001104925.
DR   EnsemblGenomes-Gn; EBG00001104926.
DR   EnsemblGenomes-Gn; EBG00001104927.
DR   EnsemblGenomes-Gn; EBG00001104928.
DR   EnsemblGenomes-Gn; EBG00001104929.
DR   EnsemblGenomes-Gn; EBG00001104930.
DR   EnsemblGenomes-Gn; EBG00001104931.
DR   EnsemblGenomes-Gn; EBG00001104932.
DR   EnsemblGenomes-Gn; EBG00001104933.
DR   EnsemblGenomes-Gn; EBG00001104934.
DR   EnsemblGenomes-Gn; EBG00001104935.
DR   EnsemblGenomes-Gn; EBG00001104936.
DR   EnsemblGenomes-Gn; EBG00001104937.
DR   EnsemblGenomes-Gn; EBG00001104938.
DR   EnsemblGenomes-Gn; EBG00001104939.
DR   EnsemblGenomes-Gn; EBG00001104940.
DR   EnsemblGenomes-Gn; EBG00001104941.
DR   EnsemblGenomes-Gn; EBG00001104942.
DR   EnsemblGenomes-Gn; EBG00001104943.
DR   EnsemblGenomes-Gn; EBG00001104944.
DR   EnsemblGenomes-Gn; EBG00001104945.
DR   EnsemblGenomes-Gn; EBG00001104946.
DR   EnsemblGenomes-Gn; EBG00001104947.
DR   EnsemblGenomes-Gn; EBG00001104948.
DR   EnsemblGenomes-Gn; EBG00001104949.
DR   EnsemblGenomes-Gn; EBG00001104950.
DR   EnsemblGenomes-Gn; EBG00001104951.
DR   EnsemblGenomes-Gn; EBG00001104952.
DR   EnsemblGenomes-Gn; EBG00001104953.
DR   EnsemblGenomes-Gn; EBG00001104954.
DR   EnsemblGenomes-Gn; EBG00001104955.
DR   EnsemblGenomes-Gn; EBG00001104956.
DR   EnsemblGenomes-Gn; EBG00001104957.
DR   EnsemblGenomes-Gn; EBG00001104958.
DR   EnsemblGenomes-Gn; EBG00001104959.
DR   EnsemblGenomes-Gn; EBG00001104960.
DR   EnsemblGenomes-Gn; EBG00001104961.
DR   EnsemblGenomes-Gn; EBG00001104962.
DR   EnsemblGenomes-Gn; EBG00001104963.
DR   EnsemblGenomes-Gn; EBG00001104964.
DR   EnsemblGenomes-Gn; EBG00001104965.
DR   EnsemblGenomes-Gn; EBG00001104966.
DR   EnsemblGenomes-Gn; EBG00001104967.
DR   EnsemblGenomes-Gn; EBG00001104968.
DR   EnsemblGenomes-Gn; EBG00001104969.
DR   EnsemblGenomes-Gn; EBG00001104970.
DR   EnsemblGenomes-Gn; EBG00001104971.
DR   EnsemblGenomes-Gn; EBG00001104972.
DR   EnsemblGenomes-Gn; EBG00001104973.
DR   EnsemblGenomes-Gn; EBG00001104974.
DR   EnsemblGenomes-Gn; EBG00001104975.
DR   EnsemblGenomes-Gn; EBG00001104976.
DR   EnsemblGenomes-Gn; EBG00001104977.
DR   EnsemblGenomes-Gn; EBG00001104978.
DR   EnsemblGenomes-Gn; EBG00001104979.
DR   EnsemblGenomes-Gn; EBG00001104980.
DR   EnsemblGenomes-Gn; EBG00001104981.
DR   EnsemblGenomes-Gn; EBG00001104982.
DR   EnsemblGenomes-Gn; EBG00001104983.
DR   EnsemblGenomes-Gn; EBG00001104984.
DR   EnsemblGenomes-Gn; EBG00001104985.
DR   EnsemblGenomes-Gn; EBG00001104986.
DR   EnsemblGenomes-Gn; EBG00001104987.
DR   EnsemblGenomes-Gn; EBG00001104988.
DR   EnsemblGenomes-Gn; EBG00001104989.
DR   EnsemblGenomes-Gn; EBG00001104990.
DR   EnsemblGenomes-Gn; EBG00001104991.
DR   EnsemblGenomes-Gn; EBG00001104992.
DR   EnsemblGenomes-Gn; EBG00001104993.
DR   EnsemblGenomes-Gn; EBG00001104994.
DR   EnsemblGenomes-Gn; EBG00001104995.
DR   EnsemblGenomes-Gn; EBG00001104996.
DR   EnsemblGenomes-Gn; EBG00001104997.
DR   EnsemblGenomes-Gn; EBG00001104998.
DR   EnsemblGenomes-Gn; EBG00001104999.
DR   EnsemblGenomes-Gn; EBG00001105000.
DR   EnsemblGenomes-Gn; EBG00001105001.
DR   EnsemblGenomes-Gn; EBG00001105002.
DR   EnsemblGenomes-Gn; EBG00001105003.
DR   EnsemblGenomes-Gn; EBG00001105004.
DR   EnsemblGenomes-Gn; EBG00001105005.
DR   EnsemblGenomes-Gn; EBG00001105006.
DR   EnsemblGenomes-Gn; EBG00001105007.
DR   EnsemblGenomes-Gn; EBG00001105008.
DR   EnsemblGenomes-Gn; EBG00001105009.
DR   EnsemblGenomes-Gn; EBG00001105010.
DR   EnsemblGenomes-Gn; EBG00001105011.
DR   EnsemblGenomes-Gn; EBG00001105012.
DR   EnsemblGenomes-Gn; EBG00001105013.
DR   EnsemblGenomes-Gn; EBG00001105014.
DR   EnsemblGenomes-Gn; EBG00001105015.
DR   EnsemblGenomes-Gn; EBG00001105016.
DR   EnsemblGenomes-Gn; EBG00001105017.
DR   EnsemblGenomes-Gn; EBG00001105018.
DR   EnsemblGenomes-Gn; EBG00001105019.
DR   EnsemblGenomes-Gn; EBG00001105020.
DR   EnsemblGenomes-Gn; EBG00001105021.
DR   EnsemblGenomes-Gn; EBG00001105022.
DR   EnsemblGenomes-Gn; EBG00001105023.
DR   EnsemblGenomes-Gn; EBG00001105024.
DR   EnsemblGenomes-Gn; EBG00001105025.
DR   EnsemblGenomes-Gn; EBG00001105026.
DR   EnsemblGenomes-Gn; EBG00001105027.
DR   EnsemblGenomes-Gn; EBG00001105028.
DR   EnsemblGenomes-Gn; EBG00001105029.
DR   EnsemblGenomes-Gn; EBG00001105030.
DR   EnsemblGenomes-Gn; EBG00001105031.
DR   EnsemblGenomes-Gn; EBG00001105032.
DR   EnsemblGenomes-Gn; EBG00001105033.
DR   EnsemblGenomes-Gn; EBG00001105034.
DR   EnsemblGenomes-Gn; EBG00001105035.
DR   EnsemblGenomes-Gn; EBG00001105036.
DR   EnsemblGenomes-Gn; EBG00001105037.
DR   EnsemblGenomes-Gn; EBG00001105038.
DR   EnsemblGenomes-Gn; EBG00001105039.
DR   EnsemblGenomes-Gn; EBG00001105040.
DR   EnsemblGenomes-Gn; EBG00001105041.
DR   EnsemblGenomes-Gn; EBG00001105042.
DR   EnsemblGenomes-Gn; EBG00001105043.
DR   EnsemblGenomes-Gn; EBG00001105044.
DR   EnsemblGenomes-Gn; EBG00001105045.
DR   EnsemblGenomes-Gn; EBG00001105046.
DR   EnsemblGenomes-Gn; EBG00001105047.
DR   EnsemblGenomes-Gn; EBG00001105048.
DR   EnsemblGenomes-Gn; EBG00001105049.
DR   EnsemblGenomes-Gn; EBG00001105050.
DR   EnsemblGenomes-Tr; Aflv_R001-1.
DR   EnsemblGenomes-Tr; Aflv_R002-1.
DR   EnsemblGenomes-Tr; Aflv_R003-1.
DR   EnsemblGenomes-Tr; Aflv_R004-1.
DR   EnsemblGenomes-Tr; Aflv_R005-1.
DR   EnsemblGenomes-Tr; Aflv_R007-1.
DR   EnsemblGenomes-Tr; Aflv_R008-1.
DR   EnsemblGenomes-Tr; Aflv_R009-1.
DR   EnsemblGenomes-Tr; Aflv_R010-1.
DR   EnsemblGenomes-Tr; Aflv_R011-1.
DR   EnsemblGenomes-Tr; Aflv_R012-1.
DR   EnsemblGenomes-Tr; Aflv_R013-1.
DR   EnsemblGenomes-Tr; Aflv_R014-1.
DR   EnsemblGenomes-Tr; Aflv_R015-1.
DR   EnsemblGenomes-Tr; Aflv_R016-1.
DR   EnsemblGenomes-Tr; Aflv_R017-1.
DR   EnsemblGenomes-Tr; Aflv_R018-1.
DR   EnsemblGenomes-Tr; Aflv_R019-1.
DR   EnsemblGenomes-Tr; Aflv_R020-1.
DR   EnsemblGenomes-Tr; Aflv_R021-1.
DR   EnsemblGenomes-Tr; Aflv_R022-1.
DR   EnsemblGenomes-Tr; Aflv_R023-1.
DR   EnsemblGenomes-Tr; Aflv_R024-1.
DR   EnsemblGenomes-Tr; Aflv_R025-1.
DR   EnsemblGenomes-Tr; Aflv_R026-1.
DR   EnsemblGenomes-Tr; Aflv_R027-1.
DR   EnsemblGenomes-Tr; Aflv_R028-1.
DR   EnsemblGenomes-Tr; Aflv_R029-1.
DR   EnsemblGenomes-Tr; Aflv_R030-1.
DR   EnsemblGenomes-Tr; Aflv_R031-1.
DR   EnsemblGenomes-Tr; Aflv_R032-1.
DR   EnsemblGenomes-Tr; Aflv_R033-1.
DR   EnsemblGenomes-Tr; Aflv_R034-1.
DR   EnsemblGenomes-Tr; Aflv_R035-1.
DR   EnsemblGenomes-Tr; Aflv_R036-1.
DR   EnsemblGenomes-Tr; Aflv_R037-1.
DR   EnsemblGenomes-Tr; Aflv_R038-1.
DR   EnsemblGenomes-Tr; Aflv_R039-1.
DR   EnsemblGenomes-Tr; Aflv_R040-1.
DR   EnsemblGenomes-Tr; Aflv_R041-1.
DR   EnsemblGenomes-Tr; Aflv_R042-1.
DR   EnsemblGenomes-Tr; Aflv_R043-1.
DR   EnsemblGenomes-Tr; Aflv_R044-1.
DR   EnsemblGenomes-Tr; Aflv_R045-1.
DR   EnsemblGenomes-Tr; Aflv_R046-1.
DR   EnsemblGenomes-Tr; Aflv_R047-1.
DR   EnsemblGenomes-Tr; Aflv_R048-1.
DR   EnsemblGenomes-Tr; Aflv_R050-1.
DR   EnsemblGenomes-Tr; Aflv_R051-1.
DR   EnsemblGenomes-Tr; Aflv_R052-1.
DR   EnsemblGenomes-Tr; Aflv_R054-1.
DR   EnsemblGenomes-Tr; Aflv_R055-1.
DR   EnsemblGenomes-Tr; Aflv_R056-1.
DR   EnsemblGenomes-Tr; Aflv_R057-1.
DR   EnsemblGenomes-Tr; Aflv_R058-1.
DR   EnsemblGenomes-Tr; Aflv_R059-1.
DR   EnsemblGenomes-Tr; Aflv_R060-1.
DR   EnsemblGenomes-Tr; Aflv_R061-1.
DR   EnsemblGenomes-Tr; Aflv_R062-1.
DR   EnsemblGenomes-Tr; Aflv_R063-1.
DR   EnsemblGenomes-Tr; Aflv_R064-1.
DR   EnsemblGenomes-Tr; Aflv_R065-1.
DR   EnsemblGenomes-Tr; Aflv_R066-1.
DR   EnsemblGenomes-Tr; Aflv_R067-1.
DR   EnsemblGenomes-Tr; Aflv_R068-1.
DR   EnsemblGenomes-Tr; Aflv_R069-1.
DR   EnsemblGenomes-Tr; Aflv_R070-1.
DR   EnsemblGenomes-Tr; Aflv_R071-1.
DR   EnsemblGenomes-Tr; Aflv_R072-1.
DR   EnsemblGenomes-Tr; Aflv_R073-1.
DR   EnsemblGenomes-Tr; Aflv_R074-1.
DR   EnsemblGenomes-Tr; Aflv_R075-1.
DR   EnsemblGenomes-Tr; Aflv_R076-1.
DR   EnsemblGenomes-Tr; Aflv_R077-1.
DR   EnsemblGenomes-Tr; Aflv_R078-1.
DR   EnsemblGenomes-Tr; Aflv_R081-1.
DR   EnsemblGenomes-Tr; Aflv_R082-1.
DR   EnsemblGenomes-Tr; Aflv_R085-1.
DR   EnsemblGenomes-Tr; Aflv_R086-1.
DR   EnsemblGenomes-Tr; Aflv_R093-1.
DR   EnsemblGenomes-Tr; Aflv_R098-1.
DR   EnsemblGenomes-Tr; Aflv_R099-1.
DR   EnsemblGenomes-Tr; Aflv_R100-1.
DR   EnsemblGenomes-Tr; Aflv_R101-1.
DR   EnsemblGenomes-Tr; Aflv_R102-1.
DR   EnsemblGenomes-Tr; Aflv_R103-1.
DR   EnsemblGenomes-Tr; Aflv_R104-1.
DR   EnsemblGenomes-Tr; Aflv_R105-1.
DR   EnsemblGenomes-Tr; Aflv_R106-1.
DR   EnsemblGenomes-Tr; Aflv_R107-1.
DR   EnsemblGenomes-Tr; Aflv_R108-1.
DR   EnsemblGenomes-Tr; Aflv_R109-1.
DR   EnsemblGenomes-Tr; Aflv_R110-1.
DR   EnsemblGenomes-Tr; Aflv_R111-1.
DR   EnsemblGenomes-Tr; Aflv_R112-1.
DR   EnsemblGenomes-Tr; Aflv_R113-1.
DR   EnsemblGenomes-Tr; Aflv_R114-1.
DR   EnsemblGenomes-Tr; Aflv_R115-1.
DR   EnsemblGenomes-Tr; Aflv_R116-1.
DR   EnsemblGenomes-Tr; Aflv_R117-1.
DR   EnsemblGenomes-Tr; Aflv_R118-1.
DR   EnsemblGenomes-Tr; Aflv_R120-1.
DR   EnsemblGenomes-Tr; Aflv_R121-1.
DR   EnsemblGenomes-Tr; Aflv_R122-1.
DR   EnsemblGenomes-Tr; Aflv_R123-1.
DR   EnsemblGenomes-Tr; EBT00001696424.
DR   EnsemblGenomes-Tr; EBT00001696425.
DR   EnsemblGenomes-Tr; EBT00001696426.
DR   EnsemblGenomes-Tr; EBT00001696427.
DR   EnsemblGenomes-Tr; EBT00001696428.
DR   EnsemblGenomes-Tr; EBT00001696429.
DR   EnsemblGenomes-Tr; EBT00001696430.
DR   EnsemblGenomes-Tr; EBT00001696431.
DR   EnsemblGenomes-Tr; EBT00001696432.
DR   EnsemblGenomes-Tr; EBT00001696433.
DR   EnsemblGenomes-Tr; EBT00001696434.
DR   EnsemblGenomes-Tr; EBT00001696435.
DR   EnsemblGenomes-Tr; EBT00001696436.
DR   EnsemblGenomes-Tr; EBT00001696437.
DR   EnsemblGenomes-Tr; EBT00001696438.
DR   EnsemblGenomes-Tr; EBT00001696439.
DR   EnsemblGenomes-Tr; EBT00001696440.
DR   EnsemblGenomes-Tr; EBT00001696441.
DR   EnsemblGenomes-Tr; EBT00001696442.
DR   EnsemblGenomes-Tr; EBT00001696443.
DR   EnsemblGenomes-Tr; EBT00001696444.
DR   EnsemblGenomes-Tr; EBT00001696445.
DR   EnsemblGenomes-Tr; EBT00001696446.
DR   EnsemblGenomes-Tr; EBT00001696447.
DR   EnsemblGenomes-Tr; EBT00001696448.
DR   EnsemblGenomes-Tr; EBT00001696449.
DR   EnsemblGenomes-Tr; EBT00001696450.
DR   EnsemblGenomes-Tr; EBT00001696451.
DR   EnsemblGenomes-Tr; EBT00001696452.
DR   EnsemblGenomes-Tr; EBT00001696453.
DR   EnsemblGenomes-Tr; EBT00001696454.
DR   EnsemblGenomes-Tr; EBT00001696455.
DR   EnsemblGenomes-Tr; EBT00001696456.
DR   EnsemblGenomes-Tr; EBT00001696457.
DR   EnsemblGenomes-Tr; EBT00001696458.
DR   EnsemblGenomes-Tr; EBT00001696459.
DR   EnsemblGenomes-Tr; EBT00001696460.
DR   EnsemblGenomes-Tr; EBT00001696461.
DR   EnsemblGenomes-Tr; EBT00001696462.
DR   EnsemblGenomes-Tr; EBT00001696463.
DR   EnsemblGenomes-Tr; EBT00001696464.
DR   EnsemblGenomes-Tr; EBT00001696465.
DR   EnsemblGenomes-Tr; EBT00001696466.
DR   EnsemblGenomes-Tr; EBT00001696467.
DR   EnsemblGenomes-Tr; EBT00001696468.
DR   EnsemblGenomes-Tr; EBT00001696469.
DR   EnsemblGenomes-Tr; EBT00001696470.
DR   EnsemblGenomes-Tr; EBT00001696471.
DR   EnsemblGenomes-Tr; EBT00001696472.
DR   EnsemblGenomes-Tr; EBT00001696473.
DR   EnsemblGenomes-Tr; EBT00001696474.
DR   EnsemblGenomes-Tr; EBT00001696475.
DR   EnsemblGenomes-Tr; EBT00001696476.
DR   EnsemblGenomes-Tr; EBT00001696477.
DR   EnsemblGenomes-Tr; EBT00001696478.
DR   EnsemblGenomes-Tr; EBT00001696479.
DR   EnsemblGenomes-Tr; EBT00001696480.
DR   EnsemblGenomes-Tr; EBT00001696481.
DR   EnsemblGenomes-Tr; EBT00001696482.
DR   EnsemblGenomes-Tr; EBT00001696483.
DR   EnsemblGenomes-Tr; EBT00001696484.
DR   EnsemblGenomes-Tr; EBT00001696485.
DR   EnsemblGenomes-Tr; EBT00001696486.
DR   EnsemblGenomes-Tr; EBT00001696487.
DR   EnsemblGenomes-Tr; EBT00001696488.
DR   EnsemblGenomes-Tr; EBT00001696489.
DR   EnsemblGenomes-Tr; EBT00001696490.
DR   EnsemblGenomes-Tr; EBT00001696491.
DR   EnsemblGenomes-Tr; EBT00001696492.
DR   EnsemblGenomes-Tr; EBT00001696493.
DR   EnsemblGenomes-Tr; EBT00001696494.
DR   EnsemblGenomes-Tr; EBT00001696495.
DR   EnsemblGenomes-Tr; EBT00001696496.
DR   EnsemblGenomes-Tr; EBT00001696497.
DR   EnsemblGenomes-Tr; EBT00001696498.
DR   EnsemblGenomes-Tr; EBT00001696499.
DR   EnsemblGenomes-Tr; EBT00001696500.
DR   EnsemblGenomes-Tr; EBT00001696501.
DR   EnsemblGenomes-Tr; EBT00001696502.
DR   EnsemblGenomes-Tr; EBT00001696503.
DR   EnsemblGenomes-Tr; EBT00001696504.
DR   EnsemblGenomes-Tr; EBT00001696505.
DR   EnsemblGenomes-Tr; EBT00001696506.
DR   EnsemblGenomes-Tr; EBT00001696507.
DR   EnsemblGenomes-Tr; EBT00001696508.
DR   EnsemblGenomes-Tr; EBT00001696509.
DR   EnsemblGenomes-Tr; EBT00001696510.
DR   EnsemblGenomes-Tr; EBT00001696511.
DR   EnsemblGenomes-Tr; EBT00001696512.
DR   EnsemblGenomes-Tr; EBT00001696513.
DR   EnsemblGenomes-Tr; EBT00001696514.
DR   EnsemblGenomes-Tr; EBT00001696515.
DR   EnsemblGenomes-Tr; EBT00001696516.
DR   EnsemblGenomes-Tr; EBT00001696517.
DR   EnsemblGenomes-Tr; EBT00001696518.
DR   EnsemblGenomes-Tr; EBT00001696519.
DR   EnsemblGenomes-Tr; EBT00001696520.
DR   EnsemblGenomes-Tr; EBT00001696521.
DR   EnsemblGenomes-Tr; EBT00001696522.
DR   EnsemblGenomes-Tr; EBT00001696523.
DR   EnsemblGenomes-Tr; EBT00001696524.
DR   EnsemblGenomes-Tr; EBT00001696525.
DR   EnsemblGenomes-Tr; EBT00001696526.
DR   EnsemblGenomes-Tr; EBT00001696527.
DR   EnsemblGenomes-Tr; EBT00001696528.
DR   EnsemblGenomes-Tr; EBT00001696529.
DR   EnsemblGenomes-Tr; EBT00001696530.
DR   EnsemblGenomes-Tr; EBT00001696531.
DR   EnsemblGenomes-Tr; EBT00001696532.
DR   EnsemblGenomes-Tr; EBT00001696533.
DR   EnsemblGenomes-Tr; EBT00001696534.
DR   EnsemblGenomes-Tr; EBT00001696535.
DR   EnsemblGenomes-Tr; EBT00001696536.
DR   EnsemblGenomes-Tr; EBT00001696537.
DR   EnsemblGenomes-Tr; EBT00001696538.
DR   EnsemblGenomes-Tr; EBT00001696539.
DR   EnsemblGenomes-Tr; EBT00001696540.
DR   EnsemblGenomes-Tr; EBT00001696541.
DR   EnsemblGenomes-Tr; EBT00001696542.
DR   EnsemblGenomes-Tr; EBT00001696543.
DR   EnsemblGenomes-Tr; EBT00001696544.
DR   EnsemblGenomes-Tr; EBT00001696545.
DR   EnsemblGenomes-Tr; EBT00001696546.
DR   EnsemblGenomes-Tr; EBT00001696547.
DR   EnsemblGenomes-Tr; EBT00001696548.
DR   EnsemblGenomes-Tr; EBT00001696549.
DR   EnsemblGenomes-Tr; EBT00001696550.
DR   EnsemblGenomes-Tr; EBT00001696551.
DR   EnsemblGenomes-Tr; EBT00001696552.
DR   EnsemblGenomes-Tr; EBT00001696553.
DR   EnsemblGenomes-Tr; EBT00001696554.
DR   EnsemblGenomes-Tr; EBT00001696555.
DR   EnsemblGenomes-Tr; EBT00001696556.
DR   EnsemblGenomes-Tr; EBT00001696557.
DR   EnsemblGenomes-Tr; EBT00001696558.
DR   EnsemblGenomes-Tr; EBT00001696559.
DR   EnsemblGenomes-Tr; EBT00001696560.
DR   EnsemblGenomes-Tr; EBT00001696561.
DR   EnsemblGenomes-Tr; EBT00001696562.
DR   EnsemblGenomes-Tr; EBT00001696563.
DR   EnsemblGenomes-Tr; EBT00001696564.
DR   EnsemblGenomes-Tr; EBT00001696565.
DR   EnsemblGenomes-Tr; EBT00001696566.
DR   EnsemblGenomes-Tr; EBT00001696567.
DR   EnsemblGenomes-Tr; EBT00001696568.
DR   EnsemblGenomes-Tr; EBT00001696569.
DR   EnsemblGenomes-Tr; EBT00001696570.
DR   EnsemblGenomes-Tr; EBT00001696571.
DR   EnsemblGenomes-Tr; EBT00001696572.
DR   EnsemblGenomes-Tr; EBT00001696573.
DR   EnsemblGenomes-Tr; EBT00001696574.
DR   EnsemblGenomes-Tr; EBT00001696575.
DR   EnsemblGenomes-Tr; EBT00001696576.
DR   EnsemblGenomes-Tr; EBT00001696577.
DR   EnsemblGenomes-Tr; EBT00001696578.
DR   EnsemblGenomes-Tr; EBT00001696579.
DR   EnsemblGenomes-Tr; EBT00001696580.
DR   EnsemblGenomes-Tr; EBT00001696581.
DR   EnsemblGenomes-Tr; EBT00001696582.
DR   EnsemblGenomes-Tr; EBT00001696583.
DR   EnsemblGenomes-Tr; EBT00001696584.
DR   EnsemblGenomes-Tr; EBT00001696585.
DR   EnsemblGenomes-Tr; EBT00001696586.
DR   EnsemblGenomes-Tr; EBT00001696587.
DR   EnsemblGenomes-Tr; EBT00001696588.
DR   EnsemblGenomes-Tr; EBT00001696589.
DR   EnsemblGenomes-Tr; EBT00001696590.
DR   EnsemblGenomes-Tr; EBT00001696591.
DR   EnsemblGenomes-Tr; EBT00001696592.
DR   EnsemblGenomes-Tr; EBT00001696593.
DR   EnsemblGenomes-Tr; EBT00001696594.
DR   EnsemblGenomes-Tr; EBT00001696595.
DR   EnsemblGenomes-Tr; EBT00001696596.
DR   EnsemblGenomes-Tr; EBT00001696597.
DR   EnsemblGenomes-Tr; EBT00001696598.
DR   EnsemblGenomes-Tr; EBT00001696599.
DR   EnsemblGenomes-Tr; EBT00001696600.
DR   EnsemblGenomes-Tr; EBT00001696601.
DR   EnsemblGenomes-Tr; EBT00001696602.
DR   EnsemblGenomes-Tr; EBT00001696603.
DR   EnsemblGenomes-Tr; EBT00001696604.
DR   EnsemblGenomes-Tr; EBT00001696605.
DR   EnsemblGenomes-Tr; EBT00001696606.
DR   EnsemblGenomes-Tr; EBT00001696607.
DR   EnsemblGenomes-Tr; EBT00001696608.
DR   EnsemblGenomes-Tr; EBT00001696609.
DR   EnsemblGenomes-Tr; EBT00001696610.
DR   EnsemblGenomes-Tr; EBT00001696611.
DR   EnsemblGenomes-Tr; EBT00001696612.
DR   EnsemblGenomes-Tr; EBT00001696613.
DR   EnsemblGenomes-Tr; EBT00001696614.
DR   EnsemblGenomes-Tr; EBT00001696615.
DR   EnsemblGenomes-Tr; EBT00001696616.
DR   EnsemblGenomes-Tr; EBT00001696617.
DR   EnsemblGenomes-Tr; EBT00001696618.
DR   EnsemblGenomes-Tr; EBT00001696619.
DR   EnsemblGenomes-Tr; EBT00001696620.
DR   EnsemblGenomes-Tr; EBT00001696621.
DR   EnsemblGenomes-Tr; EBT00001696622.
DR   EnsemblGenomes-Tr; EBT00001696623.
DR   EnsemblGenomes-Tr; EBT00001696624.
DR   EnsemblGenomes-Tr; EBT00001696625.
DR   EnsemblGenomes-Tr; EBT00001696626.
DR   EnsemblGenomes-Tr; EBT00001696627.
DR   EnsemblGenomes-Tr; EBT00001696628.
DR   EnsemblGenomes-Tr; EBT00001696629.
DR   EnsemblGenomes-Tr; EBT00001696630.
DR   EnsemblGenomes-Tr; EBT00001696631.
DR   EnsemblGenomes-Tr; EBT00001696632.
DR   EnsemblGenomes-Tr; EBT00001696633.
DR   EnsemblGenomes-Tr; EBT00001696634.
DR   EnsemblGenomes-Tr; EBT00001696635.
DR   EnsemblGenomes-Tr; EBT00001696636.
DR   EnsemblGenomes-Tr; EBT00001696637.
DR   EnsemblGenomes-Tr; EBT00001696638.
DR   EnsemblGenomes-Tr; EBT00001696639.
DR   EnsemblGenomes-Tr; EBT00001696640.
DR   EnsemblGenomes-Tr; EBT00001696641.
DR   EnsemblGenomes-Tr; EBT00001696642.
DR   EnsemblGenomes-Tr; EBT00001696643.
DR   EnsemblGenomes-Tr; EBT00001696644.
DR   EnsemblGenomes-Tr; EBT00001696645.
DR   EnsemblGenomes-Tr; EBT00001696646.
DR   EnsemblGenomes-Tr; EBT00001696647.
DR   EnsemblGenomes-Tr; EBT00001696648.
DR   EnsemblGenomes-Tr; EBT00001696649.
DR   EnsemblGenomes-Tr; EBT00001696650.
DR   EnsemblGenomes-Tr; EBT00001696651.
DR   EnsemblGenomes-Tr; EBT00001696652.
DR   EnsemblGenomes-Tr; EBT00001696653.
DR   EnsemblGenomes-Tr; EBT00001696654.
DR   EnsemblGenomes-Tr; EBT00001696655.
DR   EnsemblGenomes-Tr; EBT00001696656.
DR   EnsemblGenomes-Tr; EBT00001696657.
DR   EnsemblGenomes-Tr; EBT00001696658.
DR   EnsemblGenomes-Tr; EBT00001696659.
DR   EnsemblGenomes-Tr; EBT00001696660.
DR   EnsemblGenomes-Tr; EBT00001696661.
DR   EnsemblGenomes-Tr; EBT00001696662.
DR   EnsemblGenomes-Tr; EBT00001696663.
DR   EnsemblGenomes-Tr; EBT00001696664.
DR   EnsemblGenomes-Tr; EBT00001696666.
DR   EnsemblGenomes-Tr; EBT00001696668.
DR   EnsemblGenomes-Tr; EBT00001696670.
DR   EnsemblGenomes-Tr; EBT00001696672.
DR   EnsemblGenomes-Tr; EBT00001696674.
DR   EnsemblGenomes-Tr; EBT00001696675.
DR   EnsemblGenomes-Tr; EBT00001696677.
DR   EnsemblGenomes-Tr; EBT00001696679.
DR   EnsemblGenomes-Tr; EBT00001696681.
DR   EnsemblGenomes-Tr; EBT00001696682.
DR   EnsemblGenomes-Tr; EBT00001696684.
DR   EnsemblGenomes-Tr; EBT00001696686.
DR   EnsemblGenomes-Tr; EBT00001696687.
DR   EnsemblGenomes-Tr; EBT00001696689.
DR   EnsemblGenomes-Tr; EBT00001696691.
DR   EnsemblGenomes-Tr; EBT00001696693.
DR   EnsemblGenomes-Tr; EBT00001696696.
DR   EnsemblGenomes-Tr; EBT00001696697.
DR   EnsemblGenomes-Tr; EBT00001696700.
DR   EnsemblGenomes-Tr; EBT00001696701.
DR   EnsemblGenomes-Tr; EBT00001696703.
DR   EnsemblGenomes-Tr; EBT00001696706.
DR   EnsemblGenomes-Tr; EBT00001696708.
DR   EnsemblGenomes-Tr; EBT00001696709.
DR   EnsemblGenomes-Tr; EBT00001696711.
DR   EnsemblGenomes-Tr; EBT00001696712.
DR   EnsemblGenomes-Tr; EBT00001696714.
DR   EnsemblGenomes-Tr; EBT00001696715.
DR   EnsemblGenomes-Tr; EBT00001696717.
DR   EnsemblGenomes-Tr; EBT00001696719.
DR   EnsemblGenomes-Tr; EBT00001696720.
DR   EnsemblGenomes-Tr; EBT00001696722.
DR   EnsemblGenomes-Tr; EBT00001696723.
DR   EnsemblGenomes-Tr; EBT00001696725.
DR   EnsemblGenomes-Tr; EBT00001696726.
DR   EnsemblGenomes-Tr; EBT00001696728.
DR   EuropePMC; PMC2614493; 19014707.
DR   EuropePMC; PMC3587922; 23469333.
DR   EuropePMC; PMC4995803; 27559429.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00516; ylbH.
DR   RFAM; RF00522; PreQ1.
DR   RFAM; RF00555; L13_leader.
DR   RFAM; RF00556; L19_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF00559; L21_leader.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01315; CRISPR-DR2.
DR   RFAM; RF01352; CRISPR-DR43.
DR   RFAM; RF01410; BsrC.
DR   RFAM; RF01735; epsC.
DR   RFAM; RF01749; pan.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01820; RsaE.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01998; group-II-D1D4-1.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   SILVA-LSU; CP000922.
DR   SILVA-SSU; CP000922.
DR   StrainInfo; 45665; 1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2846746
FT                   /organism="Anoxybacillus flavithermus WK1"
FT                   /strain="WK1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:491915"
FT   gene            401..1744
FT                   /gene="dnaA"
FT                   /locus_tag="Aflv_0001"
FT   CDS_pept        401..1744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="Aflv_0001"
FT                   /product="DNA replication initiation ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32385"
FT                   /db_xref="GOA:B7GFK8"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GFK8"
FT                   /protein_id="ACJ32385.1"
FT                   /translation="MENISDLWNKALAEIEKKISKPSFETWLKSTTAHSLKGDILIITV
FT                   PNEFTKDWLESRYTRLIEQTLYDITGEELKIKCTIPNHQTTEEFDLKPTSKPRKHDDEQ
FT                   TEFPQSMLNPKYTFDTFVIGSGNRFAHAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMH
FT                   AIGHYVLEHNPSAKVVYLSSEKFTNEFINAIRDNRPDDFRNKYRNVDVLLIDDIQFLAG
FT                   KEQTQEEFFHTFNTLHEESKQIVISSDRPPKEIPTLEDRLRSRFEWGLITDITPPDLET
FT                   RIAILRKKAKAEGFDIPNEVMLYIANQIDSNIRELEGALIRVVAYSSLINKEINADLAA
FT                   EALKDIIPSSKPKVITIQDIQRVVGEHFNVKLEDFKAKKRTKSVAFPRQIAMYLSRELT
FT                   DCSLPKIGEEFGGRDHTTVIHAHEKISALIQTDVQLQKQLKEIMEKLK"
FT   gene            1901..3037
FT                   /gene="dnaN"
FT                   /locus_tag="Aflv_0002"
FT   CDS_pept        1901..3037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="Aflv_0002"
FT                   /product="DNA polymerase sliding clamp subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32386"
FT                   /db_xref="GOA:B7GFK9"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFK9"
FT                   /protein_id="ACJ32386.1"
FT                   /translation="MKVIIDREHLVRSVQDVMKAVSSRTTIPILTGIKIVASEQGVTLT
FT                   GSDSDISIESFIPAEEKDRIIVDVIKQGSVVLQARFFSEIVRKLPKETVQIEVKDQFVT
FT                   TIRSGKAEFHLNGLDPEEYPRLPQIQEENMFKVPADLLKHVIRQTVFAVSTSETRPILT
FT                   GVNWRIENNELTCIATDSHRLAMRKAKVETESEAYFNIVIPGKSLNELNKILEESNELV
FT                   HIVVTENQILFKTKHLLFFSRLLDGNYPDTSRLIPTDSQTDVIVKTKEFLQAIDRASLL
FT                   AREGRNNVVRLSTLADKIVEISSNSPEIGKVVEEVQCEQVEGEELKISFSAKYMMDALK
FT                   ALEGTEIKISFTGAMRPFLIRPLHDDSMLQLILPVRTY"
FT   gene            3136..3348
FT                   /locus_tag="Aflv_0003"
FT   CDS_pept        3136..3348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0003"
FT                   /product="S4-like RNA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32387"
FT                   /db_xref="GOA:B7GFL0"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014330"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFL0"
FT                   /protein_id="ACJ32387.1"
FT                   /translation="MKEIKISTETITLGQFLKLANVISTGGMAKWFLQTNDVFVNGERE
FT                   QRRGRKLKVGDVVDIKTIGTFTICS"
FT   gene            3339..4478
FT                   /gene="recF"
FT                   /locus_tag="Aflv_0004"
FT   CDS_pept        3339..4478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="Aflv_0004"
FT                   /product="Recombinational DNA repair ATPase RecF"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32388"
FT                   /db_xref="GOA:B7GFL1"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFL1"
FT                   /protein_id="ACJ32388.1"
FT                   /translation="MFVKVGAPLFLEQLTLKNYRNYEQGCWQFQNKVNVILGENAQGKT
FT                   NIMESIYVLSMAKSHRTTNDKDLIRWDEDYAKIEGKVGKKNGSIFLQLTVSKKGKKAKL
FT                   NHIEQAKLSRYVGHMNVVMFAPEDLNLVKGSPQIRRRFIDMEIGQVSPVYMHELGQYQK
FT                   VLQQRNQYLKLLQSKKQTDETFLDVLTEQLVELAAKITLKRYEFIELLQTWAKPIHAEI
FT                   SRGNEQLAIHYCPSVHVLDKQQWSRIVEVYNDKFARIKTKEIERGTTLIGPHRDDLSFT
FT                   INGKDVQTFGSQGQQRTTALSLKLAEIDLIFSEIGEYPILLLDDVLSELDDFRQTHLLN
FT                   AIQGKVQTFVTTTSIDGIEHRVIRDADVYEVVSGQMTRR"
FT   gene            4533..6455
FT                   /gene="gyrB"
FT                   /locus_tag="Aflv_0005"
FT   CDS_pept        4533..6455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="Aflv_0005"
FT                   /product="DNA gyrase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32389"
FT                   /db_xref="GOA:B7GFL2"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFL2"
FT                   /protein_id="ACJ32389.1"
FT                   /translation="MTMEQREQIVYDESQIQVLEGLEAVRKRPGMYIGSTGPKGLHHLV
FT                   WEIVDNSIDEALAGFCTEINVIVEEDNSITVIDNGRGIPVGIHEKMGRPAVEVIMTVLH
FT                   AGGKFGGGGYKVSGGLHGVGASVVNALSEELEVYVHRDGNIHYQKYKRGVPCSDLQVVG
FT                   ETDRTGTTIHFKPDPEIFTETTEYDYDTLAHRLRELAFLNKGIRITLEDRRGENRRNEY
FT                   YYEGGISSYVKHLNRTKETLHEEPIYIEGEKDGIQVEIALQYNDGYTSNIYSFANNIHT
FT                   HEGGTHELGFKTALTRIINDYGRKNNMFKDQDANLTGEDVREGLTAIISVKHPAPQFEG
FT                   QTKTKLGNSDARTATESIFAEQFEKFLLENPSVAKKIVEKGILASRARLAAKRARELTR
FT                   RKNALEVSSLPGKLADCSSRDPAICELYVVEGDSAGGSAKQGRDRHFQAILPLRGKIIN
FT                   VEKSRLDKILSNNEVRAIITALGTGIGEDFDITKARYHKIIIMTDADVDGAHIRTLLLT
FT                   FFYRYMREVIEQGYVYIAQPPLYKIQQGKRIEYAYSDRQLEEILTRLPEQPKPVIQRYK
FT                   GLGEMNPEQLWETTMNPETRTLLKVSLQDAMEADETFEILMGDKVEPRRQFIEENAKYV
FT                   KNLDI"
FT   gene            6528..8978
FT                   /gene="gyrA"
FT                   /locus_tag="Aflv_0006"
FT   CDS_pept        6528..8978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="Aflv_0006"
FT                   /product="DNA gyrase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32390"
FT                   /db_xref="GOA:B7GFL3"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFL3"
FT                   /protein_id="ACJ32390.1"
FT                   /translation="MSERVKEVSISQEMRASFLDYAMSVIVSRALPDVRDGLKPVHRRI
FT                   LYAMHDLGMTADKPYKKSARIVGEVIGKYHPHGDAAVYDTMVRMAQDFNYRYMLVDGHG
FT                   NFGSIDGDAAAAMRYTEARMSKISMELLRDINKDTIDYQDNYDGSEREPIVLPARFPNL
FT                   LVNGSSGIAVGMATNIPPHQLGEVIDALLELMKDPDMTIAELMEYLPGPDFPTGAQIIG
FT                   RGGIRKAYETGRGSITLRAKAEIEQKENGKEVIIVRELPYQVNKAKLIEKIAELVREKK
FT                   IDGITDLRDESDRSGMRIVIEVRRDVSAHVVLNNLYKQTALQTGFGINMLALVDGQPKV
FT                   LNLKQCLQHYLDHQKIVIRRRTQFELNKAEARAHILEGLRIALDHLDEVIELIRQSATV
FT                   DVAKEGLMTKFQLSEKQAQAILDMRLQRLTGLEREKIEQEYEELVKLIAHLKAILADEQ
FT                   KVLQIIRDELLEIKEKFNDYRRTEIVNGGLETIDDEDLITRENIVVTLTHRGYIKRLPV
FT                   STYRSQRRGGRGIQGMNTNEDDFVEHLVITSTHDIVLFFTNKGKVYKAKGYEIPEFSRT
FT                   AKGIPIVNLLNIEKDEVINTVIAIEQFREDAFLFFTTKQGIAKRSPLSSFANIRNHGLI
FT                   AIHLHEGDELISVKLTDGHKHIIVGTKNGMLIRFPETDVRSMGRTAAGVKAITLCSGDE
FT                   VVGMESLNGDEEILIVTRNGYGKRTPASEYRIQSRGGKGIKTCNITEKNGDVVAVKTVT
FT                   GEEDLMLMTASGVMIRMAVSDISIMGRNTQGVKLIRLDEENEQEYVATVAKVPKEEKEQ
FT                   LQEE"
FT   gene            8995..10107
FT                   /locus_tag="Aflv_0007"
FT   CDS_pept        8995..10107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0007"
FT                   /product="c-di-GMP phosphodiesterase class II (HD-GYP
FT                   domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32391"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFL4"
FT                   /protein_id="ACJ32391.1"
FT                   /translation="MLYKGGEKDVLLVKTAQLQEGCILAEDVVGKSNRVIVPKNTVLNA
FT                   KLLVVLQKFLVDQVRVQSVLVDGGTFRPSEIVQEDVPKTKATDNKDILTLYLEVVQQYK
FT                   QMFQGWQAGLPVDIGKVRNMFMPLFEKVLESEKELLFFHHYSTKSEYLFHHAVTVGLLS
FT                   GALAKRMQYTKGDYCQIAIAGLLSDCGMAKVDPKIIHKSTALTPTEYKDMRQHTVYGYK
FT                   MVQKITALQEGVKLAVLQHHERNDGSGYLLSVQEEKIHPYSKIVAVADVYHAMISERPY
FT                   RNKQSPFKVFEQIHKDCFGKFDLSVVQALASLLMTLSLGAKVKLSNEQVGEIIFFEQDS
FT                   PSCPMIKITNTNQIISLKNEKDLCIEEIIK"
FT   gene            10275..11798
FT                   /locus_tag="Aflv_R001"
FT   rRNA            10275..11798
FT                   /locus_tag="Aflv_R001"
FT                   /product="16S ribosomal RNA"
FT   gene            12210..12286
FT                   /gene="trnI"
FT                   /locus_tag="Aflv_R002"
FT                   /note="tRNA_Ile1"
FT   tRNA            12210..12286
FT                   /gene="trnI"
FT                   /locus_tag="Aflv_R002"
FT                   /product="tRNA-Ile"
FT   gene            12297..12372
FT                   /gene="trnA"
FT                   /locus_tag="Aflv_R003"
FT                   /note="tRNA_Ala2"
FT   tRNA            12297..12372
FT                   /gene="trnA"
FT                   /locus_tag="Aflv_R003"
FT                   /product="tRNA-Ala"
FT   gene            12508..15429
FT                   /locus_tag="Aflv_R004"
FT   rRNA            12508..15429
FT                   /locus_tag="Aflv_R004"
FT                   /product="23S ribosomal RNA"
FT   gene            15757..15870
FT                   /locus_tag="Aflv_R005"
FT   rRNA            15757..15870
FT                   /locus_tag="Aflv_R005"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(15891..16592)
FT                   /gene="yaaC"
FT                   /locus_tag="Aflv_0008"
FT   CDS_pept        complement(15891..16592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaC"
FT                   /locus_tag="Aflv_0008"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32392"
FT                   /db_xref="InterPro:IPR026988"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFL5"
FT                   /protein_id="ACJ32392.1"
FT                   /translation="MWEVFYSSNFVHQFLLERYKQEGREDAEKKSYDNCYPFMYYLQHG
FT                   KKFYDTARQAPLAIKPVLLFYGNVQLLKACLLTIHADYPESSTVLAHGVSTRKRKKQNY
FT                   DFFKDEVKIQKHGLFTYFSEKMFHVKHAYGEKFCMKQLLEQIEELTPLFDLYFKQANGQ
FT                   NKHIHEIIAHYLLLYNLSMICRYETEWWYDLLHSYSNDAYPFIVQFLDVTERKVPKYLY
FT                   DYLLHNKKDQD"
FT   gene            16709..18175
FT                   /gene="guaB"
FT                   /locus_tag="Aflv_0009"
FT   CDS_pept        16709..18175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaB"
FT                   /locus_tag="Aflv_0009"
FT                   /product="IMP dehydrogenase/GMP reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32393"
FT                   /db_xref="GOA:B7GFL6"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFL6"
FT                   /protein_id="ACJ32393.1"
FT                   /translation="MWETKFAKEGLTFDDVLLIPAKSEVLPRDVDLTVELSKTLKLNIP
FT                   IISAGMDTVTEAEMAIAMARQGGLGIIHKNMSIEQQAEQVDKVKRSESGVITDPFFLTP
FT                   EHQVYDAEHLMGKYRISGVPIVNNAEEQKLVGIITNRDLRFIQDYSMKISDVMTKENLI
FT                   TAPVGTTLAEAEKILQKYKIEKLPLVDDQGVLKGLITIKDIEKVIEFPNAAKDAKGRLL
FT                   VGAAVGVTSDTMLRVKKLVEANVDVIVVDTAHGHSKGVLETVRKIRDTYPTLNIIAGNV
FT                   ATAEATRDLIEAGANIIKVGIGPGSICTTRVVAGVGVPQITAIYDCATEARKYGVSIIA
FT                   DGGIKYSGDIVKALAAGGHAVMLGSLLAGVSESPGETEIYQGRRFKVYRGMGSVGAMEK
FT                   GSKDRYFQEDNKKFVPEGIEGRVPYKGPLADTIYQLVGGLRAGMGYCGTRNLEELREKT
FT                   QFVRMTGAGLRESHPHDVQITKEAPNYSLM"
FT   gene            18260..19603
FT                   /gene="dacA"
FT                   /locus_tag="Aflv_0010"
FT   CDS_pept        18260..19603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dacA"
FT                   /locus_tag="Aflv_0010"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32394"
FT                   /db_xref="GOA:B7GFL7"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFL7"
FT                   /protein_id="ACJ32394.1"
FT                   /translation="MEGLSVKTWYKSFIISIVAMFSFMMTLPQQTKAEEDVLNIEADAA
FT                   ILVEAETGKILYQKNIDAVLGIASMTKMMTEYLLLEAIHEGRVKWDQEYTVSEYVYQIS
FT                   QKRDLSNVPLRKDGKYTVRELYEAMAIYSANGATVAIAEIVGGSETNFVKMMNEKAQEL
FT                   GLKDYKFVNATGLNNKDLGGLHPAGSGDNEENVMSARAVATLAYHLYHEFPEILETASI
FT                   PRKYFREGTDDQIKMDNWNWMLPGLVAAYEGVDGIKTGYTEFAGYCFTGTAERNGMRFI
FT                   TVVMNAKTNGKGTYLSRFEQTRKMLDYAFSNYTVQKLYPKGYTTKKHKTVTVKKGKEKE
FT                   VAIATKQPLSLVIKRGEEKKYKPVVVIEKETLTAPVKKGQKIGYMYVKYEGTDYGYLTK
FT                   EGEKAAQVDIVTQQAVEKANGFVLAMRAIGELFSDIWSGASNAIKGLF"
FT   gene            19816..20700
FT                   /gene="pdxS"
FT                   /locus_tag="Aflv_0011"
FT   CDS_pept        19816..20700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxS"
FT                   /locus_tag="Aflv_0011"
FT                   /product="Pyridoxine biosynthesis enzyme PDX1/PDX2,
FT                   synthetase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32395"
FT                   /db_xref="GOA:B7GFL8"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GFL8"
FT                   /protein_id="ACJ32395.1"
FT                   /translation="MAVTGTERVKRGMAEMQKGGVIMDVVNAEQAKIAEAAGAVAVMAL
FT                   ERVPADIRAAGGVARMADPTVIEEVMKAVSIPVMAKARIGHYVEARVLEALGVDYIDES
FT                   EVLTPADEEFHIDKRQFTVPFVCGCRDLGEAARRIAEGASMLRTKGEPGTGNIVEAVRH
FT                   MRKVNAQVRKVVSMSEDELMTEAKNLGAPFEVLLEIKRLGRLPVVNFAAGGVATPADAA
FT                   LMMHLGADGVFVGSGIFKSENPEKYARAIVEATTHYEDYELIAHLSKGLGGAMKGIDIS
FT                   SLLPEQRMQERGW"
FT   gene            20719..21297
FT                   /gene="pdxT"
FT                   /locus_tag="Aflv_0012"
FT   CDS_pept        20719..21297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxT"
FT                   /locus_tag="Aflv_0012"
FT                   /product="Pyridoxine biosynthesis enzyme PDX1/PDX2,
FT                   glutaminase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32396"
FT                   /db_xref="GOA:B7GFL9"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GFL9"
FT                   /protein_id="ACJ32396.1"
FT                   /translation="MVKIGVLGLQGAVREHVRSIEACGAEAVVIKKVEQLTQIDGLIIP
FT                   GGESTTMRRLMDKYGFIEPLKQFAREGKPMFGTCAGLIILAKKIVGYDEPHLGLMDITV
FT                   ERNSFGRQRESFEASLAIKGVADDFIGVFIRAPHIVSVGADVDVLATYEDRIVAARQGQ
FT                   FLGCSFHPELTDDHRMTQYFINMVKETKE"
FT   misc_feature    21368..21598
FT                   /note="T-box leader; Aflv_R006"
FT   gene            21618..22898
FT                   /gene="serS"
FT                   /locus_tag="Aflv_0013"
FT   CDS_pept        21618..22898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="Aflv_0013"
FT                   /product="Seryl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32397"
FT                   /db_xref="GOA:B7GFM0"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFM0"
FT                   /protein_id="ACJ32397.1"
FT                   /translation="MLMLDLKFLRTHFEEVKQKLQHRGEDLADFERFEQLDRRRRELIA
FT                   QAEELKNKRNDVSQQIALLKREKKDADHLIAEMRQVGDRIKVLDDELREVEQQLDTLLL
FT                   SIPNIPHESVPIGESEDDNVEIRKWGEPRSFSFEPKPHWEIADQLGILDFERAAKVTGS
FT                   RFVFYKGLGARLERALINFMLDVHVEQHGYEEVLPPYIVNRASMTGTGQLPKFEEDAFR
FT                   IESEDYFLIPTAEVPVTNLHRDEILSADDLPIKYAAYSACFRSEAGSAGRDTRGLIRQH
FT                   QFNKVELVKFVKPEDSYEELEKLTNDAERILQLLGLPYRVMSMCTADLGFTAAKKYDIE
FT                   VWLPSYGTYREISSCSNFEAFQARRANIRFRRDPKAKPEHVHTLNGSGLAIGRTVAAIL
FT                   ENYQQEDGTVVIPEVLRPYMGGKEVIS"
FT   gene            22977..23069
FT                   /gene="trnS"
FT                   /locus_tag="Aflv_R007"
FT                   /note="tRNA_Ser5"
FT   tRNA            22977..23069
FT                   /gene="trnS"
FT                   /locus_tag="Aflv_R007"
FT                   /product="tRNA-Ser"
FT   gene            complement(23198..23866)
FT                   /gene="dck"
FT                   /locus_tag="Aflv_0014"
FT   CDS_pept        complement(23198..23866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dck"
FT                   /locus_tag="Aflv_0014"
FT                   /product="Deoxyadenosine/deoxycytidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32398"
FT                   /db_xref="GOA:B7GFM1"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFM1"
FT                   /protein_id="ACJ32398.1"
FT                   /translation="MNLREKYHIPSDAVITIAGTVGVGKSTMTKALADALQFRTSFEKV
FT                   DTNPYLDKFYADFKRWSFHLQIYFLAERFKEQKRIFEYGGGFVQDRSIYEDTGIFAKMH
FT                   YEKGTMSKVDYETYTSLFEAMVMTPYFPHPDLLIYLEGSFEEIIKRIRERGRPMEQQTP
FT                   IEYWKEMYERYERWINSFNACPVLRININEYDIIRDAQSIEPIVAKIGYMIEQYRTLKK
FT                   "
FT   gene            complement(23863..24501)
FT                   /gene="dgk"
FT                   /locus_tag="Aflv_0015"
FT   CDS_pept        complement(23863..24501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dgk"
FT                   /locus_tag="Aflv_0015"
FT                   /product="Deoxyguanosine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32399"
FT                   /db_xref="GOA:B7GFM2"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFM2"
FT                   /protein_id="ACJ32399.1"
FT                   /translation="MSRVPFITVEGPIGVGKTSLAKVISTHFQYELLKEIVDENPFLGK
FT                   FYENIEEWSFQTEMFFLCNRYKQLEDVEKNFLNNGKPVVADYHIFKNLIFAKQTLKGKQ
FT                   YEKYVRIYDILTNDMPKPNVVIYLHASLHTLLERIAMRGREFEKNIDPNYLQQLSHAYE
FT                   QAMEQFEQAHPHIPVLRFNGDELDFVHRDKDRFYILNELQSVLKRSLEQ"
FT   gene            24592..25125
FT                   /locus_tag="Aflv_0016"
FT   CDS_pept        24592..25125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0016"
FT                   /product="Cytosine/adenosine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32400"
FT                   /db_xref="GOA:B7GFF0"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFF0"
FT                   /protein_id="ACJ32400.1"
FT                   /translation="MIYFIDDKKVREFQKMKNDEYYMHLAIEEAKKAEKIGEVPIGAVI
FT                   VYNDQVIARAHNLRERDQRSIAHAELLAIDEACKKLGTWRLEQATLYVTLEPCAMCAGA
FT                   IVLSRIKRVVFGASDPKGGCAGTLMNLLQEPRFNHQVEVVSGILGEQCGNMLSEFFRQL
FT                   RQRKKEEKSSINSN"
FT   gene            25196..25463
FT                   /locus_tag="Aflv_R008"
FT   ncRNA           25196..25463
FT                   /locus_tag="Aflv_R008"
FT                   /product="RNA_SCR; 4.5S RNA"
FT                   /ncRNA_class="SRP_RNA"
FT   gene            25572..27251
FT                   /gene="dnaX"
FT                   /locus_tag="Aflv_0017"
FT   CDS_pept        25572..27251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="Aflv_0017"
FT                   /product="DNA polymerase III tau subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32401"
FT                   /db_xref="GOA:B7GFF1"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFF1"
FT                   /protein_id="ACJ32401.1"
FT                   /translation="MSYRALYRVFRPQSFKDVVGQEHVTKTLQNALLQQKISHAYLFSG
FT                   PRGTGKTSIAKIFAKAVNCEHRPTAEPCNECPTCLGIMNGSISDVLEIDAASNNGVDEI
FT                   RDIRDKVKFAPTSAPYKVYIIDEVHMLSIGAFNALLKTLEEPPKHVIFILATTEPHKIP
FT                   LTIVSRCQRFDFRRIELKSIVSRLKTVVTEEGIDVEEEALFAIARAADGGMRDALSLLD
FT                   QAISFSDDRVLLEDVLAVTGAVSQRKIADLIHAMYEKKTVEALRLFQDLMEQGKDPNRL
FT                   VEDLIYYYRDMLLYKAAPQLEDVTHRMLVDERFRELSDMIPTSFIYEAIDLLSKSQHDM
FT                   RLTNHPRIHMEVTIVKLCYEEEHAIKSTSYLDLEEKVKQLEQQLEKLKETGVKPSASEV
FT                   SEPVKKTVKHIRTDYKIPIGRIHEVLRQATHQHLSLVKGNWGHVLDLLKKQNKVSHAAL
FT                   LQESEPVAASSTAFVLKFKYEIHCKMVADNSNYVKDNLEQVLFELTGKKLDTIPVPESE
FT                   WLQIREQFIRQQTNGDEQHEQEDPFISEAKKWFGENLIEIKE"
FT   gene            27259..27591
FT                   /gene="yaaK"
FT                   /locus_tag="Aflv_0018"
FT   CDS_pept        27259..27591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaK"
FT                   /locus_tag="Aflv_0018"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32402"
FT                   /db_xref="GOA:B7GFF2"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFF2"
FT                   /protein_id="ACJ32402.1"
FT                   /translation="MMNMMRGMGNMQKMMKQMQKMQKDMEKAQAELAEKTVEGTAGGGM
FT                   VTVVANGHKQILEVRIKEEVVDPEDIDMLQDLVLAATNDALKKVDELTAETMGQFTKGL
FT                   NIPGLF"
FT   gene            27601..28197
FT                   /gene="recR"
FT                   /locus_tag="Aflv_0019"
FT   CDS_pept        27601..28197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="Aflv_0019"
FT                   /product="Recombinational DNA repair protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32403"
FT                   /db_xref="GOA:B7GFF3"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GFF3"
FT                   /protein_id="ACJ32403.1"
FT                   /translation="MYYPEPISKLIDSFMKLPGIGPKTAVRLAFFVLNMKEDVVLDFAK
FT                   ALVNAKRNLTYCSSCGHITDKDPCYICEDDKRDRSIICVVQDPKDVIAMEKMKEYNGLY
FT                   HVLHGAISPMEGIGPEDIKIAELLRRLQDETVQEVILATNPNIEGEATAMYISRLLKPT
FT                   GVKITRIAHGLPVGGDLEYADEVTLSKALEGRREL"
FT   gene            28197..28418
FT                   /gene="yaaL"
FT                   /locus_tag="Aflv_0020"
FT   CDS_pept        28197..28418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaL"
FT                   /locus_tag="Aflv_0020"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32404"
FT                   /db_xref="InterPro:IPR019644"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFF4"
FT                   /protein_id="ACJ32404.1"
FT                   /translation="MFWKKKGWLRKQFNDQLIERLQRYRDDWMGKKQLIEKSVEPSDKV
FT                   IFDLKIAEAKYLFLLREAKKRKVTIGKG"
FT   gene            28415..28771
FT                   /gene="bofA"
FT                   /locus_tag="Aflv_0021"
FT   CDS_pept        28415..28771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bofA"
FT                   /locus_tag="Aflv_0021"
FT                   /product="Sporulation regulation protein BofA"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32405"
FT                   /db_xref="GOA:B7GFF5"
FT                   /db_xref="InterPro:IPR010001"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFF5"
FT                   /protein_id="ACJ32405.1"
FT                   /translation="MIPLPFHIGLSYRKEVGIYLKIKQLEGEKMMNETVVIVSIVSLIV
FT                   IILLVGIPIRLTRFIGEGIARLVIGALFIFLINVVGGVLGIHLPINLFTVAVTGFLGIP
FT                   GVVALIFLQQYVIS"
FT   gene            28758..28910
FT                   /locus_tag="Aflv_0022"
FT   CDS_pept        28758..28910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0022"
FT                   /product="Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32406"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFF6"
FT                   /protein_id="ACJ32406.1"
FT                   /translation="MSFHKRTYPFIFLLTNIRIHDILLNVVVDNKKMLTSDIFCSIIIH
FT                   VFVVL"
FT   gene            28976..30500
FT                   /locus_tag="Aflv_R009"
FT   rRNA            28976..30500
FT                   /locus_tag="Aflv_R009"
FT                   /product="16S ribosomal RNA"
FT   gene            30891..30967
FT                   /gene="trnI"
FT                   /locus_tag="Aflv_R010"
FT                   /note="tRNA_Ile2"
FT   tRNA            30891..30967
FT                   /gene="trnI"
FT                   /locus_tag="Aflv_R010"
FT                   /product="tRNA-Ile"
FT   gene            30978..31053
FT                   /gene="trnA"
FT                   /locus_tag="Aflv_R011"
FT                   /note="tRNA_Ala3"
FT   tRNA            30978..31053
FT                   /gene="trnA"
FT                   /locus_tag="Aflv_R011"
FT                   /product="tRNA-Ala"
FT   gene            31189..34110
FT                   /locus_tag="Aflv_R012"
FT   rRNA            31189..34110
FT                   /locus_tag="Aflv_R012"
FT                   /product="23S ribosomal RNA"
FT   gene            34185..34298
FT                   /locus_tag="Aflv_R013"
FT   rRNA            34185..34298
FT                   /locus_tag="Aflv_R013"
FT                   /product="5S ribosomal RNA"
FT   gene            34359..34607
FT                   /gene="csfB"
FT                   /locus_tag="Aflv_0023"
FT   CDS_pept        34359..34607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csfB"
FT                   /locus_tag="Aflv_0023"
FT                   /product="Uncharacterized conserved protein CsfB"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32407"
FT                   /db_xref="InterPro:IPR019700"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFF7"
FT                   /protein_id="ACJ32407.1"
FT                   /translation="MIISEVYCYMKLGKLLAGGGERMCYKETCIVCDEQNKKGIHVFHH
FT                   FICMDCHNDLIQTETNDEKYKFYVDRLKRIGENKIYS"
FT   gene            34689..36113
FT                   /locus_tag="Aflv_0024"
FT   CDS_pept        34689..36113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0024"
FT                   /product="Arginine/lysine/ornithine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32408"
FT                   /db_xref="GOA:B7GFF8"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFF8"
FT                   /protein_id="ACJ32408.1"
FT                   /translation="MDQTKTPLYTLLREHASTQPISFHVPGHKYGAVFYEEALFSFAPL
FT                   LHLDVTELSHLDDLHHPAGAIEQAQQLAANLYGVKRTYFLVNGSTAGNLAMIVAACEKN
FT                   KKVIVQRNCHKSILHALHLVGATPIFISPEFDEDVQVMSFVSFETISHMLRKHPDAAAL
FT                   ILTNPNYYGMAIDLTPIIQLAHSYRIPVLVDEAHGAHFVLGEPFPKSAVECGADIVVQS
FT                   AHKTLPAMTMGSFLHFNSELVDERALKYFLQVFQTSSPSYPIMASLDLARAYVARQTRE
FT                   TIDEIIAQIQLFKQELRTIEAIHVVESRHPLIRTDLLKITLQTRSAHSGYELQQLLEMN
FT                   GIFTEMADPYNVLLVYPLAKMKQLRDVTERIKRALQSIRREPQNERVQIQLPKHCQAVS
FT                   YEWTKGRQTKKILLHDAIGCVCAQMVVPYPPGIPILLIGEIVTRQHIEIIQYLKKTDAY
FT                   FQTDIDGDYIEVFQEV"
FT   gene            36115..36744
FT                   /gene="tmk"
FT                   /locus_tag="Aflv_0025"
FT   CDS_pept        36115..36744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tmk"
FT                   /locus_tag="Aflv_0025"
FT                   /product="Thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32409"
FT                   /db_xref="GOA:B7GFF9"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GFF9"
FT                   /protein_id="ACJ32409.1"
FT                   /translation="MSYLFFSFEGPEGAGKTTIVRMLKDYLSEQHVDVVATREPGGIDI
FT                   AEQIRAVILHPNNERMDARTEALLYAAARRQHLVEKVIPALKDGKVVLCDRFIDSSLAY
FT                   QGVARGLGIDEILAINAFAIENWMPILTIYFDIDPSLGLARIRENGSREVNRLDLEELS
FT                   FHEQVRKGYMVLLDRFPNRIKKVDATQPITKVFEDVWALIEPLIRK"
FT   gene            36755..37753
FT                   /gene="holB"
FT                   /locus_tag="Aflv_0026"
FT   CDS_pept        36755..37753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holB"
FT                   /locus_tag="Aflv_0026"
FT                   /product="ATPase involved in DNA replication HolB"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32410"
FT                   /db_xref="GOA:B7GFG0"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFG0"
FT                   /protein_id="ACJ32410.1"
FT                   /translation="MSWKTLEMNQPHVAKTITNSIRKGRVAHAYLFKGQKGTGKKEAAL
FT                   LFAKRLFCLTHVHDEPCEICVNCRRIESGNHPDVHLVIPDGNSIKKQQIEQLQEEFTKT
FT                   AVESSRKLYIIEHADQMTVQAANSLLKFLEEPSAKTVAILLTEQFHRILPTIVSRCQVV
FT                   SFHPLSTERIYAYLQQEGVARELAILAARVTNNVEEAYQLSQDDWFAQARKIVIQLYEA
FT                   LNKQYVQALLVIQQHWLTHFTNKEQMNIGLDLLLYLYKDLLYVILGEKQQIAYDDCISE
FT                   FQRSRFLYCEKQIAQHMKAILQAKARLHTNMNPQLLMEQLVLQLREGSAFV"
FT   gene            37746..38573
FT                   /gene="yaaT"
FT                   /locus_tag="Aflv_0027"
FT   CDS_pept        37746..38573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaT"
FT                   /locus_tag="Aflv_0027"
FT                   /product="Regulator of signaling phosphorelay (PSP1/tpl
FT                   family)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32411"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFG1"
FT                   /protein_id="ACJ32411.1"
FT                   /translation="MYEVVGVRFKKAGKIYYFDPGDLPISNGDYVIVETVRGVEFGKVV
FT                   VAKKQVDEKDIVLPLKKVIRLADQKDKLVVEENKKAAEEAYDICLKKVEEHGLEMKLVD
FT                   VEYTFDRNKIIFYFTADGRVDFRELVKDLAAIFRTRIELRQIGVRDEAKMLGGIGPCGR
FT                   MLCCSTFLGDFDPVSIKMAKDQNLSLNPTKISGLCGRLMCCLKYENDEYETAKEQLPDL
FT                   GEMIETPLGLGKVVGLNILERVLQVELVEKDRVVEYTIDELIKEKVLPTQATE"
FT   gene            38589..38936
FT                   /gene="yabA"
FT                   /locus_tag="Aflv_0028"
FT   CDS_pept        38589..38936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabA"
FT                   /locus_tag="Aflv_0028"
FT                   /product="Regulator of replication initiation timing"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32412"
FT                   /db_xref="GOA:B7GFG2"
FT                   /db_xref="InterPro:IPR010377"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GFG2"
FT                   /protein_id="ACJ32412.1"
FT                   /translation="MNKKEIFQSVTSIEEQIAHLYKQLGELKSYLGELIEENHRLQVEN
FT                   DHLRRRLEQLSERKVEQGKKQTKAKLVDIGEGYDNLARLYQEGFHICNVHYGSLRTDGD
FT                   CLFCLSFLNKK"
FT   gene            38991..39725
FT                   /gene="yabB"
FT                   /locus_tag="Aflv_0029"
FT   CDS_pept        38991..39725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabB"
FT                   /locus_tag="Aflv_0029"
FT                   /product="Methyltransferase (UbiE/COQ5 family)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32413"
FT                   /db_xref="GOA:B7GFG3"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFG3"
FT                   /protein_id="ACJ32413.1"
FT                   /translation="MLREDERLDYLLAEDMKIIQSPSVFAFSLDAVLLANFVYVPIQKG
FT                   NLVDLCTGNGVIPLLLSKRTKGKIVGVEIQEKIYDMAKRSVQYNELEKQIEIIHGDIKH
FT                   MPAYLGHSKFDVVTCNPPYFPTPNEEEINKNEHFAIARHEIYCTLEDVIRVSSQLLKQG
FT                   GKAAFVHRPERLLDIVTLMRQYRLEPKRLRFVYPKEGKEANTILIEGMKDGNKGLKILP
FT                   PLFVYEQNGEYTSELKHILYGE"
FT   gene            39732..40598
FT                   /gene="yabC"
FT                   /locus_tag="Aflv_0030"
FT   CDS_pept        39732..40598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabC"
FT                   /locus_tag="Aflv_0030"
FT                   /product="Tetrapyrrole methyltransferase family enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32414"
FT                   /db_xref="GOA:B7GFG4"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFG4"
FT                   /protein_id="ACJ32414.1"
FT                   /translation="MNEQKSFIGEDGKGILYIVPTPIGNLEDMTLRAIETLRTVDFIAA
FT                   EDTRQTKKLLNHFDIHTPLVSYHEHNKQARGEHIIASLLKGKHVALVSDAGTPTISDPG
FT                   HELVVEALHAQCKVVPLPGANAAVTALTASGLPTNHFYFYGFLSRHKKEKKKELERLKH
FT                   IEDTLIFYEAPHRLQETLTIMHHIFGNRKMAIARELTKKFEQFIRGTIEEVMHWAEHHE
FT                   VRGEFCILVEGNHMPDEQSVWWNDLTIVEHVNYYVEEKQYTSKEAIKQVARDRQMPKRD
FT                   IYEAYHK"
FT   gene            complement(40635..40943)
FT                   /gene="abrB"
FT                   /locus_tag="Aflv_0031"
FT   CDS_pept        complement(40635..40943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="abrB"
FT                   /locus_tag="Aflv_0031"
FT                   /product="Transcriptional regulator AbrB"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32415"
FT                   /db_xref="GOA:B7GFG5"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR040678"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFG5"
FT                   /protein_id="ACJ32415.1"
FT                   /translation="MKEGEENSMKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIY
FT                   VDDERIILKKYKPNMTCVVTGEVSDDNFKLADGKIILSKEGAEALLQEIQNLLQQSK"
FT   gene            41392..43362
FT                   /gene="metS"
FT                   /locus_tag="Aflv_0032"
FT   CDS_pept        41392..43362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metS"
FT                   /locus_tag="Aflv_0032"
FT                   /product="Methionyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32416"
FT                   /db_xref="GOA:B7GFG6"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFG6"
FT                   /protein_id="ACJ32416.1"
FT                   /translation="MRQGGVQVTKKTFYITTPIYYPSDKLHIGHAYTTVAGDAMARYKR
FT                   MRGYDVMYLTGTDEHGQKIQRKAEEKGVTPQQYVDEIVAGIKELWKKLDISYDDFIRTT
FT                   EQRHKQVVEKIFARLLEQGDIYLDEYEGWYCTPCESFYTERQLVEGNCPDCGRPVEKVK
FT                   EQSYFFRMSKYVDRLLAFYEENPQFIQPESRKNEMINNFIKPGLEDLAVSRTTFDWGIP
FT                   VPGDPKHVIYVWIDALSNYITALGYGTENDEKYKTYWPADVHLVGKEIVRFHTIYWPIM
FT                   LMALDLPLPKKVFAHGWLLMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGS
FT                   DGVFTPEGFVERINYDLANDLGNLLNRTVAMIEKYFAGRVPVYSGTHTSFDEQLVQMAY
FT                   DTVRQYEEAMEQMQFSQALTAVWQLISRTNKYIDETQPWVLAKDEATREQLASVMSHLA
FT                   ESLRYVAVLLQPFLTATPKRMFAQLGIQDEKLMSWDSLQTFGASQHERMVEKGAPLFPR
FT                   LDVQEEVQYIQSQMKGTVANTEEKQEQNEETSEEITIDDFMKVDLRVAQVIHAEPIPKA
FT                   DRLLKLQLDLGYEKRQVVSGIAKYYKPEDLIGKKVICVTNLKPVKLRGELSQGMILAGE
FT                   KDGVLSLATVDESLPNGAKVK"
FT   gene            43479..44246
FT                   /gene="yabD"
FT                   /locus_tag="Aflv_0033"
FT   CDS_pept        43479..44246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabD"
FT                   /locus_tag="Aflv_0033"
FT                   /product="Mg-dependent DNAse"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32417"
FT                   /db_xref="GOA:B7GFG7"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFG7"
FT                   /protein_id="ACJ32417.1"
FT                   /translation="MLFDTHAHLNATQFNEDVGQVIERARAEGVSHIVVVGFDRPTIER
FT                   AMELAEQYSFIYAAVGWHPVDAIHMTDEDLSMIERLAAHPKVVALGEMGLDYYWDQSPK
FT                   DVQKEVFRKQIRLAKKVKLPIIIHNRDATADIVDILREENAGEVGGVMHCFSGSIEVAR
FT                   QCMDMNFYISFGGPVTFKNAKKPKEVAKEIPLDRLLIETDCPYLTPHPFRGKRNEPSYV
FT                   KYVAEAIAELKGLSFEEVAQKTSDNAKRLFGII"
FT   gene            44451..45644
FT                   /gene="yabE"
FT                   /locus_tag="Aflv_0034"
FT   CDS_pept        44451..45644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabE"
FT                   /locus_tag="Aflv_0034"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32418"
FT                   /db_xref="GOA:B7GFG8"
FT                   /db_xref="InterPro:IPR007137"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFG8"
FT                   /protein_id="ACJ32418.1"
FT                   /translation="MITYAKKLLQSTSKKKIALATGGFLLLSGMTGYASYEWTKETVTL
FT                   YTNGKEQKVRTHANTVAELLKEQNVQLKQEDFISPSPQAKIVDHLTVKWEASKPIVLIV
FT                   DGVEKKLRTTAKTVKDVLDIQQIQLRDYDQVSPNVDEVVKENMKIVISKAFPITLNDGG
FT                   KQQQVWSTSTTVADFLAKQHITLRELDRVQPKLNEMIQPNTKINIVRVEKVTDVVEEPV
FT                   NYTVVKKKDAQLEKGKQKVISEGEKGLVAKQYEVILENGKEVSRKLIKTETIKPSKNRI
FT                   VAIGTKPVARILASRGSGEVSEELYVIATAYTAYCGGCSGTTATGVDLRANPNAKVIAV
FT                   DPRVIPLGTKVYVEGYGYAVAADTGKNVKGYKIDLFFPDKSAAYRWGTKRVKIKIIK"
FT   gene            45706..46278
FT                   /gene="rnmV"
FT                   /locus_tag="Aflv_0035"
FT   CDS_pept        45706..46278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnmV"
FT                   /locus_tag="Aflv_0035"
FT                   /product="Ribonuclease M5 (TOPRIM domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32419"
FT                   /db_xref="GOA:B7GFG9"
FT                   /db_xref="InterPro:IPR004466"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR025156"
FT                   /db_xref="InterPro:IPR034141"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFG9"
FT                   /protein_id="ACJ32419.1"
FT                   /translation="MEAFMKIKEIIVVEGRDDTVAIRRAVDADTIETNGAAINDETIER
FT                   IRLAQQQRGVIIFTDPDYPGEKIRKTIAERVPGCKHAFLTREEARGKRGKGLGVEHASI
FT                   EAIRTALLNVYEEMIDPEEEISFQQLVDAGLIGGPFARARRERLGQLLKIGYTNGKQLH
FT                   KRLQMFQISKEQFIEAMKQVIQEEEHV"
FT   gene            46271..47158
FT                   /gene="ksgA"
FT                   /locus_tag="Aflv_0036"
FT   CDS_pept        46271..47158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="Aflv_0036"
FT                   /product="Dimethyladenosine transferase (rRNA methylation)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32420"
FT                   /db_xref="GOA:B7GFH0"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GFH0"
FT                   /protein_id="ACJ32420.1"
FT                   /translation="MYKDIATPTRTKEILEKYGFSFKKSLGQNFLIEPNILHRIVDFAQ
FT                   LSERTGVIEIGPGIGALTEQLARRAKKVVAFEIDQRLLPILADTLSPYTNVSIIHEDIL
FT                   KADVQQVIAEQFTDVDDIMVVANLPYYVTTPIIMKLLTDRLPIRGMVVMLQKEVADRMA
FT                   AKPGTKDYGSLTIAVQYYTHAETVMHVPRTVFVPKPNVDSAVIRLLKREQPAVSVSNED
FT                   FFFAVVRASFGQRRKTILNNLLNQLPNGKEKKEQIENALANAGIDPKRRGETLAIAEFA
FT                   TLSEQLYPIFYEEA"
FT   gene            47145..48110
FT                   /gene="yabG"
FT                   /locus_tag="Aflv_0037"
FT   CDS_pept        47145..48110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabG"
FT                   /locus_tag="Aflv_0037"
FT                   /product="Peptidase involved in the proteolysis and
FT                   maturation of SpoIVA and YrbA proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32421"
FT                   /db_xref="InterPro:IPR008764"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFH1"
FT                   /protein_id="ACJ32421.1"
FT                   /translation="MKRLNASFFTRSILSSHMLQTKQTKGRMCMIQVGDIVARKSYECD
FT                   ILFRVIDIKEKEGEKEAILYGEDVRLIADAPFSDLVVIDEREKKRRKEEEKRHIEQCYK
FT                   LLRQDYRLLREKSEYDATGGYEVKMDFFQLPGRVLHMDGDPLYLRKCMQLYERIGVPVY
FT                   GVHCHETDMPDRIIPLLEQVRPDILVVTGHDAYSKSKGPVHDLKAYRHSKYFVQTVKQA
FT                   RKKIPNLDQLVIFAGACQSHFESLIRAGANFASSPARVNIHALDPVYIVSRVSFTPFMD
FT                   RINVWDVLRNTLTGEKGLGGVETRGVLRTGMPFRTMDEQT"
FT   gene            48266..48586
FT                   /gene="veg"
FT                   /locus_tag="Aflv_0038"
FT   CDS_pept        48266..48586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="veg"
FT                   /locus_tag="Aflv_0038"
FT                   /product="Uncharacterized conserved protein Veg"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32422"
FT                   /db_xref="GOA:B7GFH2"
FT                   /db_xref="InterPro:IPR009366"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFH2"
FT                   /protein_id="ACJ32422.1"
FT                   /translation="MTYSFSFVILRNSEVDTMGKTLSEIKKVLDSNLGKRLTLKANGGR
FT                   RKTIERCGVLAQTYPSVFVVELDQEENAFERVSYSYADVLTETVQLTFLDDEQVAISSS
FT                   HS"
FT   gene            48705..49580
FT                   /gene="ispE"
FT                   /locus_tag="Aflv_0039"
FT   CDS_pept        48705..49580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispE"
FT                   /locus_tag="Aflv_0039"
FT                   /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32423"
FT                   /db_xref="GOA:B7GFH3"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFH3"
FT                   /protein_id="ACJ32423.1"
FT                   /translation="MNGLRLLVKAPAKINLSLDVLHKRPDGYHEVKMVMTTIDLADRVE
FT                   LMDLYSDTIQIISHNRFVPDDERNLAYQAAKLLKEKLGVRRGVAISITKYIPVAAGLAG
FT                   GSSDAAATLRGLNKLWGLGLSLDELAEIGAEIGSDVPFCVYGGTAIATGRGEKIEHIPA
FT                   PPSSWVILAKPTIGVSTAEVYRNLQLQSVNHPDVDGMVAAIREKDYEKICALAGNVLES
FT                   VTLNMYPEVAQIKEQMKRFGADVSLMSGSGPTVFGLVQHDSRLQRVYNGLRGFCEHVYA
FT                   VRLIGERHEQ"
FT   gene            49596..50420
FT                   /gene="purR"
FT                   /locus_tag="Aflv_0040"
FT   CDS_pept        49596..50420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purR"
FT                   /locus_tag="Aflv_0040"
FT                   /product="Transcriptional repressor of the purine operon
FT                   PurR"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32424"
FT                   /db_xref="GOA:B7GFH4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR010078"
FT                   /db_xref="InterPro:IPR015265"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFH4"
FT                   /protein_id="ACJ32424.1"
FT                   /translation="MKLRRSSRLVDMTHYLLYHPHQLVPLTFFAERYGSAKSSISEDLA
FT                   IIKQTFEQQGIGLLRTLPGAAGGVQYVPKISETEAKQFIQQLCTSLADPDRLLPGGYLY
FT                   MTDLLGDTRIVNQIGRLYASAFAHEHIDFVVTVATKGIPLAYAVASFLNVPVVIIRRDS
FT                   KVTEGSMVSINYVSGSSKRIQTMVLSKRSLTEGANVLIIDDFMKAGGTINGMISLLAEF
FT                   HANVVGIGVLVESEEAEERLVDEYVSLVKLTSVNVKEKQITVEEGNYFHFVK"
FT   gene            50454..50834
FT                   /gene="yabJ"
FT                   /locus_tag="Aflv_0041"
FT   CDS_pept        50454..50834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabJ"
FT                   /locus_tag="Aflv_0041"
FT                   /product="Translation initiation inhibitor, yjgF family"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32425"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFH5"
FT                   /protein_id="ACJ32425.1"
FT                   /translation="MKVVHTNQAPQAIGPYSQGIIVNNMFYSSGQIALTPEGEMVQGDI
FT                   QAQTHQVFKNLQAVLEAAGASLETVVKTTVFLKDMNDFVAMNEVYGQYFRDHKPARSAV
FT                   EVARLPKDALIEIEVVALVKQS"
FT   gene            50911..51213
FT                   /gene="spoVG"
FT                   /locus_tag="Aflv_0042"
FT   CDS_pept        50911..51213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVG"
FT                   /locus_tag="Aflv_0042"
FT                   /product="Stage V sporulation protein G required for spore
FT                   cortex synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32426"
FT                   /db_xref="GOA:B7GFH6"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="InterPro:IPR036751"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFH6"
FT                   /protein_id="ACJ32426.1"
FT                   /translation="MVNRMEVTDVRLRRVNTEGRMRAIASITLDHEFVVHDIRVIEGNN
FT                   GLFVAMPSKRTPDGEFRDIAHPINSTTRGKIQEAVLAEYHRAGELEKELEEAGAS"
FT   gene            51369..52775
FT                   /gene="gcaD"
FT                   /locus_tag="Aflv_0043"
FT   CDS_pept        51369..52775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcaD"
FT                   /locus_tag="Aflv_0043"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32427"
FT                   /db_xref="GOA:B7GFH7"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFH7"
FT                   /protein_id="ACJ32427.1"
FT                   /translation="MDKERYGGLTMRRYAIILAAGQGTRMRSKLYKVLHPVCGKPMVQH
FT                   VVDAISTLHVDRLITVVGFGAERVKEQLGSQSEYVIQEQQLGTAHAVLQAAPHLADKDG
FT                   VTLVVCGDTPLITSETMEALLQHHLQTKAKATILTALAEDPTGYGRIVRNEDGHVEKIV
FT                   EHKDATEEERNIREINTGTYCFDNRALFEALTKVSNDNAQGEYYLPDVIEILKKQGEII
FT                   SAYETPVFEETLGVNDRIALAQAEKIMRARIHRKHMANGVTIIDPEHTYIGPDVHIGQD
FT                   TIIYPGTWIEGHTVIGENCIIGPNSEVKNSRIGNDTLIRHSVVHDSEVGSDVSIGPFAH
FT                   IRPLCKIGDDVRIGNFVEIKKATFGDGSKASHLSYIGDAEVGAHVNIGCGTITVNYDGV
FT                   NKYVTKIEDGAFIGCNSNLIAPVTVGSGAYVAAGSTITDDVPSEALAIARARQTNKENY
FT                   VERLQAKKKS"
FT   gene            52793..53743
FT                   /gene="prs"
FT                   /locus_tag="Aflv_0044"
FT   CDS_pept        52793..53743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prs"
FT                   /locus_tag="Aflv_0044"
FT                   /product="Phosphoribosylpyrophosphate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32428"
FT                   /db_xref="GOA:B7GFH8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFH8"
FT                   /protein_id="ACJ32428.1"
FT                   /translation="MSQYLNSNLKLFSLNSNPILAQEIAKVIGVELGKCSVSRFSDGEI
FT                   QINIEESIRGCDVYVIQSTSAPVNEHLMELLIMIDALKRASAKTINIVMPYYGYARQDR
FT                   KARSREPITAKLVANLLETAGATRVITLDLHAPQIQGFFDIPIDHLMGVPILADYFKEK
FT                   QLDDIVIVSPDHGGVTRARKMADRLKAPIAIIDKRRPKPNVAEVMNIIGNVQGKTTILV
FT                   DDIIDTAGTITLAANALAEHGAKEVYACCTHPVLSGPAIERIENSKIKELVVTNTIAIP
FT                   EEKKTNKIVELSVAPLIGEAIIRVHEEQSISALFD"
FT   gene            53800..54426
FT                   /gene="ctc"
FT                   /locus_tag="Aflv_0045"
FT   CDS_pept        53800..54426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctc"
FT                   /locus_tag="Aflv_0045"
FT                   /product="Ribosomal protein L25 (general stress protein
FT                   Ctc)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32429"
FT                   /db_xref="GOA:B7GFH9"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GFH9"
FT                   /protein_id="ACJ32429.1"
FT                   /translation="MISLLQLQLRTDHRRSYVKQMRKQGHIPAVLYGKTTNSQPVFVDA
FT                   AEFLKQLRATGGTGLLDAKMNDNHIRIIVRDMQKHPIRHDIIHIDFLAVDAKTEIDVHV
FT                   PIHLVGEAAGVKDGGVLQQAMHQLSIRVLPSNIPPSIDVDITNLQVGDVITVSHIQTNG
FT                   AYEINHDPTEVIASILPPKQEEEIHSGEEQEPGRPESEEGRETTP"
FT   gene            54423..55046
FT                   /gene="spoVC"
FT                   /locus_tag="Aflv_0046"
FT   CDS_pept        54423..55046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVC"
FT                   /locus_tag="Aflv_0046"
FT                   /product="Peptidyl-tRNA hydrolase SpoVC"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32430"
FT                   /db_xref="GOA:B7GFI0"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFI0"
FT                   /protein_id="ACJ32430.1"
FT                   /translation="MTDVAIIGYVFCGMERRSREMVKLFVGLGNPGKEYEQTRHNVGFM
FT                   VIDELAHRWGLSLNQTKFQGIFTSGMISGEKVILCKPLTYMNLSGECVRPLMDYYNIDV
FT                   DDLIVIYDDLDLSTGTVRLRPKGSAGGHNGMKSLIHHLKTEQFKRIRIGIDRPKNGMRV
FT                   SDYVLGRWTAEEKIQIEQAIQKAADACERSLKISFAQVMNEFNK"
FT   gene            55065..55343
FT                   /gene="yabK"
FT                   /locus_tag="Aflv_0047"
FT   CDS_pept        55065..55343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabK"
FT                   /locus_tag="Aflv_0047"
FT                   /product="Uncharacterized conserved protein, contains two
FT                   CXXC motifs"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32431"
FT                   /db_xref="GOA:B7GFI1"
FT                   /db_xref="InterPro:IPR020115"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFI1"
FT                   /protein_id="ACJ32431.1"
FT                   /translation="MVQNVFDYNNHLGGTHMALHYYCRHCGVKIGTIDGLELESEKLGF
FT                   HRLTEEERLDMIQYLPTGEICVKAICEDCQEALDRNPDLHQYEKFIQ"
FT   gene            55344..58913
FT                   /gene="mfd"
FT                   /locus_tag="Aflv_0048"
FT   CDS_pept        55344..58913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mfd"
FT                   /locus_tag="Aflv_0048"
FT                   /product="Transcription-repair coupling factor (helicase,
FT                   mfd)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32432"
FT                   /db_xref="GOA:B7GFI2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFI2"
FT                   /protein_id="ACJ32432.1"
FT                   /translation="MALGYPKRFCIYVWRGGVFLRGLRQYFIHHADMQSVAEGVRNGLK
FT                   EQLVTGLSGSARSVFISSLYEDTERPLCIVTHNLFQAQKIYDDLIQLIDEEEVFLYPVN
FT                   ELIAAELAVASPELRAQRLEVLNYWCERKKGIVIAPIAALRRLLPPKDVWQRYQLHFRV
FT                   GEQMDVEHCLKQFVAMGYERVSVVSTPGEFSVRGGIIDIYPLTAELPYRIELFDVEIES
FT                   IRTFSVDDQRSVAEIDEVLIGPATELIVEQQHINEAIQRLEAQLHDTLQHIHDEKTKNR
FT                   LYEHVSFELEQLKNGKSIEEMYKYFSLFYPSAASLLDYIPEHGVVIIDEMSRIQEVAEK
FT                   LEQEEAEWYTNLLEEGKIVQSVSISHSFPEVLQKRMRSTIYLSLFLRHIPYTHPQNIVN
FT                   VSCKQMQVFYSQMQLLKGEVERWQKGNYAVVLLAGNEERAKKLKQTLEDYEIDAIQIGK
FT                   DDALLHGKCQIVPSGLVAGFELPMQKLAVITEEELFKKRMKRPVRRQKLSNAERIKSYT
FT                   DLKVGDYVVHVNHGIGKYLGIETLEINGVHKDYIHIQYQGNDTLYVPVDQMDLVQKYVG
FT                   SEGKEPKIYKLGGTEWKKVKKKVESSVQDIAEDLMKLYAEREASKGYAFSPDNEMQREF
FT                   EAAFPYQETEDQLRSIREIKRDMESERPMDRLLCGDVGYGKTEVALRAAFKAIMDGKQV
FT                   AFLVPTTILAQQHYETVRERFQGYPIHVSLLSRFRTKKQQTETIQGLKDGTIDMVIGTH
FT                   RLLSKDVSFKDLGLLIIDEEQRFGVAHKEKIKQLKTNIDVLTLTATPIPRTLHMSLIGV
FT                   RDLSVIETPPENRFPVQTYVMEYSPIIVREAIEREMARGGQVFFLYNRVEDIDRKAEEI
FT                   SALVPDARVTYAHGRMSEHELEAVMLAFLEGQYDVLVSTTIIETGVDIPNVNTLIVYDA
FT                   DKMGLSQLYQLRGRVGRSNRIAYAYFTYRKDKVLNEIAEKRLQAIKEFTELGSGFKIAM
FT                   RDLSIRGAGNLLGAQQHGFIDSVGFELYSQMLKEAIEEKRGTKQEKPFEVEIDLEVDAY
FT                   IPEHYIANEQQKIEMYKRFRGLDSLEELEQLREEMLDRFGDYPDEVAYLFQIAEMKIYA
FT                   KQHLIESIKQTKQEVTILFSQETTKQIDVSKLFKLGEPYGRDVGFGMDEDRFKIVVHIK
FT                   GMKPQQWLMIIYELLKGLKYAKK"
FT   gene            59108..59644
FT                   /gene="spoVT"
FT                   /locus_tag="Aflv_0049"
FT   CDS_pept        59108..59644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVT"
FT                   /locus_tag="Aflv_0049"
FT                   /product="Transcriptional regulator AbrB family"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32433"
FT                   /db_xref="GOA:B7GFI3"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR014213"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR039472"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFI3"
FT                   /protein_id="ACJ32433.1"
FT                   /translation="MKATGIVRRIDDLGRVVIPKEIRRTLRIREGDPLEIFVDRDGEVI
FT                   LKKYSPISELGDFAKEYAEALFDSLGQPVLICDRDVFIAVAGGSKKEYLNKSVSELVEK
FT                   VMEDRQSILHTEEKNVSFTQGHEEHMQSYVIAPIIAGGDPIGAVIIFSKDKTLGEVEHK
FT                   AAETAASFLARQMEQ"
FT   gene            59693..61258
FT                   /gene="yabM"
FT                   /locus_tag="Aflv_0050"
FT   CDS_pept        59693..61258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabM"
FT                   /locus_tag="Aflv_0050"
FT                   /product="Polysaccharide biosynthesis protein, Mvin family"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32434"
FT                   /db_xref="GOA:B7GFI4"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR024923"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFI4"
FT                   /protein_id="ACJ32434.1"
FT                   /translation="MKCMEKKDWLRGAFVLTVAALFTKILSAFYRIPYQNIVGDVGFYI
FT                   YQQVYPFYGIFLALSTYGYPVAISKLIAENKQSTYKFAVVRLSFYFLSCLSIFMFSVLY
FT                   FGASSLAALMGDHQLALLIRTVSFAFLLLPFTSVSRGYFQGGGEMNPTAVSQVVEQLVR
FT                   VGSILFLSSFLLHRGFTVYEAGAGAMIGSLMGSFAALAVLVAYMLRKRTNVHTEPWIPT
FT                   KEKRKVLLFLAVHGVTICLANMLLVLIQLVDSFTLLPLLQQAGLHELAKTAKGIYDRGQ
FT                   PFIQLGTVVATSFSLALVPMLSRKQTERNEIYTAVRVAFIIGMGAVVGLVCILKQANIM
FT                   LFKDHVGAMELTILAVSILFTSLTLTFIAILQGLGDVFRPFFVVCVGMIAKWGLNVLLV
FT                   PLWHTVGAAVATLIAYVVMCAIAFFYVQKRMSRPLLSLSIIIQTIKAAAMMAIILVGYI
FT                   ILTNELPIHHGRLFSSLQAIIGVFIGAFVYIIMIVKKEVLAENDLLAFPFGRYLIKIKQ
FT                   RKAG"
FT   gene            61261..62712
FT                   /gene="yabN"
FT                   /locus_tag="Aflv_0051"
FT   CDS_pept        61261..62712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabN"
FT                   /locus_tag="Aflv_0051"
FT                   /product="Tetrapyrrole methyltransferase domain fused to a
FT                   MazG family NTP pyrophosphatase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32435"
FT                   /db_xref="GOA:B7GFI5"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR024180"
FT                   /db_xref="InterPro:IPR035013"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFI5"
FT                   /protein_id="ACJ32435.1"
FT                   /translation="MGTITIVGLGAGDIDQLSFGVYRTLKQANRLFLRTKDHPVVAQLE
FT                   AEGIHIQSFDDIYEKYDQFEQVYEHIVEHLCEEVKKGDVVYAVPGHPLVAERTVKLLLE
FT                   KKDHISVRVEGGQSFLDALFTAVELDPIEGFQLIDATSFQQDEIQLRNHIIFCQVYDSF
FT                   IASDVKLALLEKLPHDYPIFIVYAAGSKQQRIEKVPLYELDRVITVSNLTSVYVPKVEN
FT                   DELLYHDFTTLRRVIATLRGPNGCPWDRKQTHESLKKYLLEETYELLDAIDRQDDENII
FT                   EELGDVLLQVMLHAQIGEDEGMFSIDDVIRAITEKMIRRHPHVFGDVHVEHAEQVVRNW
FT                   EAIKQAEKENVLHSLLDDVAKALPSTLRAYEYQKRAAKVGFDWSDVEPMWRKVEEEMNE
FT                   VQEEADRMDEQKLKEEFGDLLFALINVCRYYKINPEEALAMANEKFYHRFQYIEQKVKQ
FT                   QGKAWHAYSLEQLDEIWEEAKREGL"
FT   gene            62714..62971
FT                   /gene="yabO"
FT                   /locus_tag="Aflv_0052"
FT   CDS_pept        62714..62971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabO"
FT                   /locus_tag="Aflv_0052"
FT                   /product="Ribosome-associated heat shock protein"
FT                   /note="implicated in the recycling of the 50S subunit (S4
FT                   paralog)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32436"
FT                   /db_xref="GOA:B7GFI6"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFI6"
FT                   /protein_id="ACJ32436.1"
FT                   /translation="MRLDKFLKVSRLIKRRTLAKEVADQGRVWINGQQAKASSTVKIGD
FT                   EIMIQFGQKHVTVKVVELQEHAKKEDASALYEIVKEERVE"
FT   gene            63035..63331
FT                   /gene="yabP"
FT                   /locus_tag="Aflv_0053"
FT   CDS_pept        63035..63331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabP"
FT                   /locus_tag="Aflv_0053"
FT                   /product="Spore coat-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32437"
FT                   /db_xref="InterPro:IPR012504"
FT                   /db_xref="InterPro:IPR022476"
FT                   /db_xref="InterPro:IPR038705"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFI7"
FT                   /protein_id="ACJ32437.1"
FT                   /translation="MMTQNIGNKGPIQEHDIVMRSRRTLEITGVKQVESFDNEEFLLET
FT                   VMGFLSVKGQNLQMKNLDVDKGIVSIKGKIFEIIYLDEHHTEKAKGFFSKLFK"
FT   gene            63328..63936
FT                   /gene="yabQ"
FT                   /locus_tag="Aflv_0054"
FT   CDS_pept        63328..63936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabQ"
FT                   /locus_tag="Aflv_0054"
FT                   /product="Membrane protein involved in spore cortex
FT                   formation"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32438"
FT                   /db_xref="GOA:B7GFI8"
FT                   /db_xref="InterPro:IPR014242"
FT                   /db_xref="InterPro:IPR019074"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFI8"
FT                   /protein_id="ACJ32438.1"
FT                   /translation="MSLHVQFTTLLAMIGIGMIIGASFDTYAHIFNRSKRHRLIVWVAD
FT                   ILFWVTQALYVFYTLLVINNGQVRLYIFLAILCGYAAYQALFQRMYVRLLQKIIDIFVT
FT                   LYRLIIRMFYYTIILPLRLLYRFFVFLFITTCHFVLSVGKILYKVIHMFIRFLLQPFIW
FT                   IGRFIWRQTPLRFQAAVGRIFHIGKGFLAKIANMFRKKR"
FT   gene            63958..64329
FT                   /gene="divIC"
FT                   /locus_tag="Aflv_0055"
FT   CDS_pept        63958..64329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="divIC"
FT                   /locus_tag="Aflv_0055"
FT                   /product="Septum formation initiator"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32439"
FT                   /db_xref="GOA:B7GFI9"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="InterPro:IPR039076"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFI9"
FT                   /protein_id="ACJ32439.1"
FT                   /translation="MSAPQRSKVKKIQTSYVIQQEKQEYKKTQRRKKKVIRFSIVATMA
FT                   LAASSLFLYTMMVQSSMIDEQIKTKEQLEEKLHTLQQDEKRLKEEIKKLNDDQYIAELA
FT                   RKQYFLSKEGEIIFITPDE"
FT   gene            64358..64816
FT                   /gene="yabR"
FT                   /locus_tag="Aflv_0056"
FT   CDS_pept        64358..64816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabR"
FT                   /locus_tag="Aflv_0056"
FT                   /product="RNA binding protein (S1 domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32440"
FT                   /db_xref="GOA:B7GFJ0"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFJ0"
FT                   /protein_id="ACJ32440.1"
FT                   /translation="MFFSLCIMKETIFQILRRSTFFMSIEVGSKLQGKVTGITKFGAFV
FT                   ELPEGATGLVHISEVADSYVKDINEHLKVGDVVEVRVINVEKDGKIGLSIKKAKEQASR
FT                   PRNKGNDRASKESFEQKISRFLKESEDRLASLKRHTESKRGGRGARRG"
FT   gene            64950..65026
FT                   /gene="trnM"
FT                   /locus_tag="Aflv_R014"
FT                   /note="tRNA_Met1"
FT   tRNA            64950..65026
FT                   /gene="trnM"
FT                   /locus_tag="Aflv_R014"
FT                   /product="tRNA-Met"
FT   gene            65038..65109
FT                   /gene="trnE"
FT                   /locus_tag="Aflv_R015"
FT                   /note="tRNA_Glu1"
FT   tRNA            65038..65109
FT                   /gene="trnE"
FT                   /locus_tag="Aflv_R015"
FT                   /product="tRNA-Glu"
FT   gene            65281..67752
FT                   /gene="spoIIE"
FT                   /locus_tag="Aflv_0057"
FT   CDS_pept        65281..67752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoIIE"
FT                   /locus_tag="Aflv_0057"
FT                   /product="Stage II sporulation protein E (serine
FT                   phosphatase)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32441"
FT                   /db_xref="GOA:B7GFJ1"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014221"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFJ1"
FT                   /protein_id="ACJ32441.1"
FT                   /translation="MNMERVERKLVNQMAEVPLSGTKTTVSQWLQRFTVRFSHLLFQQG
FT                   FLFLVIGFLLGRALILTKMTPFALPFFAAIYLLRRDKLGFVFIALFAGSLTVSFYTSLF
FT                   IVASIVMFLIFYRLFFWIDALPKRLPVVVFFASIFAKTGMIYTWGHEWTIYEGMTMLIE
FT                   AGLGSILTLIFLQSVPLFDHQKYKQTLKPEEVISFVILISSMLTGMVGWSIHDLSLEHV
FT                   ASRYLLLLFAFVAGATVGSTVGVVTGLILSLASVSNLYQMSLLAFAGLLGGLLKEGRKL
FT                   GVSLGLVVATLLIALYSQGIADIVPNIVESLLAVLLFLMTPQSLTSKMAKYVPGTIEHT
FT                   NEQQQYVRKIRDVTAQRVEQFSHVFQALSKSFSSYGVLTHEEEEEREIDYFLSDVAAKT
FT                   CQTCFKKDQCWINHFDKTYDYMKKIMQEASENDQMTNAKLLREWNKHCVKANKVVQIIE
FT                   KDVSSYKANKKLKQQMKESRRLVAEQLLGVSQVMEDFAKEIQKERENYYVQEEQILHAL
FT                   QQFGVDVNDVEIYSLDKGSVDIEMVIPYCDGRGECEKLIAPMLSDILGETIIVKKEDCS
FT                   VYPNGDCRVAFSSSKAFVIDTGVAYVAKGGGFISGDSYAMMEIGGGKYALAISDGMGNG
FT                   ERAHYESKETLKLLQKILQSGIEERIAIKSINSILALRTTEEIFSTLDLAIVDLQNATT
FT                   KFLKVGSSPSFIKRGNNVMKIESSNLPIGIITGVEFEMIEEQLKAGDLLIMMSDGIFDG
FT                   VSHIENHDVWMKRKIKELKTNDPQEVSELLLEEVIRVNGGEIEDDMTIVVARIKHNTPK
FT                   WAVIPTYQYMK"
FT   gene            67819..68562
FT                   /gene="yabS"
FT                   /locus_tag="Aflv_0058"
FT   CDS_pept        67819..68562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabS"
FT                   /locus_tag="Aflv_0058"
FT                   /product="Uncharacterized protein containing a von
FT                   Willebrand factor type A (vWA) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32442"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFJ2"
FT                   /protein_id="ACJ32442.1"
FT                   /translation="MRKGTLRQILLITDGCSNHGEDPIAMAALAKEQGITVNVIGVLDQ
FT                   DIIDEQGLREIEGIAQSGGGISQVVYAKQLSQTVQMVTRKAMTQTLQGVINRELKQILG
FT                   SQASIEQLPPEKRGEVMEVVEELGETVNLQVLILVDTSGSMKTKLQTVKEALLDLSISL
FT                   NARLGNNEFSVFVFPGKKGEVDRILDWTPKMESISSVFPKLTSGGITPTGPAIREALQQ
FT                   FQKRRSLKSLFTHDGDDDVYIEQSM"
FT   gene            68522..69478
FT                   /gene="yabT"
FT                   /locus_tag="Aflv_0059"
FT   CDS_pept        68522..69478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabT"
FT                   /locus_tag="Aflv_0059"
FT                   /product="Serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32443"
FT                   /db_xref="GOA:B7GFJ3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFJ3"
FT                   /protein_id="ACJ32443.1"
FT                   /translation="MMVMTMYTSNNLCNIPTGTVIQGKWHKRRYEMIKQLGKGANGVVY
FT                   LAREGRTFVALKISNQATAMMSEVNVLRRFSEVQGVALGPCLLDVDDWFHPQEKRIYSF
FT                   YVMEYIEGDDLLTFIQKRGKDWIIVIILQLLGDLHKLHEKGWVFGDLKPENLIVSGTVP
FT                   KVRLIDVGGTTIRGRAIKEFTEFFDRGYWGMGTRKAEPSYDLFAVAMIMINMCYPKRFE
FT                   RKENGREQLRLMISSHPYLKKYEKILWCALDGKYTSAHEMRKDLLQCMQQPSVKKEKRE
FT                   ERTVRVKRKKKFRILETMLLFVCLLFMYVVYLYVQIL"
FT   gene            69556..70938
FT                   /gene="yacA"
FT                   /locus_tag="Aflv_0060"
FT   CDS_pept        69556..70938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacA"
FT                   /locus_tag="Aflv_0060"
FT                   /product="tRNA(Ile)-lysidine synthase MesJ"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32444"
FT                   /db_xref="GOA:B7GFJ4"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFJ4"
FT                   /protein_id="ACJ32444.1"
FT                   /translation="MLEVVHEFIEKHQLLERGTTVVVGVSGGPDSLALLHFLWSERERY
FT                   DIQLVAAHVDHMLRGKQSEEDMHFVKHFCEQHSIICEATQLDVPAYMERTGKGVQEAAR
FT                   DCRYTFFEQVMYKHHARCVALAHHGDDQIETVLMRLVRGSTTRGYAGIPVKRPFGSGYI
FT                   VRPFLCIDRRQIEQYCQQNGLHARHDPSNEKDDYTRNRFRHAVLPFFKQENIRAHEHFQ
FT                   QFSEMISEDEAFLEQLTKEELKHVVDQQEGCVRIDIPSFIRMPKPLQRRGIQLILNYLY
FT                   GNVPSSLSSIHINQALQFLKRQHPSGMLHFPNGLKVIRQYEVCIFTFQQRQTREYEFLF
FT                   HVPDTLVLPNGCQLISQFVDRYPFIEDDDHIVIEADQLMLPLRVRTRKRGDRMKVKGME
FT                   HAKKISRIFIDEKIPANERAQWPVVEDAGGDIIWIPGVKKSVYTATNITKNRYIVLHYK
FT                   KQ"
FT   gene            70939..71505
FT                   /gene="hprT"
FT                   /locus_tag="Aflv_0061"
FT   CDS_pept        70939..71505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hprT"
FT                   /locus_tag="Aflv_0061"
FT                   /product="Hypoxanthine-guanine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32445"
FT                   /db_xref="GOA:B7GFJ5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFJ5"
FT                   /protein_id="ACJ32445.1"
FT                   /translation="MIVGGKNMGMHQDMEKILITEEQIQQKVKELGALLTKEYEGRFPL
FT                   AVGVLKGAMPFMADLIKHIDTYLEIDFMDVSSYGNATVSSGEVKILKDLNTSVEGRDVL
FT                   IIEDIIDSGLTLSYLADLFRYRKAKSIKIVTLLDKPSGRKANIEADYVGFIVPDEFVVG
FT                   YGLDYCEKYRNLPYIGVLKPEVYSK"
FT   gene            71592..73475
FT                   /gene="ftsH"
FT                   /locus_tag="Aflv_0062"
FT   CDS_pept        71592..73475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="Aflv_0062"
FT                   /product="ATP-dependent Zn protease FtsH"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32446"
FT                   /db_xref="GOA:B7GFJ6"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFJ6"
FT                   /protein_id="ACJ32446.1"
FT                   /translation="MNRIFRNTIFYLLIFLVVIGVVSFLNGGNQRAERMTYDAFVTHLE
FT                   NGDVKYVSLKPERGVYEIRGQLKTYAEGQFFTTYVANSPQILQRIDEAAKQAKVEVLPA
FT                   DETSGWVTFFTSIIPFIIIFILFFFLLNQAQGGGSRVMNFGKSRAKLYNEDKKRVRFKD
FT                   VAGADEEKQELVEIVEFLKDPRKFVELGARIPKGVLLVGPPGTGKTLLARAVAGEAGVP
FT                   FFSISGSDFVEMFVGVGASRVRDLFETAKKNAPCIIFIDEIDAVGRQRGAGLGGGHDER
FT                   EQTLNQLLVEMDGFGGNEGIIIIAATNRPDILDPALLRPGRFDRQITVDRPDVKGREAV
FT                   LRVHARNKPLDESVDLKAIAMRTPGFSGADLENLLNEAALVAARQNKKKIDMSDIDEAT
FT                   DRVIAGPAKKSRVISEKERKIVAYHEAGHTVIGMVLADAEMVHKVTIVPRGQAGGYAVM
FT                   LPKEDRYFMTKPELLDKITGLLGGRVAEEIVFGEVSTGAHNDFQRATSIARRMVTEFGM
FT                   SDKLGPMQFGQSHGQVFLGRDLHNEQNYSDQIAYEIDLEMQRIIKECYEKAKRLLTENR
FT                   DKLDLIANTLLEVETLDAEQIKHLFEHGTLPNRNDNKQEEVKVNIQTKKEE"
FT   gene            73573..74349
FT                   /gene="coaX"
FT                   /locus_tag="Aflv_0063"
FT   CDS_pept        73573..74349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaX"
FT                   /locus_tag="Aflv_0063"
FT                   /product="Pantothenate kinase type III"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32447"
FT                   /db_xref="GOA:B7GFJ7"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFJ7"
FT                   /protein_id="ACJ32447.1"
FT                   /translation="MMIFVLDVGNTNTVLGVYDGDELKFHWRIETSRSKTEDEYGMIVK
FT                   MLLQDVGLRFSDIDGIIISSVVPPIMFALERMCTKYFHIKPLIVGPGIKTGLNIKYDNP
FT                   KEVGADRIVNAVAGIHLYGAPLIIVDFGTATTYCYINEHKQYMGGAIAPGITISTEALY
FT                   SRAAKLPRIEIARPDDIIGKNTVSAMQAGILYGYVGQVEGIVSRMKEKSAVPPKVIATG
FT                   GLASLIAHESNIIDIVDPFLTLKGLQLLYERNKKGE"
FT   gene            74346..75245
FT                   /gene="yacC"
FT                   /locus_tag="Aflv_0064"
FT   CDS_pept        74346..75245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacC"
FT                   /locus_tag="Aflv_0064"
FT                   /product="Disulfide bond chaperone of the HSP33 family"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32448"
FT                   /db_xref="GOA:B7GFJ8"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFJ8"
FT                   /protein_id="ACJ32448.1"
FT                   /translation="MTTMTDYLVKALAYDGQVRAYAVRTTETVREAQRRHQTWPTASAA
FT                   LGRAMTAGVMMGAMLKGDSQITIKIEGGGPIGHILVDSNAKGHVRGYVSNPHVHFELNA
FT                   NGKLDVARAVGTNGTLTVVKDLGLRDYFTGQVPLVSGELGEDFTYYFVSSEQTPSSVGV
FT                   GVLVNPDYTILAAGGFILQLMPGTEEQTIADIEKNLTTIPPISKMIENGLTPEQILHAL
FT                   LGGEQNVKILETMPVSFVCRCSRERVADAIISLGVEEIQQMIDEEGKAEASCHFCNETY
FT                   TFSAEDLEELKKLAKQND"
FT   gene            75306..76241
FT                   /gene="cysK"
FT                   /locus_tag="Aflv_0065"
FT   CDS_pept        75306..76241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysK"
FT                   /locus_tag="Aflv_0065"
FT                   /product="Cysteine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32449"
FT                   /db_xref="GOA:B7GFJ9"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFJ9"
FT                   /protein_id="ACJ32449.1"
FT                   /translation="MDEMARVVQSITELIGQTPVVKLNRIVDHDSADVYLKLEFMNPGS
FT                   SVKDRIALAMIEAAEKAGKIQPGDTIIEPTSGNTGIGLAMVAAAKGYKAIFVMPETMSL
FT                   ERRNLLRAYGAELVLTPGSEGMRGAIQKAEQLAQEHGYFMPQQFKNEANPEVHRLTTGK
FT                   EIVEQMGDQLDAFVAGIGTGGTITGAGEVLRQAYPNIKIYAVEPADSPVLSGGKPGPHK
FT                   IQGIGAGFVPDILNTSIYDEVVTVKTEEAFAAARLAARQEGILGGISSGAAIHVALQVA
FT                   KKLGKGKKVLAIIPSNGERYLSTPLYQFEE"
FT   gene            76338..77762
FT                   /gene="pabB"
FT                   /locus_tag="Aflv_0066"
FT   CDS_pept        76338..77762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabB"
FT                   /locus_tag="Aflv_0066"
FT                   /product="Anthranilate/para-aminobenzoate synthase
FT                   component I"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32450"
FT                   /db_xref="GOA:B7GFK0"
FT                   /db_xref="InterPro:IPR005256"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFK0"
FT                   /protein_id="ACJ32450.1"
FT                   /translation="MNKQRRRTMIKKIPYAQRDWFSQYKALSRKQLHHVLLESGRDGRY
FT                   SIIGLQPFAVVIGKDDKLTVWQKHRTETFEGNILQSLKKWFRQWEIEKLEEGPDFQGGA
FT                   IGYISYDCVRYIEKLPSLACDDLNMPDLYFLVFDDVFVYDHHASFLYFITHYVEGEEQQ
FT                   ANERLERYEQLWTTDFSDVSRPFIPNYEKEEAVSMSEEQFMEAVEKVRTYIAQGDVFQV
FT                   NLSVRQSKRLLTHPFTIYEKLRTLNPSPYMAYMHFPEFQIVSGSPELLVKKKGKYVSTR
FT                   PIAGTRSRGKTIQEDDQIAQSLLANEKERAEHLMLVDLERNDLGRVCAYGTVKVDEFMV
FT                   IEKYSHVMHLVSHVSGQLPAGKDAFDVISAVFPGGTITGAPKVRTMEIIEELEPVRRGI
FT                   YTGSIGWIGFDGDMELNIAIRTMIAKDGLAYVQAGAGIVIDSQPEHEYKECLKKAFALW
FT                   KAKELSEEEYVQLSMR"
FT   gene            77759..78343
FT                   /gene="pabA"
FT                   /locus_tag="Aflv_0067"
FT   CDS_pept        77759..78343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabA"
FT                   /locus_tag="Aflv_0067"
FT                   /product="Anthranilate/para-aminobenzoate synthase
FT                   component II"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32451"
FT                   /db_xref="GOA:B7GFK1"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFK1"
FT                   /protein_id="ACJ32451.1"
FT                   /translation="MSQMILMIDNYDSFTYNLVQYLGQLGEELIVKRNDEVTIAQIEQL
FT                   HPHFLMISPGPCSPNEAGISMEAIEYFAGKIPIFGVCLGHQSIAQVFGGEVVRAERLMH
FT                   GKTSSIFHDGKTIFTQIPNPFTATRYHSLIVKRETLPDCFDISAWTDEGEIMAIRHKTL
FT                   PIEGVQFHPESIMTEYGLEMLKNFITLYKRK"
FT   gene            78350..79219
FT                   /gene="pabC"
FT                   /locus_tag="Aflv_0068"
FT   CDS_pept        78350..79219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabC"
FT                   /locus_tag="Aflv_0068"
FT                   /product="Aminodeoxychorismate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32452"
FT                   /db_xref="GOA:B7GFK2"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFK2"
FT                   /protein_id="ACJ32452.1"
FT                   /translation="MFIYINGQIVKKEEARISAFDHGFMYGLGLFETFRVYDGHPFLLD
FT                   DHLARLHNGLDMLNISCSITRNDVLHILSQLLKANGYRDAYVRLNISAGIGDVGLQVEP
FT                   YTNPTIIMYMKPIPTFSEEKVCQTLQVRRNTPEGSVRLKSHHYLNNILGKQEVGHHSNV
FT                   EGIFLTKEGFVAEGIVSNVFWVKDGIVYTPSVETGILNGVTRLFVIDLLCSWGIDVQEG
FT                   CYSLQQLKEADEIFLTNSIQEIVPVCRLDNDVYPGKCGEMTSRLQRAYAFFTTHLWTRY
FT                   ERKDGYVH"
FT   gene            79216..80052
FT                   /gene="sul"
FT                   /locus_tag="Aflv_0069"
FT   CDS_pept        79216..80052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sul"
FT                   /locus_tag="Aflv_0069"
FT                   /product="Dihydropteroate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32453"
FT                   /db_xref="GOA:B7GFK3"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFK3"
FT                   /protein_id="ACJ32453.1"
FT                   /translation="MMDVIYCGTYKLDLRKNTVIMGILNATPDSFSDGGKYNHVEQAVE
FT                   RAKQLVAEGAHIIDIGGESTRPGAEKVSLEEELRRVIPIVEAVAKAVNVPISIDTYKAE
FT                   VAKQAIEAGATMINDVWGAKADCNMAQVAAYYGVPIVLMHNRYDRHYKDLISDMMNDLK
FT                   ESIDIVKQAGVKDEQIIIDPGIGFAKTVEHNLEVMRRLDEFSVLGYPILLGTSRKSFIG
FT                   HVLDLPVHDRLEGTGATVCLGIAKGAHIVRVHDVLPMARMAKMMDAMLGKGGEYAR"
FT   gene            80015..80404
FT                   /gene="folB"
FT                   /locus_tag="Aflv_0070"
FT   CDS_pept        80015..80404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folB"
FT                   /locus_tag="Aflv_0070"
FT                   /product="Dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32454"
FT                   /db_xref="GOA:B7GFK4"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFK4"
FT                   /protein_id="ACJ32454.1"
FT                   /translation="MRCLGREESMRDKIYVQQMEFYGYHGVFPEENKLGQRFYVDVIIE
FT                   TNLRKAGVTDDLSETVNYAHIYDICQTIVEGKPFKLIEAVAERIAEQILCAYTTVSSCT
FT                   VKVTKPNPPIKGHYAYVAVEITRGR"
FT   gene            80408..80938
FT                   /gene="folK"
FT                   /locus_tag="Aflv_0071"
FT   CDS_pept        80408..80938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="Aflv_0071"
FT                   /product="7,
FT                   8-dihydro-6-hydroxymethylpterin-pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32455"
FT                   /db_xref="GOA:B7GFK5"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFK5"
FT                   /protein_id="ACJ32455.1"
FT                   /translation="MENTSYIALGSNIGDRFEYLCKAVIALRDHTHISVLATSSIYETD
FT                   PVGYVEQACFLNMVVKIATSLSPFDLLAAMMDIEKKFGRKREVHWGPRTLDLDILLYNH
FT                   ENIETEQLIIPHPRMFERAFVLIPLFEIDESLIIPSVQRPLRSYVEQLSDKGVRIWKSR
FT                   EVVEEQLLGKGGI"
FT   gene            80884..81939
FT                   /locus_tag="Aflv_0072"
FT   CDS_pept        80884..81939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0072"
FT                   /product="tRNA-dihydrouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32456"
FT                   /db_xref="GOA:B7GFK6"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFK6"
FT                   /protein_id="ACJ32456.1"
FT                   /translation="MEKPRSSGRTIIRKGGNLMFKIGNVQINNPVVLAPMAGVCNSAFR
FT                   LTVKEFGAGLVCAEMVSDKAILFNNPKTMGMLYIDEREKPLSLQIFGGEKETLVQAAKY
FT                   VDQHTNADIIDINMGCPVPKITKCDAGAKWLLDPNKIYDMVAAVVDAVEKPVTVKMRIG
FT                   WDENHIYAVENAQAVERAGGQAVAVHGRTRVQMYEGKADWNVIKQVKEAVRIPVIGNGD
FT                   VQTPQDAKRMLEQTGVDGVMIGRAALGNPWMIYRTVRYLETGELIPEPSVREKIEVCIL
FT                   HLDRLIALKNEYIAVKEMRKHAAWYLKGIRGNAKVRNAINECQTRDELVTLLMSFVEEV
FT                   EAKEQHVVVES"
FT   gene            82006..83490
FT                   /gene="lysS"
FT                   /locus_tag="Aflv_0073"
FT   CDS_pept        82006..83490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="Aflv_0073"
FT                   /product="Lysyl-tRNA synthetase (class II)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32457"
FT                   /db_xref="GOA:B7GFK7"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR034762"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFK7"
FT                   /protein_id="ACJ32457.1"
FT                   /translation="MSHEELNDQLLVRREKLHKLREKGIDPFGKRFERTHQAEELFTLY
FT                   GHLSKEELEEKQIHVSIAGRIMTKRGKGKAGFAHIQDLTGQIQIYVRKDDVGEEQYEIF
FT                   DTSDLGDIVGVQGTVFKTKVGELSIKVHSYEMLTKSLRPLPEKYHGLKDIEQRYRQRYL
FT                   DLIMNPESKKTFITRSLIIQSMRRYLDQKGYLEVETPMMHSIAGGAAARPFITHHNALD
FT                   MTLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGISTRHNPEFTMLELYEAYADYTDI
FT                   MRLTEDMIAHIAQEVLGTTKIQYGEHEVDLTPSWKRLHMVDAIKDYVGVDFWKHMSDEE
FT                   ARQLAKEHGVEVAPHMTFGHIVNEFFEQKVEQHLIQPTFIYGHPVEISPLAKKNPEDPR
FT                   FTDRFELFIVAREHANAFTELNDPIDQRERFEAQLREKEQGNDEAHEMDEDFIEALEYG
FT                   MPPTGGLGIGIDRLVMLLTNSPSIRDVLLFPQMRHK"
FT   gene            83780..85302
FT                   /locus_tag="Aflv_R016"
FT   rRNA            83780..85302
FT                   /locus_tag="Aflv_R016"
FT                   /product="16S ribosomal RNA"
FT   gene            85658..88579
FT                   /locus_tag="Aflv_R017"
FT   rRNA            85658..88579
FT                   /locus_tag="Aflv_R017"
FT                   /product="23S ribosomal RNA"
FT   gene            88654..88767
FT                   /locus_tag="Aflv_R018"
FT   rRNA            88654..88767
FT                   /locus_tag="Aflv_R018"
FT                   /product="5S ribosomal RNA"
FT   gene            88936..89397
FT                   /gene="ctsR"
FT                   /locus_tag="Aflv_0074"
FT   CDS_pept        88936..89397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctsR"
FT                   /locus_tag="Aflv_0074"
FT                   /product="Transcriptional repressor of class III stress
FT                   genes, CtsR"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32458"
FT                   /db_xref="GOA:B7GJ36"
FT                   /db_xref="InterPro:IPR008463"
FT                   /db_xref="InterPro:IPR040465"
FT                   /db_xref="InterPro:IPR041473"
FT                   /db_xref="InterPro:IPR041902"
FT                   /db_xref="InterPro:IPR041908"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ36"
FT                   /protein_id="ACJ32458.1"
FT                   /translation="MRNISDVIEQYLKQVLNMSGKDIVEIKRSEIADKFQCVPSQINYV
FT                   INTRFTLERGYIVESKRGGGGYIRIMKVKTQNTSQLIEHLLSLVQERISQTNGEHIIQR
FT                   LLDEKVISKREANMMLSIIDRTVLSLDLPHRDELRARILKAMLTSLKYM"
FT   gene            89403..89954
FT                   /gene="mcsA"
FT                   /locus_tag="Aflv_0075"
FT   CDS_pept        89403..89954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcsA"
FT                   /locus_tag="Aflv_0075"
FT                   /product="Modulator of heat shock repressor CtsR, McsA"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32459"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR025542"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ37"
FT                   /protein_id="ACJ32459.1"
FT                   /translation="MNTLICQECNQRPATLHFTKIVNGEKTEFHLCEQCAHEKGEMFMF
FT                   PHQGAFSINNLIAGLLNMDASLKEPKAPSFHNEHILQCERCKMTYAQFVKVGRFGCASC
FT                   YETFRSHLPPIFRKLHGGHVAHEGKIPKRVGGTLYVRKQIGQLKQMLQELIAKEQFEKA
FT                   AEVRDQIRELEAKLHAEGGA"
FT   gene            89902..91023
FT                   /gene="mcsB"
FT                   /locus_tag="Aflv_0076"
FT   CDS_pept        89902..91023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcsB"
FT                   /locus_tag="Aflv_0076"
FT                   /product="Tyrosine kinase McSB, modulator of heat shock
FT                   repressor CtsR"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32460"
FT                   /db_xref="GOA:B7GJ38"
FT                   /db_xref="InterPro:IPR000749"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022414"
FT                   /db_xref="InterPro:IPR022415"
FT                   /db_xref="InterPro:IPR023660"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ38"
FT                   /protein_id="ACJ32460.1"
FT                   /translation="MIKFENLKQSYMRKGAPNYMNEHLFFQRALSPWMNEEGPDSDIVL
FT                   SSRIRLARNMKKYPFPTVFTNEEAMQIVQLFERLFLQKSLGHVGPFFLLKMNELQSIEK
FT                   RVLVEKHLISPHLAEDCTFGACLLSEQEEASIMINEEDHIRIQCLFAGFQLKEALKMAN
FT                   ALDDSIEQHIDYAFDEKYGYLTSCPTNVGTGLRASVMMHLPGLVLTQQMNQLIPAINQL
FT                   GLVVRGTYGEGSEALGNIFQISNQITLGKSEEDIVEDLTGVVRQLIEQERMAREALVKT
FT                   SNIQLEDKVYRSYGVLTNSRIIGSKEAAQCLSDVRLGIDLGYITNVPKTILTELMILTQ
FT                   PGFLQKYAGGALRPQERDVRRASLIRERLHQWK"
FT   gene            91035..93476
FT                   /gene="clpC"
FT                   /locus_tag="Aflv_0077"
FT   CDS_pept        91035..93476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpC"
FT                   /locus_tag="Aflv_0077"
FT                   /product="Class III stress response-related ATPase, ClpC"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32461"
FT                   /db_xref="GOA:B7GJ39"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ39"
FT                   /protein_id="ACJ32461.1"
FT                   /translation="MMKMMFGRFTERAQKVLALAQEEAVRLGHNNIGTEHILLGLIREG
FT                   EGIAAKALMALGLGPDKIQKEVESLIGRGNEVGQTIHYTPRAKKVIELSMDEARKLGHS
FT                   YVGTEHILLGLIREGEGVAARVLNNLGVSLNKARQQVLQLLGSNESASGHHGGTTHANT
FT                   PTLDSLARDLTAIAREGGLDPVIGRSKEIQRVIEVLSRRTKNNPVLIGEPGVGKTAIAE
FT                   GLAQQIVNNEVPETLRDKRVMTLDMGTVVAGTKYRGEFEDRLKKVMDEIRQAGNIILFI
FT                   DELHTLIGAGGAEGAIDASNILKPSLARGELQCIGATTLDEYRKYIEKDAALERRFQPI
FT                   HVGEPTVEESIQILKGLRDRYEAHHRVSISDEAIEQAVKLSDRYISDRFLPDKAIDLID
FT                   EACSKVRLRSFTTPPNLKELEQKLEEIRKEKDAAVQSQEFEKAASLRDAEQKLREQLEE
FT                   TKRAWKEKQGQENSEVTVEDIAAVVSSWTGIPVSKLAQTETERLLKLEEILHSRVIGQE
FT                   EAVKAVAKAVRRARAGLKDPKRPIGSFIFLGPTGVGKTELARALAEAMFGDEDAMIRID
FT                   MSEYMEKHSTSRLVGSPPGYVGYEEGGQLTEKVRRKPYSVILLDEIEKAHPDVFNILLQ
FT                   VLEDGRLTDSKGRTVDFRNTIIIMTSNVGADALKRNKYVGFNVQDESQQYKDMKGKVMD
FT                   ELKKAFRPEFLNRIDEIIVFHSLEKKHLKEIVSLMVEQLKKRLQEQQIDLELTDAAIEK
FT                   LAEEGYDLEYGARPLRRAIQKHVEDRLSEELLKGTIGSGQKVVMDVKDGQFVVLTKETV
FT                   K"
FT   gene            93535..94929
FT                   /gene="radA"
FT                   /locus_tag="Aflv_0078"
FT   CDS_pept        93535..94929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="Aflv_0078"
FT                   /product="ATP-dependent serine protease, RadA"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32462"
FT                   /db_xref="GOA:B7GJ40"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ40"
FT                   /protein_id="ACJ32462.1"
FT                   /translation="MVKRKTKFVCQHCGYETAKWMGKCPGCHSWNAMVEETEIVKPHTR
FT                   ALFVHTEEIVAKPVSITTVETTQEPRIDTKFTEFNRVLGGGIVRGSLVLIGGDPGIGKS
FT                   TLLLQICAQLASDAHSVLYISGEESVKQTKLRAERLHVTAEHLYVLSETNLEHIIQTVD
FT                   EMKPAFVVIDSIQTIYRSEITSAPGSVSQVRECTAELMRLAKTKGIAIFIVGHVTKEGA
FT                   LAGPRILEHMVDTVLYFEGERHHTYRILRAVKNRFGSTNEIGIFEMKEMGLTEVKNPSE
FT                   IFLEERSKGAAGSTVVASMEGTRPVLVEIQALVSPTSFGTPRRMATGIDHNRVSLLMAV
FT                   LEKRVGLLLQNQDAYLKVAGGIKLDEPAIDLAIAVSIASSFRDQPTNHTDVVIGEVGLT
FT                   GEVRRVSRIEQRVQEAAKLGFQRIIIPKSNIGGWNIPKGVEVIGVINVEEALYYALGEG
FT                   KNRPIF"
FT   gene            94980..96107
FT                   /locus_tag="Aflv_0079"
FT   CDS_pept        94980..96107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0079"
FT                   /product="Integral membrane protein containing PIN domain"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32463"
FT                   /db_xref="GOA:B7GJ41"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR041120"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ41"
FT                   /protein_id="ACJ32463.1"
FT                   /translation="METVYNVIEEVKNVLKRIVQASFLITGGMLGIIFFPTLLKLLHLN
FT                   DLPYVDSPYVAAPVGAVIVFLLTFWLVDHVVGLIHWMEETLVKAPVTDLLFGSLGLIFG
FT                   LIVAFLIVIPLNSIQIPPVNTILPIFLTLLLGYLGFQVGFKKRDELMNLFSLPNRSGKK
FT                   KGSEEEEKKGKSLKILDTSVIIDGRIADICQTGFLEGTIVIPRFVLEELQHIADSSDAL
FT                   KRNRGRRGLDILNRIQKELAINVEIYEGDFEGIQEVDSKLVKLAQLTSGVVVTNDFNLN
FT                   KVCELQNVPVLNINDLANAVKPIVLPGEELNVHVIKDGKEQNQGVAYLDDGTMIVVEDG
FT                   KEYIGKRVDVLVTSVLQTSAGRMIFAKLKLLEKAL"
FT   gene            96091..96813
FT                   /gene="ispD"
FT                   /locus_tag="Aflv_0080"
FT   CDS_pept        96091..96813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispD"
FT                   /locus_tag="Aflv_0080"
FT                   /product="4-diphosphocytidyl-2-methyl-D-erithritol
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32464"
FT                   /db_xref="GOA:B7GJ42"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ42"
FT                   /protein_id="ACJ32464.1"
FT                   /translation="MKKHYELLGDREMNYHVVIPAAGQGKRMNAGINKQFIEIEGIPVI
FT                   IHTLRVFERDDFCQGIVLVINDQEREQFVHMLRCFKIKKVNALVSGGEERQQSVYNGLK
FT                   AVNDGHIVLIHDGARPFVTIKKIHELVQATKETGAAVLAVPVKDTMKQVIDGHIEKTVD
FT                   RSSLWAVQTPQAFSMSIILDAHERAKQEQFVGTDDASLVERIGHRVVIVEGEYTNIKLT
FT                   TPEDLLFAEAILRARGDR"
FT   gene            96810..97295
FT                   /gene="ispF"
FT                   /locus_tag="Aflv_0081"
FT   CDS_pept        96810..97295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispF"
FT                   /locus_tag="Aflv_0081"
FT                   /product="2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32465"
FT                   /db_xref="GOA:B7GJ43"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ43"
FT                   /protein_id="ACJ32465.1"
FT                   /translation="MMYRIGQGFDVHQFAEGRPLIIGGINIPYEKGLLGHSDADVLLHA
FT                   IADACLGAIGQGDIGKHFPDTDEAYKDADSAVLLQRVWSLVRQHGYTLVNVDCTIIAQK
FT                   PKMAPYIPNMQKRIAELLEGDISQVNVKATTTEKLGFTGREEGMAAQAVVLLQKNNE"
FT   gene            97359..98819
FT                   /gene="gltX"
FT                   /locus_tag="Aflv_0082"
FT   CDS_pept        97359..98819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="Aflv_0082"
FT                   /product="Glutamyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32466"
FT                   /db_xref="GOA:B7GJ44"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ44"
FT                   /protein_id="ACJ32466.1"
FT                   /translation="MTQEVRVRYAPSPTGHLHIGGARTALFNYLFARHHHGKFIVRIED
FT                   TDIERNVEGGEQSQLENLKWLGIEYDESVDKDGGYGPYRQTERLHIYRQYTNELLEKGY
FT                   AYKCFCTPEELEQEREAQKAAGIAAPQYSGKCRHLTPEQVQQLESEGKPYTIRLKVPEG
FT                   KVYEFEDMVRGHVSFESKDIGDWVIVKANGIPTYNFAVVIDDHLMKITHVFRGEEHLSN
FT                   TPKQLMVYEYFGWEPPKYAHLTLIVNENRKKLSKRDESIIQFVSQYKELGYLPEAMFNF
FT                   FALLGWSPEGEEEIFTKEELIRIFDVSRLSKSPSMFDKQKLTWMNNQYIKKLDLDRLVE
FT                   LSLPHLIRAGRLPEQMTDEQKQWARDLIALYQEQMSYGAEIVELSDLFFKQEIEYDEEA
FT                   KAVLAGEQVPNVLKAFYEQMEQLATFDSEHIKAAIKAVQKETGQKGKNLFMPIRVAVTG
FT                   QTHGPELPEAIRLLGKETVMSRLAQFIR"
FT   gene            99107..99799
FT                   /gene="cysE"
FT                   /locus_tag="Aflv_0083"
FT   CDS_pept        99107..99799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysE"
FT                   /locus_tag="Aflv_0083"
FT                   /product="Serine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32467"
FT                   /db_xref="GOA:B7GJ45"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ45"
FT                   /protein_id="ACJ32467.1"
FT                   /translation="MKNNKGGSNMFKTLKEDIEVIFEQDPAARSYLEVVLTYSGLHAIW
FT                   AHRIAHALYKRKFYFLARLISQISRFFTGIEIHPGAKIGRRFFIDHGMGVVIGETCEIG
FT                   DNVTVYQGVTLGGTGKEKGKRHPTIKDNCLIATGAKVLGSITIGENSKIGAGSVVLKDV
FT                   PPNSTVVGIPGRVVVQNGVRVNKDLNHCDLPDPIADRFKELEAEIEQLKTQLEELKKGT
FT                   VNHEHSSV"
FT   gene            99780..101177
FT                   /gene="cysS"
FT                   /locus_tag="Aflv_0084"
FT   CDS_pept        99780..101177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="Aflv_0084"
FT                   /product="Cysteinyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32468"
FT                   /db_xref="GOA:B7GJ46"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GJ46"
FT                   /protein_id="ACJ32468.1"
FT                   /translation="MSIQVYNTLTRKKEPFIPLEPNKVKMYVCGPTVYNYIHIGNARPA
FT                   IVFDTIRRYLQFRGYEVQYVSNFTDVDDKLIRAARELGEDVPTIAERFIEAYFEDITAL
FT                   GCKKADVHPRVTENIDTIIQFIEQLIEKGYAYEVDGDVYYRTRRFSDYGKLSHQSVDEL
FT                   KSGARIEVGEKKEDPLDFALWKAAKEGEIYWDSPWGKGRPGWHIECSAMARKYLGDTID
FT                   IHAGGQDLTFPHHENEIAQSEALTGKPFAKYWLHNGYINIDNEKMSKSLGNFILVHDII
FT                   KQVDPQVLRFFMLSVHYRHPINYSQPLLESARSGLERLKTAYANLKHRLESSTNLTTND
FT                   EQWLAKIEELRNEFIREMDDDFNTANGIAVLFELAKQANVYLMENHTSQQVIQAFLQQF
FT                   EQLFDVLGLSLQQDELLDEEIEALIQQRIEARKNRDFALADRIRDELKAKNIILEDTPQ
FT                   GTRWRRG"
FT   gene            101182..101607
FT                   /locus_tag="Aflv_0085"
FT   CDS_pept        101182..101607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0085"
FT                   /product="Ribonuclease III family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32469"
FT                   /db_xref="GOA:B7GJ47"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR008226"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ47"
FT                   /protein_id="ACJ32469.1"
FT                   /translation="MLHLFNKMKDFQQLNGLTLAYIGDAVYELFVRHHLLTLGKVKPND
FT                   LHNLAKTYVCAKAQAEVLQWLLNHNQLSEQEMAIVRRGRNAKSGSTPKNTDVQTYRQST
FT                   GLEALIGYHFLSGNEERLYQLMQSALHVHQNDEERRK"
FT   gene            101607..102347
FT                   /gene="yacO"
FT                   /locus_tag="Aflv_0086"
FT   CDS_pept        101607..102347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacO"
FT                   /locus_tag="Aflv_0086"
FT                   /product="rRNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32470"
FT                   /db_xref="GOA:B7GJ48"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ48"
FT                   /protein_id="ACJ32470.1"
FT                   /translation="MMDLIIGKNPVLEALKSGREMNKIWIAEGSQRGQMQSIIQLAKEM
FT                   GITVQYVPKKKMDQLSDGNHQGVIAQVAAYRYYDIDDLFKKAEEQGEAPFFIILDELED
FT                   PHNLGSIMRTADAVGAHGIIIPKRRSVSLTATVAKASTGAIEYVPVARVTNLARTVDEL
FT                   KERGVWIFGTDAKGTQDYRQLDGVIPLALVIGSEGKGISRLLRDKCDVLVRLPMIGHVT
FT                   SLNASVAASLLMYEVYRKRHPLGE"
FT   gene            102340..102858
FT                   /gene="yacP"
FT                   /locus_tag="Aflv_0087"
FT   CDS_pept        102340..102858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacP"
FT                   /locus_tag="Aflv_0087"
FT                   /product="PIN domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32471"
FT                   /db_xref="InterPro:IPR010298"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ49"
FT                   /protein_id="ACJ32471.1"
FT                   /translation="MSKMDILIVDGYNIIGAWPELRELRDTDLSLARDRLVEKMAEYQA
FT                   FTGCKVIIVFDAHLVQGTTKKYVDHQVEVIFTKENETADEHIEKLAKSLQQVRTKVYVA
FT                   TSDYTEQWAIFGQGALRKSARELLIEVDAVQRNISTNVKHIQQKKPMSKIPLTDEVAKI
FT                   FEKWRRGEK"
FT   gene            102905..103576
FT                   /gene="sigH"
FT                   /locus_tag="Aflv_0088"
FT   CDS_pept        102905..103576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sigH"
FT                   /locus_tag="Aflv_0088"
FT                   /product="RNA polymerase sigma-30 factor, sigH"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32472"
FT                   /db_xref="GOA:B7GJ50"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014218"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR016371"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ50"
FT                   /protein_id="ACJ32472.1"
FT                   /translation="MQGGGIGVSANANEKQQSRYEQLEDEMIVELVHQGDSEALDYLIH
FT                   KYKNFVRAKARSYFLVGADREDIVQEGMIGLYKAIRDFKEDKQSSFKAFAELCITRQMI
FT                   TAIKMATRQKHIPLNCYVSLDKPIYEDDSARTLMDVLSGTKITNPEELIINREEFNHIE
FT                   EKMTELLSDLERKVLLLYLEGRSYQEISEELNRHVKSIDNALQRVKRKLEKYVEIQGIH
FT                   L"
FT   gene            103640..103789
FT                   /gene="rpmGB"
FT                   /locus_tag="Aflv_0089"
FT   CDS_pept        103640..103789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmGB"
FT                   /locus_tag="Aflv_0089"
FT                   /product="Ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32473"
FT                   /db_xref="GOA:B7GJ51"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ51"
FT                   /protein_id="ACJ32473.1"
FT                   /translation="MRKKVILACSQCLSRNYTTMKNIAHHAERLEMKKFCKTCHTHTIH
FT                   RETK"
FT   gene            103821..104003
FT                   /gene="secE"
FT                   /locus_tag="Aflv_0090"
FT   CDS_pept        103821..104003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="Aflv_0090"
FT                   /product="Preprotein translocase subunit SecE"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32474"
FT                   /db_xref="GOA:B7GJ52"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ52"
FT                   /protein_id="ACJ32474.1"
FT                   /translation="MQRVTKFFREVVREMKKVSWPKRKELVNYTITVLATVAFFTVFFA
FT                   VVDLGISELVRFILE"
FT   gene            104123..104656
FT                   /gene="nusG"
FT                   /locus_tag="Aflv_0091"
FT   CDS_pept        104123..104656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="Aflv_0091"
FT                   /product="Transcription antiterminator NusG"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32475"
FT                   /db_xref="GOA:B7GJ53"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ53"
FT                   /protein_id="ACJ32475.1"
FT                   /translation="MEKNWYVIHTYSGYENKVKTNLEKRVESMGMQDKIFRVVVPEEEE
FT                   TDTKGGKKKVVKKKVFPGYVLVEMIMTDDSWYVVRNTPGVTGFVGSAGAGSKPTPLLEE
FT                   EVSAILKRMGVDLIELDFDFELNEAVRIKEGPFANFVGTIQEIEMDKQKVTVLVDMFGR
FT                   ETPVELDFSQIEKI"
FT   gene            104739..105233
FT                   /gene="rplK"
FT                   /locus_tag="Aflv_0092"
FT   CDS_pept        104739..105233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="Aflv_0092"
FT                   /product="Ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32476"
FT                   /db_xref="GOA:B7GJ54"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ54"
FT                   /protein_id="ACJ32476.1"
FT                   /translation="MFSYMEWEGISLIPHHGLKEVCLVAKKVIKVVKLQIPAGKANPAP
FT                   PVGPALCQAGVNIMGFCKEFNARTADQAGLIIPVEITVYEDRSFTFITKTPPAAVLLKK
FT                   AAGIESGSGEPNRNKVATVKRDKVREIAETKMPDLNAASIEAAMRMIEGTARSMGIVIE
FT                   D"
FT   gene            105337..106038
FT                   /gene="rplA"
FT                   /locus_tag="Aflv_0093"
FT   CDS_pept        105337..106038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="Aflv_0093"
FT                   /product="Ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32477"
FT                   /db_xref="GOA:B7GJ55"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GJ55"
FT                   /protein_id="ACJ32477.1"
FT                   /translation="MPKRGKRYLEAAKLIDRSKAYAVQEAIELVKKTNVAKFDATVEVA
FT                   FRLGVDPKKADQQIRGAVVLPHGTGKVRRVLVLAKGEKAKEAEAAGADYVGDTDYINKI
FT                   QQGWFEFDVIVATPDMMGEVGKIGRILGPKGLMPNPKTGTVTFDVAKAVNEIKAGKVEY
FT                   RVDKAGNIHVPIGKVSFDTEKLVENFATIYETILKVKPAAAKGTYVKNVTVASTMGPGV
FT                   KVDPSTVAVAN"
FT   gene            106226..106780
FT                   /gene="rplJ"
FT                   /locus_tag="Aflv_0094"
FT   CDS_pept        106226..106780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="Aflv_0094"
FT                   /product="Ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32478"
FT                   /db_xref="GOA:B7GJ56"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ56"
FT                   /protein_id="ACJ32478.1"
FT                   /translation="MIERYKWCRNSTSTGGVDMSSVLEQKQQLVAEIAEKLRASKSTII
FT                   VDYRGLNVAQVTELRKQLREAGIEFKVYKNTLTRRAVAELGLEGLDETLTGPNAIAFSN
FT                   DDVVAPAKILNEFAKKNEALKIKAGIIEGNVATFEEVKALAELPSREGLLSMLLSVLQA
FT                   PIRNFALVTKAVAEKKEEQGA"
FT   gene            106826..107191
FT                   /gene="rplL"
FT                   /locus_tag="Aflv_0095"
FT   CDS_pept        106826..107191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="Aflv_0095"
FT                   /product="Ribosomal protein L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32479"
FT                   /db_xref="GOA:B7GJ57"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GJ57"
FT                   /protein_id="ACJ32479.1"
FT                   /translation="MTKEQIIEAVKNMTVLELNDLVKAIEEEFGVTAAAPVVVAGGAAA
FT                   GAAAEEKTEFDVILADGGAQKIKVIKVVRELTGLGLKEAKDLVDNTPKPVKEGVSKEEA
FT                   EEIKAKLEEAGAKVEIK"
FT   gene            107270..107878
FT                   /gene="rsmC"
FT                   /locus_tag="Aflv_0096"
FT   CDS_pept        107270..107878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsmC"
FT                   /locus_tag="Aflv_0096"
FT                   /product="16S RNA G1207 methylase RsmC"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32480"
FT                   /db_xref="GOA:B7GJ58"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ58"
FT                   /protein_id="ACJ32480.1"
FT                   /translation="MRVMGDHYYTERPTVESKPFQWTYMLRGHQFLFTVDQGVFSKKEV
FT                   DFGSRLLIETFVEPNVSGSILDVGCGYGPIGLALAKDFPHRMVHMIDVNERAIELAKKN
FT                   KQQNDIENVRIYISDLFQRVEGKFAAIVTNPPIRAGKAVVHSIFEQSANYLLSGGQLWV
FT                   VIQKKQGAPSALEKLKTIFDEVDVVEKKKGYFIIRAQKA"
FT   gene            108077..111646
FT                   /gene="rpoB"
FT                   /locus_tag="Aflv_0097"
FT   CDS_pept        108077..111646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="Aflv_0097"
FT                   /product="DNA-directed RNA polymerase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32481"
FT                   /db_xref="GOA:B7GJ59"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ59"
FT                   /protein_id="ACJ32481.1"
FT                   /translation="MNQLTGQLVQYGRHRQRRSYARISEVLELPNLIEIQTSSYQWFLD
FT                   EGLREMFQDISPIEDFTGNLSLEFIDYSLGEPKYSVEESKERDVTYAAPLRVKVRLINK
FT                   ETGEVKEQDVFMGDFPLMTETGTFIINGAERVIVSQLVRSPSVYYSGKVDKNGKRGFTA
FT                   TVIPNRGAWLEYETDAKDVVYVRIDRTRKLPVTVLLRALGFGSDQEIVDLLGDNEYIRN
FT                   TLEKDNTESTEKALLEIYERLRPGEPPTVENAKSLLISRFFDPKRYDLASVGRYKINKK
FT                   LHIKNRLFGQRLAETLVHPETGEVIAEKGTVLDRRTLDRILPELEKGIGIRKYQPLGGV
FT                   VEDEFALQAIKIYAPNDPDGEKVITVISNGYIPETVKHITPADIIASISYFFNLLHGVG
FT                   DTDDIDHLGNRRLRSVGELLQNQFRIGLSRMERVVRERMSIQDTNTITPQQLINIRPVI
FT                   AAIKEFFGSSQLSQFMDQTNPLAELTHKRRLSALGPGGLTRERAGFEVRDVHYSHYGRM
FT                   CPIETPEGPNIGLINSLSTYAKVNKFGFIETPYRRVDPETGKVTNQIDYLTADEEDNYV
FT                   VAQANVPIAEDGTFLEENVVARFRGENIVVKRDRVDYVDVSPKQVVSVATACIPFLEND
FT                   DSNRALMGANMQRQAVPLMQPEAPIVGTGMEYVAAKDSGAAVICKHRGIVERVEAKEIW
FT                   VRRLIEVDGKEVKGDLDKYRLLKFVRSNQGTCYNQRPIVKAGDIVEKGEILADGPSMEK
FT                   GELALGRNVLVAFMTWDGYNYEDAIIMSERLVKDDVYTSIHIEEYESEARDTKLGPEEI
FT                   TRDIPNVGEDALRNLDERGIVRIGAEVKDGDLLVGKVTPKGVTELTAEERLLHAIFGEK
FT                   AREVRDTSLRVPHGGGGIVLDVKVFTREDGDELPPGVNQLVRVYIVQKRKISEGDKMAG
FT                   RHGNKGVISRILPEEDMPFLPDGTPVDIMLNPLGVPSRMNIGQVLELHLGMAARKLGLH
FT                   VASPVFDGAREEDVWATLEEAGMARDAKTVLYDGRTGEPFDNRVSVGIMYMIKLAHMVD
FT                   DKLHARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTVKSDDVV
FT                   GRVKTYEAIVKGENVPEPGVPESFKVLIKELQSLGMDVTVLSSDEKEISMENFGEDDDV
FT                   QPVDIIPPTDESAKEDEGVVVKE"
FT   gene            111696..115295
FT                   /gene="rpoC"
FT                   /locus_tag="Aflv_0098"
FT   CDS_pept        111696..115295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="Aflv_0098"
FT                   /product="DNA-directed RNA polymerase beta' subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32482"
FT                   /db_xref="GOA:B7GJ60"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ60"
FT                   /protein_id="ACJ32482.1"
FT                   /translation="MLDVNKFEYMKIGLASPEKIRSWSYGEVKKPETINYRTLKPEKDG
FT                   LFCERIFGPTKDWECHCGKYKRVRYKGVVCDRCGVEVTRAKVRRERMGHIELAAPVSHI
FT                   WYFKGIPSRMGLVLDMSPRALEEVIYFASYVVTDPGDTPLEKKQLLSEKEYRAYREKYG
FT                   NSFQASMGAEAIKKLLQDIDLEKEVETLKEELKTAQGQRRARTIKRLEVLEAFRNSGND
FT                   PSWMVLDVLPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPNIIV
FT                   QNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSG
FT                   RSVIVVGPNLKMYQCGLPKEMALELFKPFVMKELVERGLAHNIKSAKRKIERVHPEVWD
FT                   VLESVIKEHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVH
FT                   VPLSAEAQAEARLLMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTMEREGAIGEGMVFK
FT                   DTDEALLAYHNGYVHLHTRIAVHAGSLKNETFTEEQNNKLLITTVGKLIFNEILPKSFP
FT                   YINEPTQENIEERTPDKYFLDKGVNVKEEIRKRALVPPFKKKILGNIIAEVFKRFKITE
FT                   TSKMLDRMKDLGFKYSTKAGITIGVADIVVLPEKQEILEEAQAKVDTVLKQFRRGLITD
FT                   EERYERVISIWSAAKDKIQGRLMESLDKRNPIFMMSDSGARGNASNFTQLAGMRGLMAN
FT                   PAGRIIELPIKSSFREGLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVI
FT                   IREDDCGTDRGTLIRALKDGTEVIVKLEDRLIGRYARKTVKHPETGEVLVRENEMITED
FT                   IANAIVKAGIEEVWIRSAFTCNTRHGVCKKCYGRNLATGAEVEVGEAVGIIAAQSIGEP
FT                   GTQLTMRTFHTGGVAGDDITQGLPRVQELFEARNPKGQAVISEIDGVVVAINETRDRQR
FT                   EIVVQGEVETRTYTAPYSARLKVQEGHKVERGQELTEGSIDPKELLRVKDMNAVQEYLL
FT                   REVQKVYRMQGVEISDKHIEVMVRQMLRKVRVIDAGDTDLLPGTLLDIHQFTDANAKVL
FT                   MEGKRPATARPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKRDELLGLKENVI
FT                   IGKLVPAGTGMARYRKVKPVIKTTKDEDAVTTK"
FT   gene            115421..115669
FT                   /locus_tag="Aflv_0099"
FT   CDS_pept        115421..115669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0099"
FT                   /product="Ribosomal protein HS6-type"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32483"
FT                   /db_xref="GOA:B7GJ61"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR022991"
FT                   /db_xref="InterPro:IPR023460"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ61"
FT                   /protein_id="ACJ32483.1"
FT                   /translation="MSYEKVAQAKQIVVGTKQTVRALKDGNVKEVVVAEDADVAVIEKV
FT                   VKAANDRNVPILKVDSTKKLGKACGIDVGAAAVAIIR"
FT   gene            115729..116193
FT                   /gene="rpsL"
FT                   /locus_tag="Aflv_0100"
FT   CDS_pept        115729..116193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="Aflv_0100"
FT                   /product="Ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32484"
FT                   /db_xref="GOA:B7GJ62"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ62"
FT                   /protein_id="ACJ32484.1"
FT                   /translation="MCGLEFDCEGRKFTMPTINQLVRKGRTKKVVKSKSPALNKGYNSF
FT                   KKVQTTVYSPQKRGVCTRVGTMTPKKPNSALRKYARVRLSNGIEVTAYIPGIGHNLQEH
FT                   SVVLIRGGRVKDLPGVRYHIVRGALDTAGVANRMQGRSKYGAKKPKAAKK"
FT   gene            116238..116708
FT                   /gene="rpsG"
FT                   /locus_tag="Aflv_0101"
FT   CDS_pept        116238..116708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="Aflv_0101"
FT                   /product="Ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32485"
FT                   /db_xref="GOA:B7GJ63"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GJ63"
FT                   /protein_id="ACJ32485.1"
FT                   /translation="MPRKGPVPKRDVLPDPIYNSKLVTRLINKIMIDGKKGKAQKILYT
FT                   AFDIIRERTGKDPMEVFEQALKNVMPVLEVRARRVGGANYQVPVEVRPERRTTLGLRWL
FT                   VNYARLRGEKTMEERLANEIMDAANNTGAAVKKREDTHKMAEANKAFAHYRW"
FT   gene            116843..118921
FT                   /gene="fusA"
FT                   /locus_tag="Aflv_0102"
FT   CDS_pept        116843..118921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="Aflv_0102"
FT                   /product="Translation elongation factor G, EF-G"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32486"
FT                   /db_xref="GOA:B7GJ64"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GJ64"
FT                   /protein_id="ACJ32486.1"
FT                   /translation="MARQFSLENTRNIGIMAHIDAGKTTTTERILFYTGRVHKIGEVHE
FT                   GAATMDWMEQEQERGITITSAATTAQWKGHRINIIDTPGHVDFTVEVERSLRVLDGAVA
FT                   VLDAQSGVEPQTETVWRQATTYGVPRIVFVNKMDKIGADFLYSVKTLHERLQANAHPVQ
FT                   LPIGAEDQFTGIIDLVEMCAYHYHDELGKNIERIEIPEDYRDMAEEYRGKLIEAVAELD
FT                   EELMMKYLEGEEITKEELKAAIRKATVSVQFFPVFCGSAFKNKGVQLMLDGVVDYLPSP
FT                   VDIPAIKGTVPDTEEETVREARDDAPFAALAFKIMTDPYVGKLTFFRVYSGTLNSGSYV
FT                   LNSTKRKRERIGRILQMHANHREEIAQVYAGDIAAAVGLKDTTTGDTLCDDKDPVILES
FT                   MQFPEPVIQIAIEPKSKADQDKMSTALQKLQEEDPTFRAWTDQETGQTIIAGMGELHLD
FT                   IIVDRMRREFKVEANVGAPQVAYRETFRKSAQVEGKFVRQSGGRGQYGHVWIEFSPNEE
FT                   GKGFEFENAIVGGVVPREYIPAIQAGLEDAMQNGVLAGYPVVDIKAKLFDGSYHDVDSS
FT                   EMAFKIAASMALKNAAAKCDPVLLEPIMKVEVIVPEEYLGDIMGDITSRRGRVEGMEAR
FT                   GNAQVVRAMVPLSEMFGYATSLRSNTQGRGTFTMVFDHYEEVPKSIAEEIIKKNKGE"
FT   gene            119051..120238
FT                   /gene="tufA"
FT                   /locus_tag="Aflv_0103"
FT   CDS_pept        119051..120238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tufA"
FT                   /locus_tag="Aflv_0103"
FT                   /product="Translation elongation factor Tu, EF-Tu"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32487"
FT                   /db_xref="GOA:B7GJ65"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GJ65"
FT                   /protein_id="ACJ32487.1"
FT                   /translation="MAKAKFERTKPHVNIGTIGHVDHGKTTLTAAITTVLAKQGKAEAR
FT                   AYDQIDAAPEERERGITISTAHVEYETDNRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVSAADGPMPQTREHILLSRQVGVPYIVVFLNKCDMVDDEELLELVEMEVRDLLSEYDF
FT                   PGDEVPVIKGSALKALEGDPAWEAKIIELMNAVDEYIPTPQREVDKPFMMPVEDVFSIT
FT                   GRGTVATGRVERGILKVGDQVEIIGLSEEPKATTVTGVEMFRKLLDQAEAGDNIGALLR
FT                   GVSRDEVQRGQVLAKPGTITPHTKFKAQVYVLTKEEGGRHTPFFSNYRPQFYFRTTDVT
FT                   GIIQLPEGVEMVMPGDNIEMTVELIAPIAIEEGTKFSIREGGRTVGAGSVSEIIE"
FT   gene            120474..120821
FT                   /gene="rpsJ"
FT                   /locus_tag="Aflv_0104"
FT   CDS_pept        120474..120821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="Aflv_0104"
FT                   /product="Ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32488"
FT                   /db_xref="GOA:B7GJ66"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ66"
FT                   /protein_id="ACJ32488.1"
FT                   /translation="MSILKIGEEGGKIMAKEKIRIRLKAYDHRILDQSAEKIVETAKRS
FT                   GATVSGPIPLPTEKTVYTILRAVHKYKDSREQFEMRTHKRLIDIVNPTPQTVDSLMRLD
FT                   LPSGVDIEIKL"
FT   gene            120845..121471
FT                   /gene="rplC"
FT                   /locus_tag="Aflv_0105"
FT   CDS_pept        120845..121471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="Aflv_0105"
FT                   /product="Ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32489"
FT                   /db_xref="GOA:B7GJ67"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ67"
FT                   /protein_id="ACJ32489.1"
FT                   /translation="MKGILGRKIGMTQVFAENGDLIPVTVIQATPNVVLQKKTIENDGY
FT                   EAIQLGFEDLREKLANKPQKGHAAKANTTPKRFIREIRGVNLAEYEVGQEVKVDIFNEG
FT                   EIVDVTGTSKGKGFQGVIKRHGQSRGPMAHGSRYHRRPGSMGPIAPNRVFKSKELPGRM
FT                   GGERVTVQNLKVVKVDPERNLILIKGNVPGPNKGLVIIKSAVKAK"
FT   gene            121499..122122
FT                   /gene="rplD"
FT                   /locus_tag="Aflv_0106"
FT   CDS_pept        121499..122122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="Aflv_0106"
FT                   /product="Ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32490"
FT                   /db_xref="GOA:B7GJ68"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GJ68"
FT                   /protein_id="ACJ32490.1"
FT                   /translation="MPKVALYNQNGENIGEIELNDAVFGIEPNKHVLFEAVIMQRASLR
FT                   QGTHKTKNRAEVSGGGRKPWRQKGTGRARQGSIRSPQWRGGGVVFGPVPRSYSYKLPKK
FT                   VRRLAIKSALSSKVLENSIVVLDNLTLEAPKTKEMVKILNNLSVDRKALIVTADANENV
FT                   ILSARNIPGVTVVTASGINVLDVLNHDKLVITKAAVEKVEEVLA"
FT   gene            122122..122409
FT                   /gene="rplW"
FT                   /locus_tag="Aflv_0107"
FT   CDS_pept        122122..122409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="Aflv_0107"
FT                   /product="Ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32491"
FT                   /db_xref="GOA:B7GJ69"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GJ69"
FT                   /protein_id="ACJ32491.1"
FT                   /translation="MKDPRDIIKRPVITERSTELMTEKKYTFEVDVKANKTEVKDAIEA
FT                   IFGVKVAKVNIMNYKGKFKRVGRYSGLTNRRRKAIVTLTPDSKEIELFEV"
FT   gene            122431..123267
FT                   /gene="rplB"
FT                   /locus_tag="Aflv_0108"
FT   CDS_pept        122431..123267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="Aflv_0108"
FT                   /product="Ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32492"
FT                   /db_xref="GOA:B7GJ70"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ70"
FT                   /protein_id="ACJ32492.1"
FT                   /translation="MDMAIKKYKPTSNGRRGMTVLDFSELTTDKPEKSLLAPLKKKGGR
FT                   NNQGKLTVRHQGGGHKRQYRIIDFKRDKDGIPGRVATIEYDPNRSANIALIHYADGEKR
FT                   YIIAPKNLEVGMEIMSGPDADIKVGNALPLANIPVGTVIHNIELKPGKGGQLVRAAGTS
FT                   AQVLGKEGKYVLVRLSSGEVRMILATCRATVGQVGNEQHELVNIGKAGRARWLGIRPTV
FT                   RGSVMNPVDHPHGGGEGKAPIGRKSPMTPWGKPTLGFKTRKKKNKSDKFIVRRRKK"
FT   gene            123325..123603
FT                   /gene="rpsS"
FT                   /locus_tag="Aflv_0109"
FT   CDS_pept        123325..123603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="Aflv_0109"
FT                   /product="Ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32493"
FT                   /db_xref="GOA:B7GJ71"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GJ71"
FT                   /protein_id="ACJ32493.1"
FT                   /translation="MGRSLKKGPFCDDHLMKKIEKLNETGQKQVIKTWSRRSTIFPQFI
FT                   GHTIAVYDGRKHVPVYITEDMVGHKLGEFAPTRTYKGHAADDKKTKR"
FT   gene            123624..123965
FT                   /gene="rplV"
FT                   /locus_tag="Aflv_0110"
FT   CDS_pept        123624..123965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="Aflv_0110"
FT                   /product="Ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32494"
FT                   /db_xref="GOA:B7GJ72"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GJ72"
FT                   /protein_id="ACJ32494.1"
FT                   /translation="MQAKAVARTVRIAPRKARLVIDLIRGKQVSEAVAILRHTPKAASP
FT                   IIEKVLKSAVANAEHNYDMDVNKLVVTEAYVNEGPTLKRFRPRAQGRASAINKRTSHIT
FT                   IVVSEKKEG"
FT   gene            123969..124625
FT                   /gene="rpsC"
FT                   /locus_tag="Aflv_0111"
FT   CDS_pept        123969..124625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="Aflv_0111"
FT                   /product="Ribosomal protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32495"
FT                   /db_xref="GOA:B7GJ73"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GJ73"
FT                   /protein_id="ACJ32495.1"
FT                   /translation="MGQKVNPIGLRIGIIRDWESRWYAEKDYADLLHEDLKIREYLTKR
FT                   LSDAAVSRIEIERAANRVNITIHTAKPGMVIGKGGSEVEALRKALNELTGKRVHINIVE
FT                   IKKPDLEAKLVAENIARQIENRVSFRRAQKQAIQRTMRAGAKGIKTMVSGRLGGADIAR
FT                   SEHYSEGTVPLHTLRADIDYATAEADTTYGKIGVKVWIYRGEVLPTKKKTEEGGN"
FT   gene            124628..125062
FT                   /gene="rplP"
FT                   /locus_tag="Aflv_0112"
FT   CDS_pept        124628..125062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="Aflv_0112"
FT                   /product="Ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32496"
FT                   /db_xref="GOA:B7GJ74"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GJ74"
FT                   /protein_id="ACJ32496.1"
FT                   /translation="MLMPKRVKYRREHRGRMKGRAKGGTEVHFGEYGLQALEPAWITNR
FT                   QIEAARRAMTRYMRRGGKVWIKIFPSKPYTAKPLEVRMGSGKGAPEGWVAVVKPGKVMF
FT                   EIAGVSEEVAREALRLASHKLPIKCKFVKREEIGGESNES"
FT   gene            125037..125252
FT                   /gene="rpmC"
FT                   /locus_tag="Aflv_0113"
FT   CDS_pept        125037..125252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="Aflv_0113"
FT                   /product="Ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32497"
FT                   /db_xref="GOA:B7GJ75"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ75"
FT                   /protein_id="ACJ32497.1"
FT                   /translation="MVVNQMKAKEIRELTTAEIEQKIKALKEELFNLRFQLATGQLENT
FT                   ARIREVRKAIARMKTVIREREIAANK"
FT   gene            125278..125541
FT                   /gene="rpsQ"
FT                   /locus_tag="Aflv_0114"
FT   CDS_pept        125278..125541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="Aflv_0114"
FT                   /product="Ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32498"
FT                   /db_xref="GOA:B7GJ76"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GJ76"
FT                   /protein_id="ACJ32498.1"
FT                   /translation="MSERNNRKVLVGRVVSDKMDKTITVLVETYKKHPLYGKRVKYSKK
FT                   YKAHDENNVAKVGDIVKIMETRPLSATKRFRLVEVVEKAVIV"
FT   gene            125590..125958
FT                   /gene="rplN"
FT                   /locus_tag="Aflv_0115"
FT   CDS_pept        125590..125958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="Aflv_0115"
FT                   /product="Ribosomal protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32499"
FT                   /db_xref="GOA:B7GJ77"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GJ77"
FT                   /protein_id="ACJ32499.1"
FT                   /translation="MIQQETRMKVADNSGAREVLVIKVLGGSGRRYANIGDIVVATVKD
FT                   ATPGGVVKKGQVVKAVVVRTKRGVRRTDGSYIRFDENACVIIRDDKSPRGTRIFGPVAR
FT                   ELREKDFMKIVSLAPEVI"
FT   gene            125995..126306
FT                   /gene="rplX"
FT                   /locus_tag="Aflv_0116"
FT   CDS_pept        125995..126306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="Aflv_0116"
FT                   /product="Ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32500"
FT                   /db_xref="GOA:B7GJ78"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GJ78"
FT                   /protein_id="ACJ32500.1"
FT                   /translation="MHVKKGDKVQVISGKDKGKQGVILAAFPKKNRVLVEGVNIVKKHV
FT                   KPSQANPQGGIINQEAPIHVSNVMPLDPKTGLPTRVGYKVVDGKKVRYAKRSGEILDK"
FT   gene            126336..126875
FT                   /gene="rplE"
FT                   /locus_tag="Aflv_0117"
FT   CDS_pept        126336..126875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="Aflv_0117"
FT                   /product="Ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32501"
FT                   /db_xref="GOA:B7GJ79"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GJ79"
FT                   /protein_id="ACJ32501.1"
FT                   /translation="MNRLKEKYLKEVVPALMSKFNYKSVMQVPKIEKIVINMGVGDAVQ
FT                   NAKALDNAVEELALISGQKPVVTRAKKSIAGFRLREGMPIGAKVTLRGERMYEFFDKLV
FT                   SVSLPRVRDFRGVSKKSFDGRGNYTLGVKEQLIFPEIDYDKVNKVRGMDIVIVTTAKTD
FT                   EEARELLTLLGMPFQK"
FT   gene            126910..127095
FT                   /gene="rpsN"
FT                   /locus_tag="Aflv_0118"
FT   CDS_pept        126910..127095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="Aflv_0118"
FT                   /product="Ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32502"
FT                   /db_xref="GOA:B7GJ80"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GJ80"
FT                   /protein_id="ACJ32502.1"
FT                   /translation="MAKKSMIAKQKRTPKFKVQAYTRCERCGRPHSVYRKFKLCRICFR
FT                   ELAYKGQIPGVKKASW"
FT   gene            127129..127527
FT                   /gene="rpsH"
FT                   /locus_tag="Aflv_0119"
FT   CDS_pept        127129..127527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="Aflv_0119"
FT                   /product="Ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32503"
FT                   /db_xref="GOA:B7GJ81"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GJ81"
FT                   /protein_id="ACJ32503.1"
FT                   /translation="MVMTDPIADMLTRIRNANMVRHEKLEVPASKIKREIAEILKREGF
FT                   IRDVEYIEDNKQGILRIFLKYGPNNERVITGLKRISKPGLRVYAKADEVPRVLNGLGIA
FT                   ILSTSQGILTDKEARQKRTGGEVLAYIW"
FT   gene            127557..128096
FT                   /gene="rplF"
FT                   /locus_tag="Aflv_0120"
FT   CDS_pept        127557..128096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="Aflv_0120"
FT                   /product="Ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32504"
FT                   /db_xref="GOA:B7GJ82"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ82"
FT                   /protein_id="ACJ32504.1"
FT                   /translation="MSRVGKKPLEIPAGVTVTLNGNTVTVKGPKGELTRTFHPDMVIKV
FT                   EGNILTVERPSDEKHHRALHGTTRSLLANMVEGVSKGYERALELVGVGYRATKQGKKLV
FT                   LSVGYSHPVEIEPEEGLEIEVPSQTKIIVKGADKQRVGELAANIRAVRSPEPYKGKGIR
FT                   YEGEVVRRKEGKTGKK"
FT   gene            128111..128491
FT                   /gene="rplR"
FT                   /locus_tag="Aflv_0121"
FT   CDS_pept        128111..128491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="Aflv_0121"
FT                   /product="Ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32505"
FT                   /db_xref="GOA:B7GJ83"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ83"
FT                   /protein_id="ACJ32505.1"
FT                   /translation="MKGVTRMITKLDKNAVRKKRHARVRRKVVGTAERPRLNVFRSNKH
FT                   IYAQIIDDMKAVTLVSASTLDKEFDLESTGNVEAAQKVGELIAKRALEKGITSVVFDRG
FT                   GYLYHGRVKALADAAREAGLQF"
FT   gene            128511..129011
FT                   /gene="rpsE"
FT                   /locus_tag="Aflv_0122"
FT   CDS_pept        128511..129011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="Aflv_0122"
FT                   /product="Ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32506"
FT                   /db_xref="GOA:B7GJ84"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GJ84"
FT                   /protein_id="ACJ32506.1"
FT                   /translation="MRRIDPNKLELEERVVAVNRVAKVVKGGRRFRFAALVVVGDKNGH
FT                   VGFGTGKAQEVPDAIRKAIEDAKKNLITVPIVGTTIPHEVIGHFGAGEIILKPASEGTG
FT                   VIAGGPARAVLELAGISDILSKSIGSNTPINMVRATIDGLKQLKRAEEVAKLRGKTVEE
FT                   LLG"
FT   gene            129023..129214
FT                   /gene="rpmD"
FT                   /locus_tag="Aflv_0123"
FT   CDS_pept        129023..129214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="Aflv_0123"
FT                   /product="Ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32507"
FT                   /db_xref="GOA:B7GJ85"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ85"
FT                   /protein_id="ACJ32507.1"
FT                   /translation="MMAKKLAITLTRSVIGRPQDQRVTVKTLGLRKLHQTVVHNDNPAI
FT                   RGMINKVSHLVTVKELEE"
FT   gene            129229..129669
FT                   /gene="rplO"
FT                   /locus_tag="Aflv_0124"
FT   CDS_pept        129229..129669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="Aflv_0124"
FT                   /product="Ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32508"
FT                   /db_xref="GOA:B7GJ86"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GJ86"
FT                   /protein_id="ACJ32508.1"
FT                   /translation="MKLHELQPAPGSRKERNRVGRGIGSGNGKTSGKGHKGQNARSGGG
FT                   VRIGFEGGQTPLFRRLPKRGFTNIHRKEYAIVNLEALNRFEDGTEVTPELLLETGVVSK
FT                   LKAGIKVLGDGELTKKLTVKAHKFSASAKEAIEAAGGTTEVI"
FT   gene            129669..130961
FT                   /gene="secY"
FT                   /locus_tag="Aflv_0125"
FT   CDS_pept        129669..130961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="Aflv_0125"
FT                   /product="Preprotein translocase subunit SecY"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32509"
FT                   /db_xref="GOA:B7GJ87"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ87"
FT                   /protein_id="ACJ32509.1"
FT                   /translation="MFRTISNFMRVGDIRRKILFTLLMLIVFRIGTFIPVPGVNADVLK
FT                   MQDQFNAFGVLNTFGGGALKNFSIFAMGVMPYITASIIVQLLQMDVVPKFTEWSKQGEV
FT                   GRRKLAQFTRYFTIVLGFIQAFAMSYGFHNMSGGVLIKNPGIPTYLLIALVLTAGTAFL
FT                   MWLGEQITAKGVGNGISVLIFAGIVSGIPTTLNQIYVQQFENAGDQLFLRIVTVLLVAL
FT                   AVVAVIVGVIYMQQAFRKIPIQYAKRLEGRSPVGGHSTHIPLKVNPAGVIPVIFAVSFI
FT                   ITPPTIASFFGSNDVTLWIKKVFDYTQPVGMIIYVALIVAFTYFYAFVQVNPEQMADNL
FT                   KKQGGYIPGIRPGKNTQEFITRVLYRLTFVGALFLAAIAVLPVFFIEFAKLPPSAQIGG
FT                   TSLLIVVGVALETMKQLESQLVKRHYKGFIK"
FT   gene            131018..131671
FT                   /gene="adk"
FT                   /locus_tag="Aflv_0126"
FT   CDS_pept        131018..131671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="Aflv_0126"
FT                   /product="Adenylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32510"
FT                   /db_xref="GOA:B7GJ88"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ88"
FT                   /protein_id="ACJ32510.1"
FT                   /translation="MMNLVLMGLPGAGKGTQAEKIVEKYKIPHISTGDMFRAAIKEGTE
FT                   LGLQAKSYMDRGDLVPDEVTIGIVRERLSKDDCQNGFLLDGFPRTVAQAEALETLLQQL
FT                   DRSIDYVINIEVDKSILMERLTGRRICKECGATYHLVFNPPAQAGVCDKCGGELYQRAD
FT                   DNEATVANRLEVNMKQTQPLLDFYEAKGYLRNINGQQHIDQVFADICELLGGLQ"
FT   gene            131671..132417
FT                   /gene="map"
FT                   /locus_tag="Aflv_0127"
FT   CDS_pept        131671..132417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="map"
FT                   /locus_tag="Aflv_0127"
FT                   /product="Methionine aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32511"
FT                   /db_xref="GOA:B7GJ89"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ89"
FT                   /protein_id="ACJ32511.1"
FT                   /translation="MIICKTPREIEIMREAGRIVALTHQELQKYIEPGITTRELDHIAE
FT                   TFIRKHDAIPSFKGYNGFQGSICTSVNEELVHGVPGDRVLREGDIISIDIGAKYNGYHG
FT                   DSAWTYPVGVISEEAKKLLEVTEQSLYRGLEEAKPGARLTNISHAIQTYVEAHNFSVVR
FT                   EYVGHGIGQDLHEDPQIPHYGPPNKGPRLKPGMVLCIEPMVNAGTRYVRTLEDNWTVVT
FT                   VDGKLCAHFEHTIAITETGYEILTTL"
FT   gene            132516..132734
FT                   /gene="infA"
FT                   /locus_tag="Aflv_0128"
FT   CDS_pept        132516..132734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="Aflv_0128"
FT                   /product="Translation initiation factor 1 (IF-1)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32512"
FT                   /db_xref="GOA:B7GJ90"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ90"
FT                   /protein_id="ACJ32512.1"
FT                   /translation="MAKDDVIEVEGTVVETLPNAMFRVELENGHTVLAHVSGKIRMHFI
FT                   RILPGDKVTVELSPYDLTRGRITYRYK"
FT   gene            132765..132878
FT                   /gene="rpmJ"
FT                   /locus_tag="Aflv_0129"
FT   CDS_pept        132765..132878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="Aflv_0129"
FT                   /product="Ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32513"
FT                   /db_xref="GOA:B7GJ91"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GJ91"
FT                   /protein_id="ACJ32513.1"
FT                   /translation="MKVRPSVKPICEKCKVIRRRGKVMVICENPKHKQKQG"
FT   gene            132901..133266
FT                   /gene="rpsM"
FT                   /locus_tag="Aflv_0130"
FT   CDS_pept        132901..133266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="Aflv_0130"
FT                   /product="Ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32514"
FT                   /db_xref="GOA:B7GJ92"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GJ92"
FT                   /protein_id="ACJ32514.1"
FT                   /translation="MARIAGVDIPRDKRVVISLTYIYGIGKATAQKILAEAGVSEDTRV
FT                   RDLTEEELGKIREIVDRLKVEGDLRREVSLNIKRLMEIGCYRGLRHRRGLPVRGQNTKN
FT                   NARTRKGPRRTVANKKK"
FT   gene            133292..133681
FT                   /gene="rpsK"
FT                   /locus_tag="Aflv_0131"
FT   CDS_pept        133292..133681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="Aflv_0131"
FT                   /product="Ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32515"
FT                   /db_xref="GOA:B7GJ93"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GJ93"
FT                   /protein_id="ACJ32515.1"
FT                   /translation="MARKTNTRKRRVKKNIESGIAHIRSTFNNTIVTITDVHGNAISWS
FT                   SAGALGFKGSRKSTPFAAQMAAEAAAKASMEHGMKTVEVNVKGPGAGREAAIRALQAAG
FT                   LEITAIKDVTPVPHNGCRPPKRRRV"
FT   gene            133850..134794
FT                   /gene="rpoA"
FT                   /locus_tag="Aflv_0132"
FT   CDS_pept        133850..134794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="Aflv_0132"
FT                   /product="DNA-directed RNA polymerase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32516"
FT                   /db_xref="GOA:B7GJ94"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ94"
FT                   /protein_id="ACJ32516.1"
FT                   /translation="MLEIEKPKIETVEISEDAKYGKFVVEPLERGYGTTLGNSLRRILL
FT                   SSLPGAAVTSVQIDGVLHEFSTIDGVVEDVTTIILNIKKLALKIYSDEEKTLEIDVQGE
FT                   GVVTAADITHDSDVEILNPDLQIATLAKDGRLRMRMTAKRGRGYTPADANKREDQPIGV
FT                   IPIDSIYTPVSRVSYQVENTRVGQMTNYDKLTIDVWTDGSIGPKEAISLGAKILTEHLN
FT                   IFVNLTDEAQHAEIMIEKEEDQKEKVLEMTIEELDLSVRSYNCLKRAGINTVQELAQKT
FT                   EEDMMKVRNLGRKSLEEVKAKLEELGLSLRKDD"
FT   gene            134855..135217
FT                   /gene="rplQ"
FT                   /locus_tag="Aflv_0133"
FT   CDS_pept        134855..135217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="Aflv_0133"
FT                   /product="Ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32517"
FT                   /db_xref="GOA:B7GJ95"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GJ95"
FT                   /protein_id="ACJ32517.1"
FT                   /translation="MSYRKLGRTSSQRKALLRDLVTDLIINERIETTEARAKELRSVVE
FT                   KMITLGKRGDLHARRQAAAFVRKEVANTETGQDAIQKLFSDIAPRYQDRQGGYTRIMKL
FT                   GPRRGDGAPMVIIELV"
FT   gene            135331..136185
FT                   /locus_tag="Aflv_0134"
FT   CDS_pept        135331..136185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0134"
FT                   /product="ABC-type cobalt transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32518"
FT                   /db_xref="GOA:B7GJ96"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030947"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ96"
FT                   /protein_id="ACJ32518.1"
FT                   /translation="MEVAVRVEHVSFQYANEQTQALQNVSFQVHKGEWVTIVGHNGSGK
FT                   STLAKLLIGLLPPTSGTIHVCGIPLNDETVWDVRERLGIVFQNPDNQFVGTTVQDDVAF
FT                   GLENRGVPKHEMEKRIKEALQKVGMENFMNDEPHRLSGGQKQRVAIASAIALQPNIIIL
FT                   DEATSMLDPNGKKEVLQVIQSLRCEHDMTVISITHDLNEVAKADRVIVMNKGRIALEGT
FT                   PKHIFAHGTKLEEMGLELPFSMQLSQRLKDDRIPITTDHLTIEGLVSELWTLYSAMSNI
FT                   ATK"
FT   gene            136143..137012
FT                   /locus_tag="Aflv_0135"
FT   CDS_pept        136143..137012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0135"
FT                   /product="ABC-type cobalt transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32519"
FT                   /db_xref="GOA:B7GJ97"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030946"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ97"
FT                   /protein_id="ACJ32519.1"
FT                   /translation="MDIVFRDVEHRYQINTPFEKRALYDIHVNIRSGSYVAVIGHTGSG
FT                   KSTFLQHLNGLLQPTKGTVHLGNCTITAGKKEKQLKPLRKKVGIVFQFPEHQLFEETVE
FT                   KDICFGPINFGMTEEEAKARVSEWLALVGLPEEVRHKSPFALSGGQMRRVAIAGVLAME
FT                   PEVLVLDEPTAGLDPRGRKEMMDMFAQLQRQKGMTIVLVTHSMEEAARYADDIIVMHQG
FT                   TIVRRGTPEHIFQHVDDLINLGLDVPETVLFQRAIEQKFGLQFHIPCLTIEDVVKNLQT
FT                   LFNKVKRI"
FT   gene            137009..137806
FT                   /locus_tag="Aflv_0136"
FT   CDS_pept        137009..137806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0136"
FT                   /product="ABC-type cobalt transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32520"
FT                   /db_xref="GOA:B7GJ98"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR024919"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ98"
FT                   /protein_id="ACJ32520.1"
FT                   /translation="MMNSMIIGKYVPGDSLIHRLDPRTKLLFMFIYVFIVFLANNGWTY
FT                   GLLTFFTCVLLLLSRIPFSFMVKGLKPVLWIIVFTFLLHALLTKEGEIVFQWLGIEVYD
FT                   KAIQQGTFISLRFLLLIVVTTLVTLTTTPIEVTDGMESLLSPLKKWNIPVHELALMMSI
FT                   SLRFIPTLMEETEKIMKAQTARGVDFSSGPLSERMKAMTALLVPLFISSFKRAEELAIA
FT                   MEVRGYRGGRNRTKWRELTWRRIDTAFMLLLGLLAILLWLLRS"
FT   gene            137822..138562
FT                   /gene="truA"
FT                   /locus_tag="Aflv_0137"
FT   CDS_pept        137822..138562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truA"
FT                   /locus_tag="Aflv_0137"
FT                   /product="Pseudouridylate synthase I"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32521"
FT                   /db_xref="GOA:B7GJ99"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GJ99"
FT                   /protein_id="ACJ32521.1"
FT                   /translation="MRRIKCTIAYDGTNFAGYQIQQQKRTVQGELERALSIIHKGQFVR
FT                   VYASGRTDATVHAYGQVIHFDTPLTIPDERWPKALNALLPDDVIVKEASEVPSSFHARF
FT                   SVKKKEYRYRVWIGEKNVFLRHYVYHHPYDVSVPAMNEALRYLIGTHDFTSFCSAKTEV
FT                   DDKVRTIYEAEVVQEGEELIFRLVGNGFLYNMVRIIVGTVLEVGRGERCAEEIKTILEQ
FT                   KNRSVAGKTAPGHGLYLWHVSYDN"
FT   gene            138709..139143
FT                   /gene="rplM"
FT                   /locus_tag="Aflv_0138"
FT   CDS_pept        138709..139143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="Aflv_0138"
FT                   /product="Ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32522"
FT                   /db_xref="GOA:B7GJA0"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJA0"
FT                   /protein_id="ACJ32522.1"
FT                   /translation="MRTYMAKPNEVERKWYVVDAEGKTLGRLASEVAAILRGKHKPTYT
FT                   PHVDTGDHVIIINAEKVELTGKKLTNKLYYRHSLHPGGLKVRTALEMRTNYPEQMLERA
FT                   IRGMLPKGSLGRQMFKKLHVYRGSEHPHQAQKPEVYELRG"
FT   gene            139166..139558
FT                   /gene="rpsI"
FT                   /locus_tag="Aflv_0139"
FT   CDS_pept        139166..139558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="Aflv_0139"
FT                   /product="Ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32523"
FT                   /db_xref="GOA:B7GJ32"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GJ32"
FT                   /protein_id="ACJ32523.1"
FT                   /translation="MAQVQYYGTGRRKSSVARVRLVPGEGRIIVNGRDIRDYVPYESLV
FT                   EVVKQPLVLTETFGSYDVLVNVSGGGFTGQAGAIRHGIARALLQVDPEYRQTLKRAGLL
FT                   TRDSRVKERKKYGLKGARRAPQFSKR"
FT   gene            139598..140050
FT                   /gene="ybaK"
FT                   /locus_tag="Aflv_0140"
FT   CDS_pept        139598..140050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaK"
FT                   /locus_tag="Aflv_0140"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32524"
FT                   /db_xref="InterPro:IPR019667"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ33"
FT                   /protein_id="ACJ32524.1"
FT                   /translation="MFLFFMQTICMRRDTKLGILTSFTAKKLEKQLTDERNALRDLSYR
FT                   ELWQRTRTYWKRYIVISECIETICIDVAIEAYLIGVHYSRFIYYGESTEAVRGRCIDEY
FT                   TQLLYELYEHMKKYGDDMYDACARYIDEWWKEGVEKGLRRQRLRLK"
FT   gene            140106..140804
FT                   /gene="cwlD"
FT                   /locus_tag="Aflv_0141"
FT   CDS_pept        140106..140804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cwlD"
FT                   /locus_tag="Aflv_0141"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32525"
FT                   /db_xref="GOA:B7GJ34"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR014234"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ34"
FT                   /protein_id="ACJ32525.1"
FT                   /translation="MKIRVVVVFIVFVLFLQFYVLHDRSWKAWSLPLSGKIIILDPGHG
FT                   GPDGGAVGGDVLEKEIALHVALKLRDYLQQQGALVQMTREGDHDLASEQTRGYSRRKIE
FT                   DLKRRVQFVNESEADFFISIHLNAIPSPKWRGAQVFYYPSLEENARLAKFIQQELRVNL
FT                   ENTHRLAKPIQTVYLLKTAKKPGALVEIGFLSNEEERKLLASSSYQEKLAASIYKGILR
FT                   YVSNERDPSE"
FT   gene            140884..141891
FT                   /gene="mrp"
FT                   /locus_tag="Aflv_0142"
FT   CDS_pept        140884..141891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrp"
FT                   /locus_tag="Aflv_0142"
FT                   /product="Mrp protein, an ATPase involved in chromosome
FT                   partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32526"
FT                   /db_xref="GOA:B7GJ35"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ35"
FT                   /protein_id="ACJ32526.1"
FT                   /translation="MLTEKQVVELLETIYDPFLKKTFKETGAIQEVKINEEKGLVSVKI
FT                   ALAKTGTAEQLQVQQTVVQRLKDAGASSVGLRFAQLPFEEERTTNEPIYLAIASGKGGV
FT                   GKSTVSVNLAVSLARLGKKVGLIDADIYGFSVPDMMGITERPVVRGEKIIPVERFGVKV
FT                   ISMGFFVEDNSPVIWRGPMLGKMLKNFFDEVEWGELDYLLLDLPPGTGDVALDVHTMLP
FT                   TSKEIIVTTPHPTAAFVAARAGAMAVRTNHEVVGVIENMSYFESKTTGEKEYIFGKGGG
FT                   QKLAEELQTDLLGQLPLGQPDWNDEDFAPSIYGEDHPIGKVYMDIAKKIIAKLR"
FT   gene            complement(141908..142510)
FT                   /gene="gerD"
FT                   /locus_tag="Aflv_0143"
FT   CDS_pept        complement(141908..142510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerD"
FT                   /locus_tag="Aflv_0143"
FT                   /product="Spore germination protein GerD"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32527"
FT                   /db_xref="InterPro:IPR041243"
FT                   /db_xref="InterPro:IPR041262"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJA1"
FT                   /protein_id="ACJ32527.1"
FT                   /translation="MMMNRTFLLLVFSYVLMMTGCAQQEKTPAQPDYDQTKKMVVDILK
FT                   TDEGKKAIQEVMSDEKVKQQLVMDQQIVKKTIEETLTSEKGKGFWKKAFEDPKFAQNFA
FT                   KSMQEEHEKLLKALMKDPEYQAMIVDIMQNPEMKKLIQTEMKNKDFRAHLQKVITETFN
FT                   SPLFKAKIEDILIKAAEEMQGDKKKSDQEGSSEDQTA"
FT   gene            142636..143232
FT                   /gene="kbaA"
FT                   /locus_tag="Aflv_0144"
FT   CDS_pept        142636..143232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kbaA"
FT                   /locus_tag="Aflv_0144"
FT                   /product="Integral membrane protein, activator of
FT                   sporulation histidine kinase KinB"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32528"
FT                   /db_xref="GOA:B7GIY2"
FT                   /db_xref="InterPro:IPR024164"
FT                   /db_xref="UniProtKB/TrEMBL:B7GIY2"
FT                   /protein_id="ACJ32528.1"
FT                   /translation="MNSRKWVQLFFSTLFVGGISTGIVGFVVKWNEYAHLFTSLEIKEI
FT                   LSVLVWLIGVGFIFSVISQMGFFAYLTIHRFGLGIFRSVGLWNAVQIVLIAFVLFDLVY
FT                   FRYQLFAKEGESIVSYVLVALLIFLFGLVVAYVKMRETNKEAFVPALFFMVVATVIEWF
FT                   PVLRINEENWLYLMLFPLLICNAYQLLTLHRLLRK"
FT   gene            complement(143249..144010)
FT                   /locus_tag="Aflv_0145"
FT   CDS_pept        complement(143249..144010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0145"
FT                   /product="Predicted xylanase/chitin deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32529"
FT                   /db_xref="GOA:B7GIY3"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR014132"
FT                   /db_xref="UniProtKB/TrEMBL:B7GIY3"
FT                   /protein_id="ACJ32529.1"
FT                   /translation="MKFFYILDGKEIKKWLLIISIAFVTASIFYIQQLASEFVFSTDPG
FT                   PKAIYKVENKNNELALTFDISWGETNAIPVLNVLKKHGVKATFFLSASWAERHPRIVKK
FT                   IADDGHEIGSMGYEYKNYTELERGKIIRDLAQAKKVFNTLGIKHTPFLRVPTGNFNKNV
FT                   LKVVHSFGHTVVHWSVDSKDWLNPGANAIVENVTKNAKGGDIVLLHASDSAKQTAHALE
FT                   QIIVWMKKEGYKSVTISDLVNNAHIKSKEIK"
FT   gene            144299..145822
FT                   /locus_tag="Aflv_R019"
FT   rRNA            144299..145822
FT                   /locus_tag="Aflv_R019"
FT                   /product="16S ribosomal RNA"
FT   gene            146298..149219
FT                   /locus_tag="Aflv_R020"
FT   rRNA            146298..149219
FT                   /locus_tag="Aflv_R020"
FT                   /product="23S ribosomal RNA"
FT   gene            149588..149701
FT                   /locus_tag="Aflv_R021"
FT   rRNA            149588..149701
FT                   /locus_tag="Aflv_R021"
FT                   /product="5S ribosomal RNA"
FT   gene            149868..149942
FT                   /gene="trnN"
FT                   /locus_tag="Aflv_R022"
FT                   /note="tRNA_Asn1"
FT   tRNA            149868..149942
FT                   /gene="trnN"
FT                   /locus_tag="Aflv_R022"
FT                   /product="tRNA-Asn"
FT   gene            149945..150017
FT                   /gene="trnT"
FT                   /locus_tag="Aflv_R023"
FT                   /note="tRNA_Thr1"
FT   tRNA            149945..150017
FT                   /gene="trnT"
FT                   /locus_tag="Aflv_R023"
FT                   /product="tRNA-Thr"
FT   gene            150033..150104
FT                   /gene="trnE"
FT                   /locus_tag="Aflv_R024"
FT                   /note="tRNA_Glu2"
FT   tRNA            150033..150104
FT                   /gene="trnE"
FT                   /locus_tag="Aflv_R024"
FT                   /product="tRNA-Glu"
FT   gene            150115..150190
FT                   /gene="trnV"
FT                   /locus_tag="Aflv_R025"
FT                   /note="tRNA_Val2"
FT   tRNA            150115..150190
FT                   /gene="trnV"
FT                   /locus_tag="Aflv_R025"
FT                   /product="tRNA-Val"
FT   gene            150250..150325
FT                   /gene="trnT"
FT                   /locus_tag="Aflv_R026"
FT                   /note="tRNA_Thr2"
FT   tRNA            150250..150325
FT                   /gene="trnT"
FT                   /locus_tag="Aflv_R026"
FT                   /product="tRNA-Thr"
FT   gene            150331..150415
FT                   /gene="trnY"
FT                   /locus_tag="Aflv_R027"
FT                   /note="tRNA_Tyr1"
FT   tRNA            150331..150415
FT                   /gene="trnY"
FT                   /locus_tag="Aflv_R027"
FT                   /product="tRNA-Tyr"
FT   gene            150433..150507
FT                   /gene="trnQ"
FT                   /locus_tag="Aflv_R028"
FT                   /note="tRNA_Gln1"
FT   tRNA            150433..150507
FT                   /gene="trnQ"
FT                   /locus_tag="Aflv_R028"
FT                   /product="tRNA-Gln"
FT   gene            150532..150604
FT                   /gene="trnK"
FT                   /locus_tag="Aflv_R029"
FT                   /note="tRNA_Lys1"
FT   tRNA            150532..150604
FT                   /gene="trnK"
FT                   /locus_tag="Aflv_R029"
FT                   /product="tRNA-Lys"
FT   gene            150611..150685
FT                   /gene="trnG"
FT                   /locus_tag="Aflv_R030"
FT                   /note="tRNA_Gly1"
FT   tRNA            150611..150685
FT                   /gene="trnG"
FT                   /locus_tag="Aflv_R030"
FT                   /product="tRNA-Gly"
FT   gene            150687..150759
FT                   /gene="trnA"
FT                   /locus_tag="Aflv_R031"
FT                   /note="tRNA_Ala4"
FT   tRNA            150687..150759
FT                   /gene="trnA"
FT                   /locus_tag="Aflv_R031"
FT                   /product="tRNA-Ala"
FT   gene            150895..151791
FT                   /gene="rocF"
FT                   /locus_tag="Aflv_0146"
FT   CDS_pept        150895..151791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rocF"
FT                   /locus_tag="Aflv_0146"
FT                   /product="Arginase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32530"
FT                   /db_xref="GOA:B7GIY4"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR014033"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:B7GIY4"
FT                   /protein_id="ACJ32530.1"
FT                   /translation="MNISIIGVPMDLGQTRRGVDMGPSAIRYAGVVERLENLNHDIEDL
FT                   GDIQIGRAERVQDVTNPKLRNLKAVAEANEKLAATVDDVVTRGRFPLVLGGDHSIAIGT
FT                   LAGVAKHYKNLGVIWYDAHGDLNTEETSPSGNIHGMPLAASLGLGHPALTMIGGYSPKV
FT                   KPENIVIIGARALDEGEKQLIKEKGIKIYTMHEVDRLGMTKVMEETIAYLKERTDGVHL
FT                   SLDLDGLDPHDAPGVGTPVIGGLSYRESHLAMEMLAEAQIITSAEFVEVNPILDERNKT
FT                   AATAVALMGSLFGEKLV"
FT   gene            151917..152480
FT                   /gene="sigW"
FT                   /locus_tag="Aflv_0147"
FT   CDS_pept        151917..152480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sigW"
FT                   /locus_tag="Aflv_0147"
FT                   /product="DNA-directed RNA polymerase specialized sigma
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32531"
FT                   /db_xref="GOA:B7GIY5"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014294"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:B7GIY5"
FT                   /protein_id="ACJ32531.1"
FT                   /translation="MDTFIRQRIKAVKKGDQSAFADIVEMYKDKIYQLCYRMLGNRHEA
FT                   EDAAQEAFIRAYVNIHTYDPTMKFSSWLYRIATNLSIDRMRKKKPDVYLDAEVSGTDGL
FT                   TMYSQLADEGASPEDELESLELQQMVQEAILKLPEKYRTVIVLKYIDELSLQEISDILN
FT                   LPIGTVKTRIHRGREALRKHLGHL"
FT   gene            152491..153114
FT                   /gene="rsiW"
FT                   /locus_tag="Aflv_0148"
FT   CDS_pept        152491..153114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsiW"
FT                   /locus_tag="Aflv_0148"
FT                   /product="Membrane-anchored regulator of SigW (anti-sigma
FT                   factor)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32532"
FT                   /db_xref="GOA:B7GIY6"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="UniProtKB/TrEMBL:B7GIY6"
FT                   /protein_id="ACJ32532.1"
FT                   /translation="MRQMPCSKQIVQWMHDYLDGDIPKEEEQQLRSHIQQCEACREHFY
FT                   ALEKTVAFVENVSHFTPSDDFIKKVMYNLPREKRRVRWKRWLTHHPFLTAASLFFLLST
FT                   SSLWAVWQEDNEFSFSKQEHLIVQNHTVIVPRGKVVEGDIVVRNGDIQIEGEVRGNVTV
FT                   INGHKYLASAGEVTGQIEEVNEVFDWIWYNVKRVGYNIAKTLTK"
FT   gene            153124..153999
FT                   /locus_tag="Aflv_0149"
FT   CDS_pept        153124..153999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0149"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32533"
FT                   /db_xref="GOA:B7GIY7"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR014046"
FT                   /db_xref="InterPro:IPR034701"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="UniProtKB/TrEMBL:B7GIY7"
FT                   /protein_id="ACJ32533.1"
FT                   /translation="MMAFLHVRAIRMSEGSVRMPFGELPTFVNYLIKFVDILVVWFVIY
FT                   KLIMVVRGTKAVQLLKGIIVIILVRIVSSFIGLSTLQWLMDQAITWGFLAIIIIFQPEL
FT                   RRALEQLGRGKLFSRSTTPEEEEQTHIIEAIVKATEYMAKRRIGALISIERETGMGDYI
FT                   ETGIPLHAHVSSELLINIFIPNTPLHDGAVIVQRNQIAAASCYLPLSESPFISKELGTR
FT                   HRAALGISEVTDSITVVVSEETGAISVTKNGELYRDLMLDVLRELLTKELIQPKTTSSS
FT                   RWQWRAKKSG"
FT   gene            153992..155224
FT                   /locus_tag="Aflv_0150"
FT   CDS_pept        153992..155224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0150"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32534"
FT                   /db_xref="GOA:B7GIY8"
FT                   /db_xref="InterPro:IPR012505"
FT                   /db_xref="UniProtKB/TrEMBL:B7GIY8"
FT                   /protein_id="ACJ32534.1"
FT                   /translation="MDKWMNSPWFIRIFSLLLALMIYVSVNIETQSNSTSRNTVGQSDV
FT                   ETVTDVPVVAYYDQENLVVSGIPQSVNVMLEGPKSIVTPTKLQRDFEVYVDLSKLSIGK
FT                   HTVPLKYRNISEKLRVTIDPATITVTIDERVSKDFPVEVDFINKSQIADGYSPEQPIVK
FT                   PNVVKVTGAKTLIDKVALVKARVDLKGVEETIERESKVTVYDKEGNVLPLDVEPSIVDI
FT                   TVPIKSPSKTVPLKIERKGTLREGLSIVKMEVIPSEVTIFGPKAKIDDIEFISGIEVDL
FT                   GDIIGNTTLQVDVPVPKGVKIVDPAKVTILIEVEQEKERTFYNVPIEIIGLNDAYKAEF
FT                   IDPADRNVTLTALGAQSLLNAIQLKDIKVYLNVSELGIGEHDVPIEVNGPQNVRWRLPQ
FT                   KEATIRITRNE"
FT   gene            155242..156585
FT                   /locus_tag="Aflv_0151"
FT   CDS_pept        155242..156585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0151"
FT                   /product="Phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32535"
FT                   /db_xref="GOA:B7GIY9"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GIY9"
FT                   /protein_id="ACJ32535.1"
FT                   /translation="MGKYFGTDGVRGIANSELTPELAFKIGRFGGYVLTKDKERPKVLI
FT                   GRDTRISGHMLEGALVAGLLSIGAEVMRLGVISTPGVAYLTKALGAQAGVMISASHNPV
FT                   QDNGIKFFGPDGFKLSDEQELEIEALLDSEQDTLPRPIGKDLGQVNDYFEGGQKYLQYL
FT                   KQTVDEDFSGIHVALDCAHGATSALATHLFADLDADVSTMGASPNGLNINDGVGSTHPE
FT                   ALAAFVKEKGADVGLAFDGDGDRLIAVDENGQIVDGDQIMYICAKYLNEQGRLKHQTVV
FT                   STVMSNLGFYKALEAQGIKSVQTAVGDRYVVEEMKKNGYNLGGEQSGHIIFLDYNTTGD
FT                   GLLTALQLVNIMKVTKKPLSELAGEMKKYPQKLVNVKVTDKQEAIANEEVQRVIREVEE
FT                   EMAGNGRILVRPSGTEPLVRVMAEAPTNELCDQYVERIAAVIRERFGA"
FT   gene            156745..156916
FT                   /locus_tag="Aflv_R032"
FT   ncRNA           156745..156916
FT                   /locus_tag="Aflv_R032"
FT                   /product="glmS_riboswitch"
FT                   /ncRNA_class="ribozyme"
FT   gene            156979..158781
FT                   /gene="glmS"
FT                   /locus_tag="Aflv_0152"
FT   CDS_pept        156979..158781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /locus_tag="Aflv_0152"
FT                   /product="L-glutamine-D-fructose-6-phosphate
FT                   amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32536"
FT                   /db_xref="GOA:B7GIZ0"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:B7GIZ0"
FT                   /protein_id="ACJ32536.1"
FT                   /translation="MCGIVGYVGEQPAKEILLYGLEKLEYRGYDSAGIALLNEKGVHVF
FT                   KEKGRIADLRAIVAEDVDAPLGIGHTRWATHGVPNRVNAHPHQSTSGRFTLVHNGVIEN
FT                   YELLKRDYLAHVSFTSDTDTEVIVQLIETFVNDGLTVEEAFRKTLLLLKGSYAIALIDA
FT                   ENDSVIYAAKNKSPLLAGLGEGFNVVASDALAMLQVTNQYVELMDKEIVIVTKESVTIK
FT                   KLNGEVVERAPYVAELDASDIEKGTYPYYMLKEIDEQPLVIRRLIEKYRNEQGELAIDE
FT                   NIVQAVKEADRLYIVACGTSYHAGLVGKQLIENWAKIPVEVHIASEFSYNMPLLSEKPL
FT                   FIYISQSGETADSRAVLVRTKELGHPSLTITNVPGSTLSREADYTLLLHAGPEIAVAST
FT                   KAYTAQIAVLAMLAAVAAKAKGIKLDIDVTKELGIVANAMETLCDAKHEMEQIAREYLA
FT                   TTRNCFFIGRAVDYYVVLEGALKLKEISYIQAEGFAGGELKHGTIALIENGTPVIALAT
FT                   QEHVNLSIRGNVKEVVARGANPCIISMKGLDMEDDRFVIPAVHPMLTPLASVVPLQLIA
FT                   YYAALHRGCDVDKPRNLAKSVTVE"
FT   gene            complement(159266..159961)
FT                   /locus_tag="Aflv_0153"
FT   CDS_pept        complement(159266..159961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0153"
FT                   /product="Uncharacterized transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32537"
FT                   /db_xref="GOA:B7GIZ1"
FT                   /db_xref="InterPro:IPR007404"
FT                   /db_xref="UniProtKB/TrEMBL:B7GIZ1"
FT                   /protein_id="ACJ32537.1"
FT                   /translation="MGVNLVLATLPHILVGSIIAIFTLVKDNDFFKKKLFILLFSSLVV
FT                   ISPDILKIMGILSSHSLWLVPILGLIFSFIYVQLNNDNKLSKVWLVFSLIILFGHLLLD
FT                   FIDNGVELFYPFIKDDFDYTLINKIDLLFIVILITSFTLLFFYKKKTIIVITSLSIIGL
FT                   YLGALIFSKMHLEYTLKKEFKDQDIVLLITYPDHHFNWEFQVRTKRSIVTGKSPMNKTN
FT                   IKIETRTEF"
FT   gene            160177..160737
FT                   /locus_tag="Aflv_0154"
FT   CDS_pept        160177..160737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0154"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32538"
FT                   /db_xref="GOA:B7GIZ2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025959"
FT                   /db_xref="UniProtKB/TrEMBL:B7GIZ2"
FT                   /protein_id="ACJ32538.1"
FT                   /translation="MKRLKITNDHGWTPRKLRKQERKIKDASLRVRVTAVRLVMEGHLG
FT                   KDVAKMINLCRQSVALYVARFNEGGLDHLLDRRLPPGRVPFLTEEQQQELRQLVLTTTP
FT                   VDVGWGISSSWNTRILQSYIQQTYGVSMSREGIRKLLHRLRLSWTRPTYKLVKGDPTLQ
FT                   AAFQKELELIKKNESLGKWFCFM"
FT   gene            160719..161237
FT                   /locus_tag="Aflv_0155"
FT   CDS_pept        160719..161237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0155"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32539"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:B7GIZ3"
FT                   /protein_id="ACJ32539.1"
FT                   /translation="MVLLHVDETHVRAYQALRTTWAEAGNQKQVPSYGHHAHVSIFGAV
FT                   DVQQGDVVFHRASSANADTFLDFLRLLKEKYPDRFIVLVLDNARIHHAKMVQAFLDCEE
FT                   GGAFHFIFLPPYSPHLNPIERLWKWLKDEVIANVLHKDQNDIAQSITRFEQYVLQHPDE
FT                   VLRRIGCAA"
FT   gene            complement(162461..162979)
FT                   /locus_tag="Aflv_0156"
FT   CDS_pept        complement(162461..162979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0156"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32540"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:B7GIZ4"
FT                   /protein_id="ACJ32540.1"
FT                   /translation="MVLLSVDETHVRAYQALRTTWAEVGNQKQVPSYGHHAHVSIFGAV
FT                   DVQQGDVVFHRASSANAETFLDFLCLLKEKYADRFIVLVLDNARIHHANMVQAFLQREE
FT                   GGAFHFIFLPPYSPHLNPIERLWKWLKDDVIANVLHKDQNDIAQSIARFEQYVLQHPEE
FT                   VLRRIGCAA"
FT   gene            complement(162991..163545)
FT                   /locus_tag="Aflv_0157"
FT   CDS_pept        complement(162991..163545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0157"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32541"
FT                   /db_xref="GOA:B7GIZ5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025959"
FT                   /db_xref="UniProtKB/TrEMBL:B7GIZ5"
FT                   /protein_id="ACJ32541.1"
FT                   /translation="MYKRSGNDMKRLKITNDHGWTPRTLRKQERKIKDASLRARVTAVR
FT                   LVMEGYLGKDVAKMVNLCRQSVALYVSRFNEGGLDRLLDRRLPPGRMPFLTEEQQQEIR
FT                   QLVLTTTPVEVGWGIASSWNTRLLQSYIQQTYGVSMSREGIRKLLHRLRLSWTRPTYKL
FT                   VKGDPVLQAAFEKELELIKKN"
FT   gene            complement(163824..164435)
FT                   /locus_tag="Aflv_0158"
FT   CDS_pept        complement(163824..164435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0158"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32542"
FT                   /db_xref="GOA:B7GIZ6"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR004552"
FT                   /db_xref="UniProtKB/TrEMBL:B7GIZ6"
FT                   /protein_id="ACJ32542.1"
FT                   /translation="MRKMMYHIVAKILYFIIKLFRLLEVRGKENIPKNKNYVVTCSHRG
FT                   WVDVIMLAMSLYPTQVHYMAKKELFNSRLIGTFLKYLNAFPVNRQNPGPSTLKIPMKLL
FT                   KENKIVGIFPSGTRTNEEVPLKRGAVTIAIKANVPILPASYHGPTNLKEILIGKKATVI
FT                   LGEPLYFDKQKEEMDKDELLSYSLKLLENKMKNLEKTFIK"
FT   gene            complement(165113..166582)
FT                   /locus_tag="Aflv_0159"
FT   CDS_pept        complement(165113..166582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0159"
FT                   /product="Transposase IS66 family"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32543"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="UniProtKB/TrEMBL:B7GIZ7"
FT                   /protein_id="ACJ32543.1"
FT                   /translation="MIDKEVNRMLTVQQAVFTVESLISKVQQQKQLIHQLVQENEHLRH
FT                   EIKQLRKENEQLKYRVQELEARTKKNSSNSHLPPSSDRFHTLSSRQPSGNKPGGQEGHQ
FT                   GTTLRQVEHPHHRVVHRVHACQGCGASLREIKPFKVDIRQVFDLPPVTIEVTQHEREVK
FT                   SCPHCRCVQQAEFPSHVTNHVQYGPRLTALVVYLHHIQLIPYKRLSDTIEALYQHSVST
FT                   GTLANMVKRGREALESNMDMIEDALLESNILHVDETSLRINGKLAWVHVACTSRYTYLA
FT                   PHASRGKKATDDIGILPRYQGTMMHDAFGTYPKYTQATHALCHAHHLRELKGFIEQGHA
FT                   WASRMTTFLLAAKQAVEAHHGVLSEEEARRWERVYDRILAKAQQRLETMTPLPKKALAF
FT                   VRRLQKRKEEALRFLREAHVPFDNNQAERDLRMVKVKENISGTFREETFAQSFCITRSI
FT                   VSTLTKHEKNVWDSLYLLLTGETLDRVLSTT"
FT   gene            167235..167588
FT                   /gene="acpS"
FT                   /locus_tag="Aflv_0160"
FT   CDS_pept        167235..167588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpS"
FT                   /locus_tag="Aflv_0160"
FT                   /product="Holo-acyl carrier protein
FT                   synthase:Phosphopantethiene-protein transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32544"
FT                   /db_xref="GOA:B7GIZ8"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:B7GIZ8"
FT                   /protein_id="ACJ32544.1"
FT                   /translation="MIMGIGIDITELERWHDNKVSRKVFTHSELQWCKGEPDKYAIIWS
FT                   IKEAVVKALGTGFRNNITWRDIEVINYQNNYLVKLSENVMNTFKINYNRDVFWVNVTKT
FT                   NDMVLAQVIWERY"
FT   gene            170092..170736
FT                   /locus_tag="Aflv_0161"
FT   CDS_pept        170092..170736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0161"
FT                   /product="Cell wall-associated Rhs family protein
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32545"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="UniProtKB/TrEMBL:B7GIZ9"
FT                   /protein_id="ACJ32545.1"
FT                   /translation="MLSVSENAAVAGQPLGYAGYYYDRETKLYYLQARYYDPETARFIS
FT                   RDRDPGDKDNPITQNAYTYANDNPVMLVDPDGNRGLTTLYRTVAGALTYVIVSGAVAKS
FT                   LVKKAVGKVAKKVLRKGTGKVTKGGLNLTKTTAKHMDNPDRRVPVQILQQAIKGKGYKD
FT                   PRGSNARMYYTIMYRNGKKYNLEVLYDKKTNTILHFEYARKAMGPLKAIPK"
FT   gene            170751..171035
FT                   /locus_tag="Aflv_0162"
FT   CDS_pept        170751..171035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0162"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32546"
FT                   /db_xref="GOA:B7GJ00"
FT                   /db_xref="InterPro:IPR015287"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ00"
FT                   /protein_id="ACJ32546.1"
FT                   /translation="MDIDYSKKLYQLIQDYLNKQIDTETFSNDFTVIYNLHVDYDSLST
FT                   KELKLFGELSEITSRFSPFEEDLKKYNCYFNANDVEKKAKEVLKELSKN"
FT   gene            171742..173187
FT                   /locus_tag="Aflv_0163"
FT   CDS_pept        171742..173187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0163"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32547"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ01"
FT                   /protein_id="ACJ32547.1"
FT                   /translation="MKNDFVKDKIVFLLYYFRETKWIRRYSAMYFSFSKLDLQKKRQAY
FT                   KTMYDRNHLLVKIDKVMDWNYVYSLLKPFYSENTGRPSIDPLVFVKILIIQYVEGFRSV
FT                   RFTCKQIQQHITYRWFLGLSMDDSVPCHSSVSKFLRHRVDPTVWEALFDHVLLQIQKEG
FT                   FLSPETWAADETELKANANKRKRVKVVQTVIEKEDEDVLQLLNEKRLQHGKKPLPPKPP
FT                   KEVEKEIICSTTDPDAGLSVKHDPRGLFAFHDHRIVETMHNFILDAHVTSANVLGHRVL
FT                   MERIERVEQRIGYVPEEIALDAGYYNARLGRELENKGIGAYVSYRRFHRKEHPNCRSIH
FT                   FRLVEEDVYVCPCGVKFTYSTSTRAGYHEYKPSVKGSCTGCPAARGKGDRVLRISVHQE
FT                   VYEQMRKRRLSLRGKVLRLVRPATIERSFAESKELHGLRFARYRGVQYVQIQVWITAMI
FT                   QNLKKWIKLRSLQSQGIDLTYHT"
FT   gene            173533..175209
FT                   /locus_tag="Aflv_0164"
FT   CDS_pept        173533..175209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0164"
FT                   /product="Predicted transcriptional regulator containing an
FT                   HTH domain and diverged ATP-binding domain (Schlafen-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32548"
FT                   /db_xref="GOA:B7GJ02"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR025831"
FT                   /db_xref="InterPro:IPR038461"
FT                   /db_xref="InterPro:IPR038475"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ02"
FT                   /protein_id="ACJ32548.1"
FT                   /translation="MTILNEIELKKLLDEFRSLPSENEWVEFKEAKSNFHFDDLGEYFS
FT                   ALSNEANLKNQPYGWLIFGVKDKNKEIVGTQYRENRADLDRLKYEISRHTNDGLSFVEI
FT                   YELFYPEGRVIMFQIPAAPKGMPTSWKGHYFGRNGDSKGPLSIQEIESIRNQRMKEDWS
FT                   AGICPGATIDDLDKTAIEKAREEYKKKNPRLAEDVDKWDDITFLNKARVTINGQITRAA
FT                   IILLGKPESEHFLAPAVAKMTWILKDEHNIERDYEHFGPPFILNTNELFAKIRNLKYRY
FT                   MPDQSLFPIEVNQYDPYVIREALHNCIAHQDYTLQGRINVVEKPEELIFTNLGEFIPKT
FT                   IENVIERDAPQEYYRNRFLAEAMVNLNMIDTIGSGIKKMFLEQRKRFFPMPDYDLSEPN
FT                   KVKVTIYGKILDYNYTRMLINHTDLDLSVVIALDKVQKKQRITQEEAKKLRALKLVEGR
FT                   YPNLYVSAKIAELTGDKTTYIKNRAFNKEHYKQMIISFLRQYKVASRKDIDDLLLDKLS
FT                   DALDEKQKRKYIGNLLQEMSKKDKTIVNKGSTRYPKWVLTN"
FT   gene            176376..176654
FT                   /locus_tag="Aflv_0165"
FT   CDS_pept        176376..176654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0165"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32549"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ03"
FT                   /protein_id="ACJ32549.1"
FT                   /translation="MKRLKITNDHGWTPRTLRKQERKIKDASLRVRVTAVRLVMEGHLS
FT                   KDVAKMVNLCRQSVALYVSCFNEGGLDQFGSLTDGSKLLSCFRHTFP"
FT   gene            176869..177177
FT                   /gene="mazE"
FT                   /locus_tag="Aflv_0166"
FT   CDS_pept        176869..177177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mazE"
FT                   /locus_tag="Aflv_0166"
FT                   /product="Toxin-antiotoxin addiction module antitoxin
FT                   component MazE"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32550"
FT                   /db_xref="GOA:B7GJ04"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR039052"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ04"
FT                   /protein_id="ACJ32550.1"
FT                   /translation="MDSKEHLESNINRNKGGDYMATVVAQKWGNSLGIRIPKDVADKIG
FT                   IKQGSEMELNVIGNEGIITLKPKRTRKKYTLEELISQITPENRHEEIDFGIEGRELI"
FT   gene            177177..177563
FT                   /gene="mazF"
FT                   /locus_tag="Aflv_0167"
FT   CDS_pept        177177..177563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mazF"
FT                   /locus_tag="Aflv_0167"
FT                   /product="Toxin-antitoxin addiction module toxin component
FT                   MazF (an endoRNAse)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32551"
FT                   /db_xref="GOA:B7GJ05"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ05"
FT                   /protein_id="ACJ32551.1"
FT                   /translation="MPVDVPGRGDFIVINFDPQAGHEQAGRRNAIVLSPKEFNQATGFI
FT                   AVCPITNQKKGYPFEVELPKKGIVLDGDGYPITGVILTDQIKSLDWKARNLKILKKYNP
FT                   EDAQIEEIDKIIDECLAKIETYLT"
FT   gene            178336..178728
FT                   /locus_tag="Aflv_0168"
FT   CDS_pept        178336..178728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0168"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32552"
FT                   /db_xref="GOA:B7GJ06"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ06"
FT                   /protein_id="ACJ32552.1"
FT                   /translation="MRIDKMKARKEAKGMLKKIGLLVAGGMAVLVLMFHLGPLVGLAIS
FT                   LAILYYAVKKFFKADSAFGKIVWALIGLAALMVSVSNVPALVAIVAAYVLYVVYKKWNE
FT                   PQEVVQVVDDPFVNFEKQWAELQKHY"
FT   gene            178701..179366
FT                   /gene="pspA"
FT                   /locus_tag="Aflv_0169"
FT   CDS_pept        178701..179366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pspA"
FT                   /locus_tag="Aflv_0169"
FT                   /product="Phage shock protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32553"
FT                   /db_xref="InterPro:IPR007157"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ07"
FT                   /protein_id="ACJ32553.1"
FT                   /translation="MGGATKTLLKERRTMGLLSRMKTMIAADIHEWLDEKEKKNPIAVL
FT                   NEYLRQCEQEVEKVRKLLERQYLLKEQFTREYREAMQLAEKRKKQADIASKAGESELFA
FT                   FASHEQMQYEERAARLKQLLDQTNEQLLELEKKYEQMKHQLKDMHMRRMELMGRENIAR
FT                   AHYRMNRVLDGYTSPTLTTFADTESYLARLEQQVQSDYYRHTIDARIAELEKRLQQEQ"
FT   gene            179970..180746
FT                   /locus_tag="Aflv_0170"
FT   CDS_pept        179970..180746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0170"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32554"
FT                   /db_xref="GOA:B7GJ08"
FT                   /db_xref="InterPro:IPR016975"
FT                   /db_xref="InterPro:IPR024425"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ08"
FT                   /protein_id="ACJ32554.1"
FT                   /translation="MLRLVRFIELSLKGGCPMDQQKTTDYVSWVVLLALMILALEIAFF
FT                   HPGIIFSVLFSAGFIYIGRKKWYRKLGKIAFWLGCIGLVVHVFTMVTFRFLLVALLFYA
FT                   IIQFAQSKRHPIVIRPERTTTFAETEGGFRQPLFQNMLFGRQKTPEHAYEWSDVNIQTG
FT                   IGDTVIDLSYAVVPKGEAVVVVRGWIGNVHIFVPYEMEVSVVHSVLFGAASIFSKETER
FT                   LWNQTFIYETSAYETAEQKLKIITSMAIGNVEVKRI"
FT   gene            180743..181750
FT                   /gene="yvqE"
FT                   /locus_tag="Aflv_0171"
FT   CDS_pept        180743..181750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yvqE"
FT                   /locus_tag="Aflv_0171"
FT                   /product="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32555"
FT                   /db_xref="GOA:B7GJ09"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR017202"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ09"
FT                   /protein_id="ACJ32555.1"
FT                   /translation="MNRHIVGGLLLALTVTVILFLSYALTFPPAKWLALWNETVLGVPF
FT                   IVFLFMASSLIGMLFGAVFDWFWRKQWRAIEHALFQIEQGSTELSPQHTAKELDDVWQR
FT                   IEKLQKHWLEQTKRTQKLATEKAEQEEELIERIISEERNRLARELHDSVSQQLFAASMM
FT                   MSALMETYIGSEQAKKQLKLVEQMIHQSQLEMRALLLHLRPVQLKGKSLQDGMRELLTE
FT                   LAQKVPMEIKWKIEDVTLDRGVEDHLFRILQESVSNTLRHAKATMLEVLLLERDGFVLL
FT                   RVSDDGVGFDVERTKSGSYGLQNMYERAAEIGGTLKVVSVKNKGTRLEVKVPLV"
FT   gene            181763..182389
FT                   /gene="yvqC"
FT                   /locus_tag="Aflv_0172"
FT   CDS_pept        181763..182389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yvqC"
FT                   /locus_tag="Aflv_0172"
FT                   /product="DNA-binding response regulator, NarL family
FT                   (REC-HTH domains)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32556"
FT                   /db_xref="GOA:B7GJ10"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ10"
FT                   /protein_id="ACJ32556.1"
FT                   /translation="MIKVLLVDDHEMVRLGVSAYLSAQPDMEVIGEAESGEKGVELALQ
FT                   LRPDMILMDLVMEPMDGIEATKQIISAWPEAKIMIVTSFLDDDKVYPAIEAGAVSYMLK
FT                   TSKASEIANAIRATFHGQSVFEPEVTGKMMNSMRKPSLPHEQLTSREMEVLLLIAQGKT
FT                   NQEIAEELFISLKTVKVHVSNILAKLDVQDRTQAVIYAFKHGLVK"
FT   gene            182447..183241
FT                   /gene="mta"
FT                   /locus_tag="Aflv_0173"
FT   CDS_pept        182447..183241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mta"
FT                   /locus_tag="Aflv_0173"
FT                   /product="Transcriptional regulator (MerR family)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32557"
FT                   /db_xref="GOA:B7GJ11"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012925"
FT                   /db_xref="InterPro:IPR036244"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ11"
FT                   /protein_id="ACJ32557.1"
FT                   /translation="MFIVKLSGGERVEYTVQQLAKLAGITSRTLRYYDEIGLLKPARVN
FT                   DSGYRIYGPKEVDRLQQILFYRELGVDLETIKQMITSLSFDDVQALKQHREKLLAERRR
FT                   LEALIANVEKTILAKEGRIIMSDKEKFEAFKQQLIDENERKYGKEIREKYGEGQVNKSN
FT                   EKIKNMTQAQYEEATKLGEEVLRVLHEAFLTGDPAGELAQKAADLHRQWLSYFWNHYSK
FT                   EAHAGLAQMYVDDERFKAYYDQQQSGMAEFLREAIFIYTGKK"
FT   gene            183324..184379
FT                   /locus_tag="Aflv_0174"
FT   CDS_pept        183324..184379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0174"
FT                   /product="Thioredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32558"
FT                   /db_xref="GOA:B7GJ12"
FT                   /db_xref="InterPro:IPR022890"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ12"
FT                   /protein_id="ACJ32558.1"
FT                   /translation="MITMEQQLYDVTIIGGGPAGLYATFYSGLREMKTKLIEYQSQLGG
FT                   KLHVYPEKMIWDVGGHAPITGEKLREQLVKQALTFHPTIVLNEKVETIRRREDGIFILQ
FT                   TSSGQRHISKTIIIAVGSGILKPQKLQIEGAEKFEITNLHYTVKSLKQFKEKTVIISGG
FT                   GNTAIDWANELVPIAKKVYVTYRNESLKGHEAQVTQLLNSSAICFFHTSITKLVASPNH
FT                   EMIERVVLTNHETGDVFELDVDDVIISHGYERDASLLTNSELPIQMIDEYYIATNAKGE
FT                   CSVPGLYAAGDISKYDGKLYLLTGAFQDAANAVNSAKRFIEPTADPYGMVSSHHEAFKE
FT                   RNRELVKQMLK"
FT   gene            184434..185147
FT                   /locus_tag="Aflv_0175"
FT   CDS_pept        184434..185147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0175"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32559"
FT                   /db_xref="InterPro:IPR021729"
FT                   /db_xref="InterPro:IPR025303"
FT                   /db_xref="InterPro:IPR037126"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ13"
FT                   /protein_id="ACJ32559.1"
FT                   /translation="MNILLKQRNIWLMVLTLFILTAYSQPLTVTTKKMKYTNELMEVDL
FT                   NIPIVSGSVNPSFQRQVNRLLRKESLDLKREVEKQAHENMAISKKEGFPYRLHAAVSNY
FT                   EVTYNQHGILSIPVTLYSYTGGAHGMTVKVPNNFDFHTGKSLQLSDLFKKGTNYKQVIK
FT                   DEIIAQIKKENDLYFDNAIAVVQKMPDDQPYYMTKDGIVVYYGLYEIAPYAAGIREFLI
FT                   PYSTLRPHMKTKLAR"
FT   gene            complement(185169..186788)
FT                   /gene="cstA"
FT                   /locus_tag="Aflv_0176"
FT   CDS_pept        complement(185169..186788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cstA"
FT                   /locus_tag="Aflv_0176"
FT                   /product="Carbon starvation membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32560"
FT                   /db_xref="GOA:B7GJ14"
FT                   /db_xref="InterPro:IPR003706"
FT                   /db_xref="InterPro:IPR025299"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ14"
FT                   /protein_id="ACJ32560.1"
FT                   /translation="MNLLTLLLVCGVILVIAYFTYGRFLEKQLRVDHNRKTPAHEMYDG
FT                   IDYVPAKKPVLLGHHFATIAGGGPIVGPITAAVFGWLPAVLWIMIGGIFIGGVHDYTSL
FT                   QASIRHKAQSIGTIIKQYMGNRGQVLFLTFSIATLMLVVGVFIILVANTFVAVPQAATA
FT                   SALFLGIAIIFGFFVNQMRMNLFVASVLGVIAMLLSVWAGIQYPLSLSATTWSLILLGY
FT                   AYAASVLPVWFLLQPRDYLNSFLLYGMIAGAAVGMIIAAPTIQFPAFTGFYHEKLGFLF
FT                   PILFITIACGAISGFHSLVSSGTTAKQLDNEKNGKFIAYGGMLLEAFLAIISIGTVAYL
FT                   TQADFTTRMSELGGPIGTFSAGVGYFMSHVGIPEATAVTFTALTASAFLLTTLDSATRL
FT                   MRYAIQELGEERTNAFKNNHIATTVGLIGAGALALSGTWQSVWPLFGAANQMLGALALL
FT                   AVSAWLMKIGAKSFYVVIPMAFMLVVTIAALCVLMYQNALAQNWLLAGSSFVLFVLCIF
FT                   LAIEGWSAMTKTTKKEVISSHQ"
FT   gene            complement(186785..187360)
FT                   /locus_tag="Aflv_0177"
FT   CDS_pept        complement(186785..187360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0177"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32561"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ15"
FT                   /protein_id="ACJ32561.1"
FT                   /translation="MKCFTYLSIIIFRKFKKVATMNTNKYVHTLSTILTPYFNIYRDEK
FT                   LGAFSLPFYAHYHRRDEKYFMTKKSKIWAVENEQFIFVWQKNDIVTKRDVIQFSEAFIN
FT                   HVPNYISNHQDHMSTVFIGAIVAPHACDEAIREVKHFRKLKFIRFGLHGWLECYIAIIS
FT                   LDTKQLFTHRKARSFTHVFEKPFEEDVR"
FT   gene            187464..188099
FT                   /locus_tag="Aflv_0178"
FT   CDS_pept        187464..188099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0178"
FT                   /product="Transcriptional regulator, TetR/AcrR family"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32562"
FT                   /db_xref="GOA:B7GJ16"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ16"
FT                   /protein_id="ACJ32562.1"
FT                   /translation="MVEKQLKDRIIETALTLFEKYGYHGVTVDRIVAECGASKGGFYHN
FT                   FKSKDELLYHIHDVFITYVLNKAQEAYVKYKTPTKRLCAIIQSFVKVFHIYKPHITVFN
FT                   QEVAYLKPEYAEKINAKREQYKQIIFQVLREGVEAKQFRSELSIELAGLSIIGMVNWMY
FT                   KWYKPNGPMSIEQIAAAFNDLILHSLLTEEAKRDEDISSLLLSHVGDK"
FT   gene            188198..189340
FT                   /locus_tag="Aflv_0179"
FT   CDS_pept        188198..189340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0179"
FT                   /product="Acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32563"
FT                   /db_xref="GOA:B7GJ17"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ17"
FT                   /protein_id="ACJ32563.1"
FT                   /translation="MHFELTKEQQMIKEMVRDFAEKEIAPYASKWDEEAIFPIDTFKKM
FT                   GELGLFGIPFPEQYGGSGGDTISYAIAVEEIGRACGGTGLSYAAAVSLGASPIYYFGTE
FT                   EQKEKWLVPMAKGEAFGSFGLTEPNAGSDAGGTQTRAVLDGDEYVINGEKCWITNAGYA
FT                   RQVIVTAVTGKDERGKNIISAFIVPTDAPGFTINCHYDKMGVRASNTCELVLQDVRVPK
FT                   ENILGDPKKGFKQFLYTLDGGRISIAALAVGIAQAAFEKALQYAKERKQFGQPIAKFQA
FT                   IQFKLADMAMQLELARNMVYKAAWLKDQGKPFTKEAAFAKLFASETGFHICNQAIQIHG
FT                   GYGYMKEYGVERHLRDMKLMEIGEGTSEIQRLVIARQLGC"
FT   gene            189353..190993
FT                   /locus_tag="Aflv_0180"
FT   CDS_pept        189353..190993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0180"
FT                   /product="Acyl-CoA synthetase/AMP-acid ligase II"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32564"
FT                   /db_xref="GOA:B7GJ18"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ18"
FT                   /protein_id="ACJ32564.1"
FT                   /translation="MLHTTVGQLLEQKALMHPDHEAVVYADRQLRWSYRQFNDYCRLVA
FT                   KGLMKLGIEAGEHMAIWATNKPEWLACQFATGKMGAVLVTVNTNYRTAELEYLLKQSDA
FT                   TTIILMEQYRDASYIDMIYEIAPELAYCEPGKLQAKRLPQLRNVIVLSEQRYPGTFSWH
FT                   DLLAMAEYVEDAALDARMNSLDPHDVINMQYTSGTTGFPKGVMLTHYNIVNNAYYIAEC
FT                   MKLTKEDRLCIPVPFFHCFGCVLGTLACVTVGATMVPLEQFHPKQVLQTVQDEKCTALH
FT                   GVPTMFIAELNDPDFASYDLSSLRTGIMAGSNCPIEVMKAVIEKMGAKEITIAYGQTES
FT                   SPVITQTRTDDPIELRVETVGRALPHVEVKIVDPVTNQEVPPGVQGELCTRGYHVMKGY
FT                   YNNPSATQEAIDEEGWLHTGDLAVMDENGYCRITGRLKDMIIRGGENIYPREIEEFLYK
FT                   HPKVLDVQVVGVPDETYGEEVMAWIILKEGEHATPEDIRSFCEGHISRHKIPRYIEFTT
FT                   AYPMTASGKIQKFKLREWARERVEQKKHV"
FT   gene            190954..192366
FT                   /locus_tag="Aflv_0181"
FT   CDS_pept        190954..192366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0181"
FT                   /product="Biotin carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32565"
FT                   /db_xref="GOA:B7GJ19"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ19"
FT                   /protein_id="ACJ32565.1"
FT                   /translation="MGAGASRTKKACVRGKNMFSKILIANRGEIALRIIRTCQKLGIQT
FT                   VAIYSEADANSLHVKQADEAYIVGKARVNESYLNIEKIISIAKETKAEAIHPGYGLLSE
FT                   NATFARRCEEEGIVFIGPQPDVIAKMGSKIEARQTMAEAGVPIVPGISFPLADVDEAAN
FT                   VANGIGYPVMLKASAGGGGIGMQLVYDEEQLRKAFEGNQSRAASFFGDGAMYVEKYIDN
FT                   PRHIEIQLLADAHGNCVYLWERECSIQRRHQKVVEEAPSPFLDEETRRKMGEAAVRAAK
FT                   HIGYTNAGTIEFLVDEQKNFYFLEMNTRLQVEHPVTEEITGIDIVEQQLRIAAGEKLSF
FT                   TQAEVKREGHAIEVRIYAEDPNTFFPSPGTITRLQLPEGEHIRHEIAVQSGSVVTPFYD
FT                   PMIAKCIAKGSDRQAAIATMIEALHEYKIEGIKTNIPMLTAVLTHEAFQQGHTTTNFVN
FT                   MYMNKKGGKTHA"
FT   gene            192359..192571
FT                   /locus_tag="Aflv_0182"
FT   CDS_pept        192359..192571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0182"
FT                   /product="Biotin carboxyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32566"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ20"
FT                   /protein_id="ACJ32566.1"
FT                   /translation="MHEVVALMAGNVWKIVVQVGDVVEEGQDVVILESMKMEIPIATEA
FT                   GGVVKAIHVQEGDFVNEGDVLIEIE"
FT   gene            192582..193472
FT                   /locus_tag="Aflv_0183"
FT   CDS_pept        192582..193472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0183"
FT                   /product="Hydroxymethylglutaryl-CoA lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32567"
FT                   /db_xref="GOA:B7GJ21"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ21"
FT                   /protein_id="ACJ32567.1"
FT                   /translation="MRVTVKEVGPRDGLQNEPIFIQTEDKITWINQLSKTGLSYIEVTS
FT                   FVHPKWIPQLADAYEVASRIERVEGVTYAALVPNKKGLEGALAANMDEVAVFMSASETH
FT                   NRKNINKSIDETFPILKEVIDEAKRANKTVRGYVSTVFGCPYEGTVSIERVISVSERLF
FT                   ELGIDELSLGDTIGVANPVQVQRALEQLLKRFSAEKMALHFHNTYGMALANVFASLQMG
FT                   MTTFDSSLGGLGGCPYAPGASGNLATDDLVYMLAQMGIDCGVQLEPLTEAARWIEEKIG
FT                   RPLTSHHSHVVRRNA"
FT   gene            193469..194254
FT                   /locus_tag="Aflv_0184"
FT   CDS_pept        193469..194254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0184"
FT                   /product="Enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32568"
FT                   /db_xref="GOA:B7GJ22"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ22"
FT                   /protein_id="ACJ32568.1"
FT                   /translation="MMMEAVLYSTIDAGVAVVTLNRPDAANALSVKMLNELQRIQAELK
FT                   LNRNVRAVIVTGAGHKTFCAGADLKERAKMNETQVRQTVALIRETINGFEQLPQPVICA
FT                   LNGGAFGGGLELALACDIRIAAEHAIMGLTETSLGIIPGAGGTQRLPRLIGTGRAKEMI
FT                   YTAKRISAQEAERIGLVERVVPIEQLLDEALTIATTIANNAPIAVAQAKAAINHGIQVD
FT                   IQTGLVIEQMAYERTIHTNDRREGLQAFKEKRKPVYKGE"
FT   gene            194260..195807
FT                   /locus_tag="Aflv_0185"
FT   CDS_pept        194260..195807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0185"
FT                   /product="Acetyl-CoA carboxylase, carboxyltransferase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32569"
FT                   /db_xref="GOA:B7GJ23"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ23"
FT                   /protein_id="ACJ32569.1"
FT                   /translation="MISNEQLSLVEQLQQKRKQIEQGGARKYHEKNAEQGKLFVRDRLK
FT                   LLFDDGLQFEDAFFANCLADGLPADGVVTGVGKINGQTVCVMANDSTVKAGSWGARTVE
FT                   KMIRIQETAEKLRCPILYLVDSAGARITDQIEMFPGRRGAGRIFYNQVKLSGKVPQICL
FT                   LFGPSAAGGAYIPAFCDIVIMVEGNASMYLGSPRMAEMVIGEKVTLEEMGGARMHCSVS
FT                   GCGDVLVKTEEEAIAFARKYLSYFPANFSEKPPVVEPKEPKSFQKTIEEIIPKNQNAPF
FT                   NMYDLIDRIIDEGSFCEIKKLFAPELITGLARINGQSVGIIANQPRMKGGVLFHDSADK
FT                   AAKFITLCDAFHIPLIFLADIPGFMIGTKVERAGIIRHGAKMISAMSEATVPKISIIVR
FT                   KAYGAGLYAMAGPAFEPDCCLAFPHAQIAVMGPEAAVNAVYANKIAELPEEERAAFIEQ
FT                   KREEYRKDIDIYRLASEMVIDGVIAPNELRSELIRRLDAYMSKYVVFSERKHGVYPV"
FT   gene            195984..196652
FT                   /locus_tag="Aflv_0186"
FT   CDS_pept        195984..196652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0186"
FT                   /product="Polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32570"
FT                   /db_xref="GOA:B7GJ24"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ24"
FT                   /protein_id="ACJ32570.1"
FT                   /translation="MIYIWLIALFFIYSILPTLFIRMFSFRVQKKVKSGVALTFDDGPD
FT                   PVYTPQLLDLLKKYNVKATFFVVGWKAKKYPHLIKRMQEEGHTIGLHHYYHTSNWLLLP
FT                   LVTEWELERSARVIEHITGARPVYYRPPWGHINIWTLFMQKKYKIVMWTYILGDWNASL
FT                   GVDRLYERLMSSIEDGAIIVLHDSGSTIGADEHAPANTIATLERLFQHTNVKWVKLNEE
FT                   "
FT   gene            196667..197248
FT                   /locus_tag="Aflv_0187"
FT   CDS_pept        196667..197248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0187"
FT                   /product="Uncharacterized membrane-associated protein, DedA
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32571"
FT                   /db_xref="GOA:B7GJ25"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ25"
FT                   /protein_id="ACJ32571.1"
FT                   /translation="MEANSVLTYIQSHGYIVLFLSLFFGIIGIPAPEESLLFFVGIFIS
FT                   HAQLHLFKSLFFAISGATIGMVVAYVAGYTFGSPLLFKYGHYIGFHRRRYRYVYRHFRK
FT                   RALLLIPFGYFVPGIRQLSPYMAGVVRFPFLPFLFLSFVGASFWICLFIFVGKFLGERI
FT                   HIPLHVLPWITLLFFSLFFIALYVKNRKQK"
FT   gene            197264..198376
FT                   /locus_tag="Aflv_0188"
FT   CDS_pept        197264..198376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0188"
FT                   /product="UDP-N-acetylglucosamine:LPS N-acetylglucosamine
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32572"
FT                   /db_xref="GOA:B7GJ26"
FT                   /db_xref="InterPro:IPR009695"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ26"
FT                   /protein_id="ACJ32572.1"
FT                   /translation="MMNILVLPLFQMPSGHHQVADAMIYSLRHRFPDIRCEKLDFLSYC
FT                   NEHMEKRVADFYLRWISVLPHSYEWMYQRWMRKFEQPAMEPWLLYFEKKMKRLLQEKKP
FT                   HLVICTHSFPSHVLQRLKQKGIVTVPVVNVYTDFFLSGIWGKTAIDYHFVPHKDAKRLL
FT                   CTTFHVEPRRVIVTGIPIHEQIVPVQKMKRRTNKRILVAGGNQGLGKMKQFLMNTTHAQ
FT                   LVYYVLCGKNEALYHQIKSWDNPCIRPYRYISDPAKMNELYDKVDAIVTKPGGVTMSEA
FT                   LAKRLPAFTLSYLPGQEQMNLHYLRKKGLIYFLRDNEPYDQQLLRVLMNEEEMNEWEKR
FT                   IDGYWLEREKSAQEALYEWIEANVYAMKKR"
FT   gene            complement(198391..199521)
FT                   /gene="gerKC"
FT                   /locus_tag="Aflv_0189"
FT   CDS_pept        complement(198391..199521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerKC"
FT                   /locus_tag="Aflv_0189"
FT                   /product="Spore germination protein GerKC"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32573"
FT                   /db_xref="GOA:B7GJ27"
FT                   /db_xref="InterPro:IPR008844"
FT                   /db_xref="InterPro:IPR038501"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ27"
FT                   /protein_id="ACJ32573.1"
FT                   /translation="MIRAIVCCFFCFVLTGCWGMKEIDHLAYIHAIGVDYEDGQVIAYA
FT                   QLISFTGLAKVEAGGGRQKSTVTIGKAKGETFNVATDRLYQAIQQGVSWGHVKGIVFTE
FT                   RALKKGLVRDVIDVLDRYNEIRHTIWTFATKQPIERIFETTPFLDYSPYFSLLANPTDI
FT                   YEQSSFIQPKRFNELIAASNEKAVTFPLPSLSVEEKSWTENKKKKPMLKKDGVCFLHRY
FT                   DKQACIPRHKLDGLRWITKGTGRTPIYMKPNGKMIGTLVVRGPKANISYKIKDGHPVFT
FT                   VEVQAAGSIIELREHMSEKQIIEYASKTVEKEIKNLFDLGVKEGVDTLQLSSALYRQNV
FT                   NDWRKYTTNGLVPLTKDTLQQVNVTLSIDTYGKSKK"
FT   gene            complement(199518..201080)
FT                   /gene="gerKA"
FT                   /locus_tag="Aflv_0190"
FT   CDS_pept        complement(199518..201080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerKA"
FT                   /locus_tag="Aflv_0190"
FT                   /product="Spore germination protein GerKA"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32574"
FT                   /db_xref="GOA:B7GJ28"
FT                   /db_xref="InterPro:IPR004995"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ28"
FT                   /protein_id="ACJ32574.1"
FT                   /translation="MGVADVVFLHLFSCDVIVRTCVSNTYKRKESIRVNAEWIVDEQTL
FT                   KEHFAQCKDVVLMPATIYSEERKPLSLIFIYCEELCDTMLLKQFVFPTITRMGQQYPLY
FT                   SVTDIEKYKQMPLHLIGKSVSAQQLDFIVFNGDLVIYFVEAEAMYSISLANPPNRNPEE
FT                   PNTEVSIRGPKDGFIEEVAKNVALIRKRLKTSSLHVEQVLIGKRSRTKVDILYIQDIIN
FT                   QETIAELKRRLSTINIDALTGTNQLEELLSEKYISLFPVFAYSGRPDFVVNALLSGRFA
FT                   VFIDGSPTALIGPTNLTFLLNTSEDNSTSFVFVTFQRLIRLIGVSVAVFLPGLWVAITT
FT                   YHQDQLPFTLLATIVLARQGVPLPAPLEAFIMISLFEIFKEAGMRLPIAIGQTLSVVGG
FT                   LIIGQAAINAGLAAPGTLVVIATSVIATFTLVNQSLAGTVSILRFIVLAASSLLGLFGF
FT                   IASMFFLLVYTANLTSFGVPYLAPLSPATGDIWKVVITSGWKKFRRRPKMLKTNDNTPG
FT                   DES"
FT   gene            complement(200978..202096)
FT                   /gene="gerKB"
FT                   /locus_tag="Aflv_0191"
FT   CDS_pept        complement(200978..202096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerKB"
FT                   /locus_tag="Aflv_0191"
FT                   /product="Spore germination protein GerKB"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32575"
FT                   /db_xref="GOA:B7GJ29"
FT                   /db_xref="InterPro:IPR004761"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ29"
FT                   /protein_id="ACJ32575.1"
FT                   /translation="METIKIQKEKRCVSMNTVQMLFVLMLSIGLMNHVIIIPILLEVAG
FT                   RDAWISTIIGLILLVIFLPLVYFPMKQSQQRHIFQWLKENVGAPIAYFIASITCLYLLI
FT                   ISIVTLKDTTTFTTTSYLTATPNWAIVVTLCIICFYNASIGLPSIAQTSGIILPFVVLF
FT                   GIFVALATVPHKNYELLKPILEEGWMPVWKGVMYVAAGYGEIVLLLFMQQQMKTNISFM
FT                   KLVLFGLIAASLSIGPTVGAITEFGPAEASHLRYPAFEQWRMVNLGTYLEHFDFLSVYQ
FT                   WLAGAFIRISLATALIPELFDITNKASRRWILLFVYVVMFFAAMTPMSDDTFFRMLKKW
FT                   VLPMSFFFICFLAMLLFVLALAIRIKERRASA"
FT   gene            202182..203249
FT                   /gene="ddl"
FT                   /locus_tag="Aflv_0192"
FT   CDS_pept        202182..203249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddl"
FT                   /locus_tag="Aflv_0192"
FT                   /product="D-alanyl-D-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32576"
FT                   /db_xref="GOA:B7GJ30"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ30"
FT                   /protein_id="ACJ32576.1"
FT                   /translation="MNIRGGKNMKITLGILYGGKSPEHKVSLQTARSVINAINKEKFTV
FT                   VPIYITTDGQWLRGEAIEGEVQHVNELAFQQGLPALALIANGIDVIFPLLHGPNGEDGT
FT                   VQGMLELLNVPYVGNGVLASAVGMDKVVMKQLFAQAGLKQARYVFFLKNEWEGQKENVY
FT                   ETVEQEIGYPCFVKPANAGSSVGISKCKNREQLQTAFQEAFRYDRKVIVEEAIIGREVE
FT                   IGVIGNDKPICSVVGEIVPKKEFYDYEAKYVDGNTELFIPANVTDKEYETIKQMALAAF
FT                   KVLDLAGLVRADFFLTADGEVYINEVNTMPGFTPFSMFPLLWKHTGIPYEELIERLIQL
FT                   AIERYEEKQNITYIF"
FT   gene            203259..204635
FT                   /gene="murF"
FT                   /locus_tag="Aflv_0193"
FT   CDS_pept        203259..204635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murF"
FT                   /locus_tag="Aflv_0193"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate-D-alanyl-D-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32577"
FT                   /db_xref="GOA:B7GJ31"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJ31"
FT                   /protein_id="ACJ32577.1"
FT                   /translation="MIIRSLADIQTMIPGSIIDERYASVMIHGVSTDTRTIERGNLYVP
FT                   LKGATFNGHQFVKEAFEKGAAAALWSKHEPNAPTDVPLIFVEDSLVALQQLAHAYRKQL
FT                   RACIIGVTGSNGKTTTKDMIASLLGTVYRVQKTEGNLNNHIGVPLTLLRLKEETEYAVV
FT                   EMGMSGFGEIELLSTLAEPDVSIITNIGESHLQELGSREGIATAKFEIVKGLKRDGLFI
FT                   YHGDEPLLQTRVENANLSHVQTFGMAPTNDYYPLDIRVQADGTTFKVNRWPNETFRMPL
FT                   LGRHHVMNALAAIAVARFAFVDIDHIKEGFLRLSVTKMRTEVIKRSDGVTIINDAYNAS
FT                   PTSMRAALELLGQLTGYRKKIAIVGDMLELGEQEIAFHEQIGEMIDPQKIDYVLTYGER
FT                   AKAIAERASKRFSEGRVRAYDDKSELAADVRGIIEAGDVILLKASRGMKLEEIISLLNH
FT                   "
FT   gene            204772..206187
FT                   /locus_tag="Aflv_0194"
FT   CDS_pept        204772..206187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0194"
FT                   /product="ATP-dependent RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32578"
FT                   /db_xref="GOA:B7GIY0"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030880"
FT                   /db_xref="UniProtKB/TrEMBL:B7GIY0"
FT                   /protein_id="ACJ32578.1"
FT                   /translation="MKTLVKFNEFGLSPELMKAVSKMGFEEATPIQAATIPLSLQNRDV
FT                   IGQAQTGTGKTAAFGIPLIEKIDMNNDAVQAIVVAPTRELAIQVSEELYKIGSTKRVRV
FT                   LPIYGGQDIERQIRALKKHPHIIVGTPGRILDHIQRRTLRLQHVHTVVLDEADEMLNMG
FT                   FVEDIEAILSHVPTERQTLLFSATMPEPIRRIAERFMNNPELVRVKAKEMTVPNIEQYY
FT                   IEIQEKKKFDTLTRLLDIQSPELAIVFGRTKRRVDELAEALNLRGYAAEGIHGDLSQAK
FT                   RLSVLRKFKEGSIDILVATDVAARGLDISGVTHVYNFDIPQDPESYVHRIGRTGRAGKT
FT                   GMAITFVTPREIGQLHHIEKTTKRKMERMKPPTLDEALEGQQRAAIEKLLATIEHNNLA
FT                   FYKRAAEELLEEHDSVSLVAACIKMLTKEPDMTPVQLTEEPPLMKKEKKRQVQTRQRRN
FT                   ETRSRGSKTRTKR"
FT   gene            206235..206597
FT                   /gene="acpS"
FT                   /locus_tag="Aflv_0195"
FT   CDS_pept        206235..206597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpS"
FT                   /locus_tag="Aflv_0195"
FT                   /product="Phosphopantetheinyl transferase (holo-ACP
FT                   synthase)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32579"
FT                   /db_xref="GOA:B7GIY1"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GIY1"
FT                   /protein_id="ACJ32579.1"
FT                   /translation="MIVGIGIDIVELHRVAELMERQPKFIERILTDNEHIRFQQLSSKR
FT                   KIEFVAGRFAAKEAYAKALGTGIGTHVSFHDIEIKNDENGKPYIISPSMDERVHVSISH
FT                   SEHYAVAQVIIERLSS"
FT   gene            206672..207691
FT                   /locus_tag="Aflv_0196"
FT   CDS_pept        206672..207691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0196"
FT                   /product="Uncharacterized conserved protein"
FT                   /note="related to LolA outer membrane lipoprotein-sorting
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32580"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFP4"
FT                   /protein_id="ACJ32580.1"
FT                   /translation="MRRTWLFWCLLLLVVGSLAACGEKSQQDVLKALDEKVQTMSGYKA
FT                   EAKMTLQTGTEPQVYEIEIWHKSPNYYRVNLKNAQRDQHQMILRNDEGVFVLTPALNKS
FT                   FRFQSDWPQNASQVYLYESLVKDILADTKADFKATKNHYVFQTKTNYENKKMLPKQEIT
FT                   LNKKDLTPVKVTVMDVDSQPMLTVEFSKVEWNASFDDNAFDVSKNMTRAKLENEQEATT
FT                   AANQQAAPVMYPTYELDGVKLVEEKEFTTANGKRMVMTFAGEKSFTLVQEKAHAVPTAN
FT                   VSTTVKGEPVDLGFAVGALANGTLTWTYKGVDFILASQDLTKEEMVAIARSVQGKVMK"
FT   gene            207787..208944
FT                   /gene="alr"
FT                   /locus_tag="Aflv_0197"
FT   CDS_pept        207787..208944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alr"
FT                   /locus_tag="Aflv_0197"
FT                   /product="D-alanine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32581"
FT                   /db_xref="GOA:B7GFP5"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GFP5"
FT                   /protein_id="ACJ32581.1"
FT                   /translation="MEKAFYRDTWAEIDLDAIFYNVQSMKQHVGSHVEVIAVVKANAYG
FT                   HGDIQVAKTALEAGATRLAVAFLDEALALRKKGISLDVPILVLGATKPQYAPLAASQNI
FT                   ALTVFRADWFEQAIVYAPYEQPLNVHMKLDTGMGRLGAKTKEEVQQMIYAIEQHPSFIL
FT                   EGVYTHFATADEQNIDYFSFQYDTFLHMLEWLSIQPPLIHCANSAAGLRYPDRIFNAVR
FT                   FGISMYGLAPSQEMKSLLPYPLKEAFSLHSRLTHVKKVKGGEKISYGATYEAETDEWIG
FT                   TVPIGYADGWLRRMQHFSVLVDGKRAPIVGRVCMDQMMIRLPYELPVGTKVTLIGEQQG
FT                   DRISVDDVAAHVNTINYEIPCTISYRVPRIFLKNKSIIEVRNAVL"
FT   gene            209091..209378
FT                   /locus_tag="Aflv_0198"
FT   CDS_pept        209091..209378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0198"
FT                   /product="Transcriptional regulator, CopG family"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32582"
FT                   /db_xref="GOA:B7GFP6"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFP6"
FT                   /protein_id="ACJ32582.1"
FT                   /translation="MFVSESSATTEIVIRLPQALVSELDGIVKQENGSRNELIYQAMKM
FT                   YIRERKKRQIREAMRRGYMEMAKINLSLASEAFLAEYEADHTVERLVSGG"
FT   gene            209383..209733
FT                   /gene="mazF"
FT                   /locus_tag="Aflv_0199"
FT   CDS_pept        209383..209733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mazF"
FT                   /locus_tag="Aflv_0199"
FT                   /product="Toxin-antitoxin addiction module toxin component
FT                   MazF (an endoRNAse)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32583"
FT                   /db_xref="GOA:B7GFP7"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFP7"
FT                   /protein_id="ACJ32583.1"
FT                   /translation="MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVA
FT                   AITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQIRTIDKQRLTDKITHLDDEMMDKVD
FT                   EALQISLGLIDF"
FT   gene            209755..211956
FT                   /locus_tag="Aflv_0200"
FT   CDS_pept        209755..211956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0200"
FT                   /product="Transcriptional accessory protein Tex, contains
FT                   RNAse H and S1 domains"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32584"
FT                   /db_xref="GOA:B7GFP8"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFP8"
FT                   /protein_id="ACJ32584.1"
FT                   /translation="MCSYFCLGEEFCLELLKQLAAQLNIPFIHVQHVIQLHEEGNTIPF
FT                   IARYRKEMTGALDEVQIRTILDEWNYLQNLAKRKEEVIRLIDEQGKLTDELKEAITKAT
FT                   KLQEVEDLYRPYKQKRRTKATIAKEKGLEPFAEWLLTLPNESIAERAKLFIDEQKEVRT
FT                   IDEVIQGAKDIIAEKVSDDAALRQWIRQQTWQTGTIVSFGKETEKDEKRVFEMYYDHRE
FT                   PIAKAPAHRILAMNRGEKEGILRIDIDVDADRMTAYIRQQIVTNEQSSAAPIVVEAIED
FT                   AYKRLIAPSIERDVRNELTERAEERAIHIFAENLRNLLLQPPLKGKVVLGVDPAYRTGC
FT                   KLAVVDETGKVLHIDVIYPHPPKNEVEKAKEKLKQLLHTYQVELIAIGNGTASRETEQF
FT                   VADTISEWGGNVFYSIVNEAGASVYSASDLARKEFPHLQVEERSAVSIARRVQDPLAEL
FT                   VKIDPKSVGVGQYQHDVSQKKLEQSLQFVVETVVNQVGVNVNTASPTLLQYVSGLTKTV
FT                   AENIVKYREEHGKFSNRTQLKHIPRLGAKTYEQCIGFLRILDGDEPLDRTPIHPERYEE
FT                   VYQLLHRLGFSTEAIGSEQLRGALEGINIEEVAQELNIGILTLQDIIDALNRPERDPRD
FT                   DLPKPILKKHVLKMEDLRKGMELEGTVRNVVDFGVFVDIGVKQDGLVHISKLSTRYVKH
FT                   PLDVVSVGDIVKVWVDSVDLQKERIALTMIPPTLENTLS"
FT   gene            complement(211951..212064)
FT                   /locus_tag="Aflv_0201"
FT   CDS_pept        complement(211951..212064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0201"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32585"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFP9"
FT                   /protein_id="ACJ32585.1"
FT                   /translation="MPMWLKNQMRRAYYEKNRAQIKLLNQCWFFYRKTHCS"
FT   gene            212136..212591
FT                   /locus_tag="Aflv_0202"
FT   CDS_pept        212136..212591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0202"
FT                   /product="Zn-dependent metalloprotease, SprT family"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32586"
FT                   /db_xref="GOA:B7GFQ0"
FT                   /db_xref="InterPro:IPR006640"
FT                   /db_xref="InterPro:IPR023524"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GFQ0"
FT                   /protein_id="ACJ32586.1"
FT                   /translation="MDERELQALVERISLDVFHKPFRHRAVFNDRLRTTGGRYVLSTHH
FT                   IELNRKYYEQYGEEELIQVIKHELCHYHLYLEGKGYRHRDRDFRELLQKVQAPRFCKPV
FT                   LLSKTKKEHYYKCTSCRYMYVRRKALDTTRYVCGFCRGKLKKIKREC"
FT   gene            212726..212800
FT                   /gene="trnN"
FT                   /locus_tag="Aflv_R033"
FT                   /note="tRNA_Asn2"
FT   tRNA            212726..212800
FT                   /gene="trnN"
FT                   /locus_tag="Aflv_R033"
FT                   /product="tRNA-Asn"
FT   gene            212803..212895
FT                   /gene="trnS"
FT                   /locus_tag="Aflv_R034"
FT                   /note="tRNA_Ser2"
FT   tRNA            212803..212895
FT                   /gene="trnS"
FT                   /locus_tag="Aflv_R034"
FT                   /product="tRNA-Ser"
FT   gene            212912..212983
FT                   /gene="trnE"
FT                   /locus_tag="Aflv_R035"
FT                   /note="tRNA_Glu3"
FT   tRNA            212912..212983
FT                   /gene="trnE"
FT                   /locus_tag="Aflv_R035"
FT                   /product="tRNA-Glu"
FT   gene            213023..213095
FT                   /gene="trnV"
FT                   /locus_tag="Aflv_R036"
FT                   /note="tRNA_Val3"
FT   tRNA            213023..213095
FT                   /gene="trnV"
FT                   /locus_tag="Aflv_R036"
FT                   /product="tRNA-Val"
FT   gene            213104..213179
FT                   /gene="trnD"
FT                   /locus_tag="Aflv_R037"
FT                   /note="tRNA_Asp5"
FT   tRNA            213104..213179
FT                   /gene="trnD"
FT                   /locus_tag="Aflv_R037"
FT                   /product="tRNA-Asp"
FT   gene            213215..213289
FT                   /gene="trnQ"
FT                   /locus_tag="Aflv_R038"
FT                   /note="tRNA_Gln2"
FT   tRNA            213215..213289
FT                   /gene="trnQ"
FT                   /locus_tag="Aflv_R038"
FT                   /product="tRNA-Gln"
FT   gene            213300..213375
FT                   /gene="trnK"
FT                   /locus_tag="Aflv_R039"
FT                   /note="tRNA_Lys2"
FT   tRNA            213300..213375
FT                   /gene="trnK"
FT                   /locus_tag="Aflv_R039"
FT                   /product="tRNA-Lys"
FT   gene            213381..213464
FT                   /gene="trnL"
FT                   /locus_tag="Aflv_R040"
FT                   /note="tRNA_Leu5"
FT   tRNA            213381..213464
FT                   /gene="trnL"
FT                   /locus_tag="Aflv_R040"
FT                   /product="tRNA-Leu"
FT   gene            213487..213569
FT                   /gene="trnL"
FT                   /locus_tag="Aflv_R041"
FT                   /note="tRNA_Leu2"
FT   tRNA            213487..213569
FT                   /gene="trnL"
FT                   /locus_tag="Aflv_R041"
FT                   /product="tRNA-Leu"
FT   gene            213629..213705
FT                   /gene="trnR"
FT                   /locus_tag="Aflv_R042"
FT                   /note="tRNA_Arg1"
FT   tRNA            213629..213705
FT                   /gene="trnR"
FT                   /locus_tag="Aflv_R042"
FT                   /product="tRNA-Arg"
FT   gene            213726..213802
FT                   /gene="trnP"
FT                   /locus_tag="Aflv_R043"
FT                   /note="tRNA_Pro1"
FT   tRNA            213726..213802
FT                   /gene="trnP"
FT                   /locus_tag="Aflv_R043"
FT                   /product="tRNA-Pro"
FT   gene            213819..213889
FT                   /gene="trnG"
FT                   /locus_tag="Aflv_R044"
FT                   /note="tRNA_Gly4"
FT   tRNA            213819..213889
FT                   /gene="trnG"
FT                   /locus_tag="Aflv_R044"
FT                   /product="tRNA-Gly"
FT   gene            213972..215495
FT                   /locus_tag="Aflv_R045"
FT   rRNA            213972..215495
FT                   /locus_tag="Aflv_R045"
FT                   /product="16S ribosomal RNA"
FT   gene            215837..218758
FT                   /locus_tag="Aflv_R046"
FT   rRNA            215837..218758
FT                   /locus_tag="Aflv_R046"
FT                   /product="23S ribosomal RNA"
FT   gene            219109..219222
FT                   /locus_tag="Aflv_R047"
FT   rRNA            219109..219222
FT                   /locus_tag="Aflv_R047"
FT                   /product="5S ribosomal RNA"
FT   gene            219398..219474
FT                   /gene="trnM"
FT                   /locus_tag="Aflv_R048"
FT                   /note="tRNA_Met2"
FT   tRNA            219398..219474
FT                   /gene="trnM"
FT                   /locus_tag="Aflv_R048"
FT                   /product="tRNA-Met"
FT   gene            219651..220124
FT                   /locus_tag="Aflv_0203"
FT   CDS_pept        219651..220124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0203"
FT                   /product="ATP/GTP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32587"
FT                   /db_xref="GOA:B7GFQ1"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFQ1"
FT                   /protein_id="ACJ32587.1"
FT                   /translation="MKTYEYVSHHPEDTLALAMKLAQYVQPQDVITLEGDLGAGKTTFT
FT                   KGLAKGLGIDRNVSSPTFTIIKQYEGRIPLYHMDVYRLAESEEDLGFEEYFFGDGVTVV
FT                   EWAHLIEAYLPAERLHINIHHMDGESRIIRFSPIGQRYEQLCEEIFNDESASH"
FT   gene            220087..220809
FT                   /locus_tag="Aflv_0204"
FT   CDS_pept        220087..220809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0204"
FT                   /product="Glycoprotease family enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32588"
FT                   /db_xref="GOA:B7GFQ2"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFQ2"
FT                   /protein_id="ACJ32588.1"
FT                   /translation="MRRFLTMKVLAIDTSTFVMGVAVVDGQIVKGEMITNLKKNHSIRV
FT                   MPAIESLLQQCDMNPQDLDRIVVAKGPGSYTGVRIGVTIAKTLAWTLNIPLVGISSLEV
FT                   MAANAKYFGGLIVPLMDARRGQIYTGLYKVEGDHVQSIVADQVILATDWANELKAYDQS
FT                   ILLVGNDSVLHEATFVEVLGRSVQVASATLHNPRPSELAWLGMNREPEDVHTFVPNYIR
FT                   LAEAEANWLARQQERTEC"
FT   gene            220810..221253
FT                   /locus_tag="Aflv_0205"
FT   CDS_pept        220810..221253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0205"
FT                   /product="Acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32589"
FT                   /db_xref="GOA:B7GFQ3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFQ3"
FT                   /protein_id="ACJ32589.1"
FT                   /translation="MNVSFRFMTIQDLDRIVEIEQRSFTLPWSRSSFHQELTNNPYARY
FT                   IVMEHDGQIIGYCGMWLVMDEAHITNIAVLPEFRGKKLGEALMKQAMALAREEGAKTMT
FT                   LEVRVSNIVAQSLYRKLGFLNGGIRKRYYSDNQEDALVMWVNL"
FT   gene            221238..222263
FT                   /gene="gcp"
FT                   /locus_tag="Aflv_0206"
FT   CDS_pept        221238..222263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcp"
FT                   /locus_tag="Aflv_0206"
FT                   /product="ATP-binding apurinic endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32590"
FT                   /db_xref="GOA:B7GFQ4"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GFQ4"
FT                   /protein_id="ACJ32590.1"
FT                   /translation="MGEFMNKKDMFVLGIETSCDETAAAIVKNGREIVANVVASQMESH
FT                   QRFGGVVPEIASRHHVEQITLVLEETMKQANMDISQLDAIAVTEGPGLVGALLIGVNAA
FT                   KALAFAHRIPLVGVHHIAGHIYANQLVQEMKFPLLALVVSGGHTELIYMKEHGIFEVIG
FT                   ETRDDAAGEAYDKVARALQLPYPGGPHIDRLAKQGKPIIDLPRAWLEEGSYDFSFSGLK
FT                   SAVINTLHNAKQRGEMIRPEDMAASFQASVVEVLVRKTIEAAMHYSVKQILLAGGVAAN
FT                   EGLRTQLQKQMDQLPEVELVIPPLSLCTDNAAMIAAAGTVLFQQGKRATMALNANPSLL
FT                   L"
FT   gene            complement(222557..224452)
FT                   /locus_tag="Aflv_0207"
FT   CDS_pept        complement(222557..224452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0207"
FT                   /product="ATPase component of an ABC transporter with
FT                   duplicated ATPase domains"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32591"
FT                   /db_xref="GOA:B7GFQ5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032524"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFQ5"
FT                   /protein_id="ACJ32591.1"
FT                   /translation="MIILQVNQLSKSYGAEQVLSDIKLEIQEKDRIALVGRNGAGKSTL
FT                   LKIIAGQLSYDTGEIIKPKHVTIGYLDQYTGLQAHRSIWEEMLDVFAPLQQMEKQLREL
FT                   EQQMSLHDADYERLLEQYDRLQTEFKEKGGYQYEADIRSVLHGLRFSQYDYTTKVSTLS
FT                   GGQRTRLALGKLLLTRPDLLILDEPTNHLDMETLQWLEQYLKNYDGAILIVSHDRYFLD
FT                   QIVTQVYELSRTKIKKYVGNYTSYLQQRAEQFEQQLKLYEKQQEEITKLKDFIQRNIAR
FT                   ASTTKRAQSRRKQLEKMNIIDKPLGDEKSASFRFEIERPSGNDVLTANDLAIGYDHIIA
FT                   TNLSFRITRGDSIALIGPNGIGKSTLLKTIIKQLHPKQGEIRYGTNVQIGYYDQEQAQL
FT                   TSNKRVIDELWDEDRLRTEKEIRTILGNFLFSGDDVLKPVQTLSGGEKARLALAKLMMK
FT                   KANVLVLDEPTNHLDLDSKEVLEQALIEYPGTIIFVSHDRYFINKIATKIYELSTDGLV
FT                   EYLGDYDYYVAKKAELLELGQISQKTKTGESLSPKRSYEEEKERKKLERQRQRKIEQLE
FT                   TEMEQIEQQIATYEQQLYDPSCYNDYEKARDTQGKIDELKQKFDELFEQWEILQK"
FT   gene            224680..225315
FT                   /locus_tag="Aflv_0208"
FT   CDS_pept        224680..225315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0208"
FT                   /product="AT-rich DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32592"
FT                   /db_xref="GOA:B7GFQ6"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR009718"
FT                   /db_xref="InterPro:IPR022876"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GFQ6"
FT                   /protein_id="ACJ32592.1"
FT                   /translation="MNNEQPKIPQATAKRLPLYYRFLKNLHASGKQRVSSAELSEAVKV
FT                   DSATIRRDFSYFGALGKKGYGYNVNYLLSFFRKTLDQDETTEVALFGVGNLGTAFLNYN
FT                   FSKNNNTKIVMAFDVDPDKVGTKVGGVPVYHLDELEEKLGGITVAILTVPAQVAQPITD
FT                   RLVQKGIKGILNFTPARLHVPEHIRVHHIDLAVELQSLVYFLKHYGNE"
FT   gene            complement(225325..225513)
FT                   /locus_tag="Aflv_0209"
FT   CDS_pept        complement(225325..225513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0209"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32593"
FT                   /db_xref="GOA:B7GFQ7"
FT                   /db_xref="InterPro:IPR025426"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFQ7"
FT                   /protein_id="ACJ32593.1"
FT                   /translation="MEAVFMKSEPLFYFLTGILFTYFAVHTADDGIWDITTMLFILMAT
FT                   FDFGAGIRSLWKKASRS"
FT   gene            complement(225495..226232)
FT                   /locus_tag="Aflv_0210"
FT   CDS_pept        complement(225495..226232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0210"
FT                   /product="Predicted metal-dependent membrane protease"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32594"
FT                   /db_xref="GOA:B7GFQ8"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFQ8"
FT                   /protein_id="ACJ32594.1"
FT                   /translation="MKKQYWYVIITYIAMQLSSLVGVPLLAYSGFINASNKEITFSIAS
FT                   SYWAVISFSIALFLVLYFMKEDMKYSYDRHQASIGMSVFWAIGGFLLALFAQGIAANIE
FT                   VRFFGVEMGSENTRRIVEMVKLTPALMLVTSIVGPVLEEIIFRKIIFGTLYQKYNFFLS
FT                   AIISSLLFAVVHLEFEHLLLYATMGFVFAFLYVKTKRIIVPIAAHVLMNTFVVAIQTLF
FT                   AEEIESIMREAERMQFVIWRLFS"
FT   gene            226458..226742
FT                   /gene="groES"
FT                   /locus_tag="Aflv_0211"
FT   CDS_pept        226458..226742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groES"
FT                   /locus_tag="Aflv_0211"
FT                   /product="Chaperonin GroES (HSP10 family)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32595"
FT                   /db_xref="GOA:B7GFR5"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GFR5"
FT                   /protein_id="ACJ32595.1"
FT                   /translation="MLKPLGDRIVIELIQTEEKTASGIVLPDTAKEKPQEGKVVAVGSG
FT                   RVLDNGERVAPEVSVGDRIIFSKYAGTEVKYDGKEYLILRESDILAVIG"
FT   gene            226815..228431
FT                   /gene="groEL"
FT                   /locus_tag="Aflv_0212"
FT   CDS_pept        226815..228431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groEL"
FT                   /locus_tag="Aflv_0212"
FT                   /product="Chaperonin GroEL (HSP60 family)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32596"
FT                   /db_xref="GOA:B7GFR6"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GFR6"
FT                   /protein_id="ACJ32596.1"
FT                   /translation="MAKEIKFSEEARRAMLRGVDKLADAVKVTLGPKGRNVVLEKKFGS
FT                   PLITNDGVTIAKEIELEDPFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLK
FT                   NVTAGANPMGIRKGIEKAVAVAVEELKAISKPIEGKDSIAQVAAISAADEEVGQLIAEA
FT                   MERVGKDGVITLEESKGFTTELDVVEGMQFDRGYVSPYMITDSDKMEAVLENPYILITD
FT                   KKVSSIQELLPVLEQVVQQGKPLLIIAEDVEGEALATLVVNKLRGTFTAVAVKAPGFGD
FT                   RRKAMLQDIAILTGGEVITEELGRELKSTTIASLGRAAKVVVTKEHTTIVDGAGRAEDI
FT                   QARINQIRAQLEETTSEFDREKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALN
FT                   ATRAAVEEGIVAGGGTALMNVYSKVAAIEAEGDEATGVKIVLRAIEEPVRQIAQNAGLE
FT                   GSVIVERLKTEKPGIGFNAATGEWVDMIEAGIVDPTKVTRSALQNAASVAAMFLTTEAV
FT                   VADKPEENKNTPGMPDMGGMM"
FT   gene            228884..229540
FT                   /locus_tag="Aflv_0213"
FT   CDS_pept        228884..229540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0213"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32597"
FT                   /db_xref="InterPro:IPR025457"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFR7"
FT                   /protein_id="ACJ32597.1"
FT                   /translation="MNVQIRAIYESPYLNIISTIFKDLGLPRLIDRLVPVNPQCQTRAS
FT                   DVVWLLTLDILSGRQALVHVERWEHDIDLPKLIRLGLSPSWFNDDAIARHLYRLYDANI
FT                   HAVLSACLVQIYKKEGIPLRVFHADTTDVSVYGTYESASPDALRITHGYNRHHRWQKQI
FT                   GFGLIGNEDGIPFYGDVHDGNLPDKTWNPEVLSRVQKQLKQAKIEEEWIYPILPP"
FT   gene            complement(229883..230206)
FT                   /locus_tag="Aflv_0214"
FT   CDS_pept        complement(229883..230206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0214"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32598"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFR8"
FT                   /protein_id="ACJ32598.1"
FT                   /translation="MECKQLHKQTQEVLSVNKHTTLPNLIQKIVSDEDLQSMIEAVGYQ
FT                   DTSRTFTVRTLVDFFLLAALHEWKSFRHGADVAKMYGLPTFHYSTVSKKAKEVPYDSYF
FT                   APW"
FT   gene            complement(230244..231770)
FT                   /gene="bls"
FT                   /locus_tag="Aflv_0215"
FT   CDS_pept        complement(230244..231770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bls"
FT                   /locus_tag="Aflv_0215"
FT                   /product="Carboxyethyl-arginine beta-lactam-synthase
FT                   (Beta-lactam synthetase)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32599"
FT                   /db_xref="GOA:B7GFR9"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFR9"
FT                   /protein_id="ACJ32599.1"
FT                   /translation="MVRCTGFGLIVSPDRHNEVVEWPFAVQGINSTRFERIENLEYSSV
FT                   IRGEENCVKTAYMIEEDIAIWMIGEVYNRESIWNTIIGEEKNSSDLDVDLLLNLIRLYG
FT                   TTALRLVNGRFAAVIRFRDRLLLVTDHAGTIPLYFHISKNSIYVATEAKALILGGNLSP
FT                   GLRKFEDRTFEQNMIETIFKGINRVPIGSIIEINLRTFEMKKEHHWRMPSERLVISEEK
FT                   ACHLLYETLDKAVEFQKGENDSVGVILSGGIDSSAITSLIAPKVTKLYTFSIGTESANE
FT                   FEYAKLVADRYQTDHHEFLIREEEFLEKLPHVVWAAEVPHAEFIEYLTPVYITYQHARS
FT                   FTNRILTGYGSDILFGGMLDPHMSIEELDNYIQRDVLSIDGSNEFTHTIGLVHGIWTTH
FT                   PYWDREFLRITLQLDPRLKNLHGIEKYILRKSFESFLPQRNVWRKKIGVHQSTGTENAF
FT                   TKWVNENIRGNEPLAVRKNKIIYNLLQTLYVEGANPDEININNSRVLINQ"
FT   gene            complement(231804..233003)
FT                   /gene="argJ"
FT                   /locus_tag="Aflv_0216"
FT   CDS_pept        complement(231804..233003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argJ"
FT                   /locus_tag="Aflv_0216"
FT                   /product="N-acetylglutamate synthase (N-acetylornithine
FT                   aminotransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32600"
FT                   /db_xref="GOA:B7GFS0"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFS0"
FT                   /protein_id="ACJ32600.1"
FT                   /translation="MEIINPLKDNNQEILSMYLPKGFYTCSKNLGIKDETLDFTVIYST
FT                   TLATAAAMFTQSRFCGAPIPIGRKNVANGRLQCFVINSKNANVATGEEGIANVKEIIHL
FT                   IGEELNISPEDILPSSTGVIGRQLPMEKIRKGIKGLKNQMIQGGFEKAAEAIMTTDTYP
FT                   KMRVCKVGSATLVGIAKGSGMIEPNMATLLAYFVTDAKIPSDTLKEFLEEAVNKSFNMV
FT                   SIDTDTSTSDTVAIMANGLAGKVNFDDFRTALTNMAIELAKEIARDGEGATKLLEVIVE
FT                   EASSFAQAKKVGKKIVNSPLVKTAIFGTDPNWGRIAMAIGKCEEEVEISPEKVSIFFGT
FT                   IPVYKGKPVNDLDLEQIRKYLQGSEITIRVSLGLGKDTATVWGCDLSYDYVRINGEYTT
FT                   "
FT   gene            complement(233030..234109)
FT                   /locus_tag="Aflv_0217"
FT   CDS_pept        complement(233030..234109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0217"
FT                   /product="Predicted carboxylase (ATP-grasp family)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32601"
FT                   /db_xref="GOA:B7GFS1"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR040570"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFS1"
FT                   /protein_id="ACJ32601.1"
FT                   /translation="MKQKRMMLKVLFNFLKIIMKKNPFHGLLTFSDYYVDIAAQVATYF
FT                   GFLSPSPKSVQIARNKDLSRICLLEKSVPSAKFHIVKSFEEALKAAKDIGYPCVVKPTA
FT                   ETSSYGVECVFNDEQLLKAFNFANSIIINERGQRREGKVLIEEYMVGEEVSVETISING
FT                   DCHVLGITSKGLTGWPNFVECEFSFPYKIPENTRNSVIDVVKSALNAIGYFHGPCHTEI
FT                   KLTKEGPKVVEFNPRLGGRFISKMISDSLGIDPIKEVIKLAMGDSVDLLPKRNIGTAWS
FT                   AITAPSTGFLKEIKGKEEVLKSSGVEIFILNAKIGDFVRKPTNNGDTIGYIYTLGKDAA
FT                   DARDNLKKAREKLQLIISS"
FT   gene            234634..235575
FT                   /gene="speB"
FT                   /locus_tag="Aflv_0218"
FT   CDS_pept        234634..235575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speB"
FT                   /locus_tag="Aflv_0218"
FT                   /product="Arginase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32602"
FT                   /db_xref="GOA:B7GFS2"
FT                   /db_xref="InterPro:IPR005925"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFS2"
FT                   /protein_id="ACJ32602.1"
FT                   /translation="MGEFKPMDAGISPRYAQISTFMRLPHSRDIKNYDVAIIGVPYDGG
FT                   TSYRPGTRFGPREIRSHSSLIRGYSYYSKSDLFSRLRIADYGDIDASPYNIELTYKLIE
FT                   DTIESILNENVFPVVIGGDHSISLGILRAVAKKYGPVGLVQFDAHSDTYDGVYGTEYHH
FT                   GTPFKRAIEEGLIDPSRSLQIGIRGQFVSSTDLDYALQSGMKILMMDDINKKGISDVIK
FT                   NIEGLGKEPVYVSLDIDAVDPAFAPGTGTPVPGGFDSREIIQLVRSLKPLNVVGFDLVE
FT                   VSPPYDNNGITSLLASNLIYEFLNTVSLEKKS"
FT   gene            235709..237166
FT                   /locus_tag="Aflv_0219"
FT   CDS_pept        235709..237166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0219"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32603"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFS3"
FT                   /protein_id="ACJ32603.1"
FT                   /translation="MKRMLTVQQAVFTVESLIGKVQQQKQLITHQQQVIEQLLTEIKQL
FT                   RKENEQLKYRVQELEARTKKNSSNSHLPPSSDRFVNTRSSREPSSNKPGGQEGHQGTTL
FT                   RQVEHPHHRVVHRVHACQGCGASLREIKPFKVDIRQVFDLPPVTIEVTQHEREVKSCPH
FT                   CRCVQQAEFPSHVTNHVQYGPRLTALVVYLHHIQLIPYKRLSDTIEALYQHSVSTGTLA
FT                   NMVKRGREALESNMDMIEDALLESNILHVDETSLPINGKLAWVHVACTSRYTYLAPHAS
FT                   RGKKATDDIGILPRYGGTMMHDAFGTYPKYTQATHALCHAHHLRELKGFIEQGHTWASR
FT                   MTTFLLAAKQAVEAHHGSLSEEEAKRWERVYDRILAKAQQRLETMTPLPKKALAFVRRL
FT                   QKRKEEALRFLREAHVPFDNNQAERDLRMVKVKENISGTFREETFAQSFCITRSIVSTL
FT                   TKHEKNVWDSLYLLLTGETLDRVLSTT"
FT   gene            237103..238083
FT                   /locus_tag="Aflv_0220"
FT   CDS_pept        237103..238083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0220"
FT                   /product="Carboxyethyl arginine synthase (C-terminal TPP
FT                   binding domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32604"
FT                   /db_xref="GOA:B7GFS4"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFS4"
FT                   /protein_id="ACJ32604.1"
FT                   /translation="MGLVISSVDRRNARSCSFYHLGHLLSRGCSICVAFLYIPTIGVNS
FT                   YLIITVGYDYAEDLRPSMWKHGKEKKVVRIASYPNLAYQKFKPDVDVVNNISDSLEYLQ
FT                   NSLIGCTPKKPHDISGVRKRIEELLEDQTENTEGLLVNQVMGKINKVLGNGTLVSDVGF
FT                   FRHFAVLFSKINKPNGFITSAGCSTFGFGLPAAMAAKMANRDELVILVCGDGGFHSNSQ
FT                   DLETAVRYNLPIVIVLLNNNSNGLIRLYQSLGHQETYPPAVNFGKVDFVQLAKANGCEG
FT                   FYASNLTELELSLEKAIKLNKPVLIEVPIVYHNEVGERFRSLDVE"
FT   gene            238249..239487
FT                   /locus_tag="Aflv_0221"
FT   CDS_pept        238249..239487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0221"
FT                   /product="Alanine-anticapsin ligase bacD related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32605"
FT                   /db_xref="GOA:B7GFS5"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR040570"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFS5"
FT                   /protein_id="ACJ32605.1"
FT                   /translation="MEGISMKVNVLLIGLNKTFISSLERADTDYQVFLLEEEKLFKNNP
FT                   YHNKILKEVRYGDYQQSEGFMEQAIRWHKEVGFDVVVPGSDYAVRGAYKFAEKIGLLTP
FT                   GERAVKACTNKYELRKECKNLGIPHPNFSKVKNIHDVKAFFKGSKIVVKPANRRASVGV
FT                   IGIETIEDIESAWKECIEADENVFIADRDFNWEYIVEDYIDGYEVSIETIVAEGKPIFH
FT                   NITYKETTKGKYFVEIGHTVPAPISQEDSNMLIAAKEQLLSGLEVKAGLFHSEWKMSSE
FT                   GPKLIECAARTPGDYIPVLIEQAYGFNINDAFLKVLQQKMVSHPPTRNQYITAIRYFNP
FT                   KPGRLIKIEGLEIFDILPQITNYEINLKVGQNIHQMTNSWSRLGYYSIKCKTLNELNQI
FT                   INQVEEHVKFIVE"
FT   gene            239494..240711
FT                   /locus_tag="Aflv_0222"
FT   CDS_pept        239494..240711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0222"
FT                   /product="Permease of the major facilitator superfamily,
FT                   mdtH subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32606"
FT                   /db_xref="GOA:B7GFS6"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFS6"
FT                   /protein_id="ACJ32606.1"
FT                   /translation="MKDSIKKLSTEVRIVLFGVLLIGIGYFMAIPLLSLYLSNYRGLSV
FT                   FQIGLVLTVLTISQQGFTFFGGILSDRFGVKNSLIYGMLIRIIGFLTFAFSNNSWFFVI
FT                   SSIFVGIGGALFFPASKAIIATVPNSVKSEAFALRSIAVNIGASIGPLLGGLLYKFEFK
FT                   IVFLCATLVHFIFLLLALKYVDKNHNNINSNMKIVSQLNKVIKDYKIVFLMLINSGFWA
FT                   LYSQVYITIPLDFTTRFNSDSLVSLLFSINGFLVIILQYRMVKWMNKKFNQSLILTFGM
FT                   ILMAFAFFSLSIFPSIYAFFTFIIFFTISEILIIPTIDDLTSNISPPGLAGSYLGFVSL
FT                   GTGIGSLFGNLIGGSLFEQFKSIDLIWVNWLIYALFSMFIALLFKIYPMSKHEKCGYDP
FT                   NRFKVN"
FT   gene            240895..241350
FT                   /locus_tag="Aflv_0223"
FT   CDS_pept        240895..241350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0223"
FT                   /product="Acetyltransferase (GNAT family)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32607"
FT                   /db_xref="GOA:B7GFS7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR010167"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFS7"
FT                   /protein_id="ACJ32607.1"
FT                   /translation="MQIYNAVTSDVKDIHALIQIYAEKGLVLPRSLLSIYQHLQCMYVV
FT                   KEKNKIVGVAGLHILGHDLGEIRSLVVSPDHMGKGIGRMLVNHIINEASRLGVKRLISF
FT                   TYQIEFFKKCGFEIAEKETLPEKVWIDCVNCPKLDCCDETAMIKYIV"
FT   gene            complement(241505..241936)
FT                   /locus_tag="Aflv_0224"
FT   CDS_pept        complement(241505..241936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0224"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32608"
FT                   /db_xref="GOA:B7GFS8"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFS8"
FT                   /protein_id="ACJ32608.1"
FT                   /translation="MQATGNALEAEAEIPDTLGIYGNQIQAIGNVTVVAGLLNKDGSQQ
FT                   EITGNWLQSLGGLLSFADDWGSEQSSPLSPRRMGVDKTVRRWGQMAIGAVFFRACFQLL
FT                   NAVLELFIFFAQLFVFCQQLLNDLLLVSNELFLLLDFAD"
FT   gene            242369..243904
FT                   /gene="guaA"
FT                   /locus_tag="Aflv_0225"
FT   CDS_pept        242369..243904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaA"
FT                   /locus_tag="Aflv_0225"
FT                   /product="GMP synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32609"
FT                   /db_xref="GOA:B7GFS9"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFS9"
FT                   /protein_id="ACJ32609.1"
FT                   /translation="MSQQEMIVVLDFGSQYNQLITRRIREFGVYSELHPHTITAEQIQQ
FT                   MNVKGIVFSGGPNSVYDEQAFTCDPALFELGIPILGICYGMQLMTHHLGGKVEKATHRE
FT                   YGKATITVQRASQLFSSLPTEQIVWMSHGDLVTKTPEGFTVDATSPSCPIAAMSDETRK
FT                   FYAVQFHPEVRHSVYGNELLKRFVFNICECKGDWTMGSFIDHEVRKIRELVGDKKVLCA
FT                   LSGGVDSSVAAVLVHRAIGDQLTCIFVDHGLLRKGEADSVMKTFREGFHMNVIKVDAKE
FT                   RFLNKLKGVSDPEQKRKIIGNEFIYVFDDEAAKLDGIEFLVQGTLYTDIIESGTATAQT
FT                   IKSHHNVGGLPEDMKFKLIEPLNTLFKDEVRALGTELGIPDEIVWRQPFPGPGLGIRVL
FT                   GEVTEEKLEIVRESDAILREEIKKAGLDRDIWQYFTVLPDIRSVGVMGDARTYDYTVGI
FT                   RAVTSIDGMTADWARIPWDVLEAISTRIVNEVPHVNRVVYDITSKPPATIEWE"
FT   misc_binding    243988..244089
FT                   /bound_moiety="purines"
FT                   /note="Purine_riboswitch; Aflv_R049"
FT   gene            244079..245530
FT                   /gene="pbuG"
FT                   /locus_tag="Aflv_0226"
FT   CDS_pept        244079..245530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbuG"
FT                   /locus_tag="Aflv_0226"
FT                   /product="Xanthine/uracil/vitamin C permease"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32610"
FT                   /db_xref="GOA:B7GFT0"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR026033"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFT0"
FT                   /protein_id="ACJ32610.1"
FT                   /translation="MWGRGICLVPLYVLCIMHHSHASGSLLEAFFFLLQHMEGLEVIKK
FT                   YFQFDELGTNYKREIIAGLTTFLSMAYILFVNPAVLSLSAVPDLPNEMRMDQGAVFTAT
FT                   AIAAAVGSLLMGLIARYPIALAPGMGLNAFFAFTVVLTMGIPWQTALSGVLMSGMIFIL
FT                   LTLSGIREKIINSIPEDLKYAVGAGIGLFITFIGFQNAGIIVNNDAVLVGLGHLTNGNT
FT                   LLAIFGVVITVILMVRRVNGGIFIGMVITAIVGMVVGLIDVPTKVVGAVPSLAPTFGVA
FT                   FEHLDQIFNIKMLAVVLTFLFVDFFDTAGTLVAVANQAGLLKDNKLPRAGKALFADSCA
FT                   TVVGAILGTSTTTSYIESSAGVAAGGRTGFTSVVTAILFLLALFFSPLLSVVTAPVTAP
FT                   ALIIVGVLMVSSLGKIEWTRFEIAVPSFLTLIAMPLTYSIATGIAIGFIFYPITMIAKG
FT                   KAKEVHPIMYGLFVVFILYFAFLVE"
FT   gene            245925..247448
FT                   /locus_tag="Aflv_R050"
FT   rRNA            245925..247448
FT                   /locus_tag="Aflv_R050"
FT                   /product="16S ribosomal RNA"
FT   gene            247804..250725
FT                   /locus_tag="Aflv_R051"
FT   rRNA            247804..250725
FT                   /locus_tag="Aflv_R051"
FT                   /product="23S ribosomal RNA"
FT   gene            251076..251189
FT                   /locus_tag="Aflv_R052"
FT   rRNA            251076..251189
FT                   /locus_tag="Aflv_R052"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(251318..251707)
FT                   /locus_tag="Aflv_0227"
FT   CDS_pept        complement(251318..251707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0227"
FT                   /product="Molecular chaperone (HSP20 family)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32611"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFT1"
FT                   /protein_id="ACJ32611.1"
FT                   /translation="MDWTKQWEAFFSNPFWNASNTFSSHSSGINMYRRDHELLVVVAIP
FT                   GLENVHDAEVYIHYNTLEIKANVQLHFEGFELIEEGITQGPFERVIQLPFPVGEKVEAV
FT                   YENGLLFIQLHRLIPDHIKRKVEIK"
FT   misc_binding    251862..251961
FT                   /bound_moiety="purines"
FT                   /note="Purine_riboswitch; Aflv_R053"
FT   gene            252068..252556
FT                   /gene="purE"
FT                   /locus_tag="Aflv_0228"
FT   CDS_pept        252068..252556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="Aflv_0228"
FT                   /product="Phosphoribosylcarboxyaminoimidazole (NCAIR)
FT                   mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32612"
FT                   /db_xref="GOA:B7GFT2"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFT2"
FT                   /protein_id="ACJ32612.1"
FT                   /translation="MQPLVAVIMGSQSDWETMRHACDILEELHIPFEKKVVSAHRTPDF
FT                   MFTYAESAEERGIKVIIAGAGGAAHLPGMVAAKTTLPVIGVPIMSKTLNGLDSLLSIVQ
FT                   MPGGVPVATVAIGKAGAINAALLAASILGTYEPTYMEGLRARRETIRKQVMESSDQLD"
FT   gene            252540..253688
FT                   /gene="purK"
FT                   /locus_tag="Aflv_0229"
FT   CDS_pept        252540..253688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="Aflv_0229"
FT                   /product="Phosphoribosylaminoimidazole carboxylase (NCAIR
FT                   synthetase)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32613"
FT                   /db_xref="GOA:B7GFT3"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFT3"
FT                   /protein_id="ACJ32613.1"
FT                   /translation="MISLTKMIVPGQTIGIIGGGQLGRMMAIAAKEMGFFVAVLDPTPH
FT                   SPCAQVADIEIVASYSDERALCQLAEVSDVITYEFENIDADALNRLTERGYVPQGSELL
FT                   AITQHRWKEKRAVQSAGLPVAPYRLVFKEEELEEAIREIGIPSVLKTCRGGYDGKGQVV
FT                   IRCLDDVHKARSLLANGECVLEAWVPFVKELSIIVVRNVSGDMALFPVVENIHRDNILH
FT                   ETIAPAQVNERIIEQAETYAKQLAEAFQLVGTLAIEMFLTKNGQLYVNELAPRPHNSGH
FT                   YTINGCITSQFQQHIRAICDWPLGSTKLLKPAIMVNVLGEHVDAVIRNIAQLGEAHVHF
FT                   YGKKEAKPKRKMGHITWLVDDVDAMQRKIDEFSIWTDRRMNV"
FT   gene            253661..254980
FT                   /gene="purB"
FT                   /locus_tag="Aflv_0230"
FT   CDS_pept        253661..254980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purB"
FT                   /locus_tag="Aflv_0230"
FT                   /product="Adenylosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32614"
FT                   /db_xref="GOA:B7GFT4"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFT4"
FT                   /protein_id="ACJ32614.1"
FT                   /translation="MDRSEDERMIERYTRPEMGAIWTEENRFRAWLEVEILACEAWAEL
FT                   GVIPKEDVEKIRQHASFDIDRIKQIEEETRHDVVAFTRAVSETLGEERKWVHYGLTSTD
FT                   VVDTALSYLLKQANEILLRDLENLIAVLKEKAIEHKYTVMMGRTHGVHAEPTTFGLKLA
FT                   LWYAEMERNLERFKQAAETVRVGKISGAVGTYANIDPFVEQYVCEKLGLQPAPISTQTL
FT                   QRDRHAHYMATLALIATSIEKFAVEIRGLQKSETREVEEFFAKGQKGSSAMPHKRNPIG
FT                   SENMTGMARVIRGYMLTAYENVPLWHERDISHSSAERIILPDATIALDYMLNRFTNIVK
FT                   NLTVFPENMKKNMDRTLGLIYSQRVLLALIDTGMTREEAYDLVQPKAMEAWEKQVPFRS
FT                   LIEADEVITSRLTKDQIADCFDYNYHLKHVDTIFRRLGLQ"
FT   gene            255046..255768
FT                   /gene="purC"
FT                   /locus_tag="Aflv_0231"
FT   CDS_pept        255046..255768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purC"
FT                   /locus_tag="Aflv_0231"
FT                   /product="Phosphoribosylaminoimidazolesuccinocarboxamide
FT                   (SAICAR) synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32615"
FT                   /db_xref="GOA:B7GFT5"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GFT5"
FT                   /protein_id="ACJ32615.1"
FT                   /translation="MEKQYLLYEGKAKKVYATNEKHVLWIEYKDEATAFNGEKKATIVG
FT                   KGRLNNEITSLLFSLLHEAGVSNHFIRKISDTEQLVRQVTIIPLEVVVRNIVAGSLAKR
FT                   IGLEEGTVMKKPIVEFYYKNDDLGDPLLTEDHIALLQLATHDELLYMKQMALRINDILT
FT                   SLFRSCDLQLVDFKLEFGKDETGAVLLADEISPDTCRLWDVHTKEKFDKDVFRRDLGDL
FT                   TETYTKLLQRLGGLSCTK"
FT   gene            255756..256010
FT                   /gene="purS"
FT                   /locus_tag="Aflv_0232"
FT   CDS_pept        255756..256010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purS"
FT                   /locus_tag="Aflv_0232"
FT                   /product="Phosphoribosylformylglycinamidine (FGAM)
FT                   synthase, PurS component"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32616"
FT                   /db_xref="GOA:B7GFT6"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFT6"
FT                   /protein_id="ACJ32616.1"
FT                   /translation="MYKVKVYVTLRENVLDPQGNAVKGALHSLNYREVQDVRIGKFMEL
FT                   LVEKSDRNIDAVVKEMCEKLLANTVIEDYRYEIEEVVVQ"
FT   gene            256007..256693
FT                   /gene="purQ"
FT                   /locus_tag="Aflv_0233"
FT   CDS_pept        256007..256693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purQ"
FT                   /locus_tag="Aflv_0233"
FT                   /product="Phosphoribosylformylglycinamidine (FGAM)
FT                   synthase, glutamine amidotransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32617"
FT                   /db_xref="GOA:B7GFT7"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GFT7"
FT                   /protein_id="ACJ32617.1"
FT                   /translation="MKFAVVVFPGSNCDVDMYHAISDELGEEVEYVWHDVDCLDDFDAI
FT                   LLPGGFSYGDYLRSGAIARFSNVMKAIKKAADEGKPILGVCNGFQILLEAGLLPGAMRR
FT                   NNTLTFICRPIKLRVENNETMFTSQYEQGEVITIPIAHGEGNYYCDEQTLQQLIANNQI
FT                   VFRYEGENPNGSLFNIAGIVNEKGNVLGMMPHPERAVHELLGGADGLKLFQSIVTYWRD
FT                   AHVVTT"
FT   gene            256677..258899
FT                   /gene="purL"
FT                   /locus_tag="Aflv_0234"
FT   CDS_pept        256677..258899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purL"
FT                   /locus_tag="Aflv_0234"
FT                   /product="Phosphoribosylformylglycinamidine (FGAM)
FT                   synthase, synthetase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32618"
FT                   /db_xref="GOA:B7GFT8"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GFT8"
FT                   /protein_id="ACJ32618.1"
FT                   /translation="MSLLLEPSPTMIKEQKMYRDMGLTDEEFAMIERILGRLPNYTETG
FT                   IFSVMWSEHCSYKNSKPVLKKFPTEGKHVLQGPGEGAGIVDIGDGLAVAFKIESHNHPS
FT                   AIEPYQGAATGVGGIIRDVFSMGARPIALLNSLRFGELTSPRVKYLFERVVAGIAGYGN
FT                   CVGIPTVGGEVQFDAAYEGNPLVNAMCVGVIRHEDIQKGIASGVGNTVMYVGAKTGRDG
FT                   IHGATFASEELTEQSEQKRPAVQVGDPFMEKLLLEACLEVIHCDALVGMQDMGAAGLTS
FT                   SSAEMASKAGSGIELNLDLVPQRETGMTPYEMMLSESQERMLLVVKKGREQEIMDVFSK
FT                   YGLEAKAIGRVTDDHMLRLYHRGEVVAEIPVDALAKDAPVYHKPSQEPAYYREFQTMEY
FT                   VPTVDNYEETLLALLSQPTIASKEWVYEQYDYMVRTNTVVAPGSDAAVLRIRGTNKALA
FT                   MTTDCNSRYVYLDPEVGGKIAIAEAARNIVCSGAQPLAVTDCLNFGNPEKPEIFWQLEK
FT                   AVDGMSEACRILETPVISGNVSLYNETNGEAIYPTPIVGMVGIVEHVDHITTQAFKQPG
FT                   DLIYIIGEAKQEFGGSELQKWLTGRIFGKAPTIDLHVEVKRQQQLLTAIRAGVVASAHD
FT                   VSEGGLAVALAECVMSAQGLGARVEMKGDVVAELFSETQSRFIVSVKKEHQQMFERLVQ
FT                   AVRIGEVTNDGTLHVTAEDTCILHVPVETMRNVWKGAIPCLLKSKD"
FT   gene            258818..260302
FT                   /gene="purF"
FT                   /locus_tag="Aflv_0235"
FT   CDS_pept        258818..260302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purF"
FT                   /locus_tag="Aflv_0235"
FT                   /product="Glutamine phosphoribosylpyrophosphate
FT                   amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32619"
FT                   /db_xref="GOA:B7GFT9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFT9"
FT                   /protein_id="ACJ32619.1"
FT                   /translation="MHSPRSSRNDAKCMERSYSMLAEIKGLNEECGIFGIWGHEEAATL
FT                   TYYGLHSLQHRGQEGAGIVVGGNGTLQFHKGLGLVTEVFGRGELEKLTGMAAIGHVRYS
FT                   TAGGGGYANVQPLLFRSQGGSLALAHNGNLVNADELRFRLEQQGSIFQTTSDTEVLAHL
FT                   IKRSDEPILKERIKEALTHLRGAFAFLVLTETEMYIALDPHGFRPLSLGRLGEAYVVAS
FT                   ETCAFDVIGATYEREVEPGELIMINKQGIRSERFAPKVARSICSMEYIYFARPDSNVDG
FT                   INIHTARKNLGKRLAFEAPVEADVVTGVPDSSISVAIGYAEATGIPYELGLIKNRYVGR
FT                   TFIQPSQALREQGVKMKLSPVRGVVAGKRVVMVDDSIVRGTTSKRIVRMLREAGATEVH
FT                   VRISSPPITHPCFYGIDTSTKEELIAANHTIEQIRQLIEADSLAFLSPEGLLQAIGRPN
FT                   DSANCGQCLACFTGQYPTKLGGERVGTCVQTSRCEY"
FT   gene            260265..261302
FT                   /gene="purM"
FT                   /locus_tag="Aflv_0236"
FT   CDS_pept        260265..261302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purM"
FT                   /locus_tag="Aflv_0236"
FT                   /product="Phosphoribosylaminoimidazole synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32620"
FT                   /db_xref="GOA:B7GFU0"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFU0"
FT                   /protein_id="ACJ32620.1"
FT                   /translation="MAHVYKQAGVNIEAGYEAVERMKKHVAKTARIGALGSLGGFGGMF
FT                   DLSSLGYKQPVLVSGTDGVGTKLMLAFALDRHDTIGIDCVAMCVNDIVVQGADPLFFLD
FT                   YIACGKAIPEKIESIVKGIADGCVEAGCALIGGETAEMPGMYPEDEYDVAGFAVGVVEK
FT                   EKLVTGDAIAPGDVLIGLASSGLHSNGYSLVRKIIKDANLKLDHVYEPFSRTLGEELLT
FT                   PTRIYVRAVLEALKQFHIKGMAHITGGGFIENIPRMLPNGLQAEIDYGSWPIPSIFNFL
FT                   QQHGQLRRIDMFNIFNMGIGFVLAVDSRVVPDVVQLLEACGEEAYIIGRVKEGTGVSFA
FT                   GGKIE"
FT   gene            261299..261901
FT                   /gene="purN"
FT                   /locus_tag="Aflv_0237"
FT   CDS_pept        261299..261901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purN"
FT                   /locus_tag="Aflv_0237"
FT                   /product="Phosphoribosylglycinamide formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32621"
FT                   /db_xref="GOA:B7GFU1"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFU1"
FT                   /protein_id="ACJ32621.1"
FT                   /translation="MKRIAIFASGSGTNFQAIVDAVKKGDIQAEVALLVCDRPQAKVIE
FT                   RAMHEHVPIFVFNPKQYETKQQFEREILQQLHQKEIDLVVLAGYMRLIGPTLLQAYPNR
FT                   IVNIHPSLLPAFPGKDAIGQAYRYGVKVTGVTVHYVDEGMDTGPIIAQRALYIDDGEPL
FT                   ESVERRIHEIEHVLYPQVIQQLLTEKGSTKDEKTSNY"
FT   gene            261879..263414
FT                   /gene="purH"
FT                   /locus_tag="Aflv_0238"
FT   CDS_pept        261879..263414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="Aflv_0238"
FT                   /product="Inosine-monophosphate cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32622"
FT                   /db_xref="GOA:B7GFU2"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GFU2"
FT                   /protein_id="ACJ32622.1"
FT                   /translation="MKRRAIISVSNKKGIVTFAKQLAELGVEIISTGGTKRVLAEHGVP
FT                   VISISDVTNFPEILDGRVKTLHPNIHGGLLAVRDDETHQQQLQAHNITPIDFVVVNLYP
FT                   FQETIAKPNVTLMEAIEQIDIGGPTMLRAAAKNHAYVTAVVDPADYHLVIEQLKQYGEV
FT                   LLETRRALAAKVFRHTAAYDAMIAQYLTNIVGETYPETMTMTFVKKQSLRYGENPHQTA
FT                   AFYEKPLSSPFSIAAAKQLHGKELSYNNINDANAALQIVAEFVEPAAVAVKHMNPCGVG
FT                   VGETIAEAFQKAYEADPTSIFGGIVALNREVDEQMAAKLHDIFLEIVIAPSFTEQALEI
FT                   LTRKKNIRLLTVDFEVERKKEPFVVSVRGGLLVQDEDTYTIDDATLRVVTERKPTEEEW
FT                   SNLTFAWRVVKHVKSNAIVLAKNGMTIGVGAGQMNRVGAAKIAIEQAGDRAKGAVLASD
FT                   AFFPMSDTVEAAAQAGVTAIIQPGGSIRDEDSIQKANEYGIAMVFTGVRHFKH"
FT   gene            263430..264710
FT                   /gene="purD"
FT                   /locus_tag="Aflv_0239"
FT   CDS_pept        263430..264710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="Aflv_0239"
FT                   /product="Phosphoribosylglycinamide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32623"
FT                   /db_xref="GOA:B7GFU3"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFU3"
FT                   /protein_id="ACJ32623.1"
FT                   /translation="MKVLIIGRGGREHALVWKVAQSPLVTRVYVAPGNDGMNSIATRVP
FT                   IAETNVEALVQWAKKEAIDLTIVGPEAPLLAGIVDRFENEGLRIFGPKQQAALIEGSKA
FT                   FAKEMMRKYNIPTANYATFTNYDEAVQYVHEQGAPIVIKADGLAAGKGVTVAMTIDEAL
FT                   HALHDIMVAKKFGEAGAQVVIEQYLQGEEFSLMTFVHGERVYPMVIAQDHKRAFDDDQG
FT                   PNTGGMGAYSPVPQISEQMVHEAVETIVKPIAKALKQEGCAFTGFLYAGLIATEQGPKV
FT                   IEFNARFGDPEAQVILPRLQNDLVEVIVSLLEDRPITLHWSDEATIGVVLAAKGYPEQY
FT                   EKDAVIRGLERITRAQIFHAGTKRVDDDWVTDGGRVLLVVASGNTLKEAQRLVYEQIRH
FT                   IDCAQLFYRRDIGNKAIAHVACERIQN"
FT   gene            complement(264673..264777)
FT                   /locus_tag="Aflv_0240"
FT   CDS_pept        complement(264673..264777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0240"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32624"
FT                   /db_xref="GOA:B7GFU4"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFU4"
FT                   /protein_id="ACJ32624.1"
FT                   /translation="MIAEYITDTFFILILLIGSIVALSFVYVRKRRAR"
FT   gene            complement(264823..265092)
FT                   /locus_tag="Aflv_0241"
FT   CDS_pept        complement(264823..265092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0241"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32625"
FT                   /db_xref="GOA:B7GFU5"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFU5"
FT                   /protein_id="ACJ32625.1"
FT                   /translation="MNMKQNIGIINAMIRITCGFTMLAWATANFSRKPWRESYIWVMML
FT                   AAMKIAEGIVRFCPVMALFERYQCHCDSNNEKEKAIPIEPVNPS"
FT   gene            265145..266914
FT                   /locus_tag="Aflv_0242"
FT   CDS_pept        265145..266914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0242"
FT                   /product="Adenine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32626"
FT                   /db_xref="GOA:B7GFU6"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR026912"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFU6"
FT                   /protein_id="ACJ32626.1"
FT                   /translation="MVRFRRKAIMMEKRYRWKNEQIRQHVAVVDGKQAPTKVLMNATYL
FT                   HPYIRQWVQGNVWVYDDRIVYVGPNKPKQLDSCEVVDCSNQVLVAGYMEPHAHPFQLYN
FT                   PHTLAEYAAQHGTTTLINDNLFLFLQLTKKKAFSFLSEMEKQPVTMYWWCRLDPQTEMN
FT                   GEEYFFSYKNMKGWLENDAVLQVGELTGWPKLLEGDDFILHWIQEAKKIGKKVEGHFPG
FT                   ASDRTLTKMKLFGADADHEAMTGSDVYKRFMQGYTVSLRHSSIRPDLPTLLKEMKQCGI
FT                   HHYDHCMFTTDGSTPAFYENGMIDEMIRIALQEGVSDIDAYSMATWNVARYYNIDHLHG
FT                   SITPGRIAHINILEHASNPTPISVLASGQWVKRDGVPVVAFPTVNWDVHGLAPLSLCWN
FT                   LQMDDLQFSMPLGMYMENSVIIKPYSISIDTSADELSTDHDESFLMLIDRNGKWRVNTV
FT                   LKGFATHVQALVSSYSNTGDILLIGKSKRDLLVAFERMKQIGGGIVLCEHEEIIHEVPL
FT                   PLGGLMSDKPMKMLMEEEKMLGELLRARGYAFADPIYTLLFLSSTHLPYIRITPKGIYD
FT                   VMHKTVLFPTIMR"
FT   gene            266949..267971
FT                   /locus_tag="Aflv_0243"
FT   CDS_pept        266949..267971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0243"
FT                   /product="Predicted extracellular solute-binding protein,
FT                   TRAP-type"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32627"
FT                   /db_xref="InterPro:IPR021416"
FT                   /db_xref="InterPro:IPR023158"
FT                   /db_xref="InterPro:IPR035328"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFU7"
FT                   /protein_id="ACJ32627.1"
FT                   /translation="MLRRLLFGLIIMTVFMFGTGCQRPQSNVEENESPPKTVEQRNEQK
FT                   TEETTWTFPLTGMPAKEKAMQRAVAVMINNYPAARPQSGLHKADIVYEVLAEGDITRFL
FT                   AIYQSEQPDMIGPVRSARDYFIQLSNGFHALYVCHGWSPEAQKLLKSGAADYVNGLFYD
FT                   GTLFWRDRTRKAPHNSYISFENIKKGAEKNGYAFEEEVKPLPFFTNDLTNAVKATNIDV
FT                   VYSKRSYAHVHYAYDGTKYVRSSGGKPTVDRETNTPIAVENVFVIEATHQIIDDYGRRD
FT                   IDFTSGGKGYLFQEGTMQEVEWKNIDGRLLPYKDGVPLGFTRGKTWIQVVPNLEQVQYE
FT                   "
FT   gene            267964..268299
FT                   /locus_tag="Aflv_0244"
FT   CDS_pept        267964..268299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0244"
FT                   /product="Trp repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32628"
FT                   /db_xref="GOA:B7GFU8"
FT                   /db_xref="InterPro:IPR000831"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013368"
FT                   /db_xref="InterPro:IPR038116"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFU8"
FT                   /protein_id="ACJ32628.1"
FT                   /translation="MNRGTYMQINKLRGRELDQLFRAILSLQDLEECYRFFDDLCTVNE
FT                   IQALAQRLEVARMLREGYTYHKIETETGASTATISRVKRCLNYGNDAYAMALDRIYNEQ
FT                   QEEAGSQ"
FT   gene            268363..269058
FT                   /gene="pcrB"
FT                   /locus_tag="Aflv_0245"
FT   CDS_pept        268363..269058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcrB"
FT                   /locus_tag="Aflv_0245"
FT                   /product="Predicted phosphate-binding enzyme (TIM-barrel
FT                   fold), PcrB"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32629"
FT                   /db_xref="GOA:B7GFU9"
FT                   /db_xref="InterPro:IPR008205"
FT                   /db_xref="InterPro:IPR038597"
FT                   /db_xref="InterPro:IPR039074"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GFU9"
FT                   /protein_id="ACJ32629.1"
FT                   /translation="MNEITTWRHVFKLDPNKEITDEQLEQVCESGTDAIIVGGTDGVTL
FT                   ENVIDLLARVRRFSVPCALEVSDIEAITPGFDYYFIPMVLNSRDLTWLIDLHHEAVKQF
FT                   GDLINWEELFVEGYCILNDECKAASLTSARTNVTEEDVIAYARMAEHMYHFPIFYMEYS
FT                   GRYGDVALVEKVKRTLERTRLFYGGGIHTPEQAKEMAMWADTVVVGNAIYTNLQMALQT
FT                   VEAVKGKSA"
FT   gene            269088..271268
FT                   /gene="pcrA"
FT                   /locus_tag="Aflv_0246"
FT   CDS_pept        269088..271268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcrA"
FT                   /locus_tag="Aflv_0246"
FT                   /product="ATP-dependent DNA helicase PcrA"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32630"
FT                   /db_xref="GOA:B7GFV0"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005751"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFV0"
FT                   /protein_id="ACJ32630.1"
FT                   /translation="MVVKKMSMSAHMLLEGLNEKQKEAVKTTEGPLLIMAGAGSGKTRV
FT                   LTHRIAYLMAEKGVAPWNILAITFTNKAAREMKERVERIVGKQAEDIWISTFHSMCVRI
FT                   LRRDIDRIGIHANFSILDPTDQLSVLKHILKDRNIDPKKYDPRALLGAISSAKNDLVTP
FT                   EKYAEQAANPYEKLVAEVYQEYQKRLLRNHALDFDDLIMTTIQLFQRVPEVLEYYQRKF
FT                   QYIHVDEYQDTNRSQYLLVNMLAKRFQNLCVVGDSDQSIYRWRGADISNILSFEKDYPN
FT                   AKVILLEQNYRSTKRILQAANAVIEHNTQRKPKKLWTENSEGHALVYYEAMTEVDEAQF
FT                   VVGKIKEYVDAGKRTYKDFAVLYRTNAQSRVLEEMLLKANIPYKIVGGLKFYDRKEIKD
FT                   ILAYLRLIANPNDDISFTRIINVPKRGIGASTIDKIAAYASSQGISMFDALGSIEEMGI
FT                   SARIAAPLVQFREQIHHWSQMQHYLSVTELVEDVLDRSGYRDMLREEKTLEAHSRLENI
FT                   DEFLSVTQHFEQVNEDKSLVAFLTDLALVADIDQLDNDSEGQTNDAVVLMTLHSAKGLE
FT                   FPVVFLVGLEEGIFPHNRSLNDEDEMEEERRLAYVGITRAEEKLFLTRAHMRTLFGQTH
FT                   VNAPSRFIDEIPEELIEYAHKRVKKSSASVRPSTASQGEWRVGDKVSHKVWGVGTIVRV
FT                   KESDGDQELDVAFSSPIGIKRLLAKFAPITKV"
FT   gene            271274..273292
FT                   /gene="ligA"
FT                   /locus_tag="Aflv_0247"
FT   CDS_pept        271274..273292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ligA"
FT                   /locus_tag="Aflv_0247"
FT                   /product="NAD-dependent DNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32631"
FT                   /db_xref="GOA:B7GFV1"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GFV1"
FT                   /protein_id="ACJ32631.1"
FT                   /translation="MKNVAQHDVEKQIAELREQIEKHNYAYYVLDQPSISDAEYDELMR
FT                   KLMELEEQYPQYKTPDSPSQRVGGAPLEAFRKVTHRVPMLSLSNAFNEGDLRDFDRRVR
FT                   QEVGDVRYVCELKIDGLAVSLRYEDGYFVQGATRGDGTTGEDITENLKTIRSLPLRLRQ
FT                   QVTIEVRGEAYMPRKSFEKLNEKRKMNGEELFANPRNAAAGSLRQLDPKVAASRQLDIF
FT                   AYHVVNAEELGILSHSAALNYLDELGFKTNPARQVCETIDDVLSYIEQWHERRASLPYD
FT                   IDGIVIKVDAFAQQKQLGATAKSPRWAIAYKFPAEEVVTQLVDIELSVGRTGVVTPTAI
FT                   LQPVRVAGTIVQRASLHNEDYIREKDIRLGDYVVIKKAGDIIPEVVCSLPERRTGKEEP
FT                   FDMPTHCPACASELVRLDDEVALRCVNPQCPAQIREGLIHFVSRQAMNIDGLGEKVIAQ
FT                   LFEHRLVRSVADLYTLTKDELVALERMGEKSATNLLQAIEASKQNSLERLLFGLGIRHV
FT                   GAKAAKTLAEHFETMERLQQATKEELMAIHEIGEKMADSIVTYFSKEEVKQLLERLRAY
FT                   GVNMTYKGAKQTIDISSTFAGKTFVLTGTLQSMSRSEAKEKIETLGGKVTGSVSKKTDV
FT                   VVVGEDAGSKLEKAKQLGITIWDEARFLQEIQQSKQV"
FT   gene            273296..274429
FT                   /locus_tag="Aflv_0248"
FT   CDS_pept        273296..274429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0248"
FT                   /product="Alkaline D-peptidase family extracellular enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32632"
FT                   /db_xref="InterPro:IPR011426"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFV2"
FT                   /protein_id="ACJ32632.1"
FT                   /translation="MKKWIILLACMLLTLSACAPKFNQEEQVVQETDNKKQKAIIPKYN
FT                   ISNSYYRTILPFQPGEARGLVVENVNTRLDMDEFELGLMRIAQEKFSPSQYLFQQGQYL
FT                   DRKTIESWLKRKQGNGEGLNPALGNAGTNEEKNKKHPLYISHILEHNYLVKTEKDKVQL
FT                   GGVVIGLAMNSVHYYETEEGYPREVKISKSDMDKEGKKAAAEIVSRLRQIDGLKEVPIV
FT                   VGLFEQQPKSSIVPGHFFAVGYVDKGSNNIQDWEKINEEYYVFPSDEAEKNHRDDLVKF
FT                   LNLKSDIEEFFPNYTGVIGRAFYRDDQLQQLTIDIVMQFYGKAEVIGFTQYVTGLLMEK
FT                   MPDYMPISVYISSVRGPESIIIKNPDQNEPFVHIYQP"
FT   gene            274516..276063
FT                   /gene="rocA"
FT                   /locus_tag="Aflv_0249"
FT   CDS_pept        274516..276063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rocA"
FT                   /locus_tag="Aflv_0249"
FT                   /product="Pyrroline-5 carboxylate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32633"
FT                   /db_xref="GOA:B7GFV3"
FT                   /db_xref="InterPro:IPR005932"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GFV3"
FT                   /protein_id="ACJ32633.1"
FT                   /translation="MVQPYKHEPFTDFTVEANKKAFEEGLKTVQAYLGQDYPLVIGGER
FT                   VMTEDKIVSINPANKTEVVGRVAKANKDLAEKAMQTADAAFKWWSKTKPEMRADILFRA
FT                   AAIVRRRKHEFSALLVKEAGKPWKEADADTAEAIDFMEYYARQMLKLKDGIPVESRPGE
FT                   TNRFFYIPLGVGVVISPWNFPFAIMAGTTVAALVTGNTVLLKPASATPVVAYKFVEVLE
FT                   EAGLPAGVLNYIPGSGAEVGDYLVDHPRTRFISFTGSRDVGIRIYERAAKVHPGQIWLK
FT                   RVIAEMGGKDTIVVDKEADLELAAQSIVASAFGFSGQKCSACSRVVALEDVYDQVLNRV
FT                   VELTKQLKVGNPEEQSTFMGPVIDQSAYNKIMEYIEIGKQEGKLMTGGEGDDSKGFFIQ
FT                   PTVFADLDPKARIMQEEIFGPVVAFTKAKDFDHALEIANNTEYGLTGAVISNNRFNLEK
FT                   AREEFHVGNLYFNRGCTGAIVGYHPFGGFNMSGTDSKAGGPDYLLLHMQAKTVSEMF"
FT   gene            276150..276893
FT                   /locus_tag="Aflv_0250"
FT   CDS_pept        276150..276893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0250"
FT                   /product="Minimal nucleotidyltransferase fused to
FT                   substrate-bimding domain (HEPN domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32634"
FT                   /db_xref="GOA:B7GFV4"
FT                   /db_xref="InterPro:IPR010235"
FT                   /db_xref="InterPro:IPR041633"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFV4"
FT                   /protein_id="ACJ32634.1"
FT                   /translation="MGKKMYGLKEQTFYNLICVFQNYANIIERVILFGSRARGDYKETS
FT                   DIDIAIKFRSHNDQLYRIQDDLAEANIIYTVDAIDYEKITNEKLKSYIDLEGKTIFLTN
FT                   ERGEAVATMNKIIDKLFDFEKALNKLHQSIARDVEKDDLVLDATIQRFEFAYELAWKWM
FT                   KSYLEYNGNNEVTSPRKTIKQAFKEGLIQDGEAWIQMLEDRNRTSYTYDEQIAMEIYEH
FT                   IRERYVHLFDLLLVEMKKRVRELEE"
FT   gene            complement(276955..277386)
FT                   /locus_tag="Aflv_0251"
FT   CDS_pept        complement(276955..277386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0251"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32635"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFV5"
FT                   /protein_id="ACJ32635.1"
FT                   /translation="MPSYGHHDHVSIFGAVDVQQGDVVFHRASSANAKTFLYFLRRLKE
FT                   RYTDRFLVLVLDNARIHHAKMVQAFLDGEEGDAFHFIFLPPYFPQLNPIERLWKWLKDE
FT                   VIANVFHKDQNDIAQSITRFEQYVLQHPDEVLRRIGCTA"
FT   gene            complement(277364..278014)
FT                   /locus_tag="Aflv_0252"
FT   CDS_pept        complement(277364..278014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0252"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32636"
FT                   /db_xref="GOA:B7GFV6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025959"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFV6"
FT                   /protein_id="ACJ32636.1"
FT                   /translation="MKRLKITNDHGWTPRTLRKQERKIKDASLRVRVTAVRLVMEGHLG
FT                   KDVAKMVNLCRQSVAIYVARFNQGGLDHLLDRRLPPGRVPFLTEEQQQEIRQLVLTTTP
FT                   VDAGWGIASSWNTRILQSYIQQTYGVSMSREGIRKLLHRLCLSWTRPTYKLVKGDAKRQ
FT                   AAFQKELEFIKKTNYRECHAVLCGWDTCSRLSSAVYDMGRSRKSKTSAKLRPP"
FT   gene            278062..278403
FT                   /locus_tag="Aflv_0253"
FT   CDS_pept        278062..278403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0253"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32637"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFV7"
FT                   /protein_id="ACJ32637.1"
FT                   /translation="MKKGVHTEVIVLRCMYIERAQHRLEAKTPLPKKALAFVRRLQKRK
FT                   GEALRFLREAHVPFDNKQAERDLRMVKVKENISGTFRGETFAQSASQEASFPHLRNTKK
FT                   TCGTRYVFC"
FT   gene            278665..279912
FT                   /locus_tag="Aflv_0254"
FT   CDS_pept        278665..279912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0254"
FT                   /product="Fibronectin type 3 domains containing
FT                   extracellular protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32638"
FT                   /db_xref="InterPro:IPR021631"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFV8"
FT                   /protein_id="ACJ32638.1"
FT                   /translation="MFFMKKVVSLTISVVLLLFLGTITDGSSGDYIEVYLIEKSEDSLR
FT                   LTWKQISKAKKYVLYDNRGKVLYEGNEREFIHKNLTSGEMYEYVLAAFDKDEQLLTKMN
FT                   VITNTLHPLSNDSVKVDMFFNERMIKIDWSDIPNVQSYTVYRDGKPMVVVSQSEFKDFN
FT                   VSFGREYMYIIEGIEKVKKSDKEKDKVVEDEKNHVILISAKQVTDKRNMRFEEFSQSFS
FT                   TLAVEPVTSYRNTTFIKPAKISAPDGYCYGGDNRDFSASASTYRTRVDLSIYWQDRTYG
FT                   FSKYTSDSIRYNKNDNGTCGSTELARKNAGTSGITAVKEWITSSEAQFQISHSVGLPFL
FT                   MDVPPNIDYSYSLNIQKSGVTYINGSHDQYPWHEIYRSDNGGTWKTLYQFNPDAAGTNV
FT                   KYLFPSYPNKKIAVSK"
FT   gene            279939..280244
FT                   /locus_tag="Aflv_0255"
FT   CDS_pept        279939..280244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0255"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32639"
FT                   /db_xref="GOA:B7GFV9"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFV9"
FT                   /protein_id="ACJ32639.1"
FT                   /translation="MKKFLIGVLLSFVMFALSFSLFSGFSFFIAIFPIAVLAVPFICAV
FT                   TEALIFFIDEKWGFKWDGAVVLGIATITTLPFYPSCVLVAPIYIGALGYYVGRRIM"
FT   gene            complement(280327..280917)
FT                   /locus_tag="Aflv_0256"
FT   CDS_pept        complement(280327..280917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0256"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32640"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFW0"
FT                   /protein_id="ACJ32640.1"
FT                   /translation="MVVCKGGEKMSEQLLEKILLVVTDIQKELQDIREEQKAIREEQRA
FT                   IREEQQAIRKEQMAIREEQMAIREEQKTFREEINSLREEMNAFRKEQQLVREEQQALKN
FT                   GQKELYDLMNALLHRQDETDAKLEALTMDVHHMRGEMTAMKQEIHALNEKIDSHYKQFN
FT                   ERLNNLQLDVDFTVHKTTMTERELFKMRNRLFS"
FT   gene            complement(280950..282662)
FT                   /gene="adeC"
FT                   /locus_tag="Aflv_0257"
FT   CDS_pept        complement(280950..282662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adeC"
FT                   /locus_tag="Aflv_0257"
FT                   /product="Adenine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32641"
FT                   /db_xref="GOA:B7GFW1"
FT                   /db_xref="InterPro:IPR006679"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR026912"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFW1"
FT                   /protein_id="ACJ32641.1"
FT                   /translation="MKQLAVAAKKQLADVIVKNGKIVNVFTHDIIEGDIAIADGKIVGI
FT                   GEYDGQTVIDAKGKYVCPGLIDGHVHIESSMVTPSEFARVVVPHGVTTVITDPHEIANV
FT                   AGTKGIEFMLNDSDHIPLDVYVMLPSCVPATDFEHAGATLHAEQLTPFFSHPRVLGLAE
FT                   VMDYPSLLEGKQPMLAKLAAAMEANKLIDGHLAGLDETAVNVYRSANVHTDHECVTVHE
FT                   ALARVQRGMYVLIREGSVAKDLNKLLPAVNTYNARRFLFCTDDKHIDELVTEGSIDHHI
FT                   RLTIQAGMNPLTAIQMATLNAAECYRLYTKGAIAPGYDADFLLVEDLQSFSITNVYKKG
FT                   VLVAENGRATFSVTKATAIDQTIAQSVHTKKVTKEDVQIPFTREKQANVIQIIPNHLHT
FT                   KRLMTEVDVEHGVFQPSVERDLLKLVVVERHRGLGVGVGIVNGFQLKKGAIASSIAHDS
FT                   HNIIATGTNDNDIIVAIEHIKHINGGLAVVESGRVLADLPLEISGLMTAKRFEDVLERL
FT                   QKIHDALITIGASDEFNPFITLAFLALPVIPELKLTDQGLFDVSSFQFIDVEV"
FT   gene            283213..283512
FT                   /gene="gatC"
FT                   /locus_tag="Aflv_0258"
FT   CDS_pept        283213..283512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatC"
FT                   /locus_tag="Aflv_0258"
FT                   /product="Glutamyl-tRNA(Gln) amidotransferase subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32642"
FT                   /db_xref="GOA:B7GFW2"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFW2"
FT                   /protein_id="ACJ32642.1"
FT                   /translation="MKHMSRISIEQVKHVAHLARLAITEEEATMFAKQLDAIITFAEQL
FT                   NELDTENVPPTSHVLNMKNVMREDVPTAGLPLEDVLKNAPDHRDGQFRVPAILE"
FT   gene            283525..284982
FT                   /gene="gatA"
FT                   /locus_tag="Aflv_0259"
FT   CDS_pept        283525..284982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatA"
FT                   /locus_tag="Aflv_0259"
FT                   /product="Glutamyl-tRNA(Gln) amidotransferase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32643"
FT                   /db_xref="GOA:B7GFW3"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GFW3"
FT                   /protein_id="ACJ32643.1"
FT                   /translation="MSLFDYRVSELHSLLHKKEISVSDLVDESFKRIHEVDEKVQAFLT
FT                   LNEEQARAKAKELDEKLATEKEFGLLFGMPIGIKDNIVTKGLRTTCASKILYNFDPIYD
FT                   ATVVERLNEADAVTVGKLNMDEFAMGSSTENSGFQLTRNPWDLERVPGGSSGGSAAAVA
FT                   AGEVPFALGSDTGGSIRQPAAFCGVVGLKPTYGRVSRYGLVAFASSLDQIGPITRTVED
FT                   NAYLLQVISGLDPMDSTSANVDVPDYVSALTGDIQGLKIAVPKEYLGEGVSEEVRQSVL
FT                   DALKVLEGLGATWEEVSLPHSKYALATYYLLASSEASANLARFDGVRYGYRTDHAKNLM
FT                   EMYKQTRSEGFGNEVKRRIMLGTFALSSGYYDAYYKKAQKVRTLIKQDFENVFEKYDVI
FT                   IGPTTPTPAFKIGEKTSDPLTMYANDILTIPVNLAGVPGISIPCGFVNGLPVGLQIIGK
FT                   HFDESTIYRVAHAFEQATDYHKQKPTL"
FT   gene            284994..286427
FT                   /gene="gatB"
FT                   /locus_tag="Aflv_0260"
FT   CDS_pept        284994..286427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatB"
FT                   /locus_tag="Aflv_0260"
FT                   /product="Glutamyl-tRNA(Gln) amidotransferase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32644"
FT                   /db_xref="GOA:B7GFW4"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFW4"
FT                   /protein_id="ACJ32644.1"
FT                   /translation="MMNFEIVIGLEVHVELKTKSKIFSSSPNAFGAPPNTQTSVIDLGY
FT                   PGVLPVLNKQAVEYAMKAAMALNCEIATETKFDRKNYFYPDNPKAYQISQYDQPIGQNG
FT                   WIEIEVNGKKKKIGITRIHLEEDAGKLTHTGDGYSLVDFNRQGTPLIEIVSEPDIRSPE
FT                   EAYAYLEKLKSIIQYTGVSDCKMEEGSLRCDANISLRPIGSDKFGTKTELKNLNSFNFV
FT                   RQGLEYEAKRQEKILLSGGVIQQETRRFDEATKTTILMRTKEGSEDYRYFPEPDLVMLY
FT                   IDEEWKERVRASIPELPDARKKRYIEELGLPEYDAKVLTLTKEMADFFEATVANGADPK
FT                   LASNWLMVEVSAYLNAEQKELHDIALTPESLAGMIKLIQNGTISSKIAKKIFKELVEKG
FT                   GDPEQIVKDQGLVQISDEATLRKIVLEVLDANPQSIEDFKNGKDRAIGFLVGQIMKATK
FT                   GQANPPLVNKLLLEEINKR"
FT   gene            complement(286444..287013)
FT                   /locus_tag="Aflv_0261"
FT   CDS_pept        complement(286444..287013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0261"
FT                   /product="Endonuclease, Uma2 family (restriction
FT                   endonuclease fold)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32645"
FT                   /db_xref="GOA:B7GFR3"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFR3"
FT                   /protein_id="ACJ32645.1"
FT                   /translation="MPNKKRLWTYADYANLHEEKRYEGIDGALFMTPSPTPRHQRIVTA
FT                   LSALFFDFLQHSSCEVFVSPIDVCLFATKDTPLHDIKDWYIPDLIVVCDKQKIGDERIY
FT                   GAPDLIVEILSPSTAKHDRITKFHNYERAGVKEYWIVDPIHETVEIYALQDGQFRQVHM
FT                   HYKDETICPYIFPSCFIALPKVFTPM"
FT   gene            287953..288441
FT                   /locus_tag="Aflv_0262"
FT   CDS_pept        287953..288441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0262"
FT                   /product="Nitroreductase family domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32646"
FT                   /db_xref="GOA:B7GFR4"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR020051"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFR4"
FT                   /protein_id="ACJ32646.1"
FT                   /translation="MRKASASGGGLHPEEAYVIALRVDGLIPGLYHYRVQDHKLTLLTE
FT                   GKFEEKLIELLYHQYFARGLSVGIFITARFDKAWWKYRHSCAYRNVLLDIGHASQTFQL
FT                   CPTSLGYQTWITGAFQDIEVDSFLGVNGSIEGTIFFVGAGTGELKAIDELTLRHLASR"
FT   gene            288954..289649
FT                   /gene="azlC"
FT                   /locus_tag="Aflv_0263"
FT   CDS_pept        288954..289649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="azlC"
FT                   /locus_tag="Aflv_0263"
FT                   /product="Branched-chain amino acid permease (azaleucine
FT                   resistance)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32647"
FT                   /db_xref="GOA:B7GFW8"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFW8"
FT                   /protein_id="ACJ32647.1"
FT                   /translation="MNMTIRTIRTGISEALPLAIAIAAYGLSYGVLGIQAGFGLVGTVL
FT                   MSLLVFSGSVQMVTVAMITGGAGILSILVTATLLNLRNLLYGAALAEGIAPAKRWRWLL
FT                   SFGVSDEPFVLGISRFKKYGPDPIYFATVAGTFYIAWVSSSLIGAIIGNQIIDPQKWGL
FT                   DLAFPITFVALLVPNLTEKPIITTALTGAVITVILTVLFPGTPLNILVAGVLAPLVGIY
FT                   LKEKNKNVD"
FT   gene            289657..289950
FT                   /locus_tag="Aflv_0264"
FT   CDS_pept        289657..289950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0264"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32648"
FT                   /db_xref="GOA:B7GFW9"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFW9"
FT                   /protein_id="ACJ32648.1"
FT                   /translation="MIGLLAITTYISRIIGIEVMKGRKTSSTLRLYFNYVPAGILSALV
FT                   VSQLFISKDSQIQISFPIVIGGLVTALTIKISKSFLPSVIVGIVSGLLIRKL"
FT   gene            292597..293031
FT                   /locus_tag="Aflv_0265"
FT   CDS_pept        292597..293031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0265"
FT                   /product="SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32649"
FT                   /db_xref="GOA:B7GFX0"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFX0"
FT                   /protein_id="ACJ32649.1"
FT                   /translation="MDLNNYWDLQPDESKKWQENRYKQFGFVWGDEPGPTAKMAARLFA
FT                   EKGCKNILVAGCGYGRECVYFHEKGFKVTGIELSEEGIKLAKHWSQEKKLDIDFYVDSV
FT                   LDMKHPNDGYDAVFLHKVFHQFRYEDRKKNDQRVSSSSKR"
FT   gene            complement(293971..294309)
FT                   /locus_tag="Aflv_0266"
FT   CDS_pept        complement(293971..294309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0266"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32650"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFX1"
FT                   /protein_id="ACJ32650.1"
FT                   /translation="MVESLLYDMLHEVKVPRKKVESMEKRVDSLEKEVSSLRQQVQALD
FT                   EKVQALDEKMQRLDERTLETKAICEAVRHGQEALIAKYDALALDVHNMQGNINRLTNIS
FT                   EEKSFNSS"
FT   gene            294463..295965
FT                   /locus_tag="Aflv_0267"
FT   CDS_pept        294463..295965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0267"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32651"
FT                   /db_xref="InterPro:IPR013493"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFX2"
FT                   /protein_id="ACJ32651.1"
FT                   /translation="MIEGEHKMDTSWLKPITEAKYLVVDNAYRYRAILRYFYTQHERMR
FT                   QYLFPEEVYAFLKQFDEFQDYTEEELQQDLEQLVKWKNLIARQETGHIRTIEEFKKKRF
FT                   RYQCSPYTVEIERMIRTLEQLGDTFGGSLEKTRFDRLYASLVRMEAIIHAGFVEKREEM
FT                   NQVWEETFDYFRKIIQNSADYIAYLNGENMEERMMSDSFLVYKEQFTAYLRDFIVALQK
FT                   TSMQIEKLLEDLPADGVRRFIEEVVAYQLAIPRFEGAVLSREQLTEEKLDTWRSLKEWF
FT                   LGRNGHESELSFLQKQTNEAIRRMTRVVQRLGERHHHFRSRKKDYLHLAKWFSSLETVE
FT                   EAHKLSAVVFGCFHTKHIVAENDATENMYRDIWEEQPTEWLVKPRVRHYREKKKPEAMT
FT                   DRRKEKEEAMTAYLAAKQQEEEALAQLITDGKIVLQELPVVASHIRKTLLGWIAKAMGR
FT                   EDRIVQTENGWKVKVVQREGTITLKAEDGMLMMPNYEIHLLD"
FT   gene            295979..297145
FT                   /locus_tag="Aflv_0268"
FT   CDS_pept        295979..297145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0268"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32652"
FT                   /db_xref="InterPro:IPR013494"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFX3"
FT                   /protein_id="ACJ32652.1"
FT                   /translation="MEKEFDEKAKEALTALFEHFWIVREKEPELFQKIREREKVLKRYV
FT                   QEKFGYRLIVHRYFAKLEKIPAEPEAWMGIESFQEPLDYALFCCLLAYLEGKAVEEKFL
FT                   LSDVCEEIKAMYPGETVLDWTNYQHRRALIRVLKTAEQIGIVHHVDGELEAFANQEDEE
FT                   ALYEVPVLSRYFMRSYPKDFIQYETMEQLLEEEWKVSPDDYRRHSIYRQLFLSPVVYRR
FT                   QKDDPNFYYLRNFRHRLRDDIEAHTDFRYELYKNAALLTIPERQHVYTLFPDQKGTSDM
FT                   ILHLAAVVRAHLDKYPPDEYGQIHVTMSDFHQLLNHCMEQYGEGWSKTYREMTTAQLAS
FT                   ELLSALKAWKMAEHEQETGMVTLYPLLGRLVGRYPDDFTMKGRDDDDE"
FT   gene            297132..301271
FT                   /locus_tag="Aflv_0269"
FT   CDS_pept        297132..301271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0269"
FT                   /product="Predicted ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32653"
FT                   /db_xref="InterPro:IPR013496"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFX4"
FT                   /protein_id="ACJ32653.1"
FT                   /translation="MMTNKWVLHRAGLINFWYYDEQYFEFADGKLLLRGTNGSGKSVTM
FT                   QSLLPVLLDGKKTPDRLDPFGSRARRMEDYLLGEKEIVDRDERTGYLFLEYKRKQTEQY
FT                   VTTGIGLRAKRQKNMDFWGFVIFDNRRIGHDLFLYKTEKSANGTEKIPLTKRELTNLLG
FT                   NGGTVVDSQKEYMELVNKHVFRFESMEAFQELIELLIQLRSPKLSKDFKPTVIYEILES
FT                   SLPALTDDELRHLSETIENMDQTKQQLEQLERDEQSLKRLCTQYRAYNEYMIAEKASEW
FT                   LKADKQVKRLAEEEKQWIAEKAEKQTHLVDLNEYIQTLASEQDVLHQRELELASHEVFQ
FT                   AAKEYERVQQEIRDIHEKQQKLLRQIDEKEQLERRYKRQLEEDEDRRYQVEKQLAQQLE
FT                   DLRHDAMESSFSAHDLNEADFSRQRQTKFDFTVWKREGQEYVEKLEQIIALWRRHDEKK
FT                   ARYEETSKEVGDLQREVDGLRHEEAKWLELLENEKSRFQQEVFRWLEQCQDVSVQEASV
FT                   QLFLQRLHELYETYHVDEMKQPFAEAYYDALNRKNEEKMKQKHACTLLEEKIAAKEAEW
FT                   SQWKTQKDPELARDEQTMAARAELDEKGIAFVPFYAGVEFQDHVPEPLRERIESALYHA
FT                   GLLDALITETNVDIKCDRVIVPRPVELAHTLADYLQPDVEEGCKVSTTRIKEVLQSIVF
FT                   ADGAMEGTFTLNEEGHYTLGVVKGHAPTREKALFIGRAARKRWRLEKIAALEAELLELR
FT                   AQLHKQTDMLKQLEQTIAQINSWFRAFPTDRDMRAAFEEWEKTKRYIISKQQERERKNE
FT                   KLAQLARDWQQAKQTLREQTEGLDLEFSKDGYEQALLLMKSYMRRLHELQMTHREFLHL
FT                   LDMIHHRTEQLETLQQEIDETKGERYVLAKEQQKIELKRQEIERTLQLMGAEEIQAEIQ
FT                   RVRDRLAFLQREIPAKMNERIALEHALKTIREKCAQLSVKEAFAKRLAAAWKQSFEREV
FT                   ALELVELHGADLLEKAKEAMQRYGALAKETRTSLVNRLNSIFFQESASLTEYRLSQEPV
FT                   AIEGTNPFADIELDEEMELKVAGWREKQDRIVLLLDYKGQRVSPFYVLHEIEHDIFLQR
FT                   EYMKEQDRELYEEIILKTIGRILRSRIQRAERWVKDMNERMQQLDTSSGLVLFIQWKPR
FT                   TAETEEEMDTKELVELLRMNSRLLKDEDLQRVTKHFRSKINRARELLEERGQGNTLHQI
FT                   IKEVLDYRKWFSFTLYYQKTNEPKRELTNQRFYQFSGGEKAMAMYIPLFAATYSRYQEA
FT                   ADDAPYIISLDEAFAGVDENNIRNMFGLVEQLGFNYVMNSQALWGDYDTVPALSICELV
FT                   RPKNASFVTVIRYYWNGKVKQLITEARKDELIEPVR"
FT   gene            301246..302490
FT                   /locus_tag="Aflv_0270"
FT   CDS_pept        301246..302490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0270"
FT                   /product="DNA topoisomerase IV subunit A, contains TOPRIM
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32654"
FT                   /db_xref="GOA:B7GFX5"
FT                   /db_xref="InterPro:IPR013495"
FT                   /db_xref="InterPro:IPR024465"
FT                   /db_xref="InterPro:IPR024466"
FT                   /db_xref="InterPro:IPR036078"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFX5"
FT                   /protein_id="ACJ32654.1"
FT                   /translation="MSSLNRLDEAVQFFRGERSFHRLFCEMKKKYESLGRVGGTISVTS
FT                   FSAEEKEAIASFFGKEMSRVSLAAFEQQLGNTKFAGISLVELLACYFGEPLVTKKEQQQ
FT                   EIAREKEAYFARLMNTYRAPRDWLVAVENQRFVQLAYQQNPQALETAISIVCRALEQLP
FT                   STYVRLPVFAQQVANDPHALDLHTLAGKLLLSALQFYAEKEYDLSSVEDVNELLQSYRL
FT                   LREDVLNFVTCAGVLADTDKGRHPVFVAACETNTALNVPLREVMPLVRAYPYLGSVIFV
FT                   VENAGVFSTLLEANVPLVSTNGQLNLATIWLLDLLVKEGTTLYYSGDFDPEGLKMAQRL
FT                   VDRYGSSVRLWHYDKFDYLATNPTVPLSGERLAKLQSVTLRDLQPVKQEMIRQKKAGYQ
FT                   EAIVEELKRDTYLGG"
FT   gene            302495..303844
FT                   /locus_tag="Aflv_0271"
FT   CDS_pept        302495..303844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0271"
FT                   /product="NAD-dependent aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32655"
FT                   /db_xref="GOA:B7GFX6"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFX6"
FT                   /protein_id="ACJ32655.1"
FT                   /translation="MNDHLQKQKRYFRTGATLSLSFRLAQLARLKETIQVHEQAIIDTL
FT                   AKELNKSPLEAYTTEIGVVYEEINFITKRLARWMKPKRVPTPLTHLGSKSYVYPEPYGV
FT                   SLIIAPWNYPFQLAISPLIGAIAAGNCAVVKPSEYTPAMSALLKTIVSEAFPEEYITVV
FT                   EGGADVSQQLLNLRFDHIFFTGSVPVGKIVMAAAAKHLTPVTLELGGKSPVIVDSSAHL
FT                   ELAAKRIVWGKFLNAGQTCIAPDYVLVHEAIKQPLLEKMKRYIDELYGNRDAYGRIVSK
FT                   RHAERLVRFLTNGTIVHGGNYDIEQRWMEPTLIDDVTWDDAIMQEEIFGPLLPILTFQT
FT                   MEEAIRTVQDHEKPLALYLFAEDEHVQRQVLAQVSFGGGCINDTIMHIANPHLPFGGVG
FT                   QSGIGAYHGKASFDAFSHDKSVVKQTTAFDIPIRYPNFPNAIKWVRKLLK"
FT   gene            304202..305176
FT                   /gene="qoxA"
FT                   /locus_tag="Aflv_0272"
FT   CDS_pept        304202..305176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qoxA"
FT                   /locus_tag="Aflv_0272"
FT                   /product="Cytochrome aa3 quinol oxidase subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32656"
FT                   /db_xref="GOA:B7GFX7"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR006332"
FT                   /db_xref="InterPro:IPR006333"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR034227"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFX7"
FT                   /protein_id="ACJ32656.1"
FT                   /translation="MMKRLFSLLVVGLLPLLAGCEMVVFQPQGPAARSITELINWSIGW
FT                   MLLVVVVVFALFAYIVWKYRDRPERQGEEPPEEHGSTVLEIVWTVIPILVVIALTIPTV
FT                   KTLYDLEKPPKGYEDEKPLVIHVTSADWKWIFSYPEQNIETVNYVNIPAGRLVLFKMTS
FT                   ASTMQSFWVPALAGQKYTMNKMETELYVVADRPGSYEGRNTNFNGRGYAHMQFEVLAQT
FT                   PKEFDKWVQEVKQMAPKLTKEKYEQLLLPTHLGRLTFVDTHLQWVNHADPHSKTYTNPE
FT                   LYRGHGYQGKIFIREDNYKSSSICNDEQQKALESDSGGEHHGH"
FT   gene            305145..307142
FT                   /gene="qoxB"
FT                   /locus_tag="Aflv_0273"
FT   CDS_pept        305145..307142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qoxB"
FT                   /locus_tag="Aflv_0273"
FT                   /product="Cytochrome aa3 quinol oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32657"
FT                   /db_xref="GOA:B7GFX8"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014233"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFX8"
FT                   /protein_id="ACJ32657.1"
FT                   /translation="MIAEVNIMGIKWNEIFVGGDPLLVGSQIAIVLTVVAIVVGLTYFK
FT                   KWGWLWREWLTTVDHKKIGIMYILSGVLMFFRGGMDGLLMKAQTARPEMKFLDAQHYNE
FT                   IFTTHGVIMILFMAMPFLIGLMNVVVPLQIGARDVAFPQLNALSFWLFFSGAMLFNISF
FT                   VVGGSPDAGWTSYFPLAGKEFSPGIGNNYYAIALQIAGLGTLMTGINFIVTILKMRAPG
FT                   MTLMKMPMFTWTTLITSIIIVAAFPIFTVALALMTFDRLYGTHFFTLSSGGSDMLWANL
FT                   FWLWGHPEVYIVILPAFGIFSEVIATFSRKTLYGYTSMVISIVGIAFLSMIVWVHHFYT
FT                   MDAGPAVNSFFSITTMLIAVPTGVKMFNWLFTMRKGRIQFTTAMLWALAFVPNFVIGGV
FT                   TGVMLAMAAADYQYHNTLFLVAHFHYVLIPGVVFAVFAGLYYWWPKMFGFMLNEKLGKY
FT                   HFWLFTIGFNVTFMPMFFLGLKGAVRRAYTYSAESGFAPLFLVSAIGSIILAIGFAVFC
FT                   YNIYWSFRYAKRDVSHDPWDARTLEWMTASPVQFYNFAVVPEVKQLDAFWHMKKRGETL
FT                   TLKGSDIKKIHMPSNSGLPFYMAVVFGITGFFLVFEAHIAAAIAAIGIVIGLIIRSFDY
FT                   NDGYYVSVDEIKQTERTWRTVEGGTENHVG"
FT   gene            307132..307737
FT                   /gene="qoxC"
FT                   /locus_tag="Aflv_0274"
FT   CDS_pept        307132..307737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qoxC"
FT                   /locus_tag="Aflv_0274"
FT                   /product="Cytochrome aa3 quinol oxidase subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32658"
FT                   /db_xref="GOA:B7GFX9"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR014206"
FT                   /db_xref="InterPro:IPR014246"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033946"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFX9"
FT                   /protein_id="ACJ32658.1"
FT                   /translation="MSANVNHSLPLEYQTEQNRLNILGFWIFLGAEIVLFATLFAVYGV
FT                   LGHRYAGGPTPSDIFKLNDVLIETLLLLTSSFTCGLAVFFMRQRDMKKLLVWLIITLLL
FT                   GAGFLFMEIREFIHYVHEGATMQTSAFLSSFFVLLGTHGAHVTFGIIWAVMLIIQLLQR
FT                   GLTPMTARKMFIISLYWHFLDVVWIFIFTFVYLKGMVG"
FT   gene            307738..308037
FT                   /gene="qoxD"
FT                   /locus_tag="Aflv_0275"
FT   CDS_pept        307738..308037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qoxD"
FT                   /locus_tag="Aflv_0275"
FT                   /product="Cytochrome aa3 quinol oxidase subunit IV"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32659"
FT                   /db_xref="GOA:B7GFY0"
FT                   /db_xref="InterPro:IPR005171"
FT                   /db_xref="InterPro:IPR014250"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFY0"
FT                   /protein_id="ACJ32659.1"
FT                   /translation="MEHKSKYPVSHVVGFLFSLILTFVAVFVALKMNVSYTIVMWIIGS
FT                   LAVIQAGLQLFMFMHVTEGEDGKTNVINMAYAVFVAIVIVAGSIWVLTSGHAAH"
FT   gene            308139..309647
FT                   /locus_tag="Aflv_0276"
FT   CDS_pept        308139..309647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0276"
FT                   /product="Sensory protein with an HD-GYP output domain"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32660"
FT                   /db_xref="GOA:B7GFY1"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFY1"
FT                   /protein_id="ACJ32660.1"
FT                   /translation="MRIYEETLKKLFINYTIGSVLAVVGVGSTLMVMALNIRQVDLLML
FT                   LLIQFFSFCMMLFIEYRAFQKDIHPIRRIFYETNVTEEQFYWALVQAKRFPLLTVRRIA
FT                   LPHFLGLSVPAVALTLSLIFIDVLRIPYMYVAYALFGALLIAMLHAMIEFFLTLRTMRP
FT                   LIRDMMQIGRMHRFHEAIRATNVVYVPLKIKIGLSVLFIGIFPVLLFVLATEVKLFAEG
FT                   QNTFSGYWTWTIVVLVISVLFSLFAARVLSEDVERSIEDLLQYMSRVQRKEYELMCDNV
FT                   YIDEFSELTNGFNHMVDAIVERDEKNKQLLNSFISVMTTALDARDEYTAGHSQRVAVYA
FT                   VEIGKRLGMTNEQLARLYRSAILHDIGKIGIPDHILLKDGKLTDEEFAWIKKHPALGEN
FT                   IIRQVQPIEEVKDLLPGIRSHHERIDGKGYPDGLEGEDIPLFGRIIAVADAFDAMTSDR
FT                   PYRKGMHVEKAVSILLEGRGTQWDAQMVDCFISFLKEREQEKVS"
FT   gene            309578..310408
FT                   /locus_tag="Aflv_0277"
FT   CDS_pept        309578..310408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0277"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32661"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFY2"
FT                   /protein_id="ACJ32661.1"
FT                   /translation="MGCPNGRLFYFFFKGERTRKSELDANDGIYFFYVSDILKEKGCEI
FT                   VKRLIISFIILLAGCANVNEQGPSNVKQLEQTIAKQQTTIDQLQEKNEQLQKENEQLKS
FT                   EVNQMTSSSLLSVALDVVEALKNKDMNALASYVHSTAGVRFSPYGHVDIQNDLQFSASQ
FT                   LPSLWSSTQVYQWGVYDGSGDPIQFTFQDYFDRFVYDVDFANPHMIGNNVAVGTGNMIN
FT                   NIQQVYPNGSFVEFHFTGFDPQYSGMDWRSLRLVFEQENGQWKLVGIIHDEWTT"
FT   gene            complement(310447..311118)
FT                   /gene="pspA"
FT                   /locus_tag="Aflv_0278"
FT   CDS_pept        complement(310447..311118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pspA"
FT                   /locus_tag="Aflv_0278"
FT                   /product="Phage shock protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32662"
FT                   /db_xref="InterPro:IPR007157"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFY3"
FT                   /protein_id="ACJ32662.1"
FT                   /translation="MNGKKQSKRRKSDMGIFKRVKHVVLADIHDIIDKCEDPIRMTKQY
FT                   IRELEEQLEQAQQALAQQFVLEQKYERLIADAEEMIAKRARQAKLAVEKNEEPIAKMAL
FT                   QEKVAYEKKLELYTQQYNTLKEKTTVLTEKVKQLYETYEQLKLKQMQLMTRFYVAETMK
FT                   QMDEAITSFRYDHIVKGFARMEEKVMLLEAEAKARSVIQTLPPQSFDIEVEQQLKQLKG
FT                   E"
FT   gene            complement(311081..311584)
FT                   /locus_tag="Aflv_0279"
FT   CDS_pept        complement(311081..311584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0279"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32663"
FT                   /db_xref="GOA:B7GFY4"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFY4"
FT                   /protein_id="ACJ32663.1"
FT                   /translation="MTKEVMDVKKRTVFFLIGGLVVVAVFAHIATYFMHIGWSGRMPAE
FT                   HIMGMGKHHRAFGHHGPQMMRPHGMPMFGWIPFLLQLALIIIGWIVWKTTHGGGKWIGG
FT                   ALMAIGLVALLPKALLAVLAIVAAYILFRGKTKPATEFEPFVPPIQNHSFLDEWEKTIQ
FT                   KEEK"
FT   gene            complement(311649..313073)
FT                   /gene="resE"
FT                   /locus_tag="Aflv_0280"
FT   CDS_pept        complement(311649..313073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="resE"
FT                   /locus_tag="Aflv_0280"
FT                   /product="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32664"
FT                   /db_xref="GOA:B7GFY5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFY5"
FT                   /protein_id="ACJ32664.1"
FT                   /translation="MAMNNNNLLKRCAGWDIPLKNSIRSFFHHSDMFRRTQWRLTTTYS
FT                   GILIAFLAIFIAVVSFFIHAVITNDQERRIRTLAEQEGQTIQNMLEEQSFIGWPTDQNV
FT                   IFLSEDQLFFYVVDTRGRLMMGDEVNKGLRPLLLSTLQPWTPEKNELRYVEVTIPHHRH
FT                   ELKRFRADELKILTAARPIIIDRQLIGVLYVGMDVTSMFRLLKWSTFILLSLGILFIAV
FT                   AIAFSYFMSKRALVPIQDAYNRQRQFVADASHELRTPLSVIYSSVEALKMDASLTSDPF
FT                   SQKTIERLGDETKRMTKLINDLLTLARTDDAKLQIERKPFELRACAERTLQSLQELANK
FT                   KNITLQFHASEQIEFVGDEDKCTQLLYILLDNAIKYTPEGGTVSLSLAQHVIKQRKVVT
FT                   MSVADTGIGIAPEHLPRIFDRFYRADKARTRQIGGHGLGLSIAKWIVEAHEGNIHVESE
FT                   VGKGTTFTITFPNERA"
FT   gene            complement(313009..313689)
FT                   /locus_tag="Aflv_0281"
FT   CDS_pept        complement(313009..313689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0281"
FT                   /product="DNA-binding response regulator, OmpR family
FT                   (REC-wHTH domains)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32665"
FT                   /db_xref="GOA:B7GFY6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFY6"
FT                   /protein_id="ACJ32665.1"
FT                   /translation="MMRMRVLLAEDDIYLGELIVHLLKKKGVEHVDWVQEGEDAYDYAL
FT                   ASFYDVIILDWMLPNGDGVSICQRLRKRGYHGAILMLTAKDAVQDRVEGLEAGADDYLV
FT                   KPFEIDELMARLKALSRRTFAPIQEEIVRWGAFEVNRTSHTLLKDGEQIILTPREFQLL
FT                   DLLLQNRGRVLTRDIILDRIWGYDADVSMKTIDATVKLLRKKIGDEQQQLIKTVRGVGY
FT                   TIEK"
FT   gene            313840..315039
FT                   /locus_tag="Aflv_0282"
FT   CDS_pept        313840..315039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0282"
FT                   /product="NAD(FAD)-dependent dehydrogenase"
FT                   /note="similar to sulfide-quinone reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32666"
FT                   /db_xref="GOA:B7GFY7"
FT                   /db_xref="InterPro:IPR015904"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFY7"
FT                   /protein_id="ACJ32666.1"
FT                   /translation="MANVYDVKVAIVGSGSAGISIAARLLRKNRQLHGQVLLIDPSDKH
FT                   YYQPLWTLVGGGAAKVEDSVREQASLIPDGAKWLKEAVDTFSPENNMLKTKEGSTVRYD
FT                   YLVVAAGVGIYWDQIKGLKETIGKNGVCSNYSYDYVQSTWENIRNFRGGTAIFTQPSTQ
FT                   VKCGGAPQKIMYLADDYFRQSGVRDKTNIIFASGLPNIFAVKRYADTLEQVIQRKNIET
FT                   KYRVELVEIDGEAKQATFEHLDTNERFTLSFDMIHVTPPMGPPAFIKKSPLADEAGWVD
FT                   VDPYTLQHKTYENVFGAGDCTNLPTSKTGAAIRKQAPVVAENLLAHMNGKPLKARYDGY
FT                   TSCPLVTGYNKLVLAEFDYDKNPQETFPFDQSKERLSMYIMKRNLLPIVYWNGMLKGLM
FT                   "
FT   gene            315052..315576
FT                   /locus_tag="Aflv_0283"
FT   CDS_pept        315052..315576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0283"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32667"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFY8"
FT                   /protein_id="ACJ32667.1"
FT                   /translation="MLQLIENEEQQEALRYFIEKLPQLKEAMESVEEKIAVVQHVMNDK
FT                   QSLEAMFTEWEEKAAPFRLTSEHLEALATLVQLLPTLVQWLQKAEAFISFATSVINDRD
FT                   SMAYAIQGAKEIVPIEKGLTILKETNERFQRERDSSAVSLLRMYRLLKHPLIQDGMKYI
FT                   ETLLDVASKHK"
FT   gene            315578..317002
FT                   /locus_tag="Aflv_0284"
FT   CDS_pept        315578..317002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0284"
FT                   /product="Zn-dependent hydrolase and Rhodanese-related
FT                   sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32668"
FT                   /db_xref="GOA:B7GFY9"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFY9"
FT                   /protein_id="ACJ32668.1"
FT                   /translation="MEGMYMLFRSFFDEQLAHMSYLVGCQRTGEAIVIDPGRNVDWYID
FT                   TAKKEGLQIVAATETHIHADFVSGAKELAKCCGAKLYLSDEGDANWKYQYLDEVDYELV
FT                   KEGSIFTVGNVEFKVLHTPGHTPEHISFILTDKGGGSTEPMGIFTGDFVFVGDIGRPDL
FT                   LEKAAGVAGTADVGARQMFQSLKKFKALPDYLQVWPAHGAGSACGKALGAVPVSTVGYE
FT                   KLNNWALKIEDEEEFVKLLLTGQPEPPKYFAMMKKVNKIGPAYLNDEEVQVLQTIEQLN
FT                   EYKANGAFILDVRPSQEFAKAHYAGAINIPFNKSFTNWAGWLINYDQDIVLIANQEDVQ
FT                   TIRKALAYIGLDRVVAYIEPSVALSGEVESYEEIDVHQLQQYLKDDRYHLVDVRNQAEW
FT                   DEGYIAGAQHIMLGTLVDRLHELPEGKTYIVQCRSGARSAIGASILQAKGLKQVLNLKG
FT                   GYLAWTREKLPIVKQS"
FT   gene            317069..318088
FT                   /locus_tag="Aflv_0285"
FT   CDS_pept        317069..318088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0285"
FT                   /product="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32669"
FT                   /db_xref="GOA:B7GFZ0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR017203"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFZ0"
FT                   /protein_id="ACJ32669.1"
FT                   /translation="MQFLDKIFAYIQDGIIVMNHERTIVEMNPAAKRLTGWQLGEKVPY
FT                   CSFCQERDVKEGEERCYLISTEEVPYFLSEMPTYHGHLIDVEMSTALILEQDDAKYYLL
FT                   VLRDQTAKKKEEEARRSKWMVKKLTEAKEEEHKRLAQELHDGVGQSLYSISIALDNIIQ
FT                   RVQDERLHAYVKEVREELGRVMEDVKLYAQQLRPKSLDALGLIPTIQSLIHSLQSKMPN
FT                   TSFSFQTNVYTRLSPTMEINLYRIIQEALHNVMKYAKATEVRVSIKQTERELLVSVEDN
FT                   GVGFHVEEKREGLGLKHIQERVFHLGGETTITSAPMKGTTIFVRVPLEEGGEDESVNR"
FT   gene            318060..318701
FT                   /gene="yvqC"
FT                   /locus_tag="Aflv_0286"
FT   CDS_pept        318060..318701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yvqC"
FT                   /locus_tag="Aflv_0286"
FT                   /product="DNA-binding response regulator, NarL family
FT                   (REC-HTH domains)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32670"
FT                   /db_xref="GOA:B7GFZ1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFZ1"
FT                   /protein_id="ACJ32670.1"
FT                   /translation="MERMKVLIVDDHDLIRKGIRLLLEGFSDVEVVGEASNGCDAITLA
FT                   LKYHPDVILLDLSMPTGLDGFTTAKTIMDELEDVKIIVLTMHDEEIYVQKAIQYNIHGY
FT                   LLKNSQTNDLHEALQAVYHGKRFYRTHIPEERLEKMFAEKEPRSPLTNREREIVRLTFL
FT                   GYTNNQIANKLKISPKTVENHKTNIMQKLGIKEKHELIQYALKNHIADLV"
FT   gene            318714..319505
FT                   /locus_tag="Aflv_0287"
FT   CDS_pept        318714..319505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0287"
FT                   /product="Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32671"
FT                   /db_xref="GOA:B7GFZ2"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFZ2"
FT                   /protein_id="ACJ32671.1"
FT                   /translation="MMEYTVSYLLVLFLIGAIGSILSGMVGIGGSVIKYPMLLYIPPLL
FT                   GFVAFTAQEVSAISAVQVFFSTLAALVVFKKGGYVSFRLVGYMGTAIVIGSFIGGYGSK
FT                   FLADETINFVYAILASIAAILMFFPKPKGSEEVSAEQLTFNRFYAVVLSFIVGVASGIV
FT                   GAAGAFVIVPIMLVILKVPTRIAIGSSVAITFISSIGATIGKVMGGHMLLVPSLVMVIA
FT                   SLLAAPVGAKLSQKINTKVLEYILLVLIVATVIKIWYEMLV"
FT   gene            319597..320532
FT                   /locus_tag="Aflv_0288"
FT   CDS_pept        319597..320532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0288"
FT                   /product="Diacylglycerol kinase family enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32672"
FT                   /db_xref="GOA:B7GFZ3"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR005218"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFZ3"
FT                   /protein_id="ACJ32672.1"
FT                   /translation="MMRMKRARIIYNPTSGREIFKKHLPDVLIRLEQAGYETSCHATTG
FT                   AGDATEAARKAVEREFDLVIAAGGDGTINEVVNGLADASYRPNLGIIPVGTTNDFARAI
FT                   GVPRSIEGACDVIVNGEAVPIDIGAVTNEGKTHYFINIAGGGRLTELTYEVPSKLKTMI
FT                   GQLAYYLKGIEMLPSLHPVHVKIEYDGKMFEGAVMLFLVSLTNSVGGFEKLAPDSSLND
FT                   GMFDLIILKETNLAEFIKIATLALRGEHIHDPHVIYTKANRVKVYTEENMQLNLDGEYG
FT                   GMLPGEFVNLYRHINVFVPKEKAEQMRTGE"
FT   gene            320597..321967
FT                   /locus_tag="Aflv_0289"
FT   CDS_pept        320597..321967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0289"
FT                   /product="Methyltransferase"
FT                   /note="related to tRNA (uracil-5-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32673"
FT                   /db_xref="GOA:B7GFZ4"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFZ4"
FT                   /protein_id="ACJ32673.1"
FT                   /translation="MEAPVAKNEYYDVIFEDLTHDGAGVAKIDGFPIFVPNGLPGEKAK
FT                   VKVIKVKKGYGYGRLIELYEPSADRVEAPCTVYKQCGGCQLQHLSYEGQLKAKHKHVKE
FT                   VLARIGKIEDVTVHPVLGMNDPWRYRNKAQVPVGEREGGLVAGFYKERSHDIIDMDTCL
FT                   IQQEMNDIVVQTVKQICEQYNIPAYNEQTHKGLLRHIMARYGATTKEVMVVLITRTEEL
FT                   PHKNKIVEAIVKRVPNVKSIVQNINPKRTNVIMGEQTRVLWGSEYIYDYIGDIQFAISA
FT                   RSFYQVNPEQTKVLYEKALEYAELTGEETVIDAYCGIGTISLFLAKNAKKVYGVEVVPE
FT                   AIEDAKRNAELNGMTNVEFAVGEAEVVIPKWYEQGVKADCIVVDPPRKGCDESLLQTII
FT                   AMKPKRVVYVSCNPATLARDLRILEDGGYKTLEVQPVDMFPHTVHVECVVKLEVSKC"
FT   gene            322140..323351
FT                   /locus_tag="Aflv_0290"
FT   CDS_pept        322140..323351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0290"
FT                   /product="Permease of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32674"
FT                   /db_xref="GOA:B7GFZ5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFZ5"
FT                   /protein_id="ACJ32674.1"
FT                   /translation="MENIKKLHPISITIIIGTLFARMAMFMTIPFLAIYLTSVKGVSAS
FT                   FAGAIIGISSIVGLFGGFFGGYFSDRYGKEKMMKMSLLMWTFVFIGFATAESVWTFFLL
FT                   NALNGLCRSFFEPSSRALLSQVTKQENKLLVFNLRYAAINVGAAIGPLVGLKIGASSST
FT                   TAFFVTSFVYFLYFILLVTLFSKYTIEKHSDASEHVTLRNAVTVLGNDRVFLFAVIGMI
FT                   LGITGYSQFNSTIPQYLSQYKDGVQLFSYLIVFNAITVLVVQYPVSRIGKHYSALTSIM
FT                   LGIGAVALGLFGFGLFTAVPMLFVSMFVLTVGEVMMFSMTDIFIDQIAPKHMKGLYFGS
FT                   MGFTAIGNAIGPWIGGLMLEHLGYGNQLLIFTLLALCTSIGFPVLLYVGRLIKATKRHI
FT                   EYSL"
FT   gene            323388..324596
FT                   /locus_tag="Aflv_0291"
FT   CDS_pept        323388..324596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0291"
FT                   /product="Uncharacterized conserved two domain fusion
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32675"
FT                   /db_xref="InterPro:IPR032250"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFZ6"
FT                   /protein_id="ACJ32675.1"
FT                   /translation="MKKSIFVFSLLVAVMTVGVFFYKKNDFKQNVDFARLDEKELFSYK
FT                   SQYVGDVSNVSGLLDQLAFGTYRRSVSLQTVKEPYGMTVHYDMENTEMGLKKIEKLLYD
FT                   NAVILFVLIENLDRITFDMNVDAKHVSYSFEREQVQKQMDEHLSVYAKDIDRFRSLLYA
FT                   LKGVGDVEKAVSEAIKEHGKTYGKGEYITEGHIILGAEQKGNEVKAYTIASVGVFEFQD
FT                   GIFAIVSGSGAIPTVMTFSIDEHGQYKIIAYEEPLDGDAYAKSVKRMFPKKYYSQVLYA
FT                   EKYYDELAEQQERQAREYLKQIGRDAKVSTWHVEKQPLNISVEAMNHFLTMLGSDPFLS
FT                   KCPDWLGTREVIEQGIRYVYETSQSKTNDERDVIVLKKMEEDGTIIDMRQYVIGENKLK
FT                   LIK"
FT   gene            complement(324664..325401)
FT                   /locus_tag="Aflv_0292"
FT   CDS_pept        complement(324664..325401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0292"
FT                   /product="Signal transduction protein (PAS, MCP domains)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32676"
FT                   /db_xref="GOA:B7GFZ7"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFZ7"
FT                   /protein_id="ACJ32676.1"
FT                   /translation="MGCSLDELKHMHHKQFCLSDFANSPQYLSFCKNLSQGKTFHEKVM
FT                   RINRKGERIWLDAFYVHVLNENKHPYAVLKIATDVTYQQHVLQESVNEFVGLLEEMTAS
FT                   TEHLHTFSKKIVTDMQQLREEAERSIQTFEQIQAITAFVKEVALKSNLLGLNAPIEAAR
FT                   AGEHGKGFAIVANEIRKMAEKSREAADHITKKLENFSKLTIAIDYISQNMKDDVNHTYE
FT                   SLNELKKSYEHIAHLTEQLSKII"
FT   gene            325666..326043
FT                   /gene="padR"
FT                   /locus_tag="Aflv_0293"
FT   CDS_pept        325666..326043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="padR"
FT                   /locus_tag="Aflv_0293"
FT                   /product="Predicted transcriptional regulator, PadR family"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32677"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFZ8"
FT                   /protein_id="ACJ32677.1"
FT                   /translation="MNTNKIEYVGGVFLENLSEMLKGILEGIVLEIISRGEIYGYEITK
FT                   KLHALGFQGIAEATVYALLLRLEKNKLVHITKKPSDMGPPRKFYTLNERGFEELAAFWA
FT                   KWDFLSERIHLLRTNGGEKNV"
FT   gene            326021..326608
FT                   /locus_tag="Aflv_0294"
FT   CDS_pept        326021..326608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0294"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32678"
FT                   /db_xref="GOA:B7GFZ9"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFZ9"
FT                   /protein_id="ACJ32678.1"
FT                   /translation="MEERKMFSHEMKEKIKQFAKEQAPYYLEEAEMTYMEKVRRKTGET
FT                   KSKLMAKLAKFKSRSETAMEAENDMILYMSDYMKDLMEQGLSEQEAFEQAKKELKFRSE
FT                   TTKSADLQERIVAHYHHMDIADYEAVGLFYGAFVFLGISIGALIGFIGSGGWEMFLSGG
FT                   WIRTLIGAIIGFLIGTGLGLLSNAVIVLKRKS"
FT   gene            326980..327459
FT                   /gene="sigV"
FT                   /locus_tag="Aflv_0295"
FT   CDS_pept        326980..327459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sigV"
FT                   /locus_tag="Aflv_0295"
FT                   /product="DNA-directed RNA polymerase specialized sigma
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32679"
FT                   /db_xref="GOA:B7GG00"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:B7GG00"
FT                   /protein_id="ACJ32679.1"
FT                   /translation="MCTKEQIQRAMDQYGNMVLRLAYVYMRNEHDAEDVFQDVFIKLYE
FT                   HMGRIQSEEHMKAWLIRVTINVCKNKLKSFVYRKMDEYEEGAHISIAHDYFEVTSAVAS
FT                   LPTKYREVVHLFYYEGYQTKEIAELLGKRESTVRSLLSRAREMLKNKLKGEYDFA"
FT   gene            327446..328615
FT                   /locus_tag="Aflv_0296"
FT   CDS_pept        327446..328615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0296"
FT                   /product="Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32680"
FT                   /db_xref="GOA:B7GG01"
FT                   /db_xref="UniProtKB/TrEMBL:B7GG01"
FT                   /protein_id="ACJ32680.1"
FT                   /translation="MILRERYKKEMEHIVVTKQLKDKVIARIDKIEQKKKRKSFRPAYV
FT                   ATVAASVLLAVSLHASLSTKEKTQEKVEIMMENDQGEDMLKMEATDSNITIHDVTYDEN
FT                   AQKLHFSVTNKSSGVISFGYAYTIERYDETKQTWQQTTLTNGLAFIEMLALIDQGQTVK
FT                   DMIDLSLIKQPLENGKYRIVRTYYADAAHFTGYIEFDVVDQKLLNFHTYIEMKPTETSE
FT                   SHDVTLTCEKDPHFSLYSAHNGLVSTRTGRQGLHIYPMYEGKEQVNFSMEASDGILFTD
FT                   KMADDALTIYEAEQSVSSDEQMIAESMPPDRGQIEGIEGYEGPKVLFLNGKRVDVEPSI
FT                   VFWEPDKMNEKEEIKVKVTAMNARTNESIGTFYVVIVRKGDEYMLDRIE"
FT   gene            complement(328635..329306)
FT                   /locus_tag="Aflv_0297"
FT   CDS_pept        complement(328635..329306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0297"
FT                   /product="Uncharacterized repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32681"
FT                   /db_xref="UniProtKB/TrEMBL:B7GG02"
FT                   /protein_id="ACJ32681.1"
FT                   /translation="MEQMLQRILDKLENMGAKLAEVKANMATKQELAELKTELEEVKTN
FT                   MATKQELAELKTELEEVKTNMATKQELAELKTELEEVKANTATKQELAELKTELEEVKV
FT                   NMATKQELAELKTELEEVKVNMATKQELAELKTELEEIKANTATKQELAELKTELEEIK
FT                   ANMATKQDLTLVQQATLETNEIVKKLESKMDNHEQLLTLLSHRSLEHEAAISSIRFILT
FT                   K"
FT   gene            329546..330607
FT                   /locus_tag="Aflv_0298"
FT   CDS_pept        329546..330607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0298"
FT                   /product="Nitric oxide synthase, oxygenase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32682"
FT                   /db_xref="GOA:B7GG03"
FT                   /db_xref="InterPro:IPR004030"
FT                   /db_xref="InterPro:IPR017142"
FT                   /db_xref="InterPro:IPR036119"
FT                   /db_xref="UniProtKB/TrEMBL:B7GG03"
FT                   /protein_id="ACJ32682.1"
FT                   /translation="MLWKEAEQFITLCYTELGKSDNEIYKRLQQIQHEIEQTGTYEHTY
FT                   EELEHGARMAWRNSNRCIGRLFWQTLHVFDARAIEREEDIAEWLFHHIAFATNGGKIRP
FT                   TITIFRSERVRIWNHQLIRYAGYETEHGMIGDPSSISFTKACEHLGWRGERTHFDILPL
FT                   VIQVDGREPKLFPIPKHIVLEVPIEHPTFSWFRDLQLKWYAVPIISDMCLEIGGIRYTA
FT                   APFNGWYMGTEIGARNFADDYRYNMLPKIASCMGLDTSKNSTLWKDQALVELNIAVLYS
FT                   YKKAGVSIVDHHTAAQQFKRFEQQEQEVGRKVTGSWTWLIPPLSPATTHIFHQYYDNTI
FT                   VKPNYFYQQRPYE"
FT   gene            330727..332208
FT                   /gene="tlpB"
FT                   /locus_tag="Aflv_0299"
FT   CDS_pept        330727..332208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlpB"
FT                   /locus_tag="Aflv_0299"
FT                   /product="Methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32683"
FT                   /db_xref="GOA:B7GG04"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:B7GG04"
FT                   /protein_id="ACJ32683.1"
FT                   /translation="MDFIEQLKMEETMKKNFFLFLIYTFSAVTGVIGLILIGEKVEKIA
FT                   IYGGSLVLNALVYMALKKMKKYGHMYPYFVIFILFCATLSSLFRTGGSLGTIALAFCLV
FT                   VLSVLHLNRTLFVTGLLLGIVILVVGALVPSSFQQVFQKTGHTVFIVYVMIGIALSVLL
FT                   HLSRKQFHQLVEHVGQAHAEKEKQMARRHELEGQLKHIIENVEHIHQQVLQNVQAQEEM
FT                   KEAIRQAAVAGQAQSEQVIDIHDEVAEAKAMGEQIYETSKQLKEHSSQSSEMAQAGIQK
FT                   MHLLLAHTEQFHEAIHATKATLNALTSKIANTNELTKQIKQITNQTNLLALNATIEAAR
FT                   AGEYGKGFAVVAEEIRKLAVLTEETTQHIVRNLAEVNESNNELLERMDETSEQLTKNET
FT                   LTDEVNMYFEKLYQSLNHLQEQLSYFFIISEKLEKQGEKMDRSISDFSVFIQQSSASLE
FT                   EVSATVEHLKDANEKMAAYVTETAQRAAAIQQQIV"
FT   gene            complement(332301..332858)
FT                   /locus_tag="Aflv_0300"
FT   CDS_pept        complement(332301..332858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0300"
FT                   /product="Stand-alone sensor domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32684"
FT                   /db_xref="GOA:B7GG05"
FT                   /db_xref="InterPro:IPR033425"
FT                   /db_xref="UniProtKB/TrEMBL:B7GG05"
FT                   /protein_id="ACJ32684.1"
FT                   /translation="MTKKERRTLIVSAVAIICFLTILLLRSSLSLTFEQNHFLSIHTLF
FT                   EFFSITVAMAIAFQGWISFPQALSRRRLRIATTFLAVGCLDLLHALTYKQMPGIIVADS
FT                   SVQLTTSFWLAARLTQAIFLLLAFLLPDGPIQEKEKFLAFVVPLLYVGSLAVAHRRRRS
FT                   RNRSTRLVFTIDSLRQSPRLFI"
FT   gene            complement(333025..333489)
FT                   /locus_tag="Aflv_0301"
FT   CDS_pept        complement(333025..333489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0301"
FT                   /product="Cell wall-associated hydrolase (NlpC/P60 family)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32685"
FT                   /db_xref="GOA:B7GG06"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B7GG06"
FT                   /protein_id="ACJ32685.1"
FT                   /translation="MEVQAMKKALAATALFMLLCFTCFASPFRTEAAFSANILIAEAHK
FT                   VIGTPYRAGGTTPKGFDCSGFVSYTYKKVGVSLPHSSEAMYAKGKPVSLNQLAPGDLLF
FT                   FKTSKHKGISHVAIYIGNGRMIHSTSSKGVQVNSIHQSYWKQRFVGAKRL"
FT   gene            333739..334389
FT                   /locus_tag="Aflv_0302"
FT   CDS_pept        333739..334389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0302"
FT                   /product="Membrane protein TerC ortholog"
FT                   /note="possibly involved in tellurium resistance"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32686"
FT                   /db_xref="GOA:B7GG07"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022301"
FT                   /db_xref="UniProtKB/TrEMBL:B7GG07"
FT                   /protein_id="ACJ32686.1"
FT                   /translation="MLKIIAIDIILSGDNAIVIAMATRRLPEKQRNRAILFGTAGAVIL
FT                   RILFAAVIVFLLQIPFVHFAGGLLLLWIAYKVLINEEEEANVQAADRLWKAIWTIIVAD
FT                   AVMSLDNVVAIAGASGGHIGMIAFGVAISIPIMIFGSKAIVLAMEKYKWIPYVGSGILA
FT                   WTAGEMLLKDEQMKRWIAFPQGSQSLVFLIVVTAFILLAGYVKNKKTDKRKIA"
FT   gene            complement(334517..337003)
FT                   /locus_tag="Aflv_0303"
FT   CDS_pept        complement(334517..337003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0303"
FT                   /product="Multidomain redox protein (NAD(FAD)-dependent
FT                   oxidoreductase; Rhodanese domain; SirA-like redox domain;
FT                   Peroxiredoxin domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32687"
FT                   /db_xref="GOA:B7GG08"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR017758"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="InterPro:IPR032836"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B7GG08"
FT                   /protein_id="ACJ32687.1"
FT                   /translation="MQSCDTIHNTRRLITMSKKIVIVGGVAGGATTAARLRRLDEQAEI
FT                   VMFERGEYISFANCGLPYYIGGAIKERDALLVQTVEGMAEKFHLDIRIQSEVIAINRER
FT                   KTVTVKHLPTGKTYEESYDYLVLSPGASPIKPNIPGMEEANDLFTLRNIPDTDRIKAYV
FT                   DEKKPKKAVVIGGGFIGVEMAENLWERGIDVTLVEMAKQIMAPVDYEMAAILHQHIRDK
FT                   GVRLILEDGVAAFEQQGKMVRLQSGTTIETDMIVLAIGVKPENELAKQAGLAIGERGGI
FT                   QVNEYLQTSDPSIYAIGDAIEVMDYINGKPTHIPLAWPANRQGRIVADHINGRNVHYKG
FT                   TLGTAIAKVFDMTVAATGNNEKTLQRLGIQYEVIHIHPNSHASYYPGAFPIALKLLFDR
FT                   KTGRIFGAQAVGYDGVDKRIDVLATAIKGGMTVFDLPDLELAYAPPYSSAKDPVNMAGY
FT                   VATNIIEEMVETIQWHEVNELVKNGACLVDVREEIERDMGFIPGSINIPLGQLRQRLHE
FT                   LPKDETIYVYCQVGLRGYLAARILTQHGFRVKNLDGGYKTYAVVYSEQQEQRKEEQTEK
FT                   QVERVDVMNVQATTTLDACGLQCPGPIMKVYQTMEQLKDGDVLEVKATDPGFARDIQSW
FT                   CKKTGNTLLKTTFENKTFTAYIQKGTKTTASPEKETKKDGATLVVFSGDLDKAIASFII
FT                   ASGAAAMGKKVTMFFTFWGLNILRKKDAPPVQKDMLEKMFGMMMPKGVHDLPLSKMNMA
FT                   GMGPKMIQYVMEKKHVDDLETLMKNAMAAGVKLVACSMSMDIMGIKKEELIDGIEIGGV
FT                   ATYLGDAEEAGLNLFI"
FT   gene            337091..337855
FT                   /locus_tag="Aflv_0304"
FT   CDS_pept        337091..337855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0304"
FT                   /product="Arginase family enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32688"
FT                   /db_xref="GOA:B7GG09"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:B7GG09"
FT                   /protein_id="ACJ32688.1"
FT                   /translation="MYNLVEEKTCTRVGRSMHPSVTFLNFDHTYTWQRNLLRFPHEWID
FT                   MYDIKGTNLYCDDDAMQEIEKRLACRHTRGITFIGSGNYHYVSYALLKQLHEPFTLVLF
FT                   DHHTDMNEQTLFPLLSCGSWVSYAQKHVPTLKHVVIIGSATSHTSSQVTIFPKSDFMYA
FT                   PMTIMRAIPTKHIYISIDKDVLRPQDAQTNWDQGTMSLRTLTTYVDYLFRYKHVIGVDV
FT                   CGEDRSFCVKNEQANEAIIRACLKHMPISSAS"
FT   gene            337953..338183
FT                   /locus_tag="Aflv_0305"
FT   CDS_pept        337953..338183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0305"
FT                   /product="Fe2+ transport system protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32689"
FT                   /db_xref="GOA:B7GG10"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:B7GG10"
FT                   /protein_id="ACJ32689.1"
FT                   /translation="MVAMTQLRVGERAKIVDLSRVSDLVKRRLLDMGVTEGAEICLKCT
FT                   MPLGGPFMIENCGQCVGIRRHEAMNIQVKPL"
FT   gene            338180..340183
FT                   /locus_tag="Aflv_0306"
FT   CDS_pept        338180..340183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0306"
FT                   /product="Fe2+ transport system protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32690"
FT                   /db_xref="GOA:B7GG11"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="InterPro:IPR041069"
FT                   /db_xref="UniProtKB/TrEMBL:B7GG11"
FT                   /protein_id="ACJ32690.1"
FT                   /translation="MMHVALVGNPNTGKTSLFNQLTGTYEYVGNWSGVTVEKKVGVLRS
FT                   KKAKMIDLPGVYSLHPISRDERVVTQFLLTESFDEILNIVDASQLERNLLLTVQLLEFG
FT                   KPLAIALNMVDVAERRGIFIDQTKLAEALRVPVVPVVARTGKGCDQVERMLLEKVTERT
FT                   EPLTIVYGETMERAIDRFIATWGTEESFPVRWLAIQFYEGNSYVRDYVAEKLPEATWRS
FT                   LYEQAEKEVKQAEQMSLAQFIYEKRRSFVKQVIEQVVQRTEIGRVTLTDRIDVVVTNKY
FT                   VGIPLFLLAMYVLFQLTFDWLGAPLSDLLDAFFAGPLTDSVTAMLEAIGASEFIRALVV
FT                   DGIIAGVGGVLVFVPQIFILFFFISFLEDSGYMARVALVMDRLMESVGLNGKAFIPLII
FT                   GFGCNVPGVMAARTIEQPRERLMTMLLTPLMSCSARLPVYALFVGAFFAAHQAIIVLFL
FT                   YVLGVSLALILAKLFSLTILKEEASVFVVELPPYRMPQWQALWRSTWDKGKGFVKKAGT
FT                   FIFGGSVAIWLLSYVGPHGINVNMDDSFLAMIGGVLAPLLAPLGFGTWQAGAALLTGFL
FT                   AKEVVVSTMNIIYHVPDVESLQGLMASHFTALSAFSFMVFVLLYVPCLATVATIYKETG
FT                   SRKWTMFSIGYALVLAYIVSFVIYQGGSLLGF"
FT   gene            340198..340344
FT                   /locus_tag="Aflv_0307"
FT   CDS_pept        340198..340344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0307"
FT                   /product="Uncharacterized conserved protein, contains CXXC
FT                   motif"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32691"
FT                   /db_xref="GOA:B7GG12"
FT                   /db_xref="UniProtKB/TrEMBL:B7GG12"
FT                   /protein_id="ACJ32691.1"
FT                   /translation="MVANIVIGSVIFGYAAWTIFRFIQKSKRGTCAACSVKGSCGTSCH
FT                   EKS"
FT   gene            complement(340361..340639)
FT                   /locus_tag="Aflv_0308"
FT   CDS_pept        complement(340361..340639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0308"
FT                   /product="Acylphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32692"
FT                   /db_xref="GOA:B7GG13"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR020456"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="UniProtKB/TrEMBL:B7GG13"
FT                   /protein_id="ACJ32692.1"
FT                   /translation="MIARYAIVVHGRVQSVGFRYFAQYEARRRGLTGWVKNCDAAHMIE
FT                   MEVQGDVEKVEAFVDEIKKGPPFARVERIEQYSIPTVSHEKTFRIIY"
FT   gene            340744..341484
FT                   /locus_tag="Aflv_0309"
FT   CDS_pept        340744..341484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0309"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32693"
FT                   /db_xref="InterPro:IPR025510"
FT                   /db_xref="UniProtKB/TrEMBL:B7GG14"
FT                   /protein_id="ACJ32693.1"
FT                   /translation="MNEMDRYIQKAVMYDLLARYYQYKDWEQYEKYMRKHIEYVEKMVK
FT                   SREEGRDDDDGRVRLFHASPNAPAVDVYINGQKILRHMKYKQLSQYMKVPKGEHRIDVY
FT                   PAGQTTSPVLSQTIQILPKTTYTLAVIGDVHRLQLLPILDHPYAPYGKAKVRFAHFSPD
FT                   APAVDIALRNGDVLFRNASFGKVTDYIEAPVNEKLHVDVRVAGTNQVVLSIPNVRFQPN
FT                   KSYTVVAVGYVSRTPSLEVLVLES"
FT   gene            complement(341510..342007)
FT                   /locus_tag="Aflv_0310"
FT   CDS_pept        complement(341510..342007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0310"
FT                   /product="Siroheme synthase (precorrin-2
FT                   oxidase/ferrochelatase domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32694"
FT                   /db_xref="GOA:B7GG15"
FT                   /db_xref="InterPro:IPR006367"
FT                   /db_xref="InterPro:IPR028161"
FT                   /db_xref="InterPro:IPR028281"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B7GG15"
FT                   /protein_id="ACJ32694.1"
FT                   /translation="MFPLFVRMTGKKVVIAGGGRIAYRRLLPLLDEGAYITVISPQAID
FT                   AIVHLAEQKRITWHARPVEPADYIDAFLIIAATNDSSVNEQIAAHASPNQLINVVSNHL
FT                   LGNVHVPAFFSRGKLQIAVTTGGASPTLAKQIKKQLEQQFDESFAKYVDEQYEKRQQRK
FT                   EP"
FT   gene            complement(342012..342719)
FT                   /locus_tag="Aflv_0311"
FT   CDS_pept        complement(342012..342719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0311"
FT                   /product="Sirohydrochlorin ferrochelatase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32695"
FT                   /db_xref="GOA:B7GG16"
FT                   /db_xref="InterPro:IPR002762"
FT                   /db_xref="UniProtKB/TrEMBL:B7GG16"
FT                   /protein_id="ACJ32695.1"
FT                   /translation="MKAVLYICHGSRSKEGQKEAIAFVERLSSSVPIPIQHICFLELCE
FT                   PDIVTGVERCVRDGATTILAIPLLLLAANHAKHDIPYELEKAKKMFPSVTITYGKPFGV
FT                   QHDIISALSATIEHADAIVLVGRGSSDTEAQADFQQIAHLLQNETNIPVYPCYLAATSP
FT                   SFSDIVTSLSKTANHKRVAVVPYILFFGQLLDYIHKTLQAQQASDVSFTLYPPVRTYDV
FT                   LDHLVEQQVKEWG"
FT   gene            complement(342724..343506)
FT                   /locus_tag="Aflv_0312"
FT   CDS_pept        complement(342724..343506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0312"
FT                   /product="Uroporphyrinogen-III methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32696"
FT                   /db_xref="GOA:B7GG17"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:B7GG17"
FT                   /protein_id="ACJ32696.1"
FT                   /translation="MKTMGKVYLVGAGPGDPELITVKGLKCIQQADVILYDRLINEQLL
FT                   SFAKRDADLIYCGKLPNYHTMKQETINHFLVKHAKKGKFVTRLKGGDPFLFGRGGEEAQ
FT                   ALIKHGIPFEIVPGVTSGIAVPAYAGIPVTHRDFSGSVAFVTGHRQLDATDAIQWEHLA
FT                   KGVDTLVIYMGVKHLPLICKQLQLYGRKPQTPVAIIQWGTLPQQKTVVATLQTIVDVAK
FT                   KQAIASPSIIIVGEVVRLHDQLQWFETMLEEKTAHGMG"
FT   gene            complement(343507..344097)
FT                   /locus_tag="Aflv_0313"
FT   CDS_pept        complement(343507..344097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0313"
FT                   /product="Adenylylsulfate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32697"
FT                   /db_xref="GOA:B7GG18"
FT                   /db_xref="InterPro:IPR002891"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B7GG18"
FT                   /protein_id="ACJ32697.1"
FT                   /translation="MMNIIWHKESVTKEDRRKKNNHHSFVLWFTGLSGSGKSTLANAVA
FT                   KTLFEQNVQCYVLDGDNIRHGLNSDLGFSAEDRTENIRRIGEVAKLFVDSGQIVLTAFI
FT                   SPFRQDRQLVRNKLAQDEFVEVYVRCPLETCEQRDPKGLYKKARNGEIRDFTGIDSPYE
FT                   PPLSPDVVIDTDQYSIEQCVEQIMSHLKNKQWI"
FT   gene            complement(344094..345170)
FT                   /locus_tag="Aflv_0314"
FT   CDS_pept        complement(344094..345170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0314"
FT                   /product="ATP sulfurylase (sulfate adenylyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32698"
FT                   /db_xref="GOA:B7GG19"
FT                   /db_xref="InterPro:IPR002650"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020792"
FT                   /db_xref="InterPro:IPR024951"
FT                   /db_xref="InterPro:IPR025980"
FT                   /db_xref="UniProtKB/TrEMBL:B7GG19"
FT                   /protein_id="ACJ32698.1"
FT                   /translation="MKQIVLSKAELSDLELLAIGGYEPLTGFLGKDDYDSVVETMRLTN
FT                   GAVWSIPITLAVTEQQAKQLSLGDEVKLVYEQTVYGTMEVQHIYRPDKRKEALLVYQTE
FT                   DLAHPGVKKLFEKPDVYIGGPVQLVRQTDKGIFTPFFFTPKETKQRFAELGWKTVVGFQ
FT                   TRNPVHRAHEYIQKCALEIVDGLYLNPLVGETKEDDIPADIRLKSYQVLLEHYYPKDRV
FT                   FLGVFTAAMRYAGPREAIFHALVRKNFGCTHFIVGRDHAGVGNYYGTYDAQKIFLQFTN
FT                   EELGITPLFFEHSFYCTKCEAMASTKTCPHDATAHVVLSGTKVREMLRAGEMPPSTFSR
FT                   PEVVRVLMDGLQTVGGGR"
FT   gene            complement(345215..346261)
FT                   /gene="cysP"
FT                   /locus_tag="Aflv_0315"
FT   CDS_pept        complement(345215..346261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysP"
FT                   /locus_tag="Aflv_0315"
FT                   /product="Sulfate permease"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32699"
FT                   /db_xref="GOA:B7GG20"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:B7GG20"
FT                   /protein_id="ACJ32699.1"
FT                   /translation="MVTVAFIIAFFFAMNIGGSGAAATMGAAYGSGTLSNKRIALFICA
FT                   VAIFLGSLSGGEVVKTIGSGIVPTTILKTDVVVIVLAAATISLFAANVLGIPLSTSEIT
FT                   VGAVVGAGIAYQSLYVGKLLWIVSFWLITPLVAFSLAFFISNWLKGKTLKQNKWIGFLL
FT                   IIAGFFEAFSAGMNNVANAVGPLVGAGLLSVKYGIIFGGLFVALGALLLGSRVLETNGK
FT                   KITTFSQLEGCIISGIGATLVIVSSLFGLPVPLTQITTSAIIGIGTTKNGFSIWQKQIV
FT                   IQVLKVWIVSPIFALAVSYSLIKLLLHSDIYTAIAIVSVCFATLGTISLKKTITEERRS
FT                   FHEHGGGI"
FT   gene            complement(346274..346981)
FT                   /gene="cysH"
FT                   /locus_tag="Aflv_0316"
FT   CDS_pept        complement(346274..346981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysH"
FT                   /locus_tag="Aflv_0316"
FT                   /product="3'-phosphoadenosine 5'-phosphosulfate
FT                   sulfotransferase (PAPS reductase)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32700"
FT                   /db_xref="GOA:B7GG21"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR004511"
FT                   /db_xref="InterPro:IPR011798"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GG21"
FT                   /protein_id="ACJ32700.1"
FT                   /translation="MITYETWDIEQKPTFPIDNNEKGALHVLSWAYDHYSDDLLYACSF
FT                   GIEGIVLIDLISQVRDDAEIVFLDTHLHFPETYETIERVKQAYPRLRIHLQTPSLSLAE
FT                   QEKQFGAELWKTDPNKCCELRKIIPLRQAMTGKKAWISGLRREQSPTRQHVEFINLDKK
FT                   FQNIKVCPLIHWTWKDVWRYVHRHNLSYNPLHDRGYPSIGCAPCTAPAYTEEDLRSGRW
FT                   AGLGKTECGLHES"
FT   gene            347164..348141
FT                   /locus_tag="Aflv_0317"
FT   CDS_pept        347164..348141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0317"
FT                   /product="c-di-GMP phosphodiesterase class II (HD-GYP
FT                   domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32701"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:B7GG22"
FT                   /protein_id="ACJ32701.1"
FT                   /translation="MRLILLEEYDERTMELARPIYDRHRRVLLAAGRKIHPKYVERLKQ
FT                   MDIRYVFVEDAVSEGITLEELLDMPSWMDAIEVVQQTVDAVRKREPLPLRTLFKLAVKL
FT                   VDEVKKRKVLAVIPATSLATEVQPYAHAVNVALLSLQLGKKLHLNDLQLRDVVVGALLH
FT                   DIGKEIEGEEHHTVKGFEYLRKDREISLLCAHMAYQHHEHADGSGTPRGLKETNIHLYA
FT                   QICAIANEYENLISTEFVPPHEALEIIMARSSIRYSQQLVRLFVDTIPAYLPGTTVKMS
FT                   DGRNAIVTKIVEHMQRPYVRYMDTHEEISLVDHPSLLIVGQAVL"
FT   gene            complement(348136..348354)
FT                   /locus_tag="Aflv_0318"
FT   CDS_pept        complement(348136..348354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0318"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32702"
FT                   /db_xref="InterPro:IPR009507"
FT                   /db_xref="UniProtKB/TrEMBL:B7GG23"
FT                   /protein_id="ACJ32702.1"
FT                   /translation="MTTMHLSVEQMIEQIKEKLKVLNFDAIKPDHFDEQLYDELKDIYD
FT                   MVMKKQSFSPSEMQAIAEELGNLRKKL"
FT   gene            348430..348900
FT                   /locus_tag="Aflv_0319"
FT   CDS_pept        348430..348900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0319"
FT                   /product="Protein phosphatase, low molecular weight
FT                   phosphatase family"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32703"
FT                   /db_xref="GOA:B7GG24"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:B7GG24"
FT                   /protein_id="ACJ32703.1"
FT                   /translation="MIRVLFVCLGNICRSPMAEAVFRHLVKQEGLDHVIAVDSAGTGNW
FT                   HVGKPPHHGTQRILTEKQIDFTGLKARQISKEDFHTFDYIIGMDSDNIAHLRRLVGDSS
FT                   HAVIARFMDFVPNRRVDDVPDPYFTGNFEEVYELVEEGCKHILEHIKRDHSL"
FT   gene            348911..349177
FT                   /locus_tag="Aflv_0320"
FT   CDS_pept        348911..349177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0320"
FT                   /product="Uncharacterized conserved protein, involved in
FT                   general stress response"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32704"
FT                   /db_xref="UniProtKB/TrEMBL:B7GG25"
FT                   /protein_id="ACJ32704.1"
FT                   /translation="MMGKGKWIALAGIALLLANNKTRQVIKETCREWMDSVEQVKETVH
FT                   QTRQHVDEMMNDLQFIVNKLSEVKETTPQVMEWIGELIRKRST"
FT   gene            349196..350029
FT                   /locus_tag="Aflv_0321"
FT   CDS_pept        349196..350029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0321"
FT                   /product="Ribonuclease BN-like family enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32705"
FT                   /db_xref="GOA:B7GG26"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:B7GG26"
FT                   /protein_id="ACJ32705.1"
FT                   /translation="MIISFSVVRELMKRFDEDEIFDLSAELAYFFLLSLFPFLLFLLTF
FT                   LSYLPIPHEDVIAFFSQYAPSETAHLIETNVKQLMESQSGKWLSFSVLATVWAASNGMS
FT                   AIIRALNRAYDVKETRSFFVARGVSILLTFAMIFVIIVALIFPVFGKMIGTFLFSAFGL
FT                   SDVFLHVWETIRWFVSFVILFFVFSVLYVFAPSKYVRFRDVWSGALFATVGWMIVSLAF
FT                   SSYVNQFGNYSAMYGSLGGIIALMVWFYLSGMMIVLGGELNAIFCCKREGHMRIR"
FT   gene            complement(350237..350383)
FT                   /locus_tag="Aflv_0322"
FT   CDS_pept        complement(350237..350383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0322"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32706"
FT                   /db_xref="UniProtKB/TrEMBL:B7GG27"
FT                   /protein_id="ACJ32706.1"
FT                   /translation="MSREERKNMIEFITKLRGFNQEQLVYMTDAEIEHIYNQTYYHYEE
FT                   IAE"
FT   gene            complement(350449..351621)
FT                   /locus_tag="Aflv_0323"
FT   CDS_pept        complement(350449..351621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0323"
FT                   /product="Permease of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32707"
FT                   /db_xref="GOA:B7GFW5"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFW5"
FT                   /protein_id="ACJ32707.1"
FT                   /translation="MRQRHFFILVSIVMISGLSQGLLLPLISVIFEQSGIRSSLSGMHA
FT                   TAMYIGVLIVSPFLERPLRRYGFKRLMMLGGAIVIASLAMFPISSSLSFWFMLRLLIGI
FT                   GDHILHFGSQTWITYASPIHRRGRNISLYGLSFGVGFMIGPLLVPLVYVHEALPFIVSS
FT                   FLSLCGWMLLFFLPHTYPQATEAEKIGGLRFVRAWKQAWPALLLPFGYGFLEASLHSMF
FT                   PVYALRNGLHVETVAIMLPAFALGGIAFQLPLGTLSDRFSRKTIIVVSLTIGAICFMIA
FT                   QLFSSPVLLTMCFFIAGMFVGSLFSLGMAYMTDLLPKSLLPVGNILCGMLYSIGSICGP
FT                   AIGGIVLQQQERLFFFSVSSLLFLLLLAQRPFTKFSKYFSKKQEKNIDAF"
FT   gene            351761..352810
FT                   /locus_tag="Aflv_0324"
FT   CDS_pept        351761..352810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0324"
FT                   /product="Ca2+/H+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32708"
FT                   /db_xref="GOA:B7GFW6"
FT                   /db_xref="InterPro:IPR004713"
FT                   /db_xref="InterPro:IPR004798"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFW6"
FT                   /protein_id="ACJ32708.1"
FT                   /translation="MERIFFLLTVIGVPLSVAGSLLHWPATPMFIVYCITIIALASYMG
FT                   RATESLAIVAGPRIGGLLNATFGNAVELIISIFALKAGLVGVVLASLTGSVLGNLLLVA
FT                   GLSFFVGGLKYKRQSFNVYDARHNSGLLTFAILVAFVIPEVFSMTMNEQKTLSLSIGIS
FT                   IIMIVLYLAALYFKLVTHRGVYQHKEDVEEHEEPEWSKGKAMLILALATVAVAYVSESL
FT                   VHTFEVVAHSFGWSELFIGVIIVAIVGNAAEHASAIIMAYKNKMNVAVEIAIGSTLQIA
FT                   MFVAPVLVLVSLLFPTKMALVFTLPELVAMVTAVLLTIVLSNDGDTNWFEGATLLGAYM
FT                   IMGIGFYLL"
FT   gene            352822..353688
FT                   /locus_tag="Aflv_0325"
FT   CDS_pept        352822..353688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0325"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32709"
FT                   /db_xref="GOA:B7GFW7"
FT                   /db_xref="InterPro:IPR025548"
FT                   /db_xref="UniProtKB/TrEMBL:B7GFW7"
FT                   /protein_id="ACJ32709.1"
FT                   /translation="MLADFFYKEDKLFTFEKNNDEQRKKERGLRMKRWFAFSMMFIFFC
FT                   MPTMSEATVKLPPSVIDISKENTYPNPTQNLPYLQPSELAKQLLQSANVKIENPELIRL
FT                   LNESSISSTPFAIGYEATIYLGQWPLNYESTETSTNWEYQKVNTNFIDNRGGKTAVRLT
FT                   YRQEMQKQVRGGLTASIPNEEDVKKMMLLTAMKKTNLPLSFSTWIGMGTKKEQAYNVPP
FT                   KKLGYLYAYAPAVNEKGKVTYGEVYIVLKGKKKSIVVKNVTSQGIGAWIPVQDRLSFAF
FT                   VASDVPR"
FT   gene            complement(353723..354853)
FT                   /locus_tag="Aflv_0326"
FT   CDS_pept        complement(353723..354853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0326"
FT                   /product="Radical SAM superfamily enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32710"
FT                   /db_xref="GOA:B7GG28"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014866"
FT                   /db_xref="InterPro:IPR031004"
FT                   /db_xref="UniProtKB/TrEMBL:B7GG28"
FT                   /protein_id="ACJ32710.1"
FT                   /translation="MIMGTLLRQAITPTFDPWEAYMDVEQYGSMQLTNIEFTTTTLCNM
FT                   RCEHCAVGYTLRTKDPEALPLDLLLRRLDEIPHLRSLSITGGEPMLSMKSVEQYVVPLL
FT                   KYAHERGVRTQINSNLTLDLERYEKIIPYLDVLHISHNWGTIDDFIEGGFAMMEKKPTV
FT                   AQRERYFIRMIENARAISKTGVIVSAETMLNKRTRPHLATIHRQIVNEMGCRRHEVHPM
FT                   YPSDFASSLETLTLDELRETIHHLLDIRDENVWMLFGTLPFYPCSDNEQDLALLKRLYA
FT                   SKNVTVRNDPDGRSRLNVNIFTGDIIVTDFGDEPTLGNIQTDSLLSAYDKWMASHLAKS
FT                   LNCHCPAVKCLGPNVLVKNRYYPDVDFTTRKAKIER"
FT   gene            354951..355154
FT                   /locus_tag="Aflv_0327"
FT   CDS_pept        354951..355154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0327"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32711"
FT                   /db_xref="UniProtKB/TrEMBL:B7GIG9"
FT                   /protein_id="ACJ32711.1"
FT                   /translation="MTTLGNAVSDQNLQLSYLKARLNMFLEVLEALDPETAELEDIDRL
FT                   IQMIDDLEMKYERFKKDWEKSR"
FT   gene            355267..356769
FT                   /locus_tag="Aflv_0328"
FT   CDS_pept        355267..356769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0328"
FT                   /product="Fumarate hydratase class I, aerobic"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32712"
FT                   /db_xref="GOA:B7GIG4"
FT                   /db_xref="InterPro:IPR004646"
FT                   /db_xref="InterPro:IPR004647"
FT                   /db_xref="InterPro:IPR011167"
FT                   /db_xref="InterPro:IPR036660"
FT                   /db_xref="UniProtKB/TrEMBL:B7GIG4"
FT                   /protein_id="ACJ32712.1"
FT                   /translation="MYKLIVETSTKLPKDVRRAILKARLRENAGTRAAMSLATIVQNIQ
FT                   MADENVSPICQDTGLPTFKIKVPVGVNQVEMKEAIRRAIAQATKDGKLRPNSVDSLTGE
FT                   NSGDNLGIGLPVIKFEQWEKDYIDVRLILKGGGCENKNIQYSLPCELEGLGRAGRDLDG
FT                   IRKCILHAVYQAQGQGCSAGFIGVGIGGDRSSGYDLAKEQLFRSVDDVNPNEDLRKLEE
FT                   YIMEAANKLGIGTMGFGGETTLLGCKIGVMHRIPASFFVSVAYNCWAFRRLGVIIDPHT
FT                   GDIQEWLYQEGDDVDFQQEETEVVGEAREVVLEAPITEEQIRSLKVGDVVRINGMIYTG
FT                   RDAIHKHLMDHDAPVDLNGQIIYHCGPVMLKDENGKWHVKAAGPTTSIREEPYQGEIMK
FT                   KFGIRAVIGKGGMGSKTLAALKEHGGVYLNAIGGAAQYYADCIQSVEGVDFLEFGIPEA
FT                   MWHLRVKDFTAVVTMDSHGNSLHEDVEKSSLEKLAQFKERVF"
FT   gene            356759..357637
FT                   /locus_tag="Aflv_0329"
FT   CDS_pept        356759..357637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0329"
FT                   /product="Polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32713"
FT                   /db_xref="GOA:B7GIG5"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR014235"
FT                   /db_xref="UniProtKB/TrEMBL:B7GIG5"
FT                   /protein_id="ACJ32713.1"
FT                   /translation="MYFNGNPSSDELGGFFISLFAQPMIEMNTEVQAVKKTIMLLFFFL
FT                   CFPLSQVDAMSWGFKRSENHLPPSAGKQLDELLAKYDAFYLGDPTKKYIYLTFDNGYEN
FT                   GYTAQILDVLKQKKVPATFFVTGHYLQSAPDLVKRMVNEGHIVGNHSWHHPDLTTVGDE
FT                   KLREELEMVRKKTELLTGQKHMRYLRPPRGIFDERTLAAARELGYYHVFWSLAFVDWHV
FT                   HDQKGWLYAYNNVMKQIHPGAIILLHTVSKDNADALAKIIDDLRKEGYVFKSLDDLILQ
FT                   KMNVPTWLFSL"
FT   gene            357642..358559
FT                   /locus_tag="Aflv_0330"
FT   CDS_pept        357642..358559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0330"
FT                   /product="3-methyladenine DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32714"
FT                   /db_xref="GOA:B7GIG6"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:B7GIG6"
FT                   /protein_id="ACJ32714.1"
FT                   /translation="MQRDLFRYNRRKRVGIEMWQQRIEVEAPYDFSRVLERLAQDPLSA
FT                   VDIEKQQLVMPFYINETPVAVSVRSIGTKQEPVFLVEANYPELKEAILSRLFRMFHWDR
FT                   SLLPIHKHFLQTELRDIFLEHEGTPLVLESDLYFCLIKCIIHQQLHMKVAYKMTERFVK
FT                   TFGQEIDGLWFYPRPEQIARLSYDELKALQFSGKKAEYMIDTSRLIVEGKLDLERLVDA
FT                   TDEEVMKTLLAIRGIGPWTVQNFLLFGLGRPNLFPKADIGLQRAVQKLLSLETKPSLAQ
FT                   MEALSKRWEPYLSYASLYLWRSIE"
FT   gene            358572..359930
FT                   /locus_tag="Aflv_0331"
FT   CDS_pept        358572..359930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0331"
FT                   /product="tRNA (Uracil-5-)-methyltransferase fused to TRAM
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32715"
FT                   /db_xref="GOA:B7GIG7"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/TrEMBL:B7GIG7"
FT                   /protein_id="ACJ32715.1"
FT                   /translation="MLQQGQQFPLTIKRLGINGEGVGYFKKQVVFVPGALPGEEIVVQA
FT                   TNVYPTYAEGKMVRIRKRSPYRVKPLCPVYERCGGCQLQHLDYNAQLEAKRDIVTQALE
FT                   RHSRLNIEALDIRPTIGMDDPWHYRNKSQFQVGVKKGHVIAGLYSMNSHELVDIDRCLI
FT                   QHDATNRVTTVVKAILQDLRIPVYHERKKTGVVRTIVARVGFYTGDVQLVVVTATKELP
FT                   RKELFVAEVKRRLPEVKSIAQNINGQKTSLIFGDETIVLAGEPYIQEVLGDLSFELSAR
FT                   AFFQLNPIQTIKLYDEVKKAAALTKNERVVDAYCGVGTIGLWLAREAKEVRGMDTIPEA
FT                   IDDARQNAERHGFTNVMYAVGKAEELLPKWVKEGWKPDVIVVDPPRTGCDHALLKTILQ
FT                   VKPKTVVYVSCNPSSLARDIDTLTKQYRVEYIQPFDLFPHTAHVESVAKLVRK"
FT   gene            359940..360416
FT                   /locus_tag="Aflv_0332"
FT   CDS_pept        359940..360416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0332"
FT                   /product="NUDIX family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32716"
FT                   /db_xref="GOA:B7GIG8"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:B7GIG8"
FT                   /protein_id="ACJ32716.1"
FT                   /translation="MSIEKRIVFCRKIFAKNEDREGTFMKKTVRVVGAVIFDNQNRVLC
FT                   ALRSHTMTLPNLWEFPGGKIEEGEKEEETLVREIYEELGCTIDVHEKIEEVHYEYPQVI
FT                   VHLLTYKATIIEGEPQAKEHAELRWVPLRDLKFLEWAPADIPTVDALLANQVNI"
FT   gene            complement(360393..363572)
FT                   /locus_tag="Aflv_0333"
FT   CDS_pept        complement(360393..363572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0333"
FT                   /product="N-terminal HKD family nuclease fused to DNA/RNA
FT                   helicase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32717"
FT                   /db_xref="GOA:B7GIH0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR021835"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B7GIH0"
FT                   /protein_id="ACJ32717.1"
FT                   /translation="MVKFYKKYVRWFLLMEKSFFEELQLLAKQYPDTSVIQRLSPKDYI
FT                   EVLVLHSAKQLAHKLKSLAEENRFDEIIQLTKHISTLVSNNEDSFSLPLSMITYTYGQR
FT                   EIPVIEDFFLSRLHLLYNDKHTMKNFFKTLKYEMLTADSVDFMVSFIRMSGLQLLIRPL
FT                   LMLEKERIPVRIITSTYLGITEPKALKKLMQFSNVQVKIIDTQQHSFHTKAYIFHRRSG
FT                   LNTVIIGSSNISDSALINGHELNVKLPDTSFLPIYEHTKEMFEKIWNRADTISLDYAFI
FT                   ETYQQQTIRKENKPLVAEPKGEYNVTSSVKPNDMQKKALKNLEHTRKNGNTKGVIIAAT
FT                   GTGKTYLAAFDVKAYNPKKLLFIAHREELLDKAIETFKHVIENDHLFGKITGTVKQFDK
FT                   PYLFSTVQSLSKDETLNRFKQHEFDYIIIDEFHHAEAPTYQKVIRYFRPKFLLGLTATP
FT                   ERMDGRDVLAICDHNVVYEIRLREALDAQLLAPFHYFGISDRTVDYSQIPLKNGMFDEA
FT                   LLVKALKTNERTDFIIEMIRTYSYDGDRIVGLAFCVNIDHAKYMSEQFNKRGYCTTYLT
FT                   GEHSVEYREQIIKRLENPDDPLEFIFTVNIFNEGIDIPSLNLLLFLRPTESSTVFIQQL
FT                   GRGLRKVEGKEFVTVLDFVGNYQKSFMIPLALAGQLNDKAFDKDSLRVAITHEFADLPG
FT                   GAYVDLDPVTQREILDRIDSIKMNSTDMLKMLYQQFKNELGRSPEILDFLYYEQSPSLT
FT                   FFIYKYRSWVKTKEKMNDINELDQMILHYPLMCECVERLENQLPIKWPYDFVILQLALL
FT                   QKVVSCEDVVKQLARKFAIDVPLEKHEKMIMQSMDRLSLPYKKQKWSFGQRNGQQFILN
FT                   DDILALTEDTQFFNYIKDRIDYGLIEFRRTYRPERFLTKGEKLTLYQNYTRNDLIFLFE
FT                   AGLKEGSWREGVSRVRNHYLLFVNLNKSERVKEHLHYKDYFLDQKHFHWQSQNQTSHSS
FT                   SVGQHFIRHKELGIHIHLFVRKFEEMHGMTLPFTYLGEVDYVSSYGDKPMSITWRLHHS
FT                   VPEDLYIDLIR"
FT   gene            363800..365242
FT                   /locus_tag="Aflv_0334"
FT   CDS_pept        363800..365242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0334"
FT                   /product="Uncharacterized conserved protein, YdiU/UPF0061
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32718"
FT                   /db_xref="GOA:B7GIH1"
FT                   /db_xref="InterPro:IPR003846"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GIH1"
FT                   /protein_id="ACJ32718.1"
FT                   /translation="MNANWNFDNSYARLPERFFTRIYPTPVSDPKLVVLNHSLAKELGL
FT                   NAEVLASEEGVAVFAGNRVPEGAEPLAQAYAGHQFGYFNMLGDGRAILLGEHVTPSGER
FT                   VDIQLKGSGRTPYSRGGDGRAALGPMLREYIISEAMHALGIPTTRSLAVVTTGEVVMRE
FT                   TELPGAILTRVAASHLRVGTFQYAGRFLSKEELQALADYAIKRHYPNGEHASNRYVFLL
FT                   EEVMKKQAALVAKWQLVGFIHGVMNTDNMTISGETIDYGPCAFMDVYDPETVFSSIDTQ
FT                   GRYAYGNQPYIAGWNIARFAESLLPLLHDEEEKAIEIAQKVIEQFPALYETYWLQGMRA
FT                   KLGLWTEEAEDKKLIGELLHLMYTHRLDYTNTFRSLTLEEWHFCEQELRDWYTRWQQRI
FT                   ARQDMTKEEVYECMRQNNPAIIPRNYRVEEALAAAVEHGDDTVMERLLHVLSDPYAYME
FT                   EQEEYAKTPEPSDRPYRTFCGT"
FT   gene            365427..366644
FT                   /locus_tag="Aflv_0335"
FT   CDS_pept        365427..366644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0335"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32719"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:B7GIH2"
FT                   /protein_id="ACJ32719.1"
FT                   /translation="MGEEWLFFYFSYEKQLILSVIYRIIVYILKKEVKRMELVVTAKIR
FT                   LLPTETQHLQLVETMQAMKQTLNFASKVAYEQHLLSSFKKLQVLVYRDLRELFGLKSQM
FT                   ACNVCTIVAGVYASMKSNGERTLAVFKKPKLQYSYNRDYSFTKDGQLSIGTLNKRIKMP
FT                   FLTKGQERYFDGSWEFGTGTLVYKKGKFYLHVAAKKVIHPPTVYQNVVGVDMGMRFLVT
FT                   AVDSHDRHLFIKGNHIQNVKARYVRLRKELQQRNTKSAKRKLKKIAGQENRFMTNVNHC
FT                   VSKALVRFAGKHSLLVLEDLTGINDTVCVRKKDRYVRFTWSFAQLRSFIEYKARLHDSH
FT                   VLAVHPAYTSQQCPTCGFTHKNNRKKQIHTFICEACGYTSNDDRVGALNLRQKGIEYHH
FT                   GVTTQA"
FT   gene            366829..367077
FT                   /locus_tag="Aflv_0336"
FT   CDS_pept        366829..367077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0336"
FT                   /product="Transcriptional regulator, Crp family"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32720"
FT                   /db_xref="GOA:B7GIH3"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B7GIH3"
FT                   /protein_id="ACJ32720.1"
FT                   /translation="MFHIVFEKMDKRLIEFLLDRCEKNKINVIEITHEHIAVELGTARE
FT                   VVSRILKQLEREGYVQLARGKVKIVDEKRLCDKFATM"
FT   gene            367110..367334
FT                   /locus_tag="Aflv_0337"
FT   CDS_pept        367110..367334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0337"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32721"
FT                   /db_xref="GOA:B7GIH4"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="UniProtKB/TrEMBL:B7GIH4"
FT                   /protein_id="ACJ32721.1"
FT                   /translation="MMRVDEERGGKKMKANVGSVDRIIRFILGIALLGLFFLEGNIKYV
FT                   GILGIVLIATAFMRFCPLYVPFRINTTKK"
FT   gene            complement(367388..368449)
FT                   /gene="adhA"
FT                   /locus_tag="Aflv_0338"
FT   CDS_pept        complement(367388..368449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adhA"
FT                   /locus_tag="Aflv_0338"
FT                   /product="Zn-dependent alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32722"
FT                   /db_xref="GOA:B7GIH5"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B7GIH5"
FT                   /protein_id="ACJ32722.1"
FT                   /translation="MHRRKNPFLLQRRKIVMKAAVVEQFKEPLQIKDVEKPTISYGEVL
FT                   VRIKACGVCHTDLHAAHGDWPVKPKLPLIPGHEGVGVIEEVGPGVTHLKVGDRVGIPWL
FT                   YSACGHCDYCLSGQETLCEHQQNAGYSVDGGYAEYCRAAADYVVKIPDNLSFQEAAPIF
FT                   CAGVTTYKALKVTGAKPGEWVAIYGIGGLGHVAVQYAKAMGLNVVAVDLGDEKLELAKQ
FT                   LGADLIVNPKHEDAAQWMKEKVGGVHAAVVTAVSKTAFESAYKAIRRGGACVLVGLPPE
FT                   EMPVPIFDTVLNGVKIIGSIVGTRKDLQEALQFAAEGKVKTIVEVQPLENINDVFDRML
FT                   KGQINGRVVLKVD"
FT   gene            368829..370520
FT                   /gene="tlpA-1"
FT                   /locus_tag="Aflv_0339"
FT   CDS_pept        368829..370520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlpA-1"
FT                   /locus_tag="Aflv_0339"
FT                   /product="Chemotaxis sensor protein (CHASE 3, HAMP, MCP
FT                   domains)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32723"
FT                   /db_xref="GOA:B7GIH6"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:B7GIH6"
FT                   /protein_id="ACJ32723.1"
FT                   /translation="MKLTVRKKLVATFLSILLLFVVVSMLTYNRLQQIDEQYSNAMKEG
FT                   FERINVVTNMQNAMLREQIAVRGYLINGKPESLTAFEQAASEFADNQQKIASLQLEDQA
FT                   KQAVDRLIKAEQEYRDIAKQAMEFKKQGEMDEISRLMKERGNAITLEVTEAGEQARAIQ
FT                   QKHLQQMSETLSKQAENMKYMTLITIGVAFLVSIAIALYISEKIAKPVRQVSEHAEKIA
FT                   RGDLSVDDIYVANRDEIGELAASFNQMVHNLKQFIQQVSAATEHVSASAQELMASAEQA
FT                   SAATEEVTTAIQEVAQGAEMQGKHAEESVHAIGEMATGIERMAQTSTVVANSATETTKQ
FT                   ATIGQQYLQKVVMQMNTINESTNATNTVIKELNEKSAQIGKIVDVIVGIAEQTNLLALN
FT                   AAIEAARAGEHGKGFAVVADEVRKLAEQSRESANQIAQLIDMIQQNTSHVVNIVEKGTE
FT                   EVEEGTRLVEETGTFFKQISRSIEQVNDQIQELSAISEQMSAGVHQVHVSMDEVSSIAK
FT                   RFVERTAEISASSEEQLASSEEVTSAATSLAEMADKLRHAVATFKF"
FT   gene            complement(370578..370766)
FT                   /locus_tag="Aflv_0340"
FT   CDS_pept        complement(370578..370766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0340"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32724"
FT                   /db_xref="InterPro:IPR025435"
FT                   /db_xref="UniProtKB/TrEMBL:B7GIH7"
FT                   /protein_id="ACJ32724.1"
FT                   /translation="MGRSRGQKARDKNKSTMPQVPKTMKSDGYDVEFSAEFADHEDLEA
FT                   QARAEAAGIRQSKRRKS"
FT   gene            complement(370840..370968)
FT                   /locus_tag="Aflv_0341"
FT   CDS_pept        complement(370840..370968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0341"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32725"
FT                   /db_xref="InterPro:IPR025437"
FT                   /db_xref="UniProtKB/TrEMBL:B7GIH8"
FT                   /protein_id="ACJ32725.1"
FT                   /translation="MADKKKREKTKSTLSSAQEVTYARDFKRADQAGGFTDKHARH"
FT   gene            complement(371062..371634)
FT                   /locus_tag="Aflv_0342"
FT   CDS_pept        complement(371062..371634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0342"
FT                   /product="Acetyltransferase, RimL family"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32726"
FT                   /db_xref="GOA:B7GIH9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B7GIH9"
FT                   /protein_id="ACJ32726.1"
FT                   /translation="MEGDSMLKKRELHDCQALYELMVHPDVFPFVRHKAYSYEEFLFIT
FT                   KQTIEAEERGELISRTILDEWGNPIGTINLFDIEDGAGFLGTWLGKPYHGKGYNQLAKD
FT                   AFFNELFYERSINTIFMRIRKVNVRSTKAAEKLPYVTLANETRKPLWEAINQGEDIYNL
FT                   YEISKDNYTLYAMRQQKLDDEQQLKEA"
FT   gene            complement(371856..372983)
FT                   /gene="hutI"
FT                   /locus_tag="Aflv_0343"
FT   CDS_pept        complement(371856..372983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hutI"
FT                   /locus_tag="Aflv_0343"
FT                   /product="Imidazolone-5-propionate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32727"
FT                   /db_xref="GOA:B7GII0"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B7GII0"
FT                   /protein_id="ACJ32727.1"
FT                   /translation="MKHILLKYGTVYPITSPPMKGADVRIENGKIAEIGYNLLADEQTE
FT                   VIDVSGKYVFPGFIDVHTHLGLYDEGTGWAGNDANETIETMTPHVRAIDSVYPLDPGFR
FT                   DAIEHGITTVHIMPGSANVIGGTTAVIKTYGKNVENMIIKQPAGLKIALGENPKRMHSQ
FT                   GNKESLTRMGIMGMLRETFYNAKYSDWPHDFRTIPIIQALNRDIPIRVHAHRADDILSA
FT                   IRFADEFGLDLRIEHCTEGHLIAEELQGRDLQVSVGPTLTRRSKVELKNKSWKTYKILS
FT                   DAGVHVSITTDHPYTPIQYLPICAAIAVREGLDEQKALEGITILPARNLGVDDRVGSLE
FT                   TGKDADIVVWNYHPFHYLATPIFTMINGEIIYKKN"
FT   gene            complement(373024..373932)
FT                   /locus_tag="Aflv_0344"
FT   CDS_pept        complement(373024..373932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0344"
FT                   /product="NAD dependent epimerase/dehydratase family
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32728"
FT                   /db_xref="GOA:B7GII1"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR010099"
FT                   /db_xref="InterPro:IPR013549"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B7GII1"
FT                   /protein_id="ACJ32728.1"
FT                   /translation="MNILIAGGTGFVGKALTAHFTQNGHHMYILTRNAQKRENDPYIHH
FT                   VQWLTDGVNPHEQLPSIDVIINLAGESINSGRWNETRKRAIMESRLQATHAIYELITKM
FT                   NKKPQVVIQASAIGIYGTSLNDTFTERHETIGMDFLAQTVKRWEEAGRRIESLGVRTVF
FT                   MRFGIILGKNGGALPRIVLPYKWFIGGTIGSGKQWMSWVHINDVVGAIDFAIRHENILG
FT                   SINVTAPHPVTMEQFGKTIAKVLHRPHWLPVPSFALKLLLGEMSMLVLEGQRVIPEKLL
FT                   QAGYHFSFPTVDRALVNILQS"
FT   gene            373878..374801
FT                   /locus_tag="Aflv_0345"
FT   CDS_pept        373878..374801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0345"
FT                   /product="Uncharacterized conserved protein, RecX family"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32729"
FT                   /db_xref="GOA:B7GII2"
FT                   /db_xref="InterPro:IPR003783"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B7GII2"
FT                   /protein_id="ACJ32729.1"
FT                   /translation="MLLTPCLQILFLQQSKYSLFSLLSFIMRCLKKKRKKRCVFKMWIE
FT                   KIEVDRKNVERFYVHFVKEDGEKQIMSVDQDVLIEYRLKKGMTVTEEQWMEMMKKDDEK
FT                   QAYKMALRFLAYRMRSKQEVVDYLKKKDIDAQTIERVIEKLQQERYIADEQFAHAYVQT
FT                   QVNTTMKGPYLIYKELMDKGISEDVIVKAMERYTEDMQRDKAIKWVEKINKQSKKRSHQ
FT                   EQKAYIAQLLHMKGFPSHIVEMAKQHVTADDGTEWEALVYHGEKAHRRYEKYERYTYEQ
FT                   KMKQALYRKGFSLSLIEKFLEKKKED"
FT   gene            complement(374808..375485)
FT                   /locus_tag="Aflv_0346"
FT   CDS_pept        complement(374808..375485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0346"
FT                   /product="Short-chain alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32730"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B7GII3"
FT                   /protein_id="ACJ32730.1"
FT                   /translation="MKIMEYIIITGAGTGLGKELALLYAQRGYDIILVGRRKEPLQSVQ
FT                   QQIESYGRKAIVFPLDITNYEQVHEAAETLCRTYYVTTLVNNAGVGHFGPLEQMTEQHI
FT                   HEMIDINVKGTIYMTKAFLPYFKTLPQANIINIISTAGLRGKVNESVYVASKFAVRGFS
FT                   ESLVKELADTNVAVTAIYMGGMATPFWDNSDHIQDRSLLRSPKQVAETMINEYKRQAEI
FT                   IVE"
FT   gene            375592..377280
FT                   /locus_tag="Aflv_0347"
FT   CDS_pept        375592..377280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0347"
FT                   /product="L-lactate permease"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32731"
FT                   /db_xref="GOA:B7GII4"
FT                   /db_xref="InterPro:IPR003804"
FT                   /db_xref="UniProtKB/TrEMBL:B7GII4"
FT                   /protein_id="ACJ32731.1"
FT                   /translation="MSYVIILQQGKGNNMSFLQVVTASTPVLAVFLFLVLLRLPAAKAM
FT                   PISFVITVVLSLFVWKMPGIQVAAATIEGIIVAISILWIIFGAILLLNTLTKSGAMDAI
FT                   RSGFLGITRDRRVQVIIIAWLFGAFIEGAAGFGTPAAIGAPLLVALGFPPLAAVVVALV
FT                   ADSSPVSFGAVGTPIIVGVDQGLREGNSVAERVQQVIGTADLSPFLQTLAKQAVSFDII
FT                   IGTFIPLILVLILTRFFGENRSWKEGLEIWKFALFAGLSFTVPAFLVASFLGPEFPSMI
FT                   GGLIGLAIVVPAAKKGFLLPKEPWDFKKTDAHQHVTNVQKSDMPLLLAWMPYIFVAIIL
FT                   VLTRLQNLPLKTWLRSVKIQFNNILGTNISTSIEPLYLPGTIFLVVIFITIFMHKMRRE
FT                   DVLATMKESAYTLIGSAIALGTAVPMVRIFINSGINDAGLASMPIELASMVAGAVGAAW
FT                   PLVAPLIGALGSFISGSATFSNMMFSLFQFSVADQIQVPHHIVIAGQMLGANAGNMVCV
FT                   LNVVAAASVVGLAGKEGTIIRMTLIPMLYYVLMTGIFSLILIYVF"
FT   gene            377325..377654
FT                   /locus_tag="Aflv_0348"
FT   CDS_pept        377325..377654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0348"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32732"
FT                   /db_xref="InterPro:IPR014938"
FT                   /db_xref="InterPro:IPR036289"
FT                   /db_xref="UniProtKB/TrEMBL:B7GII5"
FT                   /protein_id="ACJ32732.1"
FT                   /translation="MGKMDQKRYSEMSERELKQEIAMLTEKARKAEQMGMVNEYAVYER
FT                   KIAMAKAYLLNPNDFQPGEFYEIEGDPHSLFKLQYMNGVFAWGYRLSDPNTEVALPISL
FT                   LKKRG"
FT   gene            complement(377678..377842)
FT                   /locus_tag="Aflv_0349"
FT   CDS_pept        complement(377678..377842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0349"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32733"
FT                   /db_xref="InterPro:IPR025413"
FT                   /db_xref="UniProtKB/TrEMBL:B7GII6"
FT                   /protein_id="ACJ32733.1"
FT                   /translation="MGKHWRKKFYDNRYSDPFPQPWANPKHAHAQVNGETQQSQSLMIL
FT                   HSEVSKRKI"
FT   gene            complement(377844..378011)
FT                   /gene="sspK"
FT                   /locus_tag="Aflv_0350"
FT   CDS_pept        complement(377844..378011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sspK"
FT                   /locus_tag="Aflv_0350"
FT                   /product="Small, acid-soluble spore protein K"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32734"
FT                   /db_xref="GOA:B7GII7"
FT                   /db_xref="InterPro:IPR012611"
FT                   /db_xref="UniProtKB/TrEMBL:B7GII7"
FT                   /protein_id="ACJ32734.1"
FT                   /translation="MSNKERGFPNQNNEKLEGEPRAKAEYASKRANGTINTHPQERMHA
FT                   SSQRGDIEEE"
FT   gene            complement(378095..379072)
FT                   /locus_tag="Aflv_0351"
FT   CDS_pept        complement(378095..379072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0351"
FT                   /product="Membrane-bound metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32735"
FT                   /db_xref="GOA:B7GII8"
FT                   /db_xref="InterPro:IPR007404"
FT                   /db_xref="UniProtKB/TrEMBL:B7GII8"
FT                   /protein_id="ACJ32735.1"
FT                   /translation="MDTGTHVLMGFALGGLATFDPAVANDPTLAHAVLIGTLLGSQAPD
FT                   IDTVLKLKNNAKYIRNHRGMTHSIPALFVWTLLISVALFYVYDTSFFHVALWTWIAVSL
FT                   HVFVDIFNSYGTQALRPFSKKWVALGIINTFDPFIFIIHLAGVVLWLSGHHAGYTFLSV
FT                   YIVLIGYYIIRFRQQQAIKRKLKQMFSDVEQIITVPTIKWNEWHLAVTTSTHFYVARAQ
FT                   SGAIDVLDVFEKCPVPNIPVIEKAKQDENLAAFLSFSPVYRWEIHEYDDHYEVRFIDLR
FT                   YRSKDYYPFVAVVQLDRDLNIVSSYTGWIFSEKKLRKKLELIPS"
FT   gene            379095..380216
FT                   /gene="mutY"
FT                   /locus_tag="Aflv_0352"
FT   CDS_pept        379095..380216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutY"
FT                   /locus_tag="Aflv_0352"
FT                   /product="A/G-specific adenine glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32736"
FT                   /db_xref="GOA:B7GII9"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:B7GII9"
FT                   /protein_id="ACJ32736.1"
FT                   /translation="MDLLLVYHFGGMNVKENVQQILEHFHIEQFQHDLIDWFRTEQRDL
FT                   PWRKDKDPYKIWVSEVMLQQTRVDTVIPYFYQFIEKFPTLDALADAKEEEVLKAWEGLG
FT                   YYSRVRNLHAAVKEVKEKYGGRVPASKEQFSSLKGVGPYTTGAVLSIAYGIPEPAVDGN
FT                   VMRVLSRIFYITDDIARASTRKKFEQIVSCIISHDDPSDFNQALMELGALVCTPKNPSC
FT                   FLCPVQRHCRAFAEGVEAELPVKTKGKAPKHVAFRAIVLTNEEGKIRIEKRPSSGLLAN
FT                   LWQFPNDEYAPTSNEQAFIKEISERYHVVLRSIQRIGTFEHVFSHIVWHIEAYKGNALE
FT                   LQMGDETNKWVTVDELNQYAFPVIYQKIWQAYE"
FT   gene            complement(380229..380462)
FT                   /locus_tag="Aflv_0353"
FT   CDS_pept        complement(380229..380462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0353"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32737"
FT                   /db_xref="UniProtKB/TrEMBL:B7GIJ0"
FT                   /protein_id="ACJ32737.1"
FT                   /translation="MRMMYIGRDLTALQMISKREWKDSELAFFHHVFQQVTPYLNTEGQ
FT                   TLHREMIEEIEARGGLQRNEATYTNGTRVFYE"
FT   gene            380501..380704
FT                   /gene="sspE"
FT                   /locus_tag="Aflv_0354"
FT   CDS_pept        380501..380704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sspE"
FT                   /locus_tag="Aflv_0354"
FT                   /product="Small acid-soluble spore protein (gamma-type
FT                   SASP)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32738"
FT                   /db_xref="GOA:B7GIJ1"
FT                   /db_xref="InterPro:IPR006341"
FT                   /db_xref="UniProtKB/TrEMBL:B7GIJ1"
FT                   /protein_id="ACJ32738.1"
FT                   /translation="MRIFFSKLYKVIIVEVSIMKPNKTIAGTNIQHVKQQNAGQYGTEF
FT                   STETDVQHIKQQNAKSEAKKNQ"
FT   gene            380804..381334
FT                   /locus_tag="Aflv_0355"
FT   CDS_pept        380804..381334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0355"
FT                   /product="Uncharacterized domain associated with RNAses G
FT                   and E"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32739"
FT                   /db_xref="InterPro:IPR007295"
FT                   /db_xref="InterPro:IPR016882"
FT                   /db_xref="InterPro:IPR035930"
FT                   /db_xref="UniProtKB/TrEMBL:B7GIJ2"
FT                   /protein_id="ACJ32739.1"
FT                   /translation="MEYPQTGAIIQIHSYKHDGHIHRAWKETVVLKGSEEEVIGGNDRT
FT                   LVTEADGRTWVTREPAICFFYAKHWFNIIAMIRPDGVYYYCNISSPYVWDGEALKYIDY
FT                   DLDIKVFPNGQYDILDRDEYERHRDEMNYPEIIDKILKNNIQKLIQWIKEKKGPFAPEV
FT                   VEHWYKKFIMYGK"
FT   gene            381461..382540
FT                   /gene="appD"
FT                   /locus_tag="Aflv_0356"
FT   CDS_pept        381461..382540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="appD"
FT                   /locus_tag="Aflv_0356"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32740"
FT                   /db_xref="GOA:B7GIJ3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B7GIJ3"
FT                   /protein_id="ACJ32740.1"
FT                   /translation="MKRNIKNYFKNINFLYIKGVASVGDEAILRVKSLKTCFFTDEGEV
FT                   PAVDGVDFYINKGEILGIVGESGCGKSVTSLSIMGLLPKGIGKITDGEIWFKDENIALA
FT                   SEKRMKEIRGNEIAMIFQEPMTSLNPLFTIGNQMIEAIRIHQNISKAEARKRAIDMLKL
FT                   VGLPRAEEMIDEYPHQLSGGMRQRVMIAMAMVCNPSLLIADEPTTALDVTIQAQILHLM
FT                   KQLNEQFGTAIMMITHDLGVVAEMCHRVVVMYAGKIIEEGDVQTIFRHPKHPYTIGLIR
FT                   SVPDIRERKERLYSIPGSVPKPGSIKYGCRFAARCEQAFERCFSENPDLYEVEQGHRAR
FT                   CFLYAKEEHAIHERTVTTS"
FT   gene            382491..383483
FT                   /gene="appF"
FT                   /locus_tag="Aflv_0357"
FT   CDS_pept        382491..383483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="appF"
FT                   /locus_tag="Aflv_0357"
FT                   /product="ABC-type oligopeptide transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32741"
FT                   /db_xref="GOA:B7GIJ4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B7GIJ4"
FT                   /protein_id="ACJ32741.1"
FT                   /translation="MQRRNMLSMNEPLLQVKGLKKYFPITAGLFNKQIGQVKAVDDLSF
FT                   SVYKGETLGIVGESGCGKSTTGRMLLRLIEPTEGSIIFENEEVTKLSPQQLRKLRRDMQ
FT                   MIFQDPFASLNPRHTVEKILEEPLIVHGIGSKEERRKKVREMLEVVGLSSYHAKRYPHQ
FT                   FSGGQRQRIGIARALMTKPKLIIADEPVSALDVSIQAQVLNLLEDLQKEFGLTYIFIAH
FT                   DLGVVRHISDRVGVMYLGRMVELANSEDVYRNPKHPYTQALLEAVPIPDPEYKKEKQLL
FT                   SGDLPSPSNPPAGCAFHTRCQACMDICKTTKPAWKEVEQGHYVACHLYT"
FT   gene            383531..385135
FT                   /gene="oppA"
FT                   /locus_tag="Aflv_0358"
FT   CDS_pept        383531..385135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppA"
FT                   /locus_tag="Aflv_0358"
FT                   /product="ABC-type dipeptide transport system, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32742"
FT                   /db_xref="GOA:B7GIJ5"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B7GIJ5"
FT                   /protein_id="ACJ32742.1"
FT                   /translation="MKKKWLLTMLTFLLVAATALAGCGKSEQTGGEKTEETNKPTTLVY
FT                   GRGGDSVGLDPATVTDGESFKVTKNIFDTLLDYNDGDTSIQPALAEKWEVSPDGLTYTF
FT                   TLRKGVKFHDGTDFNAEAVVFNFERWANGNADTFPYYGSMFGGYKNDEGHVIKEVKALD
FT                   EHTVQFVLKRPQAPFLKNLAMVPFAIASPEAIKKYGDKFGENPVGTGPFVFKEWKRNER
FT                   IVLEKNKEYWLEGHPKLDKLIFVSIPDNSARLNALLKGEIDIMEDLNPSDLAQVEGNKD
FT                   FQVFKRPSMNVGYVGLTVTRGPLGNKLVRQALNHAVDKQAIIDAFYAGQAQPAKNPLPP
FT                   SIPGYNDAIQDYPYDLEKAKQLLAEAGYPNGFEMELWAMPVPRPYMPDGQKVAEALQAS
FT                   FAKIGVKAKIVTYEWATYLDKVAKGEADAFLLGWTGDNGDADNFLYALLDKDSIGSNNY
FT                   TYYANDELHNILIEAQTVSDENKRNELYKKAQEIIKEDAPWIPLVHSTPLLAGKANIEG
FT                   FNPHPTGTDKFTKVQFK"
FT   gene            385141..386205
FT                   /gene="appB"
FT                   /locus_tag="Aflv_0359"
FT   CDS_pept        385141..386205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="appB"
FT                   /locus_tag="Aflv_0359"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32743"
FT                   /db_xref="GOA:B7GIJ6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B7GIJ6"
FT                   /protein_id="ACJ32743.1"
FT                   /translation="MLREGRESSPFPSCEKGVRRMFSYTVKRLLTVIPVLLGMSLVVFF
FT                   MIRAIPGNPAQVILGQKATKEAVEALTHKLGLDQPWYVQYIKYLGGLLKGDLGESLRTG
FT                   VAVSQEIWPYLAATLELSLAAMFIAVVIGVNAGIISAWFQNSWFDYVAMVLALVGVSMP
FT                   IFWLGLMEQWIFAINLDWFPTSGREDVRNPIEPITHLYVIDTLMQGHTDQFVQTLQHLV
FT                   LPSVALATIPMAIIARMTRSSMLEVMKSDYIRTARAKGLSMFWVVYKHSLKNAIIPVLT
FT                   VIGLQMGLLLGGAILTETIFSWPGIGRYIYEAIGYRDYPVIQSGILIVAMIFIFINLIV
FT                   DLLYAAIDPRIKYN"
FT   gene            386220..387113
FT                   /gene="appC"
FT                   /locus_tag="Aflv_0360"
FT   CDS_pept        386220..387113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="appC"
FT                   /locus_tag="Aflv_0360"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32744"
FT                   /db_xref="GOA:B7GIJ7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B7GIJ7"
FT                   /protein_id="ACJ32744.1"
FT                   /translation="MAELARNEANIVQQEEQATSLWKEGWIRFRKNKMALVGSGIVLFF
FT                   ILLAVFAPLIAPYEMNDQQLSMRLQAPSKDHIFGTDDFGRDIFSRVVYGARISLWVGFF
FT                   SVLGSVVIGSLLGIIAGYYGRWIDAVISRIFDIMLAFPSILLAIGIVAVLGPSLKNALI
FT                   AIAVINIPNFGRLIRSRVLSIKQEEYITAAKAIGMSDARILFHHILPNSMAPIIVQGTL
FT                   AIATAIIEAAALGFLGLGAQPPNPEWGKMLADSKAYLTQAPWTMIFPGLAIMLTVLGFN
FT                   LMGDGLRDALDPRMKS"
FT   gene            complement(387146..388228)
FT                   /locus_tag="Aflv_0361"
FT   CDS_pept        complement(387146..388228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0361"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32745"
FT                   /db_xref="GOA:B7GIJ8"
FT                   /db_xref="InterPro:IPR010343"
FT                   /db_xref="UniProtKB/TrEMBL:B7GIJ8"
FT                   /protein_id="ACJ32745.1"
FT                   /translation="MTMRLGARVFKTGIAITFALVLAKLLQLPSPVFAGISAVFAMQPT
FT                   IYRSYLSLIEQVQANVIGAIFAIVFTLIFGHDPFIIGLTAILVIALFLRLRLESSISVA
FT                   LVTVIAIMEYTEQHFIEFALIRFSTIMLGVLAAFVVNLVFLPPKYEKKLYTKIVEYTEH
FT                   ILKWIRMNVRHASEHHLLKEDIEKLKENMMKLDQLYLLYKEERTYFRKHKYSKSRKLVL
FT                   YRQMIVATNRALETLKLLHRLENELAHTPAELQNAIKNELDCLLNYHDQILLKFIGKVK
FT                   SDPQSQFVTEACSGKKGLIHSFLNHYAEQSIKQENYQLFPLIGAIIEYSHQLEHLDTLI
FT                   ESFHHYHKEEHVVPTPEEQE"
FT   gene            complement(388358..392830)
FT                   /gene="gltA-2"
FT                   /locus_tag="Aflv_0362"
FT   CDS_pept        complement(388358..392830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltA-2"
FT                   /locus_tag="Aflv_0362"
FT                   /product="Glutamate synthase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32746"
FT                   /db_xref="GOA:B7GIJ9"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:B7GIJ9"
FT                   /protein_id="ACJ32746.1"
FT                   /translation="MKQRWNPNSFQHFHEHEHDACGIVAAVEKRRIPTRENIMTCINAL
FT                   VTMNHRAGFINGEGDGVGVHIDIPKALWKEKLAAAHLDPQLVDRNDFIVGHIFITRTTN
FT                   VEEKKARMRQLFAQSQLTLIFESDRVTSSSALGPIALREEPVFWQVALLPNHQQKTLSQ
FT                   TLFELTIEIEKDEHIHVASLSNHHAIYKVMGAGDILPKYYHDLASPLVASTMTLGHNRY
FT                   STNTLSNFFRVQPFSVLGHNGEINTIAKLREEATMIGVPLTNGGSDSQDLSRTMETLIY
FT                   RDGYTLFEAMDFLFPPIVNEIKNYPAHLQDLYTYIREAWGHFAQGPAGIISRHGDEAVF
FT                   SVDALGLRPLWKIETEHRYVFASEPGIIPTCEYTGEPKPLAPGEKIGLKWDADGTIRVY
FT                   EYADYQQEVYNRIRKRLNIENMRYRLQTPTFKPHVLAAQPTKVHNGQYAAFGWDREHIQ
FT                   LLEQMAEKGAEPIRSLGHDAPLAAIDPERKNIADFIKESVAVVTNPAIDRDRETEHFST
FT                   RVVVGKRPSIVSHEEHPYTVELLSPILIEGKLGNECAEMLQQPSYDQLVHAFEEKQLAY
FT                   FISATFVEHETIPMALNRLSEEACEAAANGKTLLIIDDAKAHQDGHLWIDPLLVISAID
FT                   QALTKANLRRNCSLLLRSGAIRSLHDFIVAYGLGANVISPYLMFATVADTSTRPAIHLY
FT                   QALNKGLEKVISTIGIHELRGYSRLFSSIGLHEDIASVLNIVNFFGSDSLSQNFEALKQ
FT                   DAITRAKDFEAEQAKLRKTFHVFPRIWKAIGEVAQTGSYDSYREKLTEIETETPTAIRH
FT                   LTDLKQANVPARKELVDISVGEHSLPFVIASMSFGSQNEIAFRAYAEAANRLNMISLNG
FT                   EGGEIKDMLGKYPRTRGQQVASGRFGVNAELLNSSNLLEIKIGQGAKPGEGGHLPGSKV
FT                   TAKIAEARNATIGSDLISPSNNHDIYSIEDLAQMIAELKTANDQAKVAVKVPVVPNIGT
FT                   IAVGIAKAGADIITLSGFDGGTGAARIHAIQHVGLPVEIGVKAAHNALLEAGLRHQVEI
FT                   WADGGIKSAMDVIKVMLLGANRVGFGTLAMIAIGCTTCRGCHLDTCHVGIATQIESEAQ
FT                   AKEHGLRRFVPRQFEQAVQNLVRFFTAFGEELKALTASLGYTNLQQLVGRSDLLEQTRG
FT                   RDRINLATLLKPLDIGQWYQKEVAATSEEGKLAVAAGAEYLDYQVEDLHRSREFSTVTA
FT                   EQRVLGSRVACHRVRGRLDGSYKKLPNISLRYKDGSVPGNGLGAYNVAGIHIHVDGGAQ
FT                   DGVGKTSFGGGIFIFKSKGKDGKFYNGSVGKGFGYGAQKGLLVVQGNADARAGIRLSGA
FT                   DMIIGGQVTKPIPEVEHGNIGVNANIKGFAFEYMTNGRGLVLGDPGPWICAGMTGGVVY
FT                   LRHQPEMGLTKTALERRIAKGANVTIQPLNEKGKADVKELLGTYIDLLIEHEQHDEAAT
FT                   LQPLLQQPEQHFFQVIPKKEQADPSVSTE"
FT   gene            complement(393093..394460)
FT                   /gene="gsaB"
FT                   /locus_tag="Aflv_0363"
FT   CDS_pept        complement(393093..394460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsaB"
FT                   /locus_tag="Aflv_0363"
FT                   /product="Glutamate-1-semialdehyde aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32747"
FT                   /db_xref="GOA:B7GIK0"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GIK0"
FT                   /protein_id="ACJ32747.1"
FT                   /translation="MVCSNKCDKINTMKEILHKRRRLRVNFTKSEQLYQEALEHIVGGV
FT                   NSPSRSYKAVGGGAPVVMERAQGAYFWDVDGNKYIDYLAAYGPIITGHAHPHITKAIQH
FT                   AAENGVLYGTPTPYEITFAKMLKEAIPSLEKVRFVNSGTEAVMTTIRVARAYTGRDKIV
FT                   KFAGCYHGHSDLVLVAAGSGPSTLGTPDSAGVPKSIAQEVITVPFNDVDAFKQAMDRWG
FT                   NEVAAVLVEPIVGNFGIVEPKPGFLQAINDIAHAVGALVIYDEVITAFRFMYGGAQNLL
FT                   GIEPDLTALGKIIGGGLPIGAYGGRKDIMEQVAPLGPAYQAGTMAGNPASILAGIACLE
FT                   VLQQEGVYEHLDHLGAMLEAGILTHAKTYDIPITINRLKGALTVYFTTEKVENYEQAER
FT                   TDGEMFAKFFKLMLHQGINLAPSKYEAWFITLAHTEEDIEYTIEAVERAFKSLKNE"
FT   gene            394513..395517
FT                   /locus_tag="Aflv_0364"
FT   CDS_pept        394513..395517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0364"
FT                   /product="ABC-type uncharacterized transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32748"
FT                   /db_xref="GOA:B7GIK1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B7GIK1"
FT                   /protein_id="ACJ32748.1"
FT                   /translation="MRNMYAIEVEKLRKEFKSYSSRSGLAGAFRDLFTRNYKIIRAVDD
FT                   ISFAVKQGEMVGYIGENGAGKSTTIKMLTGILTPTSGRVVVNGMNPHKERERFVQTIGV
FT                   VFGQRSQLWWDIAVQESFRLLKKVYRVSDQDYNEHMDHVIETLDIGPLLDKPVRKLSLG
FT                   QRMRCELAAALIHNPPLLFLDEPTIGLDVLVKLKIRQFLKEINEKYNTTILLTTHDMTD
FT                   IEALCERVIMLDEGKIIYDGSLQHLKQNWGEGKQIHFQFRNIVSKEELTSLVHVTWEQG
FT                   EDRYSWIAHVRANDMAHVIGKVVSSYELKDIHIREVSTEEIIRNIYEEGIHHG"
FT   gene            395456..396301
FT                   /locus_tag="Aflv_0365"
FT   CDS_pept        395456..396301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0365"
FT                   /product="ABC-type uncharacterized transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32749"
FT                   /db_xref="GOA:B7GIK2"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:B7GIK2"
FT                   /protein_id="ACJ32749.1"
FT                   /translation="MKFQRKKLFATFMKKGFIMAKYIEMIRMRFLMMLAYRTNYYSGIF
FT                   IYSINIGAYYFLWSAIYGGQSSMQGMTVEQMTTYVAIAWMARAFYFNNIDREIAMEIRD
FT                   GKVAIELIRPYNYLVMKTMQGLGEGIFRLLFFSLPGMVIVTFVFSLQFTTNVHTWGYFA
FT                   LSTTLSFIINSQLNLLAGMVTFFTLNGEGLLRAKRFIIDLFSGLILPISFYPEWAQHVM
FT                   HYLPFQAISYIPSMIFTESFTGDAAIRGMMFQAAWCVVLIVPIYLLWKAAKRKLIIQGG
FT                   "
FT   gene            396306..397091
FT                   /locus_tag="Aflv_0366"
FT   CDS_pept        396306..397091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0366"
FT                   /product="ABC-type uncharacterized transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32750"
FT                   /db_xref="GOA:B7GIK3"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:B7GIK3"
FT                   /protein_id="ACJ32750.1"
FT                   /translation="MFYMSIFFQYMSQYIKTKLQYRTDLVVEFLSDLMFQGVNLIFILV
FT                   VFGHTQLLNGWTRDEIIFIYGFFLIPFALFASFFNIWDFNERYIVRGEMDRVLTRPVHS
FT                   LFQIVLERMELESLLGGITGFIVMGYAASRLDITFHWYDAILFVLFVLGGTFVYAGIFI
FT                   SLASISFWSDARSSIMPMMYNIGNYGRYPVDIYNRIIRYILTWILPFAFVGVYPSAYFL
FT                   RKTEWYMYSFLTPVMGIVCFTLSLLLWNAGVKRYRGAGN"
FT   gene            397049..397534
FT                   /locus_tag="Aflv_0367"
FT   CDS_pept        397049..397534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0367"
FT                   /product="Ion transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32751"
FT                   /db_xref="GOA:B7GIK4"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="UniProtKB/TrEMBL:B7GIK4"
FT                   /protein_id="ACJ32751.1"
FT                   /translation="MECGRQTLSWCGELNKTSPRIYKGTGGDVVTYVWIGMIVFVICMS
FT                   FISFWQTKRSVISVKNFIAILFVYSTTMIGFALVYTILHINGHVVMMENGENINASNFF
FT                   QYVETSLYFSAVTLLSVGYGDIVPIGIGRWIAMVEALLGYALPAAFVVRTVIDAERR"
FT   gene            397547..398008
FT                   /locus_tag="Aflv_0368"
FT   CDS_pept        397547..398008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0368"
FT                   /product="Peroxiredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32752"
FT                   /db_xref="GOA:B7GIK5"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B7GIK5"
FT                   /protein_id="ACJ32752.1"
FT                   /translation="MRAPDFTLPASNGENVTLSQFRGKYIVLYFYPKDMTPGCTTEACE
FT                   FRDQYEIFTELGAVVIGISPDSIERHKKFIEKHRLPFLLLADEKQDVAKLYDVWKLKKN
FT                   FGKEYMGIERSTFLIDPDGQIIKEWRKVKVNGHVEEVLNALKQAISSSE"
FT   gene            398178..398636
FT                   /gene="perR"
FT                   /locus_tag="Aflv_0369"
FT   CDS_pept        398178..398636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="perR"
FT                   /locus_tag="Aflv_0369"
FT                   /product="Peroxide regulon repressor PerR, fur family"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32753"
FT                   /db_xref="GOA:B7GIK6"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B7GIK6"
FT                   /protein_id="ACJ32753.1"
FT                   /translation="MKVGGMTVTHAHQLKEALHTLKETGVRITPQRHAILEYLIQSMSH
FT                   PTADEIYKALEGKFPNMSVATVYNNLRVFKEVGLVKELTYGDASSRFDFVTTHHYHVIC
FT                   ETCGKIVDFHYPGLDEVEDLAAHVTGFKVSHHRMEIYGTCPDCQKGHH"
FT   gene            complement(398660..399022)
FT                   /locus_tag="Aflv_0370"
FT   CDS_pept        complement(398660..399022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0370"
FT                   /product="Membrane-associated metal-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32754"
FT                   /db_xref="GOA:B7GIK7"
FT                   /db_xref="InterPro:IPR020912"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GIK7"
FT                   /protein_id="ACJ32754.1"
FT                   /translation="MGVKYSSKINKIRTFALSLIFIGFFVMYGGIFFRTSPIVMTLFMI
FT                   LGLLFIIASTVVYFWIGMLSTKTVQVVCPSCNKVTKMLGRVDVCMYCNEPLTLDPTLEG
FT                   KEFDEKYNRKTRDKKS"
FT   gene            399129..400016
FT                   /locus_tag="Aflv_0371"
FT   CDS_pept        399129..400016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0371"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32755"
FT                   /db_xref="InterPro:IPR029348"
FT                   /db_xref="InterPro:IPR041143"
FT                   /db_xref="UniProtKB/TrEMBL:B7GIK8"
FT                   /protein_id="ACJ32755.1"
FT                   /translation="MEDSIMEDVLRPIYQERASQSRTLGILMVERGSDYSPETDLFDVI
FT                   LFVIVREGEEAVFIKHYVFGEKSASLYVVDERRVKEWVLLGSNRKVINWLLNGKILFER
FT                   NEYIGQLRQRLLQFPEEERKVKMGIEFAKLVRRYIEGRSFFEKDQWLDAYNHVLHALHH
FT                   LARLSIIENGFYPEVTVWNQVKQIEPQIYKLYAELVGSEEPLDKRLQLLFLASDFFIHS
FT                   KLKQGASHLIQVLEKRETSWSMADLLNEKELSVYGVDLEILLEFLVEKHLITVEKIATK
FT                   GQGVFHRHYVVEKK"
FT   gene            400238..401761
FT                   /locus_tag="Aflv_R054"
FT   rRNA            400238..401761
FT                   /locus_tag="Aflv_R054"
FT                   /product="16S ribosomal RNA"
FT   gene            402120..405041
FT                   /locus_tag="Aflv_R055"
FT   rRNA            402120..405041
FT                   /locus_tag="Aflv_R055"
FT                   /product="23S ribosomal RNA"
FT   gene            405192..405305
FT                   /locus_tag="Aflv_R056"
FT   rRNA            405192..405305
FT                   /locus_tag="Aflv_R056"
FT                   /product="5S ribosomal RNA"
FT   gene            405318..405393
FT                   /gene="trnV"
FT                   /locus_tag="Aflv_R057"
FT                   /note="tRNA_Val4"
FT   tRNA            405318..405393
FT                   /gene="trnV"
FT                   /locus_tag="Aflv_R057"
FT                   /product="tRNA-Val"
FT   gene            405421..405497
FT                   /gene="trnM"
FT                   /locus_tag="Aflv_R058"
FT                   /note="tRNA_Met3"
FT   tRNA            405421..405497
FT                   /gene="trnM"
FT                   /locus_tag="Aflv_R058"
FT                   /product="tRNA-Met"
FT   gene            405502..405577
FT                   /gene="trnD"
FT                   /locus_tag="Aflv_R059"
FT                   /note="tRNA_Asp6"
FT   tRNA            405502..405577
FT                   /gene="trnD"
FT                   /locus_tag="Aflv_R059"
FT                   /product="tRNA-Asp"
FT   gene            405738..405813
FT                   /gene="trnF"
FT                   /locus_tag="Aflv_R060"
FT                   /note="tRNA_Phe1"
FT   tRNA            405738..405813
FT                   /gene="trnF"
FT                   /locus_tag="Aflv_R060"
FT                   /product="tRNA-Phe"
FT   gene            405825..405900
FT                   /gene="trnT"
FT                   /locus_tag="Aflv_R061"
FT                   /note="tRNA_Thr3"
FT   tRNA            405825..405900
FT                   /gene="trnT"
FT                   /locus_tag="Aflv_R061"
FT                   /product="tRNA-Thr"
FT   gene            405912..405987
FT                   /gene="trnK"
FT                   /locus_tag="Aflv_R062"
FT                   /note="tRNA_Lys3"
FT   tRNA            405912..405987
FT                   /gene="trnK"
FT                   /locus_tag="Aflv_R062"
FT                   /product="tRNA-Lys"
FT   gene            405992..406072
FT                   /gene="trnL"
FT                   /locus_tag="Aflv_R063"
FT                   /note="tRNA_Leu6"
FT   tRNA            405992..406072
FT                   /gene="trnL"
FT                   /locus_tag="Aflv_R063"
FT                   /product="tRNA-Leu"
FT   gene            406077..406151
FT                   /gene="trnG"
FT                   /locus_tag="Aflv_R064"
FT                   /note="tRNA_Gly2"
FT   tRNA            406077..406151
FT                   /gene="trnG"
FT                   /locus_tag="Aflv_R064"
FT                   /product="tRNA-Gly"
FT   gene            406162..406247
FT                   /gene="trnL"
FT                   /locus_tag="Aflv_R065"
FT                   /note="tRNA_Leu3"
FT   tRNA            406162..406247
FT                   /gene="trnL"
FT                   /locus_tag="Aflv_R065"
FT                   /product="tRNA-Leu"
FT   gene            406256..406332
FT                   /gene="trnR"
FT                   /locus_tag="Aflv_R066"
FT                   /note="tRNA_Arg2"
FT   tRNA            406256..406332
FT                   /gene="trnR"
FT                   /locus_tag="Aflv_R066"
FT                   /product="tRNA-Arg"
FT   gene            406336..406412
FT                   /gene="trnP"
FT                   /locus_tag="Aflv_R067"
FT                   /note="tRNA_Pro2"
FT   tRNA            406336..406412
FT                   /gene="trnP"
FT                   /locus_tag="Aflv_R067"
FT                   /product="tRNA-Pro"
FT   gene            406420..406495
FT                   /gene="trnA"
FT                   /locus_tag="Aflv_R068"
FT                   /note="tRNA_Ala5"
FT   tRNA            406420..406495
FT                   /gene="trnA"
FT                   /locus_tag="Aflv_R068"
FT                   /product="tRNA-Ala"
FT   gene            406512..406588
FT                   /gene="trnM"
FT                   /locus_tag="Aflv_R069"
FT                   /note="tRNA_Met4"
FT   tRNA            406512..406588
FT                   /gene="trnM"
FT                   /locus_tag="Aflv_R069"
FT                   /product="tRNA-Met"
FT   gene            406594..406670
FT                   /gene="trnM"
FT                   /locus_tag="Aflv_R070"
FT                   /note="tRNA_Met5"
FT   tRNA            406594..406670
FT                   /gene="trnM"
FT                   /locus_tag="Aflv_R070"
FT                   /product="tRNA-Met"
FT   gene            406685..406777
FT                   /gene="trnS"
FT                   /locus_tag="Aflv_R071"
FT                   /note="tRNA_Ser6"
FT   tRNA            406685..406777
FT                   /gene="trnS"
FT                   /locus_tag="Aflv_R071"
FT                   /product="tRNA-Ser"
FT   gene            406801..406876
FT                   /gene="trnT"
FT                   /locus_tag="Aflv_R072"
FT                   /note="tRNA_Thr4"
FT   tRNA            406801..406876
FT                   /gene="trnT"
FT                   /locus_tag="Aflv_R072"
FT                   /product="tRNA-Thr"
FT   gene            406882..406957
FT                   /gene="trnH"
FT                   /locus_tag="Aflv_R073"
FT                   /note="tRNA_His1"
FT   tRNA            406882..406957
FT                   /gene="trnH"
FT                   /locus_tag="Aflv_R073"
FT                   /product="tRNA-His"
FT   gene            407139..407209
FT                   /gene="trnG"
FT                   /locus_tag="Aflv_R074"
FT                   /note="tRNA_Gly5"
FT   tRNA            407139..407209
FT                   /gene="trnG"
FT                   /locus_tag="Aflv_R074"
FT                   /product="tRNA-Gly"
FT   gene            407215..407288
FT                   /gene="trnI"
FT                   /locus_tag="Aflv_R075"
FT                   /note="tRNA_Ile3"
FT   tRNA            407215..407288
FT                   /gene="trnI"
FT                   /locus_tag="Aflv_R075"
FT                   /product="tRNA-Ile"
FT   gene            407317..407391
FT                   /gene="trnN"
FT                   /locus_tag="Aflv_R076"
FT                   /note="tRNA_Asn3"
FT   tRNA            407317..407391
FT                   /gene="trnN"
FT                   /locus_tag="Aflv_R076"
FT                   /product="tRNA-Asn"
FT   gene            407395..407486
FT                   /gene="trnS"
FT                   /locus_tag="Aflv_R077"
FT                   /note="tRNA_Ser3"
FT   tRNA            407395..407486
FT                   /gene="trnS"
FT                   /locus_tag="Aflv_R077"
FT                   /product="tRNA-Ser"
FT   gene            407498..407572
FT                   /gene="trnE"
FT                   /locus_tag="Aflv_R078"
FT                   /note="tRNA_Glu4"
FT   tRNA            407498..407572
FT                   /gene="trnE"
FT                   /locus_tag="Aflv_R078"
FT                   /product="tRNA-Glu"
FT   gene            complement(407650..408624)
FT                   /gene="czcD"
FT                   /locus_tag="Aflv_0372"
FT   CDS_pept        complement(407650..408624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="czcD"
FT                   /locus_tag="Aflv_0372"
FT                   /product="Co/Zn/Cd efflux system component"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32756"
FT                   /db_xref="GOA:B7GK00"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK00"
FT                   /protein_id="ACJ32756.1"
FT                   /translation="MYDYHHLPHMKAQTASKKALWTTLILTTFFTIVEIIGGILSNSLA
FT                   LLSDSAHMASDVIALSLSMIAIYLASRPPNERFTFGYLRFEIIASFLNGLALMIIAIGI
FT                   FIEGIRRFIHPENIQFSLMLTIATIGFVVNLILTIVLSRSIKEEENLNVKSALWHFIGD
FT                   LLSSIGVIISAILIYFTGLYMFDPLISIVIGTIIFIGGAKIVRESYFILMDAVPPQFDI
FT                   ERIRTDILAVEGVEDVHELHIWAISTDHYSLTAHVLINECIQPFCIILAINELIKEKYN
FT                   LSHVTVQVEHPSIHQHGEYGKKFLEKRNDVSEPYENEDNLADF"
FT   gene            408879..410825
FT                   /gene="glgB"
FT                   /locus_tag="Aflv_0373"
FT   CDS_pept        408879..410825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgB"
FT                   /locus_tag="Aflv_0373"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32757"
FT                   /db_xref="GOA:B7GK01"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK01"
FT                   /protein_id="ACJ32757.1"
FT                   /translation="MRRRLLTMSPTDLQMHLFHEGTFYQSYQLFGAHLVKQDGTIVTRF
FT                   CVWAPHAKEIRLVGTFNNWNGEQHKLTKINEQGVWMIVVHENLEGHLYKYEIITRDGRT
FT                   FLKADPYAFYAEERPNTASIVYELDGYKWNDQAWQRKKKRKRVYDQPMFIYEVHFGTWK
FT                   KKDDGQFYTYREMADELIPYVVEHGFTHIELLPLIEHPLDRSWGYQGTGYYAATSRYGT
FT                   PHDLMYFIDRCHQEGIGVILDWVPGHFCKDAHGLYMFDGEPTYEYVNMQDRENIVWGTA
FT                   NFDLGKSEVHSFLISNALFWLQYYHIDGFRVDAVANMLYWPNSDVLHPNPYAISFLKKL
FT                   NEVVFAFEPSVLMIAEDSTDWPKVTAPTYDGGLGFNYKWNMGWMNDVLSYMETGMSERK
FT                   HMHHKMTFSLLYAYTENFILPLSHDEVVHGKKSLLNKMPGDYWDKFAQLRLLYGYFMTH
FT                   PGKKLLFMGGEFGQFDEWKDLEQLDWVLFDFDMHRKMDDYVKSLTYFYKKQKALYEYDH
FT                   DPNGFEWIDVNNAEQSIFSFIRRGKKEEDTLIVVCNFTNVVYDNYKIGVPFLTSYREVF
FT                   NSDDVMYGGAGHINKKPLKACEEPYHGKPYHIRMTIPPYAITILRPTRKREGKESYGTK
FT                   KVRRYAARRGTGK"
FT   gene            410722..411945
FT                   /gene="glgC"
FT                   /locus_tag="Aflv_0374"
FT   CDS_pept        410722..411945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgC"
FT                   /locus_tag="Aflv_0374"
FT                   /product="Glucose-1-phosphate adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32758"
FT                   /db_xref="GOA:B7GK02"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005836"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR011831"
FT                   /db_xref="InterPro:IPR011832"
FT                   /db_xref="InterPro:IPR023049"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK02"
FT                   /protein_id="ACJ32758.1"
FT                   /translation="MLSLFYGQLEKEKGRKAMVRKKCVAMLLAGGQGSRLSSLTKNLAK
FT                   PAVPFGGKYRIIDFTLSNCANSGIDTVGVLTQYQPLELNTYIGIGSAWDLDRKHGGVAV
FT                   LPPYAESSEMRWYKGTANAIYQNLNYLEQYDPEYVLILSGDHIYKMNYAHMLQYHIEKK
FT                   ADVTISVIEVPWEEASRFGIMNTNEEMEIVEFEEKPAHPKNNLASMGIYIFKWSVLKEY
FT                   LEMDNRNDRSSHDFGKDIIPLLIDEKKRLVAYPFKGYWKDVGTVKSLWEANMDLLEDTP
FT                   ALNLFDHTWRIYSVNPNEPPQYIAPYAQVKESLVNEGCIVEGHVEHSVLFQGVHIAQGA
FT                   TVKDCVVMPNAVIGKNVYIEKAIVPPNIEIPDGTSIYASSSEGEVILVTEGLLGHFSER
FT                   EDEKLWEN"
FT   gene            411933..412955
FT                   /gene="glgD"
FT                   /locus_tag="Aflv_0375"
FT   CDS_pept        411933..412955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgD"
FT                   /locus_tag="Aflv_0375"
FT                   /product="ADP-glucose pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32759"
FT                   /db_xref="GOA:B7GK03"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR011832"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK03"
FT                   /protein_id="ACJ32759.1"
FT                   /translation="MGKLMLGVIDATTYKKEMNDLTLQRSIAAVPFAGRYRLIDFVLSN
FT                   MVNSGIESVAIFPKYQYRSLMDHLGSGKNWDLNRKRDGLFFFPSPDLPISHIGSFQHFQ
FT                   QHIDYFLRSTQKYALICNSYTVCNIDYEEVLKRHITNHCDITRICHRGQSLDMFILETS
FT                   LLLDLIANQQNNRYQSIVDVVNDETNGLTVCDYEYNGYVAVIDSIERYFHHSLELLQPD
FT                   VWKQLFLKGRPIYTKVKDEPPTKYTSHACVRNAMIANGCIIEGKIENSIISRAVKIGKG
FT                   TVVQNSVVMQKSQIGENCYLEYVIIDKDARIGDGVQLIGTPKQPIVIRKGTIQGALMKS
FT                   "
FT   gene            412952..414406
FT                   /gene="glgA"
FT                   /locus_tag="Aflv_0376"
FT   CDS_pept        412952..414406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgA"
FT                   /locus_tag="Aflv_0376"
FT                   /product="Glycogen synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32760"
FT                   /db_xref="GOA:B7GK04"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GK04"
FT                   /protein_id="ACJ32760.1"
FT                   /translation="MKVLFVVSECVPFVKTGGLADVAGALPKELKKLGTDVRVMLPKYG
FT                   LIPQHMRQKMKKIAELVVRVGWRRQYCGIEQLEHEGITYYFVDNEYYFKRDSLYGHYDD
FT                   GERFSYFCRAVLDCLPVIDFQPNVIHCHDWHTGMIPFLLREEYMRNSFYAQMKTVFTIH
FT                   NLQFQGIFPREILGDLLNLSDRYFSIEHLEFYGHVSFMKGALVSAHLITTVSPTYKEEI
FT                   QTPYYGERLDGLLRARSSHLVGILNGIDDEIYNPKKDPYIAVPYDVTTIARKSINKRAL
FT                   QQHFSLPSEEDVPVIAIVSRLTKQKGLDLVKCVFHEIIAEHVQMIILGTGEWEFEQFFQ
FT                   DMTMTYPDRVRVYIGFSEQLAHQIYAGADMFLMPSKFEPCGLGQMIAMRYGAVPIVRET
FT                   GGLNDTVQSFNELTKEGTGFTFKNFNAHDMLYTIQRARSFYEQKEIWETIMKQAMSRDY
FT                   SWAKSAFKYNQLYDELMAGSGIYVHE"
FT   gene            414384..416780
FT                   /gene="glgP"
FT                   /locus_tag="Aflv_0377"
FT   CDS_pept        414384..416780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgP"
FT                   /locus_tag="Aflv_0377"
FT                   /product="Glucan phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32761"
FT                   /db_xref="GOA:B7GK05"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK05"
FT                   /protein_id="ACJ32761.1"
FT                   /translation="MASMFTSKEEFKQTFLKRLEMMYGKRFWESTVLDQYNTLGHMIRE
FT                   YISKHWIQTNERYRAEHKKQVYYLSIEFLLGRLLGSNLMNLGIRDVVEQGLKELGIELA
FT                   RIEEVEIDAGLGNGGLGRLAACFLDSLASLDLPGHGQGIRYKHGLFDQKIVNGYQVELP
FT                   EQWLRHGNVWEVKKEDLAVEVNFWGKVECYEQNGRLTFRHYDVEKVMAVPYDMPVIGYD
FT                   TTTVNTLRLWSAEPAKFPLHKHVMQYKRETEAISEFLYPDDTNDEGKILRLKQQYFLVA
FT                   ASIGSIVRDYRQRYGHLQHFHRHVAIHVNDTHPVLAIPELMRILLDEEGMGWDEAWHIT
FT                   TNTISYTNHTTLSEALEKWPIYIFQPLLPRIYMIVQEINERFCRDLWNRYPGDWKRIEE
FT                   MAIIAHGLVKMAHLAIVGSYSVNGVAKIHSEILKHREMKLFYEYFPEKFNNKTNGITHR
FT                   RWLLKANPELSSLITEAIGTEWMKHPEQLIELKKYATDHAFQEQLAKVKHGHKQKLAKY
FT                   IYEKTGVAVDDSSIFDVQVKRLHAYKRQLLNVLHIMHLYNRLKEDEHFDMHPRTFIFGA
FT                   KASPGYHYAKRIIKLINSVAQKVNGDEQINGRLKVIFLENYRVSLAEKIFPAADVSEQI
FT                   STASKEASGTGNMKFMMNGAVTIGTLDGANIEILERVGHDNMFIFGLTAEEVLHYYANG
FT                   GYHSYEYYHHDQRIHQVVNQLVNGFFPDAYDHFEPIYDSLLAHNDQYFVLRDFASYADA
FT                   QQRLGVAYENRQKWLEMSVMNIACSGYFSSDRTIEEYAHDIWHIH"
FT   gene            complement(416821..417552)
FT                   /gene="dksA"
FT                   /locus_tag="Aflv_0378"
FT   CDS_pept        complement(416821..417552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dksA"
FT                   /locus_tag="Aflv_0378"
FT                   /product="DnaK suppressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32762"
FT                   /db_xref="GOA:B7GK06"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR014240"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK06"
FT                   /protein_id="ACJ32762.1"
FT                   /translation="MQDISALRDRLLQEKRQIEQRLKQNDHFGLTRTSAHDSVGELSNY
FT                   DNHPADTGTELYEREKDIALNEHTERELHDIERALQAMEDGTYGICEVCGKSIPFERLE
FT                   AIPTTTYCKDHSSDQFISQQRPIEESVLSPPFGEFVVHEDVETFDAEDSWQKVARFGTS
FT                   ETPSDVQEDTVHYDRMYIDDEEQIGYVEPFETFAATDLYGTGITIYPNIVHEQYEQILD
FT                   DEQLMSPLGDLPAYEKDPYTS"
FT   gene            complement(417642..418577)
FT                   /gene="menA"
FT                   /locus_tag="Aflv_0379"
FT   CDS_pept        complement(417642..418577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menA"
FT                   /locus_tag="Aflv_0379"
FT                   /product="1,4-dihydroxy-2-naphthoate octaprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32763"
FT                   /db_xref="GOA:B7GK07"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR004657"
FT                   /db_xref="InterPro:IPR026046"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK07"
FT                   /protein_id="ACJ32763.1"
FT                   /translation="MPTPVRSNTQTVHYKRDWRVWWRLLRPHTLTAAFVPVSIGTVLAV
FT                   DETPIHFPLFFSMLIASLFIQAATNMFNEYYDYKRGLDTPESVGIGGAIVRDGISPKTV
FT                   LLLAWSFFAIAMLLGVYICANSSWWLAVIGTICMAAGYFYTGGPVPIAYTPFGELAAGF
FT                   FMGLTIILISFFIQTGTITSTPVLVSVPISILVGAILLANNIRDLDGDKKSGRKTLAIL
FT                   LGRKRAIWVLGGMFVTSFLWIVLLVFTKTISPWTLLVFFSVPKAWRATKGFIGKTKPID
FT                   MMPAMKATAQTNTQFGFLLVVGLFIHYWMQ"
FT   gene            418735..420090
FT                   /gene="menF"
FT                   /locus_tag="Aflv_0380"
FT   CDS_pept        418735..420090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menF"
FT                   /locus_tag="Aflv_0380"
FT                   /product="Menaquinone-specific isochorismate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32764"
FT                   /db_xref="GOA:B7GK08"
FT                   /db_xref="InterPro:IPR004561"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="InterPro:IPR034681"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK08"
FT                   /protein_id="ACJ32764.1"
FT                   /translation="MVTLYQNKVIDQLRYVLGKKEHMVSITIRMEQIDPLAFFSAGETL
FT                   FYGQRFYWSDCLHERTFVGLGRAQVIKSEEKTKKRFRDVEREWKQIVEGAFIEGQGPLM
FT                   FGGFAFDPLKQSDEHWIEFPSAQFVVPTFLLTKQRDEIWLTVNVVHESLNQIEEMIDSL
FT                   FHTRDESDWHRAHIVKKEEVARDQWLRAVHYATDLIRNDAIEKVVLARELFLSFSDRIN
FT                   CSQVLHELHEQQPMSYIFAFENGSTCFIGASPEQLVRKNGHMCETACLAGSIRRGHTME
FT                   EDEELGRWLLQDDKNRREHAFVVDMIKQAMNEVCTEVVIPNEPTLLKMRHIQHLYTPVQ
FT                   GKVKEEVSIFSLVERLHPTPALGGFPKEKAVQTIREIEPLDRGWYAAPIGWVDANGNGE
FT                   FAVAIRSALLEENKAHLFAGCGIVAHSDPHNEYEETNIKFKPMLSALEGGWR"
FT   gene            420081..421826
FT                   /gene="menD"
FT                   /locus_tag="Aflv_0381"
FT   CDS_pept        420081..421826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menD"
FT                   /locus_tag="Aflv_0381"
FT                   /product="2-succinyl-6-hydroxy-2,
FT                   4-cyclohexadiene-1-carboxylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32765"
FT                   /db_xref="GOA:B7GK09"
FT                   /db_xref="InterPro:IPR004433"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR032264"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK09"
FT                   /protein_id="ACJ32765.1"
FT                   /translation="MEMNEMTAYVTAFVEQLAHMGVQQVVISPGSRSTPLAMVMAEHPT
FT                   LNIHVHIDERSAAFFALGMAKASGEPVALVCTSGTAVANYYPAIVEAYYARVPLVVITA
FT                   DRPHELRDVGAPQAIDQLHMYGSYVKWFVDMALPEGNEQMLRYAEMVAARAVYVASSVP
FT                   KGPVHINVPLREPLVPTIDEPLFLPSSPARIVYRGNKHLCEEMIDELYAELSGVEKGVI
FT                   ICGDLHIEGFSEAVVKLAEALQYPILADPLSPLRTGTHEKRCIIESYDAMLKNETFANK
FT                   FVPDVVIRFGAMPVSKSLYVWLRKHKQVKQMVVDEAGQWRDPTLSLQVLIEANEVQFCY
FT                   DLAQRASHSLRSSQWMSQWQYMNERAKQILLKAEEETDMFEGKIFIELASLLPDKATLY
FT                   VGNSMPIRDADTFFMSSNKRIRLLANRGANGIDGVVSSALGASYVSQPLVLVIGDLSFY
FT                   HDLNGLLAAKLQKLHATIIVLNNNGGGIFSFLPQANEPKHFERLFGTPTHLSFQHVVDM
FT                   YNGHYEKVETWEHFRRAMMHALSRPTLNVIEVPTSREHNVKIHQKLWKDVSQEMSNLLN
FT                   KGERT"
FT   gene            421823..422650
FT                   /locus_tag="Aflv_0382"
FT   CDS_pept        421823..422650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0382"
FT                   /product="Alpha/beta superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32766"
FT                   /db_xref="GOA:B7GK10"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022485"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK10"
FT                   /protein_id="ACJ32766.1"
FT                   /translation="MKFVVGGQTYYVEMYGSGQPLLLLHGFTGSCQTWHPFISTWSQHM
FT                   QCIAIDILGHGRTDAPSAVQRYDIEIVAKDIATLLEQLEIKKAHVLGYSMGGRLALTFA
FT                   VLYPQYVQTLILESSSPGLKTEEERMKRRKEDERLAQFIEKHGVASFVDRWENIPLFSS
FT                   LQRLPKSVQQRLREERLQHTAIGLANSLRGMGTGAQPSWWGALHQLHMPTLLICGEDDE
FT                   KFCRIASEMVQLLPNGTLIVFPQAGHVVHMEQRERFDTLVQQFVLRGGLLHGD"
FT   gene            422640..423458
FT                   /gene="menB"
FT                   /locus_tag="Aflv_0383"
FT   CDS_pept        422640..423458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menB"
FT                   /locus_tag="Aflv_0383"
FT                   /product="Dihydroxynaphthoic acid synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32767"
FT                   /db_xref="GOA:B7GK11"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR010198"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK11"
FT                   /protein_id="ACJ32767.1"
FT                   /translation="MAIEWIKEREYEDILYETYNGIAKITINRPEVHNAFRPKTVMELI
FT                   DAFAYARDDSNIGVIILTGAGGKAFCSGGDQKVRGHGGYVGDDQIPRLNVLDLQRLIRV
FT                   IPKPVIAMVAGYAIGGGHVLHVVCDLTIAADNAIFGQTGPKVGSFDGGYGAGYLARIVG
FT                   HKKAREIWYLCRQYNAQEALEMGLVNKVVPLEQLEEETVKWAEEILEKSPTAIRFLKAA
FT                   FNADTDGLAGIQQLAGDATLLYYTTDEAKEGRDAFKEKRKPDFKQFPRFP"
FT   gene            423477..424943
FT                   /gene="menE"
FT                   /locus_tag="Aflv_0384"
FT   CDS_pept        423477..424943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menE"
FT                   /locus_tag="Aflv_0384"
FT                   /product="O-succinylbenzoic acid-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32768"
FT                   /db_xref="GOA:B7GK12"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR010192"
FT                   /db_xref="InterPro:IPR020459"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK12"
FT                   /protein_id="ACJ32768.1"
FT                   /translation="MYTSSCFFEGGVKMIPNWLRQRAHLTPNRVALYDDIQAISFAELH
FT                   DRTVKRARQFVYLGVKKGDIVAILMKNSIHMVEVIHALHYIGAIVLLQNVRLSMEEIKW
FT                   QLDHSGARFVICDGPFPDERVIEWNEFIKLRERDGEWQTMYHLDDVATIMYTSGTTGKP
FT                   KGVMQTYGNHWWSAIGSALNLGLHENDCWLAAVPFFHVSGLSILMRSVIYGMSVYIMSS
FT                   FDAKRSNELILQGKVTMMSAVSTMVQQIIQQLKQPYPSSFRCMLVGGGPVSQTLLQSCA
FT                   HWNIPVYQTYGMTETASQVATLPPDARHKHGSAGKPLFHMGIRIEKDGQQLNANEVGEI
FT                   VVKGPSVMKGYWNNEQATAAVLKDGWLYTGDIGYMDEEGFLYVLDRRSDLIISGGENVY
FT                   PAEIESVLLQHEAVKEAGVVGVADGTWGQVPCAFVVLHDVTATEEQLKQFCMNKLAKYK
FT                   VPKRIYFVDHLPRNAANKLMRHKLKNWINE"
FT   gene            complement(424967..426049)
FT                   /gene="cydB"
FT                   /locus_tag="Aflv_0385"
FT   CDS_pept        complement(424967..426049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydB"
FT                   /locus_tag="Aflv_0385"
FT                   /product="Cytochrome bd-type quinol oxidase, subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32769"
FT                   /db_xref="GOA:B7GK13"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK13"
FT                   /protein_id="ACJ32769.1"
FT                   /translation="MRKKDRTHPQLRKVGKYNMSHEMVAIIWFGLWGLIWTIYFVLDGY
FT                   TLGTGMLFPFLARNRQERNQLQEAVGPFWGGNEVWLITAGGATFAAFPAVYADLFSFLY
FT                   TPMMLILFALFFRAAGLEFMHKDDAPLWQKSWKWAFTISSFALALLFGVAFANLFYGLK
FT                   IGPSGYEGTFFSLLHPYGLLGGLLFISLFIVSGALWVMLKAVGEVAERAYAVARPAAII
FT                   ATVILSLFFVATSNRTPLFHNFTKAPILWVVPALTFVCALLMLLFVWQKRIGLAFTNIC
FT                   LTIFTLMATGFIGMFPNMLPSRINDEYSTTLFEAAGSELNLKIMLGVAIVMVPIVVGYQ
FT                   LWSYKLFKEKITKETAKGYQ"
FT   gene            complement(425985..427388)
FT                   /gene="cydA"
FT                   /locus_tag="Aflv_0386"
FT   CDS_pept        complement(425985..427388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydA"
FT                   /locus_tag="Aflv_0386"
FT                   /product="Cytochrome bd-type quinol oxidase, subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32770"
FT                   /db_xref="GOA:B7GK14"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK14"
FT                   /protein_id="ACJ32770.1"
FT                   /translation="MRLLLYIVKNILNVGGGLMSDVLLLSRFQFAITVFYHFLFVPLTI
FT                   GLIVLIAWMETQHVRTKNPLYRQMADFWGKLFAINFVLGVVTGITMEFQFGTNWSEYSK
FT                   YMGDIFGSPLAIEALVAFFLESTFMGIWLFGKDKISPKLRAFSIWMVALGTNISALWII
FT                   TANGFMQNPVGYIERNGRIELQNFWEVVTNPYAWHMFVHTVVSCYIVGAFFVMAVSAWH
FT                   LLRKQHVEFFKKSFKYGLILGLIAATATPFIGHKSASFAAKMQPAKGAALEAVWETKES
FT                   LPFHIVQIPDPKNERNIVEFLTIPKLGSYFYTHSFDGKVVGFDQIPKDERPNVNIVFYS
FT                   FRLMVALGLYFVALFWYGFYLYRKNKLVESQRFLKLVMYSVLLPYVAINAGWVVAEVGR
FT                   QPWTVYGLMRTAEAVSPISLSQIIFSLVSLVLFYTILLIADVYLMLKYAKKGPYTSAAT
FT                   KGGEIQHVS"
FT   gene            complement(427513..427674)
FT                   /locus_tag="Aflv_0387"
FT   CDS_pept        complement(427513..427674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0387"
FT                   /product="Uncharacterized conserved protein Cys rich
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32771"
FT                   /db_xref="InterPro:IPR011437"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK15"
FT                   /protein_id="ACJ32771.1"
FT                   /translation="MIVAKDVLCEVQNCQFWSQGNRCSADAIYVVSHAGATATSSTETD
FT                   CKTFQPNE"
FT   gene            427845..428144
FT                   /locus_tag="Aflv_0388"
FT   CDS_pept        427845..428144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0388"
FT                   /product="Predicted diverged REC-like domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32772"
FT                   /db_xref="InterPro:IPR016772"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK16"
FT                   /protein_id="ACJ32772.1"
FT                   /translation="MSSLLVVGADHLGNITDKLKNSGFQEIIHLDGRKVNMVKRQIPEH
FT                   VDIVFVMTDYINHNLAKVIKQKAKDQHKPIYFVKRSWSSIQAVIEQMGELKQVN"
FT   gene            428152..428604
FT                   /locus_tag="Aflv_0389"
FT   CDS_pept        428152..428604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0389"
FT                   /product="Predicted diverged REC-like domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32773"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK17"
FT                   /protein_id="ACJ32773.1"
FT                   /translation="MTLWQPFLNEVLTYHYSISPPHRSSLTLLKGIERATSSFPIASCD
FT                   SPVTYYKTIAQMTDYLLRFVANDQSFVHILDAHDAFITTSCTSDTCVVPSCMNVFVVDH
FT                   ISLLDARQQFEKHFGQKPNTITIHHVMKNRLCYVTFTSETYCKKTG"
FT   gene            complement(428618..429655)
FT                   /gene="nrdF"
FT                   /locus_tag="Aflv_0390"
FT   CDS_pept        complement(428618..429655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdF"
FT                   /locus_tag="Aflv_0390"
FT                   /product="Ribonucleotide reductase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32774"
FT                   /db_xref="GOA:B7GK18"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK18"
FT                   /protein_id="ACJ32774.1"
FT                   /translation="MLLTKVKLLEPSHPNKATSIINGKASGILNWNDIKYSHFYDIYKM
FT                   LLGNFWTPFEINMSDDIKQWHALSERERDAFLHIIGLLSILDSVQPNFIGAMKEYITDP
FT                   SVKAIFSIIEQQEVVHNQSYSYVLASIEKLSEQHRAFEMARTNPHIYKRNEHVIRVYEA
FT                   FREQPTVETFCRALVASLVLEGINFYSGFAFFYNLARNQKMLKTSTMISYINKDELCHS
FT                   YFISQLVRAVLWENPQIDENGAFSAWIYDYIDEAIRYETEWSRFVLRDIDGIDVIEMEK
FT                   YIEYLGNKRLRMLGLDDRYDADENSMPWIRVFSDENVNLGKTDFFEARPRSYTKTTDVN
FT                   GFDEL"
FT   gene            complement(429609..430100)
FT                   /locus_tag="Aflv_0391"
FT   CDS_pept        complement(429609..430100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0391"
FT                   /product="Flavodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32775"
FT                   /db_xref="GOA:B7GK19"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK19"
FT                   /protein_id="ACJ32775.1"
FT                   /translation="MNVLICYTSKTGNTKEVALLIEEAFCSYGHAVKTIDIEHIFAIES
FT                   LIHEAHLLLFGSYTWGNGQLPDEMRKLLRFLIKERNLPLPPVALFGTGDQMWPYYCRAV
FT                   DEMTYHLRKVTTVLGTLKIEQSPRGHQQHLPTVFVQQLLEEVDRFVIDESKIARAVASK
FT                   "
FT   gene            complement(430263..431438)
FT                   /locus_tag="Aflv_0392"
FT   CDS_pept        complement(430263..431438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0392"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32776"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK20"
FT                   /protein_id="ACJ32776.1"
FT                   /translation="MIRTYKVMLLPNNKQKTKLFQCAGVARWAYNFALAQQQENDKQGG
FT                   KFLSDGELRKRLTQLKQTKEYSWLNNYSNNITKQAIKDAYQAYKNFFEGRAKFPKFKTK
FT                   KRTRPSFYQDTSKIKITDTHVKLEKLTPSKKKTKQKLNWVRLAERGRIPHGAHIKYVNP
FT                   RIVFDGLRWFLTVGVEEAEVKHETYNEGIGIDLGVKSFATVSNGMTFPNIHHMPQVKKL
FT                   EKQMKRMQRKISRKYEMNKIQTEGGEFRYRKTENIKKLEFLVLKKRRRLKNTQLNYTHH
FT                   ITTTLVKTKPSYVVMEDLNISGMLKNRKLSKAIQQQTFHEFKRQMTYKCAWHGIELIVA
FT                   DRFYPSSKMCSRCGHVKEKLSLSERTYRCEACGIEMDRDLNASINLKNYAK"
FT   gene            complement(431534..433810)
FT                   /gene="nrdE"
FT                   /locus_tag="Aflv_0393"
FT   CDS_pept        complement(431534..433810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdE"
FT                   /locus_tag="Aflv_0393"
FT                   /product="Ribonucleotide reductase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32777"
FT                   /db_xref="GOA:B7GK21"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK21"
FT                   /protein_id="ACJ32777.1"
FT                   /translation="MYIKQQTEVNEETIRTLLFHIFKDFPHLSSERYIERTIRSLTYTK
FT                   SHDDMMNKLILNALDEITVEQPDWTFVAARLYLQQLYNEAAINRGYDVSDTYRYFYELQ
FT                   TMLVNLGIYDPFVLERYTKEELQEAGTWIDPKKDEQFTYIGLKTLVDRYLAKGYDGEIY
FT                   ELPQERFLTIALTLMVNESKEKRMELVKEAYWALSNQYMTVATPTYANAGKSYGQLSSC
FT                   FIDTVDDSLIGIYESNTDVARLSKGGGGIGVYLGKIRARNSDIKGFKGVSSGVIPWMRQ
FT                   LNNTAVSVDQLGTRQGSIAVYLDVWHKDIFSFLDAKLNNGDERQKCHDLFYGVCIPDLF
FT                   MEQVEKRGDWYLFDPHEVKKVMGWKDTDGNPLGLEDFYDEERGRGSFREKYEECINHPE
FT                   LSKERVPAIEIMKRILKSQLETGTPYMFYRDEANRMNPNKHAGMIYSSNLCTEIMQNMS
FT                   PTTVTKEYTQDGEIIIHKKPGDFVVCNLSSIHLARAVQDDVLERLIPIQVRMLDNVIDL
FT                   NENRIEVLQAVMTNKKYRAIGLGAFSWHHLLALKGIKWNSEESVDFADKLFEKIAYLTI
FT                   RASMELAKEKGAYPAFAGSDWHTGKYFDLRGYHSHDELDWDELKQQVMRHGIRNGYLMA
FT                   PAPNASTSVLANGTASCDPVFNRLYFEEKKNYKIPVTVPDLNAKTFWFYENAYEVDQKM
FT                   SIRQNAARQKHVDQSLSFNLYVYNTIKAKDLLDLHLTAWKERLKSTYYVRSTAVTIEEC
FT                   DVCSS"
FT   gene            complement(434219..435259)
FT                   /locus_tag="Aflv_0394"
FT   CDS_pept        complement(434219..435259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0394"
FT                   /product="Cytochrome bd-type quinol oxidase, subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32778"
FT                   /db_xref="GOA:B7GK22"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK22"
FT                   /protein_id="ACJ32778.1"
FT                   /translation="MMTDELIAISILWGFIFIYAVMATMDFGAGFWSMVYMNRPQTKAT
FT                   KIANRYLSPTWEVTNVFIVAIVVALVSFFPGATFMLGTILLIPGSIILLLLTVRSAFLV
FT                   FSHVAPKYEKILIYISGISGLLIPAFLISVLPITHGSFVETVGGVSRLRLDRLFTSPHE
FT                   YAFIAFAITSTLFLSSLLLADYSNEANEAEAYAIYRRDAFIIGPFALLSSMLIMITMRN
FT                   EARWLYDGMMSHWPWLVASVILFLLAGAALFLPSWKKKHGRGMPRLAVVAIVLQYFCAS
FT                   YAYGKAHLPYMIYPDVTIESGFTHPNTFRALFVTYIVGFAILFPGFIYFWRLFMKDRRY
FT                   IANDEK"
FT   gene            complement(435271..436623)
FT                   /locus_tag="Aflv_0395"
FT   CDS_pept        complement(435271..436623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0395"
FT                   /product="Cytochrome bd-type quinol oxidase, subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32779"
FT                   /db_xref="GOA:B7GK23"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK23"
FT                   /protein_id="ACJ32779.1"
FT                   /translation="MERDEHFGMDHVLTARTLFGTTMAFHIIFATLGVGIPLMILLAEL
FT                   LYQKTKDNDYAIMANRWTKALAILLGVAIPSGTIAGVQLSLLWPGFMEVIGKVMALPFQ
FT                   IEIYAFFVEALFLSIYVYAADRISPTMRIVSLIFVAIGAAASAILITNVHAFEGTPTGF
FT                   RIENGQIVDVDPWKAFFNPSFAVTATHVVLSAYMTGAFTIASIAAYKMLKNKHNERIQL
FT                   FHKKALMLGLTVGGVFSLLTAINGHESAQLLHEYQPEKLAAAEGLFETQSHAPLVIGGF
FT                   TDRETQTVKWGIEIPWLLSFLAGNRFDTIVIGLNDFPEEWWPPLFVHTLFNAMVGIGMF
FT                   LLLLSTVGFIWNRIKKQHTFPNWFMRTVVTAGPLALLGIEFGWIFACTGRQPWVIYRMM
FT                   TTAEAVTQSTNLGTLFLLFTSIYVFLLIAVVLVLRSYFRRHPIEQQLSIHI"
FT   gene            complement(436696..437745)
FT                   /locus_tag="Aflv_0396"
FT   CDS_pept        complement(436696..437745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0396"
FT                   /product="ABC-type metal ion transport system, periplasmic
FT                   component/surface adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32780"
FT                   /db_xref="GOA:B7GK24"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK24"
FT                   /protein_id="ACJ32780.1"
FT                   /translation="MRKMLSDDQKHLSLFGRRKKMKVKTILSIILASTLLLFGCSQQEQ
FT                   TNESKNKEKNDQLIVYTTVYPLQDFTEKIGGKHVQVESVYPPGVDVHTYEPTAKTMQQI
FT                   ADADAFIYIGQGMEGFVDRVVKTLENEHVKFVEATAGMELLPADDTHRDEHAHEDEHAH
FT                   EDEHGHEDEHEHGDVDPHVWLDPIYSIQMAETIKQTLTKLKPEAKDDFEQNFASLKQQL
FT                   EQLDQQFQQLIKEAQRKEILVAHAAYGYWEKRYGLKQISVTGLSPTNEPSQKQLASIIQ
FT                   IAKDHDMRYIFFEQNVTSKIAEVVKNEIGADVLILHNLEARTNDDIKNNKDYFAIMNDN
FT                   ISVLKKALQ"
FT   gene            complement(437784..438965)
FT                   /locus_tag="Aflv_0397"
FT   CDS_pept        complement(437784..438965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0397"
FT                   /product="GTPase (G3E type), CobW/P47K subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32781"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK25"
FT                   /protein_id="ACJ32781.1"
FT                   /translation="MKIPVTVLSGYLGSGKTTLLNHILNNRDGLKIAVIVNDMSEVNID
FT                   AELIKQGGFSRTEEKLVQIQNGCICCTLREDLMKEVEKLVNAGNIDYIVIESSGISEPI
FT                   PVAQTFTYIDEEFGIDLTSKCRLDTMVTVVDAHRFWHDFASGETLLDRKQAIDETDVRE
FT                   VVDLLIDQIEFANVLILNKIDCISEEDADELEALLRKLNPEAKIIRTTYGKVALHDILN
FT                   TRLFDFEKASQSAGWIKELNEEHTPETEEYGISSFVYRRRRPFHPERLMHWLENWPVEI
FT                   VRAKGFFWLASRNNMCGLLSQAGPSIMLQGAGEWIATYPPHEREQILQQEPELRAKWND
FT                   TYGDRMTELVFIGIDMDEQAISSSLDTCLLTDEEMSKDWSTFVDPLPPFVSVS"
FT   gene            complement(439043..439267)
FT                   /locus_tag="Aflv_0398"
FT   CDS_pept        complement(439043..439267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0398"
FT                   /product="Uncharacterized conserved protein, HlyA family"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32782"
FT                   /db_xref="GOA:B7GK26"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GK26"
FT                   /protein_id="ACJ32782.1"
FT                   /translation="MKHIFILLIRFYQRFISPLKPPTCRFYPTCSHYGLEAIRRFGALK
FT                   GGYLTIKRILKCHPFHPGGFDPVPEKEQK"
FT   gene            439355..439870
FT                   /gene="luxS"
FT                   /locus_tag="Aflv_0399"
FT   CDS_pept        439355..439870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="luxS"
FT                   /locus_tag="Aflv_0399"
FT                   /product="LuxS protein involved in autoinducer AI2
FT                   synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32783"
FT                   /db_xref="GOA:B7GK27"
FT                   /db_xref="InterPro:IPR003815"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR037005"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK27"
FT                   /protein_id="ACJ32783.1"
FT                   /translation="MYDKNVTIEKEVTYMPSVESFELDHCAVKAPYVRHCGVHQVGSDG
FT                   VVNKFDIRFCQPNKEAMQPAAIHTLEHLLAVHIRKHAEKYDHFDIIDISPMGCQTGYYL
FT                   VVSGTPTVEEIIDLLEATMNEALTVTEVPAATEKECGQAKLHDLEGAKRLMRYWLSQPK
FT                   EQLKKVFG"
FT   gene            complement(439889..440044)
FT                   /locus_tag="Aflv_0400"
FT   CDS_pept        complement(439889..440044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0400"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32784"
FT                   /db_xref="GOA:B7GK28"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK28"
FT                   /protein_id="ACJ32784.1"
FT                   /translation="MGGICMLLTFIISIIIVFVVLILSVLTTSKAYKYKHTIDELPSEK
FT                   NKGSDM"
FT   gene            440139..440576
FT                   /gene="dps"
FT                   /locus_tag="Aflv_0401"
FT   CDS_pept        440139..440576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dps"
FT                   /locus_tag="Aflv_0401"
FT                   /product="DNA-binding ferritin-like protein (oxidative
FT                   damage protectant)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32785"
FT                   /db_xref="GOA:B7GK29"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK29"
FT                   /protein_id="ACJ32785.1"
FT                   /translation="MKEKLIDIVNKQIANWNVLYVKLHNYHWYVKGPQFFTLHTKFEEL
FT                   YNEAALHIDELAERLLALGGKPLATMKDYLAVASVHEAKGNETAEEMVAEIVRDFETMI
FT                   EELKAGMDYAGEIGDETTGDMLLGIHQSLEKHVWMLKSFLG"
FT   gene            440545..441000
FT                   /locus_tag="Aflv_0402"
FT   CDS_pept        440545..441000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0402"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32786"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK30"
FT                   /protein_id="ACJ32786.1"
FT                   /translation="MYGCSNRFSDKVGVGPTLFACSVADECFCCMKINESTHTNCNKRK
FT                   RGGSMKKTYYVSVARGEISQVKTASPWEFRIEATDEEIIQLREYFDEMYSSDWQSFWRA
FT                   HVPYVQYHYDRPNDGYDNAMKKVYEMIYELGDEEAKQQIETMGVIQL"
FT   gene            441061..441537
FT                   /locus_tag="Aflv_0403"
FT   CDS_pept        441061..441537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0403"
FT                   /product="NUDIX family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32787"
FT                   /db_xref="GOA:B7GK31"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR014078"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK31"
FT                   /protein_id="ACJ32787.1"
FT                   /translation="MMIVFQDYHGYNVRLSFSDHPFSQQPKHVFVICRYGGRWLLTNHA
FT                   VRGLEFPGGKIEKGEMPEQAAIREVKEETGGVVEKITYIGQYEVNRPNETIVKNIYFAH
FT                   VKSLEQRESYFETNGPVLIEHMPNDIAKDERFSFIMKDGVWTYTKQELQRRGML"
FT   gene            complement(441565..442371)
FT                   /locus_tag="Aflv_0404"
FT   CDS_pept        complement(441565..442371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0404"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32788"
FT                   /db_xref="GOA:B7GK32"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK32"
FT                   /protein_id="ACJ32788.1"
FT                   /translation="MNKHEWLQRIYDQYMAYEKREKQIVRFFQMIIVITFFSLWEIASR
FT                   FHWIDPLLFSSPSSIWHLFIAKIRDHTLLTHTTVTLTETVLGFIAGTMIGVCFAAILWW
FT                   FPRISHIADPYLVILNAMPKVALGPILIVALGPNMTSIVAMGAIISIIITTIVVYTSFK
FT                   EVDANYIKVLRTFGATKRQWFTEAILPASFPTIISTLKVNVGLSWVGVIVGEFLVSKQG
FT                   LGYMIIYGFQVFNFTLVLLSLLMIALLSSIMYQLVSWLEKKLVKRA"
FT   gene            complement(442358..443137)
FT                   /locus_tag="Aflv_0405"
FT   CDS_pept        complement(442358..443137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0405"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32789"
FT                   /db_xref="GOA:B7GK33"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK33"
FT                   /protein_id="ACJ32789.1"
FT                   /translation="MNIMPILTIDQVMHAYVTKQSAVLALDHLSLTVERGEFVSFLGPS
FT                   GCGKTTLLSIVAGLIKPTKGRVLIEGKEMHTMSQTIGYMLQHDYLFPWKTIEQNVTLGL
FT                   KLTGKYSEKTRKQTLSLLHQIGLRDVDDRYPYELSGGMRQRAALVRTLATDPKILLLDE
FT                   PFSALDYQTKLKLEDLVWETLKQYRKTALLVTHDIGEAIAMSDRIVLFTAKPGKIKRIV
FT                   TVPDSLKACTPFQARQHPDFSPLFQMIWKELESIEQT"
FT   gene            complement(443138..444115)
FT                   /locus_tag="Aflv_0406"
FT   CDS_pept        complement(443138..444115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0406"
FT                   /product="ABC-type nitrate/sulfonate/taurine/bicarbonate
FT                   transport system, periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32790"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK34"
FT                   /protein_id="ACJ32790.1"
FT                   /translation="MRKWGFLLIVLMFLLTACSSNDVKTLRVAEVTRSIFYAPQYVAIE
FT                   KGFLAEEGLHIELNTTWGGDKTMTTLLSNGADIALVGSETSIYVYSQGAVDPVINFAQL
FT                   TQTDGTFLVSRKPIANFTWDQLKGSTFLGQRKGGMPQMVGEYVLKQHSIDPHKDLNLIQ
FT                   NIEFANIANAFASGTGDFVQLFEPTASIFEQEGKGYIVASFGTESGHLPYTTFMAKQSF
FT                   IDKNKDVIEKFTRALYKAQQWVQTHDAKEIATVIQPYFENTDIALIEKVVDRYKQQGSY
FT                   ATDPILDEEEWNHLQNIMKEANELPSYIEHSILVNTSFAEKAKK"
FT   gene            complement(444215..444457)
FT                   /locus_tag="Aflv_0407"
FT   CDS_pept        complement(444215..444457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0407"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32791"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019699"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK35"
FT                   /protein_id="ACJ32791.1"
FT                   /translation="MGMPLEVQTMIVTNGKEKRIEHNLFVLQKEGYRLYPLDVPLEVRR
FT                   TKHGETTGKAIVKKLTFENETTIVTYELIALHSIN"
FT   gene            444633..445775
FT                   /locus_tag="Aflv_0408"
FT   CDS_pept        444633..445775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0408"
FT                   /product="Fatty acid desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32792"
FT                   /db_xref="GOA:B7GK36"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK36"
FT                   /protein_id="ACJ32792.1"
FT                   /translation="MFEYSFLFKGKCLRMRGVFCYMKQFHSFGWYAARIAPYLPEEAFR
FT                   PVPSRLFGGLAYMIVLVSSIVTISLFDLHWVWNGLLSVVIGFCFAGLGFLGHEILHGTV
FT                   VKRAWLRDLLGGIAFLPLCTGPKLWRKWHNATHHVHTQHEELDPDAWPTIKRLAQSRFL
FT                   RWIYRIPFPIRAAFSFLSLAGMFTVHSLHMLLHFWKEFEKGSRRAVFWQFVLPWSVWIG
FT                   LLLMIGVEKWLFAFVLPLLIGNAIVMGYISTNHRLNPLVPVNDPLANSLTVIVPKWVDV
FT                   LHFNFSHHTEHHLFPAMSSKYYPLVKQYIKQLWPDRYYEMPMTKALIALWKTPRLYHEQ
FT                   TELIEPREGYVYGTLGYGLNIDDLSHKAKENVVGKMVKEK"
FT   gene            complement(445833..446630)
FT                   /locus_tag="Aflv_0409"
FT   CDS_pept        complement(445833..446630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0409"
FT                   /product="ABC-type cobalt transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32793"
FT                   /db_xref="GOA:B7GK37"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK37"
FT                   /protein_id="ACJ32793.1"
FT                   /translation="MDNKRNDLHICSSWIVHRLSVGGHMIHVSNICYTYPDGHKAIHDV
FT                   SFSVQQGECIGIIGANGAGKSTLLKLLVGLYILKKGEIIIDNMPMSKQTLRHIRRIIGF
FT                   TFQQADDQLFMPTVYDDVAFALRNDGMNEDEVKKRVTNSLKIVGAIHLVDRPPYRLSEG
FT                   EKRLVTLATVLAMEPKILLMDEPTAALDPQARRTLIHLIQGLPHTKIVTTHDLDFVLEC
FT                   CERTIVLANGTIVYDGPTEAVLTNEPFLREHHLELPLMLQGRK"
FT   gene            complement(446555..447289)
FT                   /locus_tag="Aflv_0410"
FT   CDS_pept        complement(446555..447289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0410"
FT                   /product="ABC-type cobalt transport system, permease
FT                   component CbiQ"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32794"
FT                   /db_xref="GOA:B7GK38"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK38"
FT                   /protein_id="ACJ32794.1"
FT                   /translation="MEKRSMIDAYRRRDVHPLSLLIITFTYIFVVASFHSYAFVELIPL
FT                   SLYPLAMIVFYHLSIRHIKNILLASLPFITAIGVSQLFFIDERISFFHWHIEAGWLAFT
FT                   TLVIKNTLAILAATVLFLTIPIEQLAGALLSLRIPRLLVIQLLLTYRYIFLFLEEANRL
FT                   KQAYMLRAPHHRAMKLSVWGSLVGHLLLRTFERAERVYEAMTLRGFSIQRMHIKIKRWT
FT                   TKEMIYTFVVVGLFIAYRLVVI"
FT   gene            complement(447271..448236)
FT                   /locus_tag="Aflv_0411"
FT   CDS_pept        complement(447271..448236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0411"
FT                   /product="ABC-type cobalt transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32795"
FT                   /db_xref="GOA:B7GK39"
FT                   /db_xref="InterPro:IPR002751"
FT                   /db_xref="InterPro:IPR025937"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK39"
FT                   /protein_id="ACJ32795.1"
FT                   /translation="MHMADALISPAVGIAMWGATAGVASYSLKKLNIEADEKKLPLMGV
FT                   LGAFVFAAQMINFAIPGTGSSGHLGGGLLLAALLGPYAAFLTLAVVLFIQALFFADGGL
FT                   LAFGCNVFNLGFYTCFIAYPLYKRLIRRTNIWFASIIAAVVGLQLGAFSVVVQTVLSGK
FT                   VELPFTTFTLFMQPIHLAIGIVEGIATATVISFVMKTKPELAKQTDAPMNRLIGILGVL
FT                   ALMIGGIFSSVASSKPDGLEWSIFHTAGTDELRVTTTLHTMLERLQQSLALLPDYNLKS
FT                   GNVSIGWIDIGTSISGIIGTFIVAIALMTPYIIKKWRKEA"
FT   gene            complement(448288..449478)
FT                   /locus_tag="Aflv_0412"
FT   CDS_pept        complement(448288..449478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0412"
FT                   /product="N-acetylmuramoyl-L-alanine amidase fused to LysM
FT                   and peptidoglycan binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32796"
FT                   /db_xref="GOA:B7GK40"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR006619"
FT                   /db_xref="InterPro:IPR015510"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK40"
FT                   /protein_id="ACJ32796.1"
FT                   /translation="MNKKQKSSQRSSGKTLKNSQTLIHASKNSVGQSHKQQKLPVSAAF
FT                   FFFYCFVQTIYEMEHIVVYKNEQEEAKKMNELLALPQLKDIRHLLPTRSERSYKKTTIQ
FT                   QKTHIIIHHSLTKTGSAFAFANYHVSKGWPGIGYHFVIEQDGTIHFCNDLETISYHVGN
FT                   HNPYCIGICLTGDFRTQQPTDEQKQSLRTLYKTLVNILPNYKDVKGHNELKGYEWKQCP
FT                   CFNYAQVLTEDENIQIKEEVKRYTIQSGDTLWAISQKTGVSVKTLLRLNPHVDPRALQP
FT                   GQQIIIEKLIKKEEVKTPSQPSNQTPKQQNPIEQLMNKLPNKVLRYGDRGEDVRILQQA
FT                   LNEIHFKCGEEDGVFGKKTLDAVKRVNLMFSGGNKNGIYDEKTKNYIISKLKEKMK"
FT   gene            complement(449375..451045)
FT                   /gene="pckA"
FT                   /locus_tag="Aflv_0413"
FT   CDS_pept        complement(449375..451045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pckA"
FT                   /locus_tag="Aflv_0413"
FT                   /product="Phosphoenolpyruvate carboxykinase (ATP)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32797"
FT                   /db_xref="GOA:B7GK41"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR015994"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK41"
FT                   /protein_id="ACJ32797.1"
FT                   /translation="MHELVWTIYQNVLYFLHKDKSNKGRFCPMNSIELTNKLSTLLQRD
FT                   GVFHNLSVPRLVEKVLTRKEGILTSSGAICATTGKYTGRSPKDKYIVEEPSVKHKIDWG
FT                   TVNQPISKEVFDKLYNKVIDYLMKKEELFVFNGFAGADPAYRLPIQVVNEFAWHNLFAH
FT                   QLFIRPTAEELQAHEPRFTVISAPTFKADPSIDGTRSETFIIISFERRTVLIGGTEYAG
FT                   EMKKSIFSVMNFLLPEQGIFPMHCSANVGQEGDVALFFGLSGTGKTTLSADPNRRLIGD
FT                   DEHGWSNNGVFNIEGGCYAKCINLSREKEPQIFDAIRFGSVLENVIVDPDTRIPNYDDA
FT                   TLTENTRAAYPLEAMDNIVQPSVAGHPHTIVFLTADAFGVLPPISKLTKEQAMYHFLSG
FT                   YTSKLAGTERGVTAPEATFSTCFGSPFLPLPATRYADMLGQKIDAHGVQVFLVNTGWTG
FT                   GGYGVGERMKLSYTRAMVKAALEGELNNVETVQDTIFGLHIPLHVPGVPDEVLQPKSTW
FT                   ADQEAYEQKAKELAAKFRENFKKFTNVDPRIEKLGGPIA"
FT   misc_binding    451136..451244
FT                   /bound_moiety="S-Adenosyl methionine"
FT                   /note="SAM_riboswitch_StAu; Aflv_R079"
FT   gene            451365..452570
FT                   /gene="metK"
FT                   /locus_tag="Aflv_0414"
FT   CDS_pept        451365..452570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metK"
FT                   /locus_tag="Aflv_0414"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32798"
FT                   /db_xref="GOA:B7GK42"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK42"
FT                   /protein_id="ACJ32798.1"
FT                   /translation="MPKRRLFTSESVTEGHPDKICDQISDAILDAILANDPNARVACET
FT                   SVTTGLVLVSGEITTSTYVDIPKIVRETIREIGYTRAKYGFDADTCAVLTSIDEQSPDI
FT                   AMGVDKALEAREGQMTDEEIEAIGAGDQGLMFGFACNETKELMPLPISLAHKLARRLAE
FT                   VRKEDILPYLRPDGKTQVTVEYDENGKPVRIDTIVVSTQHHPEITQDQIVRNIKEHVIQ
FT                   PVVPAELIDENTKYFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDP
FT                   TKVDRSAAYAARYVAKNIVAAGLADKCEVQLAYAIGVAQPVSISIDTFGTGKVSEDVLI
FT                   EVVRNNFDLRPAGIIKMLDLRRPIYKQTAAYGHFGRTDIDLPWERTDKAEALKQQALEL
FT                   AK"
FT   gene            complement(452608..453132)
FT                   /locus_tag="Aflv_0415"
FT   CDS_pept        complement(452608..453132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0415"
FT                   /product="Membrane-associated phospholipid phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32799"
FT                   /db_xref="GOA:B7GK43"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK43"
FT                   /protein_id="ACJ32799.1"
FT                   /translation="MLMLRKWYEWECKLFYSINRYFDQKWLNTYFRSITHVGGATFSIT
FT                   SVMLAIWLLRDEWRDTAIASAIALALSHIPVAMMKKIYPRKRPYISLYKTKVTKNPLTD
FT                   HSFPSGHTTAIFSVIVPFLLYAPSLTIWLLPIACSVAISRIYLGLHYPSDVLAGCMLGT
FT                   LFGVTTFSALM"
FT   gene            complement(453200..453730)
FT                   /locus_tag="Aflv_0416"
FT   CDS_pept        complement(453200..453730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0416"
FT                   /product="Isoleucine patch superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32800"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK44"
FT                   /protein_id="ACJ32800.1"
FT                   /translation="MIYPYKEHAPNIAPSAFIADYVTITGDVTIGEETSVWFNTVIRGD
FT                   VAPTIIGNRVNIQDNSVLHQSPNNPLIIEDDVTVGHQVILHSAIIRRGALIGMGSIVLD
FT                   GAEIGEGAFIGAGSLVPQGKKIPPRTLAFGRPAKVIRELTEEDEREMARIRREYVEKGQ
FT                   YYKSLQVNKPRDK"
FT   gene            453807..454631
FT                   /locus_tag="Aflv_0417"
FT   CDS_pept        453807..454631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0417"
FT                   /product="Lysophospholipase, alpha-beta hydrolase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32801"
FT                   /db_xref="GOA:B7GK45"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK45"
FT                   /protein_id="ACJ32801.1"
FT                   /translation="MYMWKWEGENAKGTIVIVHGAAEHHGRYKWLIEMFRMHGFHVVAG
FT                   DLPGQGTTSRSRRGHIDSFDEYIEAVASWVHEASVYEQPVFLLGHSMGGLVVIRTLQEK
FT                   RLPVRGVILSSPCLGLVHYPSKALEIASRILNVIHPKKRFPSGLTVEMATRNEEVREMD
FT                   KNDSLYVTKVSVRWYRELVKAIRIAHDNIADLPDVPMLVMQAGDDKIVDKSAVKSWFDQ
FT                   LTVSEKVYKEWPKLYHEIFNELEREQVFLYAHTFLSLQLQRGELIERSNKSV"
FT   gene            454597..455676
FT                   /locus_tag="Aflv_0418"
FT   CDS_pept        454597..455676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0418"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32802"
FT                   /db_xref="InterPro:IPR019712"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK46"
FT                   /protein_id="ACJ32802.1"
FT                   /translation="MNSLNVPTNPFSLMRAVYHRVFPLVHRELAVWKKRAEAIPDEELR
FT                   KQALASIATKTFHCEGGGILALLAGKEMERCIRFIVAYQTISDYLDNLCDRSTSLDPTD
FT                   FRALHDSMIHALTVGAKKETYYRYRAEQDDGGYLHALVDTCQEMLEGVQHYEVIAPFLH
FT                   ELASYYCDLQVHKHVKKEERIPRLKQWFAKHEASLPKMEWYEFSACSGSTLGIFCLVAY
FT                   ACNDAFDQLLAQRVRNSYFPYVQGLHILLDYFIDQEEDRQGGDLNFCFYYPNEETLFAR
FT                   LRHFIEEADRHIAQLPHREFHRFIHRGLLGLYLSDEKVHEQETIRKLAKQLLRSGGMTS
FT                   HFFYWNGRMYRKWQRWMYA"
FT   gene            455633..456283
FT                   /locus_tag="Aflv_0419"
FT   CDS_pept        455633..456283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0419"
FT                   /product="Endonuclease, Uma2 family (restriction
FT                   endonuclease fold)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32803"
FT                   /db_xref="GOA:B7GK47"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK47"
FT                   /protein_id="ACJ32803.1"
FT                   /translation="MVECIENGKDGCMREENGCIMEEKKRGMNMSLPRFSHVTYEQYLM
FT                   MRQDSDERLEYINGVVYMTPSPSIQHQLVSSNLHTIFGNYLKGKTCKVFAAPTDIELVS
FT                   EKCSERKLVIPDLSIICDPSGFTDTKYIGVPTLIVEILSPSNQAHDLVTKFNLYMEYGV
FT                   KEYWIVNPMKQAVTVYALNEDGLYEQADIKVSIGIVQSVSFSDLFFNLEEIFH"
FT   gene            complement(456323..456898)
FT                   /locus_tag="Aflv_0420"
FT   CDS_pept        complement(456323..456898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0420"
FT                   /product="SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32804"
FT                   /db_xref="GOA:B7GK48"
FT                   /db_xref="InterPro:IPR010719"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK48"
FT                   /protein_id="ACJ32804.1"
FT                   /translation="MMKLMRILPFARSLIDLAVKEGDIVVDATIGNGHDTLYLAERVGQ
FT                   SGHVFGFDIQAQAIENTTKRLHEHHMETRVTLVQASHAEIDAHIPPEYKGRITGAMFNL
FT                   GYLPGGDKQIVTKPNSTIAAIEQLLDIMAPEGIIVLVIYHGHPEGAIERDALLQYVRTI
FT                   DQQRAHVVRYEFINQINQPPFIVAIEKR"
FT   gene            complement(456895..457854)
FT                   /locus_tag="Aflv_0421"
FT   CDS_pept        complement(456895..457854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0421"
FT                   /product="Radical SAM superfamily enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32805"
FT                   /db_xref="GOA:B7GK49"
FT                   /db_xref="InterPro:IPR005911"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR032432"
FT                   /db_xref="InterPro:IPR039661"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK49"
FT                   /protein_id="ACJ32805.1"
FT                   /translation="MINMNPFPYTNDKKRYHTWNYHLRQTFGEKVFKVSLDAGFDCPNR
FT                   DGTVAYGGCTFCSAAGSGDFAGRRTDDLVTQFHTIKEKMHTKWKDGKYIAYFQAFTNTH
FT                   APVDVLREKFESVLHLEGVVGLSIATRPDCLPDDVVDYLAELNERTYLWVELGLQTVHE
FT                   QTATLINRAHDFSCYVEGVQKLRKHGIRVCAHIINGLPLETYDMMMETAKTVAHLDVQG
FT                   IKIHLLHLLKGTPMVKQYEKGMLRFLTFDEYVQLVCDQLEVLPPEMIIHRITGDGPIDL
FT                   MIGPMWSVNKWEVLNAIDAELERRNSYQGKNYVRKEER"
FT   gene            457964..458233
FT                   /locus_tag="Aflv_0422"
FT   CDS_pept        457964..458233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0422"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32806"
FT                   /db_xref="InterPro:IPR019668"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK50"
FT                   /protein_id="ACJ32806.1"
FT                   /translation="MRMATRQSMDEFLQHCEDVLRYAKEQYTEASKLEHYNDTEYVKAQ
FT                   QMLEHAVTDLAHFSLSCNAQQREQLHRMRLQLEQLQNDMILLRH"
FT   gene            458244..458384
FT                   /locus_tag="Aflv_0423"
FT   CDS_pept        458244..458384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0423"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32807"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK51"
FT                   /protein_id="ACJ32807.1"
FT                   /translation="MKKRSKQNNPEQKTLHAKDFGDPVKEVKQRNAKKGQEAKAEYHNE
FT                   T"
FT   gene            complement(458421..459203)
FT                   /locus_tag="Aflv_0424"
FT   CDS_pept        complement(458421..459203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0424"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32808"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK52"
FT                   /protein_id="ACJ32808.1"
FT                   /translation="MLMIKKSFLIFCTLVSFLILGCQSEHTKGFIVFGKWDGIYVAKKD
FT                   DPFVLNFILLSDSPLTNVTSIDFPEISHAIDDMQYDLIEGDKYKDFQLFNIAVNLRLKE
FT                   TNSATLSKITLIFDQKYKETFPIGQIKLAVDEKGIFTPQNGYVTAYPNTQFFQAKLKNI
FT                   SEHTIQIKRVTVENTDLQTKDVKINDKSEKQSVRPNETMNMYFTLAEKTEQNAHFYIVT
FT                   PKIEYELAGKASSTYIDPVFYGVTNLTKDKLDDILKQN"
FT   gene            459858..462275
FT                   /gene="leuS"
FT                   /locus_tag="Aflv_0425"
FT   CDS_pept        459858..462275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuS"
FT                   /locus_tag="Aflv_0425"
FT                   /product="Leucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32809"
FT                   /db_xref="GOA:B7GK53"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GK53"
FT                   /protein_id="ACJ32809.1"
FT                   /translation="MSFNHREIEKKWQKYWEENKTFKTTEDDGKRKFYALDMFPYPSGA
FT                   GLHVGHPEGYTATDILARMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNDPAEFTEKNI
FT                   NNFRRQIKSLGFSYDWDREVNTTDPNYYKWTQWIFLKLYEKGLAYMDEVPVNWCPALGT
FT                   VLANEEVIDGKSERGGHPVIRKPMKQWMLRITAYADRLLEDLEELDWPESIKEMQRNWI
FT                   GRSEGANIHFQVDGHDETFTVFTTRPDTLFGATYAVLAPEHPLVEKITTPEQKEAVEAY
FT                   LKQIQSKSDLERTDLAKEKTGVFTGAYAINPANGEKLPIWIADYVLMSYGTGAIMAVPA
FT                   HDERDYEFAKKFNLPIKQVVAGGDISKEAYTGDGEHINSDFLNGLNKEEATKKMIEWLE
FT                   ANGKGEKKVSYRLRDWLFSRQRYWGEPIPIIHWEDGTMTPVPEEELPLVLPKTDEIKPS
FT                   GTGESPLANIEEWVSVVDPKTGKKGRRETNTMPQWAGSCWYYLRYIDPHNDKQLADPEK
FT                   LEKWLPVDIYIGGAEHAVLHLLYARFWHKFLYDIGVVPTKEPFQKLFNQGMILGENNEK
FT                   MSKSKGNVVNPDDIVESHGADTLRLYEMFMGPLEASIAWSTKGLDGARRFLDRVWRLFV
FT                   EENGELNPKIVDNPETDTLERVYHQTVKKVTEDYEALRFNTAISQLMVFINEAYKAPIL
FT                   PKAYMEGFVKLLSPVCPHIAEELWEKLGYSNTIAYEAWPAYDEAKLVEDEVEIVIQVNG
FT                   KVRAKLHVPADATKEQLEQLAMEDEKIKEQIEGKTVRKVIAVPGKLVNIVAN"
FT   gene            462262..462630
FT                   /locus_tag="Aflv_0426"
FT   CDS_pept        462262..462630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0426"
FT                   /product="Rhodanese-related sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32810"
FT                   /db_xref="GOA:B7GK54"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK54"
FT                   /protein_id="ACJ32810.1"
FT                   /translation="MLQINVQSLSHMWRGAFAKERKRLMKEITAAQLKQIMQTGERVHI
FT                   IDVREDEEVAFGMIPSAIHIRMGDIPERMSELDKQKTYVIICRSGVRSEHVCRYLEAHG
FT                   YNVCNVIDGMLGWNGELL"
FT   gene            complement(462667..463941)
FT                   /locus_tag="Aflv_0427"
FT   CDS_pept        complement(462667..463941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0427"
FT                   /product="Predicted flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32811"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK55"
FT                   /protein_id="ACJ32811.1"
FT                   /translation="MKVMTYDVVVIGGGPSGLMAAIAAGERSKRVLLLDKGDKLGRKLA
FT                   ISGGGRCNVTNRRPVDELIQHIPGNGRFLYGAFSMFNNEDIIRFFERLGVPLKEEDHGR
FT                   MFPMSDSAQSVVQALLRELKRLRVDIRVHTPVKDIEYKDGAVYGVRLQTGEVIQTKAVV
FT                   VAVGGKSVPHTGSTGDGYAWAEKAGHTITELFPTEVPIVSHEPFIQKRTLQGLSLRDVA
FT                   LSVLNEKGKPIVTHRMDMIFTHFGISGPAALRCSQFVVKQLKKQPSTIMTIDALPDEKE
FT                   ETLFQRIVHTMKEEPKKTIKTIVKGTISLPERYVLFLLEQTKIDPHTVASTLSREKVRM
FT                   FVSLLKKFSFSVHGTLPLEKAFVTGGGVSVKEVHPKEMASKLMNGLYFCGEILDIHGYT
FT                   GGYNITAALVTGRLAGMHAAMYANQ"
FT   gene            464033..465658
FT                   /locus_tag="Aflv_0428"
FT   CDS_pept        464033..465658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0428"
FT                   /product="Polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32812"
FT                   /db_xref="GOA:B7GK56"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR024923"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK56"
FT                   /protein_id="ACJ32812.1"
FT                   /translation="MSSSKLLRGTFILTGGVFLSRILGLIYVFPFYQLVGKQGGALYSY
FT                   GYVPYTLFISIATMGVPLAVSKFVSKYNALGEYAIGRKLFRSGITLMAITGFLAWLVLY
FT                   ISAPLLAPFVVNDDGHGNSIADVTSVIRAVSFALLLVPMMSLIRGFFQGHESMGPTALS
FT                   QVVEQLVRIVFLLAGSYIVLRIFDGSLVTAIQVATFAAFIGAVGGLAVLFMYWFKRKSF
FT                   LDELLKQDRGTIHMSLKEMYKELIAYAAPFAFVGLAMPLYQLIDQFTFNKAMASIGLGA
FT                   ISEDAYGIFNVWAQKLVIIPVTLATSFSLTLIPTITKAYVQGESKQLRKYLNDTFQVVM
FT                   FITLPAVIGMALLSEYVYAAFYSYDPLGTEVLRAYAPTAIFFALFSVTAAILQGINKQK
FT                   FTVISLTIGLLFKLLFNYILIVSFETVGAILATTIGYALSVGLNLWVIHRYTNYRYHFV
FT                   AKRVLFMGILTTMMCAVVWPIVKLMDRFFHYNGSMLQSVIIVACGGGIGAAVYFYLSER
FT                   SNLLYALFGNRFSFLRKKEKKAVS"
FT   gene            complement(465673..465993)
FT                   /locus_tag="Aflv_0429"
FT   CDS_pept        complement(465673..465993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0429"
FT                   /product="Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32813"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK57"
FT                   /protein_id="ACJ32813.1"
FT                   /translation="MSIVTYTAYVTTKAKGVFYMDERQQQQQQMPGMPYYGGSPFTPGF
FT                   PMGFPGNPGFPGTPNFPSGSLERRVDRLERITERQQQQINNLNRRLQRVERQLGFPFSS
FT                   DF"
FT   gene            466043..466765
FT                   /locus_tag="Aflv_0430"
FT   CDS_pept        466043..466765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0430"
FT                   /product="RNA pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32814"
FT                   /db_xref="GOA:B7GK58"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK58"
FT                   /protein_id="ACJ32814.1"
FT                   /translation="MLRIDKLLANMGYGTRKEVKKLLKAGVVKVDGTIIKDAKTHVDPK
FT                   AQVVTVWGEEVEYKPFIYLMMNKPKGVISATEDAVEETVVDLLEEEDRIFDPFPVGRLD
FT                   KDTEGLLLLTNDGQLAHQLLSPKKHVPKIYEAIIDGEVTEDDVVAFQRGVVLDDGYETK
FT                   PAELVVIRTGLRSDVRITITEGKFHQIKRMFQAVGKRVIYLKRIQMGPIPLDETLELGE
FT                   YRELTDEEIALLKGEDKK"
FT   gene            complement(466804..467025)
FT                   /locus_tag="Aflv_0431"
FT   CDS_pept        complement(466804..467025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0431"
FT                   /product="Transcription regulator DeoR family"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32815"
FT                   /db_xref="GOA:B7GK59"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK59"
FT                   /protein_id="ACJ32815.1"
FT                   /translation="MKPSTDRMLTRIKSVYMFINERGTVTTQELVDEFGITPRTIQRDL
FT                   NVLAYNDLIHSPSKGKWTTTKKRVKMSS"
FT   gene            467187..468599
FT                   /locus_tag="Aflv_0432"
FT   CDS_pept        467187..468599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0432"
FT                   /product="Zinc-dependent metallopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32816"
FT                   /db_xref="GOA:B7GJZ9"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010964"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B7GJZ9"
FT                   /protein_id="ACJ32816.1"
FT                   /translation="MKVTMNMNWIEEVKKREKALLQDLQTFLRIPSVRNEQTATEEAPL
FT                   GKEVYEALCYMLKRGEEEGFVVKNVDGLAGHIEMGHGEEMVGILCHVDVVPAGDGWTFD
FT                   PFGATIVDGKIYARGALDDKGPTIAAFYAMKIVKELGLSLSKRVRMIIGTDEESDWQCV
FT                   ERYFQTEPMPTLGFAPDADFPIIYAEKGIADFDLIQQPMNQQMDAVLLSFQAGRRYNMV
FT                   PDFAEAVLQLTNGNDMKERFIKFLQVHTLEGEAYVDGETMKLCVRGVSAHGMEPNNGVN
FT                   AGLWLAKFLADETLDPQANEFVRFVSQYFYEDTRGKQLGVAHTNEELGDLTINVGVLSY
FT                   TSEHGGKMGINLRYPVTSDIAHTKEVIERVANGHHFTLTNFSNSSPHYVAKDHPLVQTL
FT                   QRVYEEQMGERASLLAIGGGTYARSLQAGVAFGPLFPNRPDVAHQKDEYMFIEDLLKAT
FT                   AIYAQAIYELAK"
FT   gene            468686..469837
FT                   /locus_tag="Aflv_0433"
FT   CDS_pept        468686..469837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0433"
FT                   /product="Maltose permease, MFS type"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32817"
FT                   /db_xref="GOA:B7GK60"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR024989"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK60"
FT                   /protein_id="ACJ32817.1"
FT                   /translation="MYTRIFRIFYFLQFFSFGSLFPLLSVYLKDEVGLSGTEIGMIMSI
FT                   SPIVMIFIQPIWGMISDYTRKPVQVLIVSLLGTAFFGFMYSFVHSYAWLLVIAALLAVT
FT                   QSGIVPLSDSITLHYVQKANERYGSIRLWGALGFAAAVPVAGQVAEWFDLRFIFYIFVA
FT                   LLIISSLLAWKLPREQSSAKVNIREGMKELIRIPRFLLFLLTTFLVFGPVYANNFYFGI
FT                   LITDLGGTLTGVGLAFLLAAGSEAPFMKFADGVVRKFGMMNVLFVATALSCARWLFYFF
FT                   EPPLMIVYATTIVQGASVGLFIPAALQYVRDITPAHVRTTAVSLYATVGNGLGSWFCTF
FT                   VGGYILERWTIEHVYLFFGLLTFGGMMIFAWQSKKALRKIHEF"
FT   gene            469834..470400
FT                   /locus_tag="Aflv_0434"
FT   CDS_pept        469834..470400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0434"
FT                   /product="2'-5' RNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32818"
FT                   /db_xref="GOA:B7GK61"
FT                   /db_xref="InterPro:IPR004175"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK61"
FT                   /protein_id="ACJ32818.1"
FT                   /translation="MIKFRKSKVGRYMHYFLAISLPNELKKQLHSFISEWKAPFRLFVH
FT                   EEDYHITLAFLGRATEEERKQIAEYMPKVVRKHRAFSLQLSEVYSFGSRILWYGVKEES
FT                   RLFSLRQDVYDVCRQIGFSLDARPFTPHITLAKKWNGSFPFSLETYPRKIEGEDIRFFV
FT                   HDVVLYETHMDQTPKYKPLMRFPLS"
FT   gene            470423..470800
FT                   /gene="lrgA"
FT                   /locus_tag="Aflv_0435"
FT   CDS_pept        470423..470800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lrgA"
FT                   /locus_tag="Aflv_0435"
FT                   /product="Putative effector of murein hydrolase LrgA, holin
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32819"
FT                   /db_xref="GOA:B7GK62"
FT                   /db_xref="InterPro:IPR005538"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK62"
FT                   /protein_id="ACJ32819.1"
FT                   /translation="MGITVIQIGVLYMLYIFGSIIQQLLHIPIPGSMIGMLLLFLLLMT
FT                   GMVKEEWISRGANMLLSHLTLLFIPATVGIIDYVELFSGKGIWSIFVVIVSTMIVMLFA
FT                   GFIGQWAQTREQKRMHEVKGA"
FT   gene            470797..471468
FT                   /gene="lrgB"
FT                   /locus_tag="Aflv_0436"
FT   CDS_pept        470797..471468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lrgB"
FT                   /locus_tag="Aflv_0436"
FT                   /product="Putative effector of murein hydrolase LrgB"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32820"
FT                   /db_xref="GOA:B7GK63"
FT                   /db_xref="InterPro:IPR007300"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK63"
FT                   /protein_id="ACJ32820.1"
FT                   /translation="MIGAIMLLWTIVVYMAMRKLYARFYFPLLVPIATSTVVIIITLSL
FT                   FHLSYEQYMSGGKCLVHLLGPAVVALALPLYQHRHTLKQFLWPLLCSTFFGTIIGMGSG
FT                   LLLARLFHLPERVVRSIIPKSVTSPVAMDIAKLIDGIPTLAAVYVMVAGIFGAMFGPTI
FT                   FQRLRLTTALGVGSGLGAASHGIGTAKALEIGKKEAAISSVAMTLSAIFASLLCPLLLL
FT                   L"
FT   gene            471504..472460
FT                   /locus_tag="Aflv_0437"
FT   CDS_pept        471504..472460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0437"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32821"
FT                   /db_xref="InterPro:IPR012397"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK64"
FT                   /protein_id="ACJ32821.1"
FT                   /translation="MGQLIKLQDYISRYELDIYHYPSEFIRLKKKQWERMKHAWETGQL
FT                   VPQVESHVHESWKWLEEEPSLFDKIKRIWKRKKVKDVTDENEQSPEEEDFMFSIPSEPR
FT                   TIEELKILFLEKLFQLQIRWASSTLIEESVIDPKYYYDVYLKYFLQRFPDTYLCMYKPV
FT                   FLLKKAPVELNTILISPTTTWCVAFTEERKNNIIVGSAERFWTEIVDDVERKIVNPMIS
FT                   LHRTEKVVQTIYKQFSVDMPIKKVLINREGYIDYRYAPSDLDIVDRRHYETWFMSLRQL
FT                   TMPLKHTQLKAAQSLLTYCDTRYYDPLVIEEVEEADE"
FT   gene            472671..474791
FT                   /locus_tag="Aflv_0438"
FT   CDS_pept        472671..474791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0438"
FT                   /product="Type II secretory pathway, pullulanase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32822"
FT                   /db_xref="GOA:B7GK65"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011840"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR040697"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK65"
FT                   /protein_id="ACJ32822.1"
FT                   /translation="MMTKQHSFEAYLDELTLITILVPNDVVHERAPIFFLCDKEQTAYR
FT                   LTIRSTERQHLFTKYECTVPFIVELGKRYVVYTEEGWQAPLQVGAVMRTKAFDDLYAYD
FT                   GNDLGATYKQEKTTFKVWAPTATNVLLKLIHPKTKEETTYAMVREQKGVWTYTVYENME
FT                   YFLYTYKTYINFVWREAVDPYAKAVSANGTYGVVVDLSKTNIQKPTMPPFISMTDAIIY
FT                   EMHVRDFTIHPKSGVEHKGKYLGLTERDTLGPNGMVTGLSYVKQLGVTHVQLMPVQDFE
FT                   GVDELQPFEYNWGYNTVHYNAPEGSYATDPTDPYARIIELKQAIRAFQQEGIRVILDVV
FT                   YNHVYIREMSSFEQLVPGYYFRYESNGYPSNGTGVGNDLASERKMVRKFIVDSVTYWLS
FT                   EYGVDGFRFDLMGILDIDAMNDVRRAIDAIDPTVLVLGEGWELATPLPQEKKTTIANAR
FT                   HTPRIAYFNDRFRDYVKGSTFQVHDRGFALGDCSYKEAVMEAVRGSIHLFFSPRQSVNY
FT                   VECHDNHTLWDKMMIANAHESEYIRRKRQKLATAIVLLSQGIPFLHSGQEFYRTKQGIE
FT                   NSYNAPDEVNRIDWERKSEWEEDIREITALIALRKKHAAFRFFTADQVRRHIKFYDTHP
FT                   SVIAYQLVDVGVYGPWEQIVVVHHNEEKKTTLPLSEGKWKVVFSSNREEVEKKCERFIE
FT                   MNGIGTWVLIEC"
FT   gene            474873..475649
FT                   /locus_tag="Aflv_0439"
FT   CDS_pept        474873..475649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0439"
FT                   /product="Phosphotransferase, choline kinase family enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32823"
FT                   /db_xref="GOA:B7GK66"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK66"
FT                   /protein_id="ACJ32823.1"
FT                   /translation="MEQLLGKEWEISPAGGATGDAYIAEHDGKKLFLKRNSSPFLAVLS
FT                   AEGIVPKLVWTKRMENGDVITAQQFLQARELKPHDMTSKQVAQLLRKIHRSKELLGMME
FT                   RLGKKPLLPNRLLEEVKQNEYAELKAHPIVRDALTFLERHVNDMHNTDYVVCHCDMNHN
FT                   NWLLTEDNQLYLIDWDSAMIADPAIDIGMLLYAYIPREQWESWLEEYGLTFDEQLQLRM
FT                   KWYTIAQTVALLSWHKGRNNEKEMQRLLHFLEHVLR"
FT   gene            complement(475641..475916)
FT                   /locus_tag="Aflv_0440"
FT   CDS_pept        complement(475641..475916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0440"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32824"
FT                   /db_xref="InterPro:IPR025547"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK67"
FT                   /protein_id="ACJ32824.1"
FT                   /translation="MNMAINHEHQLTVLKDILSEHHLDRSGTVSECEQIERLAKSLMAN
FT                   DAIHSELKQTLSHIYAYSQNGKNATDLSLHIDQHEQQLANWMDQLT"
FT   gene            475890..476633
FT                   /locus_tag="Aflv_0441"
FT   CDS_pept        475890..476633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0441"
FT                   /product="Predicted SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32825"
FT                   /db_xref="GOA:B7GK68"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK68"
FT                   /protein_id="ACJ32825.1"
FT                   /translation="MFMINGHVHPPIRFIIWPFLSFYIQRNGGWDVRLRNKPWAKEKIA
FT                   SYPQYIIPQPEQYKGRWHELFSNDHPIHIEIGTGKGRFITEMAKTNPHINYIGIELYES
FT                   VIVCALDKLIENDLPNLRLLNVNAKDLTNIFAKGEVERIYLNFSDPWPKKRHEKRRLTY
FT                   RSFLELYENILVDEGEIHFKTDNRGLFEYSLVSFSQYGLVLQYVSLDLHRSDFEGNVMT
FT                   EYEQKFSEKGNPIYRCEVKYRKPMS"
FT   gene            476680..477552
FT                   /locus_tag="Aflv_0442"
FT   CDS_pept        476680..477552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0442"
FT                   /product="Zn-dependent hydrolase, glyoxylase family"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32826"
FT                   /db_xref="GOA:B7GK69"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK69"
FT                   /protein_id="ACJ32826.1"
FT                   /translation="MDDERGQGGEKMEKLTIGRITMTWLNGGITHLDGGAMFGVVPKPL
FT                   WTKKYPCNEQNQIPLRTDPILLQVDGKNILIESGIGRGKLNEKQKRNFGVTEESSLIEQ
FT                   LALLSLTPEDIDVVLMTHLHFDHASGLTTWEGDALVPTFPRARIITSAVEWAEMKEPNI
FT                   RSRNTYWKENWEAIVDQVDTFAEQLEVVSGVTMIHTGGHSDGHAIIMITSEGETAIHLG
FT                   DLMPTHAHQNPLWVMAYDDYPMTSIFAKQKWLAYGMEKNAWFTFYHDAYYRAVRWSDEF
FT                   QIVESVKRQ"
FT   gene            complement(477576..477878)
FT                   /locus_tag="Aflv_0443"
FT   CDS_pept        complement(477576..477878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0443"
FT                   /product="Uncharacterized small secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32827"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK70"
FT                   /protein_id="ACJ32827.1"
FT                   /translation="MHMRMKTFLTGIVVGATAAYIFDQWQHRRFISSEQALQKAKEAFQ
FT                   QTGAITGSWIQTTVEAIEKNGLRYTVYRGGVTRPTDAYECLIDAKTGTIIEARKL"
FT   gene            477979..479046
FT                   /locus_tag="Aflv_0444"
FT   CDS_pept        477979..479046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0444"
FT                   /product="Cellulase M related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32828"
FT                   /db_xref="GOA:B7GK71"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK71"
FT                   /protein_id="ACJ32828.1"
FT                   /translation="MDLQLFRTLTELPGAPGNEHAVRAFMREQLQKYADEIVQDRLGSI
FT                   FGVKRGTENGPVVMVAGHMDEVGFMVTAITEQGMVRFQPLGGWWGQVLLAQRVQIITDQ
FT                   GPIVGVIGSIPPHLLDEEQRKKPMDMKNMLIDVGADDRNDAERMGIRPGQQIVPLCPFT
FT                   PMANEKKIMAKAWDNRYGCGLAIELLKELKDETLPNVLYAGATVQEEVGLRGAQTAATM
FT                   IQPDIFFALDASPANDMTGDKKEFGHLGKGALVRIYDATMITHRGMREFILDTAETNNI
FT                   PYQYFISPGGGTDAGRVHIANSGVPSAVIGICARYIHTHASIIHVDDYEAAKQLLIALV
FT                   KQCDRATVDAIRHNA"
FT   gene            479059..479586
FT                   /locus_tag="Aflv_0445"
FT   CDS_pept        479059..479586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0445"
FT                   /product="Inosine/xanthosine triphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32829"
FT                   /db_xref="InterPro:IPR026533"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK72"
FT                   /protein_id="ACJ32829.1"
FT                   /translation="MKIAVGTKNNTKVKAVKAVFHEAHHTIIASDVQPSVSKQPFSDEE
FT                   TLQGAIERATLAAHEQQAHIGIGLEGGVFVAHNGTVWLCNWGALVDRDGVVVVAGGARI
FT                   PLPVEISEQLKTGKELAEVIDEYADRRDVRSNEGAIGILTNGAIDRTTMYTHIVHMLKG
FT                   QYEHQKKGWRNQ"
FT   gene            479571..479909
FT                   /locus_tag="Aflv_0446"
FT   CDS_pept        479571..479909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0446"
FT                   /product="Thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32830"
FT                   /db_xref="GOA:B7GK73"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK73"
FT                   /protein_id="ACJ32830.1"
FT                   /translation="MEKSMKTIERIEQYNEAIQHGKVIMMFTADWCRDCQFIKPVLPEI
FT                   EAQFSDYTFYAVDRDRLLDLFAEHNVFGIPSFIVYENGQEKGRFVSKDRKTKEEIVAFI
FT                   QSLGERNE"
FT   gene            479893..480705
FT                   /locus_tag="Aflv_0447"
FT   CDS_pept        479893..480705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0447"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32831"
FT                   /db_xref="InterPro:IPR010838"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK74"
FT                   /protein_id="ACJ32831.1"
FT                   /translation="MSVMNSKQISEHIQQRLSDYPWEFRWDRKKDTLRIEHRDTKKGVT
FT                   ISLPSIIAKWELEKERAIDEVVYYVEQTLTALHDDSSLQGKEKHIYPVIRSTSFPTTTN
FT                   EGAAFIYDEHTAETRIYYALDLGTTYRLIDERLVESERWNVQQLKEIARFNVRSLPTTV
FT                   KEDHVAGNTFYFVNTNDGYDASRILNDAFLKNFAEKIKGTMLLAVPHQDVLIIADIENE
FT                   IGYDVLAQLTMSFFASGRVPITALSFLYEDGQLQPIFILGKNRRKDEK"
FT   gene            480702..481310
FT                   /locus_tag="Aflv_0448"
FT   CDS_pept        480702..481310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0448"
FT                   /product="EMAP domain RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32832"
FT                   /db_xref="GOA:B7GK75"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027855"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR037154"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK75"
FT                   /protein_id="ACJ32832.1"
FT                   /translation="MMNVFYNREGIGDTLLITLKVVDPQVRAFEKKGDVVRIYDEQTGE
FT                   TVGYNIFRASTYSTFQGNGVVELNEQVIATINDILQKNGVNEQLKADFSPKFVVGYVKE
FT                   KEKHPNADKLSVCQVDVGTETLQIVCGAPNVEAGQKVVVAKVGAVMPSGLVIQEAELRG
FT                   VKSYGMICSARELDLPNAPQEKGILVLNDEYEVGQPFFS"
FT   gene            481488..483548
FT                   /locus_tag="Aflv_0449"
FT   CDS_pept        481488..483548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0449"
FT                   /product="DNA segregation ATPase FtsK/SpoIIIE"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32833"
FT                   /db_xref="GOA:B7GK76"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018541"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041027"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK76"
FT                   /protein_id="ACJ32833.1"
FT                   /translation="MEAKVVYEYPKGKFRFPLIPDEPKERQKERIYEQKRSSPQTVSFE
FT                   KKIARIERKGNEAPTFRPTDVPSPVFGYKRMERVERKKEHDAVVEFELPIVEKVETNKH
FT                   VHTQGDELVGRQLVDETNEHVHMLASESFQHEEKEVVHEKEEMQREEVQKEVVEEHVRQ
FT                   TQVGENKEQERREEKIEQTNEERERRRSGVPYNVMMLKQDREKWKERQEKRSYVFPSLS
FT                   LLHAPMIQHEGDEAWLKEQTERLNETFKNFNVGATVVHVTQGPTVTRFEVQPELGVKVN
FT                   KITNLADDIKLNLAAVDIRIEAPIPGKNTIGIEVPNRSSRPVFIREVLQSEVFQQSDSP
FT                   LTVALGLDISGNPIVTDLKKMPHGLIAGATGSGKSVCMNAMLVSLLYKAAPHEVKLLLI
FT                   DPKMVELAPYNHIPHLVSPVITDAKAATAALKWAVSEMERRYELFAHTGVRDIVRYNEL
FT                   IRKAQKLEQHLPYIVIVIDELADLMMVAPADVEEAICRIAQKARACGIHLLVATQRPSV
FT                   DVITGLIKANIPTRIAFSVSSQIDSRTIIDINGAEKLLGRGDMLFLENGKAKPIRLQGN
FT                   FVSDEEIERVVAHVRQQMEPSYLFQHDELLQQHVQADEDDELFYEACEFVVQQGGASTS
FT                   SLQRRFRIGYNRAARLIEMMEQRGIVSAPKGSKPRDVLIDEQDLEQLQDTI"
FT   gene            483590..484729
FT                   /locus_tag="Aflv_0450"
FT   CDS_pept        483590..484729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0450"
FT                   /product="Nicotinic acid phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32834"
FT                   /db_xref="GOA:B7GK77"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR035809"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK77"
FT                   /protein_id="ACJ32834.1"
FT                   /translation="MKTMVEGERKMKEIELKLQGKIKRLTNKTFKFDERVRDGWFSAVY
FT                   FLKTREIVKEFRPNNIVTMQFFQKEHAVLCGTDEVIALLHTFADEPEKLEIYSLKDGDK
FT                   ISPFETVLTITGPYQNFGYLEGIIDGILARRTSVATNVYNVVKAAALSGVQKPVIFMGD
FT                   RDDHFMMQAGDGYAAFIGGSTAQATHAMNEWWGKQGMGTMPHALIQLFDGDVVAAAKAY
FT                   HAKYPDDDLIVLVDYNNDCITDALKVAREFGDKLKAVRVDTSRTMIDQYFIRHPEVLGT
FT                   FDPRGVNPPLIFALREALDREGFEHVKIVVSGGFNEQRIIEFEKQGVPVDMYGVGSSLL
FT                   KVHIGFTGDNVLLNGKHQAKAGRRYRPNPRLEKVEYTPQ"
FT   gene            484890..486191
FT                   /gene="murC"
FT                   /locus_tag="Aflv_0451"
FT   CDS_pept        484890..486191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="Aflv_0451"
FT                   /product="UDP-N-acetyl muramate-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32835"
FT                   /db_xref="GOA:B7GK78"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GK78"
FT                   /protein_id="ACJ32835.1"
FT                   /translation="MTIYHFVGIKGTGMSALAQVLHDMKCVVQGSDYDKRFFTQEALEA
FT                   RGIPIFPFSAQNIRENMVVIAGNAFPDTHEEIVAARELGVPVIRYHQFLGDFLQKFTSI
FT                   AVTGAHGKTSTTGLLAHVMQGAKPTSYLIGDGSGKGREGSEYFVFEACEYRRHFLAYSP
FT                   DYAIMTNIDFDHPDYFANIEDVFSAFQQMAWQVKKGIIACGDDEYLQKIQAKVPVVFYG
FT                   FGEDNDFQARNIVKTPEGTSFDVFVRHTFFASFHIPRYGDHNVLNALAVIALCHYEGID
FT                   VNIIQERLKTFPGVKRRFHEKMLGSQVLIDDYAHHPTEIRATIEAARQKYPERQIVAIF
FT                   QPHTYTRTQTFLDEFAESLSLADAVYLCDIFSSAREHQGKLSIEDLRAKIEGAKLLDEE
FT                   QVDVLKQHDNAVLIFMGAGDIQKFQEKYEQSVHV"
FT   gene            complement(486200..486535)
FT                   /locus_tag="Aflv_0452"
FT   CDS_pept        complement(486200..486535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0452"
FT                   /product="Thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32836"
FT                   /db_xref="InterPro:IPR022551"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK79"
FT                   /protein_id="ACJ32836.1"
FT                   /translation="MHMEKIETIEQFKQIYSFHRPFLLMKHSLTCPISHRAWGEFERFT
FT                   KDFPHIHAYYLHVQHARPLSQHIAETFHVKHESPQVLWVTNEGVAWHASHWNVTYEQIK
FT                   KATMSES"
FT   gene            complement(486516..486845)
FT                   /locus_tag="Aflv_0453"
FT   CDS_pept        complement(486516..486845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0453"
FT                   /product="Uncharacterized conserved protein, involved in
FT                   general stress response"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32837"
FT                   /db_xref="GOA:B7GK80"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK80"
FT                   /protein_id="ACJ32837.1"
FT                   /translation="MAKNGSFLLGAIVGGIAGAAATLFLSSERGKQLLQEFTETNMKRW
FT                   QQHEKENVTHDVEQQKGKEEQKPFSSIPIPLPSSDVEQLLKETEQAVNDVEKRFNKGMD
FT                   AHGEN"
FT   gene            complement(486858..487250)
FT                   /locus_tag="Aflv_0454"
FT   CDS_pept        complement(486858..487250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0454"
FT                   /product="Uncharacterized conserved membrane or secreted
FT                   protein, involved in general stress response (DUF948)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32838"
FT                   /db_xref="GOA:B7GK81"
FT                   /db_xref="InterPro:IPR009293"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK81"
FT                   /protein_id="ACJ32838.1"
FT                   /translation="MNVILYGSVALIAIAFLILVIYVIQTLKTLQTTLQHVTKTVEEVE
FT                   KQMHEIGKETAQLLHKTNALADDVYKKAESLQDVFDAVKQVGVTVQTFSDSISKTLATN
FT                   EKKIMQAIQWGQTLVEIWTKWKEKRK"
FT   gene            487350..488495
FT                   /gene="ampS"
FT                   /locus_tag="Aflv_0455"
FT   CDS_pept        487350..488495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampS"
FT                   /locus_tag="Aflv_0455"
FT                   /product="Aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32839"
FT                   /db_xref="GOA:B7GK82"
FT                   /db_xref="InterPro:IPR000787"
FT                   /db_xref="InterPro:IPR035097"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK82"
FT                   /protein_id="ACJ32839.1"
FT                   /translation="MYIRWNGGIQMKDPRIEKLAKNLIHYSLRLQKGEKVLIENFGLQR
FT                   ELVIALVREAYAVGAHPFVSLKDHQVDRALLLGAQEEQFNMMAEFEANVMKEMDAYIGL
FT                   RAGDNINEFADVPADKMKIHGKTIMQKVHRDIRVPKTKWVVLRYPNPSMAQLAKMSTEA
FT                   FEDFYFNVCNLDYGKMDKAMDALVELMNKTDQVRITGPGTDLTFSIKDIPAVKCSGQMN
FT                   IPDGEVYTAPVRDSVNGTITFNTPSPYQGFTFENVKLTFKDGKIIEATANDTERINQIF
FT                   DTDEGARYIGEFAIGVNPYIQHPMQDILFDEKIDGSFHFTPGQCYDEAYNGNHSNIHWD
FT                   MVMIQRPEYGGGEIYFDGVLIRKDGRFVLPELEPLNPENLK"
FT   gene            complement(488518..490674)
FT                   /locus_tag="Aflv_0456"
FT   CDS_pept        complement(488518..490674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0456"
FT                   /product="FtsA-like ATPase fused to uncharacterized domain"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32840"
FT                   /db_xref="GOA:B7GK83"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK83"
FT                   /protein_id="ACJ32840.1"
FT                   /translation="MGSLIFALDIGTRSVVGIILKETDGRYQVEDIVVKEHEERAMLDG
FT                   QIHDVLAVSNVILDIKKTLEGRHGPLTRVCVAAAGRSLKTEKGRATISIKGKPLLTHED
FT                   VAYLELAAVQQAQMTLAEKSANEKSHHYYCVGYSVTRYEIDGEEIGNLIDQQGDEASVE
FT                   VIATFLPRLVVESLLAALQRAHLEMEALTLEPIAALNVLIPPTMRRLNVALVDIGAGTS
FT                   DIAITDLGTVIAYGMVPMAGDEITEAISDAYLLDFPLAEQAKRDLHTKETVTITDILGF
FT                   ETEVPREQMIATISDAIDRLADAISKEILRLNNHQSPKAVMLVGGGSLTPELPKRLAHK
FT                   LHLPENRVAIRGIDAIQKLHIDREEMKHRPELVTPIGIAIAAKQTPIQYVTVHVNGQVI
FT                   RLFDMKQLTIGDALLAAGIQLHKLYGKPGLACVVTLNGQVITVPGTHGEPPTIIKNGEL
FT                   ATFDTPIKNNDEIVIEKGKDGQQATVQLRDLLESLPTKHVTINDQHYTIEPLILRNGEP
FT                   VSLDAVLCDRDDIVVHMPETIEQLLQATKNDHLLKQLEPFTITLNGKQIKFPEWCGTMY
FT                   RNGLECQRYTTFEDGDHITVYEQKQRTIAQIAEAKQIKLHYTMPIIFHGETFTLTKPIG
FT                   IFYRNGEQLKEDDLVHHEDELEFHEQKIEPFIFQDIFQYVEVDIPHGASTTFTLLKNGE
FT                   PTTFYEPLTPGDQLEIVWHKKKQL"
FT   gene            490816..491907
FT                   /gene="aroA"
FT                   /locus_tag="Aflv_0457"
FT   CDS_pept        490816..491907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroA"
FT                   /locus_tag="Aflv_0457"
FT                   /product="3-deoxy-D-arabino-heptulosonate 7-phosphate
FT                   (DAHP) synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32841"
FT                   /db_xref="GOA:B7GK84"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006268"
FT                   /db_xref="InterPro:IPR010954"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK84"
FT                   /protein_id="ACJ32841.1"
FT                   /translation="MRCMSNERLDELRAKVDELNLELLKLINERGRIVQEIGKIKDAQG
FT                   TYFYDPVRERKMLDLILEHNDGPFDTATLKHIFKEIFKAGLDLQEDDHKKALLVSRKKK
FT                   PENTIVDVKGEKIGDGNQYFVMGPCAVESYEQVAEVAQAIKRHGLKLLRGGAYKPRTSP
FT                   YDFQGLGVEGLKILKRIADEFDLAVISEIVTPADIETALDYIDVIQIGARNMQNFELLK
FT                   AAGQVNKPVLLKRGLAATIEEFIHAAEYIMSQGNGQIILCERGIRTYEKATRNTLDISA
FT                   VPILKKETHLPVFVDVTHSTGRRDLLLPCAKAALAIGADGVMAEVHPDPAVALSDSAQQ
FT                   MDIDQFNEFMEELKSFQKQFVKA"
FT   gene            491988..493058
FT                   /gene="ccpA"
FT                   /locus_tag="Aflv_0458"
FT   CDS_pept        491988..493058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccpA"
FT                   /locus_tag="Aflv_0458"
FT                   /product="Transcriptional regulator, LacI family (HTH and
FT                   periplasmic-binding domains)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32842"
FT                   /db_xref="GOA:B7GK85"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR006377"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B7GK85"
FT                   /protein_id="ACJ32842.1"
FT                   /translation="MIFLHKIAMYDSFRYIECKKGVYVMNVTIYDVAREANVSMATVSR
FT                   VVNGNPNVKPSTRKKVLEVIERLGYRPNAVARGLASKKTTTVGVIIPDISSIFFAEMAR
FT                   GIEDIATMYKYNIILSNSDQNKEKELHLLNTMLAKQVDGILFMGGDVTEEHVEQFKKSD
FT                   VPIVLAATIEKNNIIPSVNIDYEQAAYDAVHMLIEKGHKRIAYVTGPLNDPINGLKKLA
FT                   GYRRALEEANIAYDEALVVEGDYTYDSGMEAYEKLAELAQQPTAIFVGTDEMALGVIHG
FT                   AQDRGIRIPDELEVVGFDNTRLATMVRPKLTTVVQPMYDIGAVAMRLLTKYMNKEHVDN
FT                   HIVVLPHRIEYRDSTK"
FT   gene            complement(493159..494358)
FT                   /gene="acuC"
FT                   /locus_tag="Aflv_0459"
FT   CDS_pept        complement(493159..494358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acuC"
FT                   /locus_tag="Aflv_0459"
FT                   /product="Histone deacetylase family protein, involved in
FT                   acetoin utilization"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32843"
FT                   /db_xref="GOA:B7GGP1"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR003085"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGP1"
FT                   /protein_id="ACJ32843.1"
FT                   /translation="MAEFAGGFIMSKNSVFIYSDAFQTYKFHDRHPFNQLRVKLTYDLL
FT                   QTLGALHDEQIVAPRLATDEELALIHDVDYIEAVKKAGKGQLSEDVALNYGLGTEDTPI
FT                   FPNMHEASALLVGGTLTAVDYVLSGKAEHALSLGGGLHHGFRGKASGFCIYNDSSVAIK
FT                   YMQEKYGVRVLYVDTDAHHGDGVQWTFYDDPNVCTFSIHETGRYLFPGTGNVNERGQGK
FT                   GYGYSFNIPVDAFTEDESWLAAYKEALMEIADFFRPDVILTQNGVDAHYYDPLTHLCAT
FT                   MRIYREIPKLAHQIAHQYCNGRWIAVGGGGYDIWRVVPRAWALLWLEMTEQSDISGRLP
FT                   ENWVARWQPHAPVSLPLEWDDPENLYSPIPRKAEITEKNAQTVMKALQPIRSNKQRLNL
FT                   "
FT   gene            complement(494328..494957)
FT                   /gene="acuB"
FT                   /locus_tag="Aflv_0460"
FT   CDS_pept        complement(494328..494957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acuB"
FT                   /locus_tag="Aflv_0460"
FT                   /product="Acetoin utilization protein (CBS, ACT domains)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32844"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGP2"
FT                   /protein_id="ACJ32844.1"
FT                   /translation="MMKTDVIALKPSNTIADALNIVKQKNIRHLPIVDDEYRVVGIVTD
FT                   RDLRDASPSIFHANEHLEDLQKPLSTIMKTNVITGHPLDFVEEVAALFYEHRISCMPIV
FT                   KENKLVGIITESDLLYTLVQLTGAHQPGSQIEIKVPNRAGMLSEVASVFHKRNINISSV
FT                   LVYPHQDDMYKVLVFRIQTMNPMAIIHDLKEQGYDVLWPNLPGVSS"
FT   gene            complement(494992..495624)
FT                   /locus_tag="Aflv_0461"
FT   CDS_pept        complement(494992..495624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0461"
FT                   /product="Acetyltransferase (GNAT family), involved in
FT                   acetoin utilization"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32845"
FT                   /db_xref="GOA:B7GGP3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR024699"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGP3"
FT                   /protein_id="ACJ32845.1"
FT                   /translation="MEHKKTYNAKQLKTPKGTLIIEGPISPEKLASYEFHHDLTAFRQP
FT                   HQQHRALIEIAGLPEGRIIIARHGHTIVGYVTFLYPDPLERWSQGKMENLIELGAIEVI
FT                   PDFRGCGVGKNLLKVAMMDDAMEDYIIITTEYYWHWDLKRTGLNVWEYRKVMEKMMNAG
FT                   GLVWYATDDPEICSHPANCLMARIGKRVDQQSIQKFDQLRFMNRFMY"
FT   gene            495788..497509
FT                   /gene="acsA"
FT                   /locus_tag="Aflv_0462"
FT   CDS_pept        495788..497509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acsA"
FT                   /locus_tag="Aflv_0462"
FT                   /product="Acyl-coenzyme A synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32846"
FT                   /db_xref="GOA:B7GGP4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGP4"
FT                   /protein_id="ACJ32846.1"
FT                   /translation="MIKVETLPVIQGDFNLKNYEETYQTFDWSEAEKHFSWYETGKVNM
FT                   AYEAIDRHVETFRKNKVALYYRDATREEKYTFKEMKEFSNKVANVLKEVADVEKGDRVF
FT                   IFMPRSPELYFSVLGAIKLGAIVGPLFEAFMEGAVRDRLEDSEAKVIITTPELLPRVPV
FT                   NELPALKYVFLVGDDIKEEGPFFDLKKRMNAASKHFDIEWVGREDGLILHYTSGSTGKP
FT                   KGVLHVHNAMIQHYQTAKWVLDLKEDDVYWCTADPGWVTGTSYGIFGPWLCGASNVIVG
FT                   GRFNPEAWYKTIEDYGVTVWYSAPTAFRMLMGAGDELVKKFDLRSLRHILSVGEPLNPE
FT                   VVRWGMKVFNRRIHDTWWMTETGAQLICNYPCMEIKPGSMGKPIPGVKAAIVDDQGNEL
FT                   PPYRMGNLAIKKGWPSMMRAIWNNPQKYESYFLPGDWYVSGDSAYMDEDGYFWFQGRID
FT                   DVIMTAGERVGPFEVESKLVEHPAVAEAGVIGKPDPVRGEIIKAFVALREGYEPSEELK
FT                   EDIRNFVKKGLAAHAAPREIEFRDKLPKTRSGKIMRRVLKAWELNLPTGDLSTMED"
FT   gene            complement(497535..500351)
FT                   /locus_tag="Aflv_0463"
FT   CDS_pept        complement(497535..500351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0463"
FT                   /product="Membrane carboxypeptidase (penicillin-binding
FT                   protein) fused to uncharacterized domain"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32847"
FT                   /db_xref="GOA:B7GGP5"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGP5"
FT                   /protein_id="ACJ32847.1"
FT                   /translation="MKIQHGWEVTMSEKQVRFSWQKLWRHFTITYEVIWNVCLIIFIVS
FT                   LCAFSFAFGVGAGYFASLVKDAKPIPYKEMKKDIYNYEETTHIYFANREYLGYFRSDLE
FT                   RDEVKLSQVSPYFIQAVIATEDEHFYEHKGVVPKAIIRAIFQEATNSSTRSGGSTLTQQ
FT                   LVKNQILTSEVSFERKAKEVLLALRLEKFFTKDEILEAYINVVPFGRNASGRNIAGVQA
FT                   AAKGVFGIDAKELTLPQAAFLAGLPQSPFRYTPFTSEGELKNDLSPALNRMKTVLSRMK
FT                   KAGYISEKQYKEALAYDITKDFVSSLPSPVEKYPWLTFEIERRAKDIFIDLLAKKDGYE
FT                   RQDVRSNDQLYREYAEKAEKQLRQNGYTIYTTIDKNIYERMQAIVEKYPYFGSDTIVRK
FT                   KDEKTGQMVSVRQPVEVGAILIENKTGRIISFVGGRDYKREQLNHATQAYRSNGSTMKP
FT                   LLVYAPAMEMGIVQPGSVIPDIDLEIPTRQGPYRPKNADGKTHGLTSVRHALKKSYNIP
FT                   AIRTYARIIDQRPISYLEKMGFTSLTTGDGHNLSLALGGLTKGVTIEENVNAYATFANG
FT                   GKFVDAYLIEKIVDKNGKVVYEHESKPTEVFSPQTAYLTIDMMRDVIRSGTAAFLNGKL
FT                   KFSADWAGKTGTSQNTKDAWFVATNPNVTFGTWMGYDTPKPLEKSYKGLSYSQRNLLLW
FT                   AQLMNGAYDIHPELIAPKERFHMPGGIVKRSYCAISGLLPSEACKQFGLIESDLFNAAF
FT                   VPKQEDRYLINGTFVELNGERYVALPTTPKEFTKEGVMVDTSLLEQWGIQQMTDMSKLF
FT                   PQNDQWKHVFVAKALQENGKKPDPIAVYQKGNTLVWSEHHEQDVIGYRVYYTASETAPF
FT                   QVTATIRKGEQKSIPLKQGMYYVTAVDIAGLESNPSNIVRMLPATPPEQSTNEQPIERP
FT                   AEEQSSTN"
FT   gene            500705..501994
FT                   /gene="tyrS"
FT                   /locus_tag="Aflv_0464"
FT   CDS_pept        500705..501994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrS"
FT                   /locus_tag="Aflv_0464"
FT                   /product="Tyrosyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32848"
FT                   /db_xref="GOA:B7GGP6"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGP6"
FT                   /protein_id="ACJ32848.1"
FT                   /translation="MDSEKERVVEMDLLRDLQFRGLINQMTDEDGLKALLAEESVKVYC
FT                   GFDPTADSLHIGHLLPILMLRRFQRAGHQPIALVGGATGLIGDPSGKKAERKLNEKETV
FT                   AYYSERIKQQLSRFLDFEKVDNPAIIANNYEWIGSLDVITFLRDVGKNFGINYMLAKES
FT                   VQSRLETGISFTEFSYMILQAYDFLKLYEMYGCKLQVGGSDQWGNITAGLELIRKTEED
FT                   AKVFGLTVPLVTKADGTKFGKTEGGAVWLDADKTSPYEFYQFWINTDDRDVVKYLKYFT
FT                   FLSHEEIIELERQTAEAPEKRAAQKALAAEMTRLVHGEEALQQAINISEALFSGDVAKL
FT                   TADEIEQGFKDVPSYVCDEKEMALVDLLVASGICPSKRQAREDVTNGAIYINGERVQDV
FT                   NKMMTEEDRMEGRFTIIRRGKKKYYLIRYA"
FT   gene            complement(502031..502690)
FT                   /gene="rpsD"
FT                   /locus_tag="Aflv_0465"
FT   CDS_pept        complement(502031..502690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /locus_tag="Aflv_0465"
FT                   /product="Ribosomal protein S4"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32849"
FT                   /db_xref="GOA:B7GGP7"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGP7"
FT                   /protein_id="ACJ32849.1"
FT                   /translation="MVRHDCFYFTKNKNKGGAFMARYTGPTWKISRRLGISLSGTGKEL
FT                   QKRPYPPGQHGPGQRKKLSEYGMQLQEKQKLRHMYGVNERQFRKTFEEAGKMAGKHGEN
FT                   FMILLESRLDNLVYRLGFARTRRQARQLVNHGHILVDGSRVDIPSYRVKPGQTISVREK
FT                   SRNLQIIKEALEVNSFVPDYLTLDADKLEGTYTRLPERSELPAEINEALIVEFYSR"
FT   gene            503005..504861
FT                   /locus_tag="Aflv_0466"
FT   CDS_pept        503005..504861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0466"
FT                   /product="Signal transduction diguanylate cyclase
FT                   (GAF-GAF-GGDEF domains)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32850"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGP8"
FT                   /protein_id="ACJ32850.1"
FT                   /translation="MKKMNVQERDHYAIFKQKFFDWFLSEEDFTDLPRMIQALITLLQN
FT                   EFHLLNVTFYTLNPFKHVFEPEVTTDRTIERYRERHIVPFDEQLKKQFDDVVILDEKSE
FT                   IKTVQFGIHFSEDSFGLVRFQLHERDMLPKAFVNKLRQDFLKVFARIRKVSEVLSEEKR
FT                   YEQLHRAATKIHASMNIGDVLEEIVKTLKEVYPTFTCHLFLSYDSTTDRDLPIKLLTFE
FT                   NEDEHMGAMQAYVTGQIQFHDSLVHKKSVIYAPIKGAQGIYGVIEMIAPTVMELPEREM
FT                   RFISLLANTAGSALENAKLYEQSKRLIADLQLINETIHHLNTNLRFQDALQFMIEKIKT
FT                   SFDAEEVGFIILQEKERKVLPGSTSFFQSREAKAYVDFVFHRIQHPRDTLFLGDVKIHS
FT                   NGTKHFRSLMAVPMMRGMMKGVAIVLHQEAYHFSFDMFKLLQSLIHHSTLAFTNAALRE
FT                   ELERMVITDRLTNLYARHYLDERIQRSMEEDGLGTFILIDIDNFKKVNDTYGHQVGDEI
FT                   IIQVANIIKANIRQNDIGARWGGEELAIYLPKVSIHAGVSIANRLVQKVRELTNPPVTI
FT                   SCGVSYWKKNRADSVKELFNRADEALYTAKRTGKNRVVVQEY"
FT   gene            complement(504888..505382)
FT                   /locus_tag="Aflv_0467"
FT   CDS_pept        complement(504888..505382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0467"
FT                   /product="Methionine-(R)-sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32851"
FT                   /db_xref="InterPro:IPR000614"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGP9"
FT                   /protein_id="ACJ32851.1"
FT                   /translation="MKNMFHTQTYTGTREENYTLVIEQLKALISDEKSVVANLANASAL
FT                   LNYFLHDINWVGFYIAEGNELVLGPFQGLPACVRIPFGKGVCGTAAAEKRTVRVADVHA
FT                   FPGHIACDAASQSEIVVPMMKNGVVIGVLDIDSPIKNRFDEIDEQYLQRFVETLVQHLN
FT                   I"
FT   gene            complement(505387..506208)
FT                   /gene="hisJ"
FT                   /locus_tag="Aflv_0468"
FT   CDS_pept        complement(505387..506208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisJ"
FT                   /locus_tag="Aflv_0468"
FT                   /product="Histidinol phosphate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32852"
FT                   /db_xref="GOA:B7GGQ0"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR010140"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGQ0"
FT                   /protein_id="ACJ32852.1"
FT                   /translation="MSNFAPKGVTNVRDGHIHTPFCPHGSDDALHEYIERAISLGYTDI
FT                   SFTEHAPLPKGFIDPTPYQDSAMKEEQLASYVSILQSLKKQYERHIRIRIGLEVDFILG
FT                   YEQKTKEFLNEIGPQLDDSILSVHFLHVNDRYMCIDYSEDMFGDIVTSFGSIERVYDAY
FT                   YRTVLASVVADLGVHKPKRIGHITLVRKFHRAYPCEYDATNIIAHILDEMKNRQLELDY
FT                   NGAGTVKPLCLEPYPPHWVVKEAVKRGIPLVYGSDAHSAFNLHQGVEHMLI"
FT   gene            506319..508031
FT                   /gene="ezrA"
FT                   /locus_tag="Aflv_0469"
FT   CDS_pept        506319..508031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ezrA"
FT                   /locus_tag="Aflv_0469"
FT                   /product="Negative regulator of FtsZ ring formation
FT                   (frequency and position)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32853"
FT                   /db_xref="GOA:B7GGQ1"
FT                   /db_xref="InterPro:IPR010379"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGQ1"
FT                   /protein_id="ACJ32853.1"
FT                   /translation="MTTRRPIMEFVAISALLVIGGLTYTYVHRKRLYKQIDQLEQWKIS
FT                   LMNRPVPEELSKIKSLNMMGETEQLFEKWRNEWDDIVAVQLPNIEEKLFDIEEAVVKYR
FT                   FMKAKEALRQTEQQLQEIEGNIQRILLELQELVGSEEKNREEIEQLKEKYRHVKKAMLT
FT                   QRHTFGRTEAALEARLNELQQQFQSFEQLTTEGNYLAAREVVLLIQNELNEFNRFIEHI
FT                   PLLLSDAQVEIPAQLDNIIEGYRELLEKEYVLDHLPVEKEVEAIRGKVSEVLALLETLA
FT                   VDEAEKLLREAQEDIDTLYDLLEKEVYAERFVHEETEKIEQTLYELEEETKETRDETLF
FT                   VQQSYHLSQSDLDKYRQIEKQVQQLMKRFMLIQQKMIEERLAYSLIREELEEILAQIAT
FT                   VKEKHVQFREHLYALRKDELAAREKLAEMKKQLSEAIRLVKKSKLPGLPESYMLQVSEA
FT                   RESLTRVSLTLDGKPLNMEAVHQSLDEAIVFVQNVYDQTKEMIEQAQLAESVIQYGNRY
FT                   RRRFHAVNAGLEEAEQLFRRYEYELALQKAIAAVEQVEEGAFERIRQWLKENE"
FT   gene            complement(508055..509467)
FT                   /gene="braB"
FT                   /locus_tag="Aflv_0470"
FT   CDS_pept        complement(508055..509467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="braB"
FT                   /locus_tag="Aflv_0470"
FT                   /product="Branched-chain amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32854"
FT                   /db_xref="GOA:B7GGQ2"
FT                   /db_xref="InterPro:IPR004685"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGQ2"
FT                   /protein_id="ACJ32854.1"
FT                   /translation="MKLLIKTTKFLFCMVVYRLVRRQQRRSSMSKKDLMAIGFMLFALF
FT                   FGAGNMIFPPALGQAAGENVWIAIAGFLITGVGLPVLAVSAIARTGSDLQQLASRVHPV
FT                   FGVIFTTVMYLAIGPFFGIPRTGTVSFEIGVTPFLPETVDRSIMLAVYTVVYFSISLWL
FT                   ALNPSKLVDRIGKLLTPLLLVGLTLFFIKSIWTPMGTIQKPTDTYADAPLFKGFIDGYL
FT                   TMDAIAALVFGIIVIQAIQQKGITNTKQLTKLCIQAGFIAASGLTLVYLSLAFIGASSV
FT                   QAIGYRDNGGEIISQAATYLFGQAGTIILSIIIMLACLTTSVGLLSSCASYFSKISPKF
FT                   SYRTFVIVMSGFSAVIANVGLTKLISLSIPVLIIIYPLAITLVVLSFLHDYFNGKQAVY
FT                   IGALVGTSLVSIVDGLKTAGFDVSAILYVYEKTLPLFEQGIGWLTPALIGGLIGLLLNK
FT                   TNHVARTERKAS"
FT   gene            509561..510712
FT                   /gene="nifZ"
FT                   /locus_tag="Aflv_0471"
FT   CDS_pept        509561..510712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifZ"
FT                   /locus_tag="Aflv_0471"
FT                   /product="Cysteine desulfurase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32855"
FT                   /db_xref="GOA:B7GGQ3"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGQ3"
FT                   /protein_id="ACJ32855.1"
FT                   /translation="MIYLDNSATTKPFPEVLQSFLKVASDYFGNPSSLHGLGMQAERLL
FT                   TQAREQIARLLEVKPTEVIFTSGGTEGNNLAIKGAAWQHQQRGRHIITTAIEHPSVIEP
FT                   CRQLEQLGFQVTYVPVDERGIISPTHIEQALRDDTILVSVMHVNNEVGSIQPIEQIGAM
FT                   LKKYPKVLFHVDGVQGAAKVPLHLKRANVDLYTISAHKFHGLKGAGVLYVREGVRLSPL
FT                   LSGGAQEMQLRSGTENVAAIVAMAKALRLSMEKYHEAYDRLEKMKRALIERLQTIEGIR
FT                   VHTPFEQSAPHIIHFSLEGIKSETFVHELEKQHIYVSTTSACSSRKKAPSKTLLAMGIE
FT                   KTRAERSIRISLSYEQQMEHVPIIIEAIEQAYERLKIVVRGTK"
FT   gene            510709..511902
FT                   /locus_tag="Aflv_0472"
FT   CDS_pept        510709..511902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0472"
FT                   /product="Thiamine biosynthesis ATP pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32856"
FT                   /db_xref="GOA:B7GGQ4"
FT                   /db_xref="InterPro:IPR003720"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020536"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GGQ4"
FT                   /protein_id="ACJ32856.1"
FT                   /translation="MTYDHIVIRYGEMSTKGKNRLRFVRCLKRNIAKKLKHFPNLQIEA
FT                   SRDRMYIRLHDTPPHPVIEKLQEVFGIQSLSLALKTESDLQKIKEATLFFVKQFPYEGK
FT                   TFKISARRADKQFPITTNELNYELGSYVLKNTTGLTVDVHHPDIDVRVEVRKEGTYITA
FT                   YDVPGAGGLPVGTSGKAMLMLSGGIDSPVAGYLAMKRGLQIEAVHFFSPPFTSERAKQK
FT                   VIDLAQRLTEFGGTIRLHIVPFTELQQAIYKQVPENYSLIAMRRAMLRITDEIRKKENG
FT                   LAIVTGESLGQVASQTLESMVVVNDVTTTPILRPLVSMDKTEIIAIAERIGTHHISIRP
FT                   YEDCCTIFTPKAPKTKPKKEKIIQYEKFLPLDEMIAQTVARVETITLKPNEPLDELF"
FT   gene            511958..512149
FT                   /gene="sspD"
FT                   /locus_tag="Aflv_0473"
FT   CDS_pept        511958..512149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sspD"
FT                   /locus_tag="Aflv_0473"
FT                   /product="Small acid-soluble spore protein (alpha/beta-type
FT                   SASP)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32857"
FT                   /db_xref="GOA:B7GGQ5"
FT                   /db_xref="InterPro:IPR001448"
FT                   /db_xref="InterPro:IPR018126"
FT                   /db_xref="InterPro:IPR038300"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGQ5"
FT                   /protein_id="ACJ32857.1"
FT                   /translation="MANRNRLLVPGVQQAIDQMKYEIAQEFGVQLGPDTTARANGSVGG
FT                   EITKRLVKMAEQQLSSQK"
FT   gene            512157..513854
FT                   /locus_tag="Aflv_0474"
FT   CDS_pept        512157..513854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0474"
FT                   /product="Acetyl-coenzyme A synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32858"
FT                   /db_xref="GOA:B7GGQ6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGQ6"
FT                   /protein_id="ACJ32858.1"
FT                   /translation="MTKLGSSSYRVFIFKIFRKVIQNYSIFLYNFFVSYGKGERKMNLI
FT                   APEKYNLTSEFEKYADDPNRMALKWESESGETKELTYVELMKQANKIANAFVNHGLQKG
FT                   DKVLVMLPRLLEAYAVYIGALKAGLVVIPSSEMLRTKDLQYRISHGEVKGVIAYFLYIE
FT                   QFIPIEGMENMVAFSVGGSTERWLDLHEEMAKQSDAFVAVETSREDMAFLSYTSGTTGN
FT                   PKGVVHTHAWAYAHLRTAAKNWLCIEEGDLVWATASPGWQKWVWSPFLSTLGSGATGFV
FT                   YYGRFEPEKYLQLLEKYHINVLCCTPTEYRLMAKVPTISQYKLPHLHSAVSAGEPLNRE
FT                   VIDTFERYFGVQVRDGYGQTENTLLVGVMKGMKIKPGSMGKPTPGNRVEIINEFGEPCA
FT                   VGEVGDIAVHVETPALFKCYYKDPERTAMQFRGEYYITGDKAKKDEEGYFWFEGRGDDI
FT                   IISSGYTIGPFEVEDALVKHPFVKECAVVASPDEIRGHVVKAFIVLREGVDKNDPNLIP
FT                   QLQEHVKQLTAPYKYPRKIEFVDDLPKTTSGKIRRVELREREMKAMQK"
FT   gene            complement(513903..514685)
FT                   /locus_tag="Aflv_0475"
FT   CDS_pept        complement(513903..514685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0475"
FT                   /product="NAD kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32859"
FT                   /db_xref="GOA:B7GGQ7"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGQ7"
FT                   /protein_id="ACJ32859.1"
FT                   /translation="MYFFHKHDEETTKQVQPLIELAKQYGFQVMDDAKHANIIVSVGGD
FT                   GTFLQAVRKTGFRDDCLYAGISTSGSLSMYCDFHIHDTDKMIEAMTTEQIEVRKYPTIY
FT                   VTVNDSTSFYCLNECTIRSSIIKTFVMDVFIDHLHFETFRGDGMIIATPTGSTAYNKSV
FT                   NGAVVDPMLPCFQVSELASLNNNRYRTLGSSFILSGNRKLTLKVVQDGNDYPIIGMDNE
FT                   ALSIQHVEKIDIALSGKVIKTVKLKDNSFWEKVKRTFL"
FT   gene            514832..515482
FT                   /locus_tag="Aflv_0476"
FT   CDS_pept        514832..515482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0476"
FT                   /product="Uncharacterized conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32860"
FT                   /db_xref="InterPro:IPR021338"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGQ8"
FT                   /protein_id="ACJ32860.1"
FT                   /translation="MIFIIAIIFIAFLTFIPFLHVYMTIQFQHAQDNDQFTIDVRILRI
FT                   FHYRFVVPLIEISKKEAGVVTEQKTTTGKDEKTTFTVADARQRLAQLKQWLNQIVHLHT
FT                   IMKKFLQHVSVLQFQWHTQIGVGDAAKTAMLVGTGWSVKYWVVAMISKYMNVCSTPSIS
FT                   IVPFFQGALSRMSFTCMIRFRIGYAILAGLKVVKHWKKGAKVSRRNEHEWTSN"
FT   gene            515457..515888
FT                   /locus_tag="Aflv_0477"
FT   CDS_pept        515457..515888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0477"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32861"
FT                   /db_xref="InterPro:IPR014229"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGQ9"
FT                   /protein_id="ACJ32861.1"
FT                   /translation="MNMSGHPIEGLMTTAMENLKQMIDVNTIIGDPVETPDGSVILTVS
FT                   KVGFGFAAGGSEFMLNGGHEQQKEAHPFGGGSGGGVSITPIAFLIVNSSGVKLLHVDES
FT                   THLYEKILDLAPQAIEKIQQMFEKKEKPQQQHEAPDFDI"
FT   gene            515966..516472
FT                   /gene="tpx"
FT                   /locus_tag="Aflv_0478"
FT   CDS_pept        515966..516472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tpx"
FT                   /locus_tag="Aflv_0478"
FT                   /product="Thiol peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32862"
FT                   /db_xref="GOA:B7GGR0"
FT                   /db_xref="InterPro:IPR002065"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR018219"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGR0"
FT                   /protein_id="ACJ32862.1"
FT                   /translation="MAKVTFKGNPVTLIGNEVKVGDAAPNFTVLANDLSPVTLDDTKGF
FT                   VRLISVVPSVDTGVCDAQTRRFNEEAGSIEGVKVLTISVDLPFAQKRWCAANGLENVVT
FT                   LSDHRDVSFGQAYGVLIQELRLLARAVFVVDRNDRVTYVEYVSEATNHPNYEAAIEAAK
FT                   QAAQQ"
FT   gene            516558..517532
FT                   /locus_tag="Aflv_0479"
FT   CDS_pept        516558..517532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0479"
FT                   /product="Adenine-specific DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32863"
FT                   /db_xref="GOA:B7GGR1"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR016843"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGR1"
FT                   /protein_id="ACJ32863.1"
FT                   /translation="MEKLFTVIDETATWLQEELKCSYLEAVAETGENLFHEDVLQEEVS
FT                   ELLKKRLQKAYASVHLHEWKNEHIRKALQLAMLKGMKEYVQPHHQMTPDAVAVFIGYLV
FT                   DEFTKTYFSLSLLDPAIGTGNLMTAVLNQLTNKKVKSYGADADDLLLKLAYVNANLQQH
FT                   DIQLFHQDSLKPLFIEQVDVVVCDLPIGYYPDDENAKSFRLHATSGHSYAHYLFIEQSI
FT                   RYTKEGGYVFLVIPNTLFTSDESKQLHALIKEETFIQGLLQLPLSMFKNEKAAKSIFIL
FT                   QKKGAHAKPPKQALLAQLPSFSNKEAMQAMVVKLEQWLKENRS"
FT   gene            517690..518883
FT                   /gene="ackA"
FT                   /locus_tag="Aflv_0480"
FT   CDS_pept        517690..518883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ackA"
FT                   /locus_tag="Aflv_0480"
FT                   /product="Acetate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32864"
FT                   /db_xref="GOA:B7GGR2"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GGR2"
FT                   /protein_id="ACJ32864.1"
FT                   /translation="MPKVIAINAGSSSLKFQLFNMPSEEVLTKGVVERIGFEDAIFNIT
FT                   VNGEKIKEVTPIPDHAVAVKMLLDKLIELGIIQSFDEIEGIGHRVVHGGEKFSDSVLIT
FT                   DETLKEIEDLSDLAPLHNPANVVGIKAFREVLPNVPAVAVFDTAFHQTMPEQSFLYSLP
FT                   YEYYEKFGIRKYGFHGTSHKYVTQRAAELLGRPIEQLRLISCHLGNGASIAAVEGGKSI
FT                   DTSMGFTPLAGVAMGTRSGNIDPALIPYIMQKTGKTAEEVIDILNKKSGMLGLTGFSSD
FT                   LRDIEEAAAKGDQRAELALEVFAGRIHKYIGSYAARMCGVDAIIFTAGIGENSDIVRAK
FT                   VLRGLEFMGVYWDPALNKVRGKEAFISYPHSPVKVLVIPTNEEVMIARDVMRLANLA"
FT   gene            complement(519178..519492)
FT                   /locus_tag="Aflv_0481"
FT   CDS_pept        complement(519178..519492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0481"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32865"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGR3"
FT                   /protein_id="ACJ32865.1"
FT                   /translation="MSAHFIYDERLGIRLPHLQKEWDMYTKEEQAEILLEWETIRGKIP
FT                   DRIIELEQQINEKQRQLGEENDFARSCTLNFEIAALASIINDLWIWYRMNQTVTNRIHQ
FT                   "
FT   gene            519639..520847
FT                   /gene="argG"
FT                   /locus_tag="Aflv_0482"
FT   CDS_pept        519639..520847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argG"
FT                   /locus_tag="Aflv_0482"
FT                   /product="Argininosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32866"
FT                   /db_xref="GOA:B7GGR4"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GGR4"
FT                   /protein_id="ACJ32866.1"
FT                   /translation="MANPKVVLAYSGGLDTSVAIKWLQEQGYDVVACCLDVGEGKDLEF
FT                   VKEKALKVGAVKSYMIDAKEEFANEYALIALQAHALYEGKYPLISALSRPLISKKLVEI
FT                   AELEGAVAVAHGCTGKGNDQVRFEVSIQALNPNLKVIAPVREWKWSREEEIEYAKQHDI
FT                   PIPIDLDSPFSIDQNLWGRSNECGILEDPWAAPPEEAYELTVALEHTPNEPDIIEIGFE
FT                   QGIPKTINGKAYSLAELILQLNALAGKHGVGRIDHVENRLVGIKSREVYECPGAMTLIK
FT                   AHKELEDLTLVKEVAHFKPIIEQKIAEVIYNGLWFSPLKDALVAFLKETQKNVTGVVRV
FT                   KLFKGHAIVEGRKSPFSLYDEKLATYTAEDEFDHQAAVGFISLFGLPTKVYSIVNGEKK
FT                   VSV"
FT   gene            520844..522220
FT                   /gene="argH"
FT                   /locus_tag="Aflv_0483"
FT   CDS_pept        520844..522220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argH"
FT                   /locus_tag="Aflv_0483"
FT                   /product="Argininosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32867"
FT                   /db_xref="GOA:B7GGR5"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GGR5"
FT                   /protein_id="ACJ32867.1"
FT                   /translation="MKKLWGGRFTKTAAQWVDDFGASIHFDQQLVEEDIEGSIAHVTML
FT                   GECGILPKEDVETIKKGLTKLLEKAKRGELSFSVTYEDIHLNIEKMLIDEIGPVGGKLH
FT                   TGRSRNDQVATDMHLYLRKRVIEIIELIRQLQRVLVEKAEQHIETLIPGYTHLQRAQPI
FT                   SFAHHLMAYVWMFERDRERFAESLKRMNKSPLGAGALAGTTFPIDRHLTARLLGFDGIY
FT                   ENSLDAVSDRDFIIEFLSNSSILMMHLSRFCEELILWSSQEFQFIEMDDTFATGSSIMP
FT                   QKKNPDMAELIRGKTGRVYGHLMALLTVMKGLPLAYNKDMQEDKEGMFDTVQTVIGSLN
FT                   IFAGMIETMTIRTDVMEKATKQDFSNATELADYLAKKGVPFREAHEIVGKLVLTCIERG
FT                   VFLADLPLHVYQQASPLFEEDIYEALNPYTAVNRRTSAGGTGFTEVKKAIEKAKQMIEA
FT                   "
FT   gene            complement(522233..522817)
FT                   /gene="uspA"
FT                   /locus_tag="Aflv_0484"
FT   CDS_pept        complement(522233..522817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uspA"
FT                   /locus_tag="Aflv_0484"
FT                   /product="Nucleotide-binding protein, UspA family"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32868"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGR6"
FT                   /protein_id="ACJ32868.1"
FT                   /translation="MFFLFLFTHRSTPFVINFSTICSVCFTKNDILELEGKFFIGGMFM
FT                   YKYKKILVAVDGSKEAEWAFKKAIEIAKRNDASLVLSHIIDVRSFATIEAYDRTVAERA
FT                   EKFAKELLQSYEKQAVDAGVKEVVTDIEYGSPKVKISKEVAPKYEVDLIVCGATGMSAV
FT                   ERFFIGSVSEHITRYAKCDVLVVRTPEQTEA"
FT   gene            522791..522919
FT                   /locus_tag="Aflv_0485"
FT   CDS_pept        522791..522919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0485"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32869"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGR7"
FT                   /protein_id="ACJ32869.1"
FT                   /translation="MREKEQKEQLYYDESGVSEVTEQITDAYISGVIEQEDEQRRR"
FT   gene            523013..523774
FT                   /locus_tag="Aflv_0486"
FT   CDS_pept        523013..523774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0486"
FT                   /product="Dehydrogenase"
FT                   /note="related to short-chain alcohol dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32870"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGR8"
FT                   /protein_id="ACJ32870.1"
FT                   /translation="MRHAIITAGTKGLGKKVTERFLNKGYAVTVHYRSDIKAVEALKEM
FT                   YRGCHDRLHFVQGDVTKKEDLIRIVDEAVAKFGRIDYLIHNAGPYIFERKKLADYTDDE
FT                   WYEMIEGNLSAMFHLFKRVVPIMRNQHFGRIVTYGFQGADHAPGWMYRSAFSAAKVGLV
FT                   SLTKTIALEEAEYGITANMVCPGNIIGDMKEATIAYARQRKDDMTPIGRSGTGEDIARV
FT                   VEFLCDDCSDMITGTVIEVTGGLDVIHRYRK"
FT   gene            complement(523792..524853)
FT                   /locus_tag="Aflv_0487"
FT   CDS_pept        complement(523792..524853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0487"
FT                   /product="Xaa-Pro aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32871"
FT                   /db_xref="GOA:B7GGR9"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGR9"
FT                   /protein_id="ACJ32871.1"
FT                   /translation="MKETNASWSFITSTANVFYFSNFYSNPHERLLAIVIFPNDEPFLI
FT                   CPEMDANQAKQAGWPYAIVSYDDVHNPWRMLSNELNKRNVQTEQIGIEKSHMTVSRLEQ
FT                   LQSYFPHASFVDLTDTLHELRMIKDEKELQTLRQAAELADFSVDIGVRSIKEGRTELEI
FT                   IATIEYELKKKGVRTMAFDTMVLVGTNSAHPHGVPGMNRIQAGDFVLFDLGIVLDGYCS
FT                   DITRTVVFGQPTEEQKRIYNTVLQAQQAAIHACQIGASIGSIDKAARSRIEQEGYGAYF
FT                   PHRIGHGLGIDVHEYPSMNATNTMSLQAGMVFTIEPGIYVPSIGGVRIEDDVYMTEKGP
FT                   LLLTTYPKELQIV"
FT   gene            524992..525669
FT                   /locus_tag="Aflv_0488"
FT   CDS_pept        524992..525669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0488"
FT                   /product="Metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32872"
FT                   /db_xref="GOA:B7GGS0"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR022877"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GGS0"
FT                   /protein_id="ACJ32872.1"
FT                   /translation="MKLTYHGHSVVKIETNGKTIFIDPFITGNPLTDLKAEDVHVDVIL
FT                   LTHGHNDHVGDTVSLAKKNDALVIAPYELATYLSWKGVRIHPMHIGGSFTFDFGKVKLT
FT                   QAFHGSSYVEENETIVYTGMPSGILFHAEGKTIYHAGDTALFSDMKLIGEMNDIDVAFL
FT                   PIGDNFTMGPKDAAIAAKWLKAKMVVPIHYNTFPVIQQDPQQFVSMIEGIGRVLRIGES
FT                   IEL"
FT   gene            525744..527054
FT                   /locus_tag="Aflv_0489"
FT   CDS_pept        525744..527054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0489"
FT                   /product="Predicted transcriptional regulator containing
FT                   CBS domains"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32873"
FT                   /db_xref="GOA:B7GGS1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR010766"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGS1"
FT                   /protein_id="ACJ32873.1"
FT                   /translation="MTITKHEQILQYIESLPVGEKISVRQIAKEMGVSEGTAYRAIKDA
FT                   ETKGYVSTIERVGTIRIEQKKKENIERLTYAEVVNIVDGQVLGGKEGLHKTLNKFVIGA
FT                   MKLEAMMRYTGAGNLLIVGNRTKAHELALEAGAGVLITGGFDTEEHVKKLADERQLPII
FT                   STSYDTFTVATMINRAIYDQLIKKEIVLVEDILTPFEKTAYLYVTDQVERWYELNRETN
FT                   HSRFPVIDQQLKVQGIVTAKDVMGYERDVLIEKVMTKHPITVSGKTSVASASHMMVWEG
FT                   IEVLPVVDEYDRLQGIISRQDVLKALQMVQRQPQVGETIDDIVTTQFLTETVDGVFRCN
FT                   ITPQMTNHLGTLSYGVFTTIVTEAATRALRLHKRGDLVVENITIYFIKPVQIDSVIDIK
FT                   PKLLEIGRKFGKVDVEVFNEGTLVGKALMMCQLLERQ"
FT   gene            complement(527070..527369)
FT                   /locus_tag="Aflv_0490"
FT   CDS_pept        complement(527070..527369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0490"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32874"
FT                   /db_xref="GOA:B7GGS2"
FT                   /db_xref="InterPro:IPR025618"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGS2"
FT                   /protein_id="ACJ32874.1"
FT                   /translation="MPIFVILIVFSLSFYLYYKVKYVRSKKPMERKWISAKSSMALGSF
FT                   VFFFAINQFFIHQSTVSLIVGIVLLLVGAGSIWAGYRAHRYYFPLAVKEAEETK"
FT   gene            527469..528416
FT                   /locus_tag="Aflv_0491"
FT   CDS_pept        527469..528416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0491"
FT                   /product="Bifunctional oligoRNAse and pAp phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32875"
FT                   /db_xref="GOA:B7GGS3"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGS3"
FT                   /protein_id="ACJ32875.1"
FT                   /translation="MEQKVLEIIENIRQFDTIIIHRHVRPDPDAYGSQGGLAELIQASF
FT                   PEKRVYTVGKDEPSLEFLRKMDVVPDEMYNDALVIVCDTANEERVCDQRYKLGKKIIKI
FT                   DHHPNEDPYGDILWIDTNASSVSEMIYELYLIGKEQGLILTKEAARLIYAGIVGDTGRF
FT                   LFPSTNPKTFKYASELVEYGFSFVDLYDQLYRTKLSLAHLSGYVLQNFELSEYGVAHIV
FT                   LTKELLKQYDATPSEASQLISVLGNIEGIKAWVFFVEEDDQIRVRLRSRGPIVNEVAKK
FT                   YRGGGHPLAAGASIYSWEEVEHVLADLNEVCKQQ"
FT   gene            complement(528425..528925)
FT                   /locus_tag="Aflv_0492"
FT   CDS_pept        complement(528425..528925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0492"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32876"
FT                   /db_xref="GOA:B7GGS4"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGS4"
FT                   /protein_id="ACJ32876.1"
FT                   /translation="MRVPPYTRDPGWQRFFAGAAIGALISWIVFSQIFGILQEKQVRLL
FT                   KMQQEIIAQLKHDLNIWQQDYIQLNKENKKRLTIQSIDVKVINAKSYGIDTYTTFRMEE
FT                   DIKKDIQHITAKDIETVYKSRELLKKAIENKTYIIDNRTYHLDIETILFFTHISIELKL
FT                   KQQ"
FT   gene            complement(528922..529269)
FT                   /locus_tag="Aflv_0493"
FT   CDS_pept        complement(528922..529269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0493"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32877"
FT                   /db_xref="GOA:B7GGS5"
FT                   /db_xref="InterPro:IPR025689"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGS5"
FT                   /protein_id="ACJ32877.1"
FT                   /translation="MSEMEIKTAFLPAFIQSYFIALGVLVGGALIGGFGAFLSGEPPLT
FT                   MMYRFASSLKIWALIAAIGGTFDTFYSMERGFFQGETRDVIKQFLLILSATGGAQTGMT
FT                   FIRWFTQEHGA"
FT   gene            529362..532595
FT                   /gene="dnaE"
FT                   /locus_tag="Aflv_0494"
FT   CDS_pept        529362..532595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaE"
FT                   /locus_tag="Aflv_0494"
FT                   /product="DNA polymerase III, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32878"
FT                   /db_xref="GOA:B7GGS6"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGS6"
FT                   /protein_id="ACJ32878.1"
FT                   /translation="MGDTLSFIHLQVRSGYSLLSSTVKIEELVTRARELQFPAIALTDE
FT                   NVLYGVMPFYEACQAHGIKPIIGMMATIMDEHGHPDQLVLLAKNNDGYRQLVHIATAIQ
FT                   TNDGKGISLLDFSHHTSELIGMTSGVYGRVEQHLLNGEIEQAEAIVQTYAKLFQRGDFY
FT                   INVQRHGLQEQEHLLSLLFEHSKRWDIPLVATNDVRYIYKEDTLAFECLLAMKHGKKMV
FT                   DPNRPRLATNEYHLKSAHEMAALFSNGYEAVEETVRIAQRCHVTFESKRWFMPRYPVPS
FT                   GKTADEYLQTWCWEQFTKRFPDRPKAYVARLQYELQIIQQMNFSDYFLIVADFVRFARE
FT                   RGILTGPGRGSAAGSIVAYILGITQVDPLQYGLLFERFLNPARLSLPDIDIDFPDDRRE
FT                   EVIRYIEQKYGTDHVAQIVTFGTFGMRSAIREVGRVFDVDEREIQQTLATGSFDRTRPW
FT                   HYVAQRIEGLPKHTSVHAAGIVISPRPLTDIIPLQSGQTTTYVTQYAMDALERLGLLKF
FT                   DLLALKNLTMIEQMIQSIEQRTGHRLSFENMPIDDQKTYALLSRGDTFGVFQLESEGMK
FT                   RILRELQPTTFEDIVAVNALFRPGPMEQIPTYIARKHGREPIRYMHDDLQSILQSTYGV
FT                   IVYQEQIMKIAEQMAKFSLAQADLLRRAISKKDVGQMEKEKKHFIEGCIQNGYDAHLAN
FT                   ELYELIVRFAGYGFNRSHAVAYSYIAYMLAYIKAHYPLDFYAAVLTNVSGQKEKMMQCV
FT                   HELRSKKIRLLPPSIARSEGHFTVDDNGIRFGLLAIKQVNAAFVKQMVRERQKRPFSDF
FT                   FDFVSRLRMESSQKKVIEALIFSGCFDEFHIERATLYASIDVAIEHAELMNFSLHVQPK
FT                   YVHAEPLSLIDQLKYEKQWLNVYVSPHPVESFSHFYSMWGAKRMYEWTKENVNHGKVIV
FT                   YVEEVTRKRTKKGEEMAFVTICDDSDEWQAVVFPTSYRRFHDLLQQGSILYMEGKIEQR
FT                   SSGWHLIVQQVRKPVCVYIKIDEQHASPVVLKQLKDVLTAHRGHAPVILYYETERKKVQ
FT                   LSHEYAVSPNDVCIRQLVTLLGDGNVAVK"
FT   gene            532686..533939
FT                   /locus_tag="Aflv_0495"
FT   CDS_pept        532686..533939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0495"
FT                   /product="Malic enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32879"
FT                   /db_xref="GOA:B7GGS7"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGS7"
FT                   /protein_id="ACJ32879.1"
FT                   /translation="MSLFEEALRMHKRYQGKLEVKAKVPLKNAYDLSLAYSPGVAEPCK
FT                   VIHQEPSKIYDYTLKANTVAVVSNGSAVLGLGNIGAEAALPVMEGKAVLFKSFAGVDAF
FT                   PICLNTSDAEQIIQTVKLLESTFGGINLEDIAAPHCFIIEERLKQELNIPVFHDDQHGT
FT                   AIVTVAGLVNALKLVNKKIEDVRVVINGAGAAGIAIIKLLRCYGVKHMIMCDSKGAIYE
FT                   GRPYGMNDMKRDVAQWTNDERKSGSLQEVIVGADVFIGVSVAGALTTSMIETMNRDAII
FT                   FAMANPTPEIMPEEALQAGATVVGTGRSDYPNQVNNVLAFPGIFRGALDVRAKQINEQM
FT                   KMAAVEAIANLITEDELRADYVIPAPFDPRVAPAVAVAVAKAAMETGVAQIIVDPKEVE
FT                   RRTRQLAFIAGEHEHDYF"
FT   gene            533908..534528
FT                   /locus_tag="Aflv_0496"
FT   CDS_pept        533908..534528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0496"
FT                   /product="Transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32880"
FT                   /db_xref="GOA:B7GGS8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGS8"
FT                   /protein_id="ACJ32880.1"
FT                   /translation="MQVSMNMTTSKVYIETFWQIHRMIEEAGLQPGDRLPSERELADRL
FT                   GVGRSSVREALRALELLGLIETRRGEGTFMKPFGDHQLIQLLGSFILQGNQEKRDLIET
FT                   KVLIERICLQLTCERLTDEKLERIKREEHTYHSFFRRIVEATDNYLLLRIWLVLADFFK
FT                   HVYTLTLPSEFYEQMWVALRKRSCEEAIAVYEQYVMRKMSKEN"
FT   gene            534598..535470
FT                   /gene="accD"
FT                   /locus_tag="Aflv_0497"
FT   CDS_pept        534598..535470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accD"
FT                   /locus_tag="Aflv_0497"
FT                   /product="Acetyl-CoA carboxylase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32881"
FT                   /db_xref="GOA:B7GGS9"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="InterPro:IPR041010"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GGS9"
FT                   /protein_id="ACJ32881.1"
FT                   /translation="MLKDLFSKKKKYATIPSEQAKQDVPEGIMTKCPKCKKIMYTKELV
FT                   KNLRVCISCGYHHPMSAPERIGCLLDEGTFQEYDRHLLSKNPLEFPQYMEKIEEDREKT
FT                   KLNEAVVTGEGTINGFPVVIAVMDSRFRMGSMGSVVGEKIARAIERAMEKSVPFIIFTA
FT                   SGGARMQEGVLSLMQMAKTSAALKLFSEQGGLIISVMTHPTTGGVSASFASLGDYNFAE
FT                   PGALIGFAGRRVIEQTVREELPDDFQTAEFLLKHGQLDAVIPRHELKDTLTNVLDIHQS
FT                   RGGDEWHTN"
FT   gene            535455..536432
FT                   /gene="accA"
FT                   /locus_tag="Aflv_0498"
FT   CDS_pept        535455..536432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accA"
FT                   /locus_tag="Aflv_0498"
FT                   /product="Acetyl-CoA carboxylase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32882"
FT                   /db_xref="GOA:B7GGT0"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GGT0"
FT                   /protein_id="ACJ32882.1"
FT                   /translation="MAYELEFEKPLVELRKKISELKEFTKHRDVDFSDEINKLEARLEK
FT                   LENDIYANLSPWDRVQIARHPNRPTTLDYIERLFTNFFECHGDRCFGDDEAIVGGIAKY
FT                   HGLPVTVIGHQRGKDTKENIRRNFGMPHPEGYRKALRLMKQAEKFGRPIICFIDTKGAY
FT                   PGKAAEERGQSEAIARNLFEMAGLTVPVVCVVIGEGGSGGALALGVGNYVHMLENSTYS
FT                   VISPEGAAAILWKDASLAKKAAETMKITAKDLKQLGVIDEIIPEVRGGAHRNVDEQAKY
FT                   IDDVLKRSLRELLPLHAEQLIAQRYEKYKKIGDFVESQQHVSVM"
FT   gene            536622..537581
FT                   /gene="pfkA"
FT                   /locus_tag="Aflv_0499"
FT   CDS_pept        536622..537581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfkA"
FT                   /locus_tag="Aflv_0499"
FT                   /product="6-phosphofructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32883"
FT                   /db_xref="GOA:B7GGT1"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012003"
FT                   /db_xref="InterPro:IPR012828"
FT                   /db_xref="InterPro:IPR015912"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GGT1"
FT                   /protein_id="ACJ32883.1"
FT                   /translation="MKRIGVLTSGGDSPGMNAAIRAVVRKAIYHGLEVYGIYHGYAGLI
FT                   AGQIKKLEIGDVGDIIHRGGTMLYTARCPEFKTLEGQLKGIEQLKKHGIEGLVVIGGDG
FT                   SYQGAKKLTEHGYPCVGVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERT
FT                   YVIEVMGRHAGDIALWAGLAGGAESILIPEADYDMDEIVSRLKRGHERGKKHSIIIVAE
FT                   GVGSGVDFGKRIEEATGLETRVTVLGHVQRGGSPTAFDRVLASRLGARAVELLIEGKGG
FT                   RCVGIQNNQLVDHDIIEALAQTHTVDQKMYQLSKELSI"
FT   gene            537591..539390
FT                   /locus_tag="Aflv_0500"
FT   CDS_pept        537591..539390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0500"
FT                   /product="Pyruvate kinase fused to PEP-utilizers swivelling
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32884"
FT                   /db_xref="GOA:B7GGT2"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018209"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGT2"
FT                   /protein_id="ACJ32884.1"
FT                   /translation="MVSFPYAKCRRVFMRKTKIVCTIGPASESVEKLVQLIEAGMNVAR
FT                   LNFSHGSHEEHAARIRNIREAAKMTGKTVAILLDTKGPEIRTHNMENGAIELKVGAEVT
FT                   ISMKEVLGTPEKFSITYEGLIDDVHVGSTILLDDGLIGLEVLAVDKEAKEIKTKVLNGG
FT                   VLKNKKGVNVPGVKVKLPGITEKDAEDIRFGIEQGIDFIAASFVRRASDVLEIRELLEA
FT                   HNALHIQIIPKIENQEGVDNIDEILEVADGLMVARGDLGVEIPAEEVPLVQKELIKKCN
FT                   ALGKPVITATQMLDSMQRNPRPTRAEASDVANAIFDGTDAIMLSGETAAGAYPVEAVQT
FT                   MHRIALRTEQALQYRDLLSKRSKQSGTTITDAIGQSVAHTALNLDVAAIVTPTVSGHTA
FT                   RMISKYRPKAPIIAVTSNEGVSRKLALVWGVYPRVAQHATSTDEMLDIAVEAALDTGIV
FT                   KHGDLVVITAGVPVGETGSTNLMKVHMIGDMIAKGQGIGRKSAFGKVVVAKTAEEALEK
FT                   MIEGGILVAPATDADMMKALEKAAAIITEEGGLTSHAAVVGLSLGIPVIVGVNHATAIL
FT                   KDGQDITVDASFGAIYRGHASVL"
FT   gene            539344..539829
FT                   /locus_tag="Aflv_0501"
FT   CDS_pept        539344..539829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0501"
FT                   /product="Protein affecting phage T7 exclusion by the F
FT                   plasmid"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32885"
FT                   /db_xref="GOA:B7GGT3"
FT                   /db_xref="InterPro:IPR007313"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGT3"
FT                   /protein_id="ACJ32885.1"
FT                   /translation="MRASVPFIAAMRACYNKEGDIPFFIILGGMCVRNIFFLLFIVIPA
FT                   LEIVVLVLSGKAMGIWPTFALIVTTGIIGAFLAKKQGLSTLQRAKYEFMNGRIPSDALL
FT                   DGVCILVGGTLLLTPGFITDTAGFILLLPFAREKIKPWLVRLLKRMFYTKTWVYIRK"
FT   gene            complement(539847..540965)
FT                   /locus_tag="Aflv_0502"
FT   CDS_pept        complement(539847..540965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0502"
FT                   /product="Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32886"
FT                   /db_xref="GOA:B7GGT4"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="InterPro:IPR014227"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGT4"
FT                   /protein_id="ACJ32886.1"
FT                   /translation="MSTHYVYRSLRFLFVIFVIIAGLASLYYVSTLTYPFLIALAITFF
FT                   INPVVDVLEKKAKMPRALAVIVVLIFLLALVAGLVTLLVAEIVTGTQYLATVVPNHFQK
FT                   LVIYIEQFVASQIIPLYNQLATLFKNLDTSQQDTIMTNIQSVGTKIATTVGQFIQNILQ
FT                   NIPSIIGWLPNFATIFIFSLLATFFISKDWYRLKALFQKLLPTKVQTSTTKVFAELKKA
FT                   LFGFLKAQATLISITTLIVLVGLLVLRVEYAITIALIIGIVDVLPYLGTGLVFVPWIVY
FT                   AAMSGNTHFAIGLGVLYVVVLVQRQVMEPKLLSSNIGLDPLATLIALFVGFKLIGFLGL
FT                   IVGPVLLVIGRTLHHAGVFQDIWNFIIGKKEA"
FT   gene            541012..541509
FT                   /locus_tag="Aflv_0503"
FT   CDS_pept        541012..541509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0503"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32887"
FT                   /db_xref="GOA:B7GGT5"
FT                   /db_xref="InterPro:IPR007382"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GGT5"
FT                   /protein_id="ACJ32887.1"
FT                   /translation="MQRKKKFQRRGAYFMQPFIFLFILLVIGMMAKNQSLIIAVLFLLI
FT                   VKSIGLSSKVLPYLEQKGIQLGVTIITIAVLVPIATGKIGFKELAESVRSIYAWIAMLS
FT                   GIAVALLAKGGVALLAKDPHVTTALVLGTILAVSLFKGVAVGPLIGAGIAYVIMKIVDV
FT                   FS"
FT   gene            541771..542889
FT                   /gene="citZ"
FT                   /locus_tag="Aflv_0504"
FT   CDS_pept        541771..542889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citZ"
FT                   /locus_tag="Aflv_0504"
FT                   /product="Citrate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32888"
FT                   /db_xref="GOA:B7GGT6"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR011278"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGT6"
FT                   /protein_id="ACJ32888.1"
FT                   /translation="MTVTRGLEGVVATTSTISSIIDDTLTYVGYNIDDLAEHATFEEVV
FT                   YLLWHRKLPNKEELETLTKQLAENADIPQQVIDHFKMYPLDQVHPMAALRTAISFLGLY
FT                   DEEAEAMNPEANYRKAIRLQAKVSTIVAAFSRIRKGLEPVPPRKDLSFAANFLYMLTGK
FT                   EPDPIAEEAFNKALVLHADHELNASTFTARVCVATLSDVYSGITAAIGALKGPLHGGAN
FT                   EAVMKMLTEIGTLENVETYVHNKLNNKEKIMGFGHRVYRQGDPRAKHLKKMSEKLTKLT
FT                   GEPHWYDMSVKIEEIVTSTKGLPPNVDFYSASVYHSLGIDHDLFTPIFAISRMSGWLAH
FT                   ILEQYENNRLIRPRAEYTGPTRQVYVPLEERA"
FT   gene            542954..544243
FT                   /gene="icd"
FT                   /locus_tag="Aflv_0505"
FT   CDS_pept        542954..544243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icd"
FT                   /locus_tag="Aflv_0505"
FT                   /product="Isocitrate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32889"
FT                   /db_xref="GOA:B7GGT7"
FT                   /db_xref="InterPro:IPR004439"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGT7"
FT                   /protein_id="ACJ32889.1"
FT                   /translation="MEVVIVMQGEKITVTNGVLNVPNYPIIPFIEGDGTGPDIWAAASR
FT                   VLEAAVEKAYKGERKIVWKEVLAGEKAFKLTGEWLPQETLDTIREYIIAIKGPLTTPVG
FT                   GGIRSLNVALRQELDLFVCLRPVRYFKGVPSPVKRPEDTDMVIFRENTEDIYAGIEYAK
FT                   GTPEVRKLIDFLQNEMGVRKIRFPETSGIGIKPISEEGTKRLVRAAIKYAIEHGRKSVT
FT                   LVHKGNIMKYTEGAFKNWGYELAEQEFGDQVFTWAEYDRIVETHGKEAANRAQAEAEAA
FT                   GKIIVKDAIADIFLQQILTRPREFDVVATMNLNGDYISDALAAQVGGIGIAPGANINYE
FT                   TGHAIFEATHGTAPKYAGLDKVNPSSVILSGVMMFEHLGWNEAAKLIVDSMEKTIASKV
FT                   VTYDFARLMEGATEVKCSEFADALIRNMGE"
FT   gene            544267..545205
FT                   /gene="mdh"
FT                   /locus_tag="Aflv_0506"
FT   CDS_pept        544267..545205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdh"
FT                   /locus_tag="Aflv_0506"
FT                   /product="Malate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32890"
FT                   /db_xref="GOA:B7GGT8"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011275"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GGT8"
FT                   /protein_id="ACJ32890.1"
FT                   /translation="MGMKRKKISIIGAGFTGATTAFILAQKELGDIVLVDIPQLENPTK
FT                   GKALDMLESSPVLGFDANIIGTSDYADTADSDVVVITAGIARKPGMSRDDLVTTNQGIM
FT                   KAVTKEVVKYSPNCFIIVLTNPVDAMTYTVFKESGFPKNRVIGQSGVLDTARFRTFVAQ
FT                   ELNLSVKDITGFVLGGHGDDMVPLVRYSYAGGIPLETLIPKERLDAIVERTRKGGGEIV
FT                   NLLGNGSAYYAPAASLAEMVEAIVKDQRRVLPAIAYLEGEYGYEGIYLGVPTILGGNGI
FT                   EKVIELELTEEEKAALAKSVESVKNVMKVLQ"
FT   gene            545260..545730
FT                   /locus_tag="Aflv_0507"
FT   CDS_pept        545260..545730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0507"
FT                   /product="Acyl dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32891"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGT9"
FT                   /protein_id="ACJ32891.1"
FT                   /translation="MGMLSKKRKLGRLISDISVGEKLVLTEAIEDKDLLLYLGLTNDAN
FT                   PLYIQHDYASQTPWKRPIVPAIMLTGIITSAVSKYLPGPGSHIVSQTIEFKRPVYHYEH
FT                   VEFLFEVTSVDEENNEIHISVQAIRDEEEVLVGSLRVVPPYPFVEEKALDNF"
FT   gene            545752..546537
FT                   /gene="phoP"
FT                   /locus_tag="Aflv_0508"
FT   CDS_pept        545752..546537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoP"
FT                   /locus_tag="Aflv_0508"
FT                   /product="DNA-binding response regulator, OmpR family
FT                   (REC-wHTH domains)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32892"
FT                   /db_xref="GOA:B7GGU0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGU0"
FT                   /protein_id="ACJ32892.1"
FT                   /translation="MFFSFHITRYNKNVTNLRCWRMIMSKRVLVVDDEQSIVTLLEYNL
FT                   KQAGFIVLTAYDGEEGLHKALEERPDFIILDLMLPKLDGIEVCKQLRQQKVMTPILMLT
FT                   AKDDEFDKVLGLELGADDYMTKPFSPREVVARVKAILRRTVIHGQEEKQEHSDDSLVVG
FT                   QLEIFPDRYEAYFAQKRLELTPKEFELLAYLAKYKGRVLTRDQLLSAVWNYDFAGDTRI
FT                   VDVHISHLRDKIEQDTRKPVYIKTIRGLGYKLEEPKADE"
FT   gene            546530..548293
FT                   /gene="phoR"
FT                   /locus_tag="Aflv_0509"
FT   CDS_pept        546530..548293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoR"
FT                   /locus_tag="Aflv_0509"
FT                   /product="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32893"
FT                   /db_xref="GOA:B7GGU1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR031967"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGU1"
FT                   /protein_id="ACJ32893.1"
FT                   /translation="MNKFRSRLLLGLISVILSVLFGLGLLLGQLFQKFYADTVHDRMAK
FT                   EAKLLALYMENKSLQSDMFGQRLRAISDMLSARITIVDRDGKVLLDTNNYVLIDKKRHQ
FT                   KFIQTLLKKEDESVIFEEEQDLYYYAVPFWKHDQQLGHIVMSLPMDAIERVDEQIWLLL
FT                   MFSLSIAFFIILLLGMKITNQYTKPIEAATKVAMELARGNYKARTYESREDETGMLSQS
FT                   LNILARNLQEMVRTQEMQQDRLRALIENIGSGLILIDQRGYISLMNRAYKEMFRIDPSD
FT                   YVHRLYYEAFPYKEVIALVEEIFMTEVNVRKQMLLPVDIERKHFEVYGTPIIGTNDEWK
FT                   GIIVVFHDITELKKLEQMRKDFVANVSHELKTPITSIKGFAETLLDGAMHDAQTLEYFL
FT                   TIILKESERLQHLIQDLLDLSKIEQQGFTLNISVVDLHEVLKEVIVMLEAKANDKQITL
FT                   EYTSNAPVCYMYGDLHRLKQIFINLINNAIAYTPAGGRVTVYVEKDEKELHVHVSDTGI
FT                   GIEQKEIPRIFERFYRVDKARSRNSGGTGLGLAIVKHLVEAHHGTISVKSEVGIGTTFT
FT                   VHFRADACADE"
FT   gene            548487..551114
FT                   /gene="polA"
FT                   /locus_tag="Aflv_0510"
FT   CDS_pept        548487..551114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /locus_tag="Aflv_0510"
FT                   /product="DNA polymerase I"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32894"
FT                   /db_xref="GOA:B7GGU2"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGU2"
FT                   /protein_id="ACJ32894.1"
FT                   /translation="MANKLVLIDGNSIAYRAFFALPLLHNDKGIHTNAIYGFTMMLMKL
FT                   IEEEKPTHILVAFDAGKTTFRHEVYTEYKGGRQKTPPELSEQFPFLRELLDAYNIRTYE
FT                   LENYEADDIIGTLATKAEKEGFDVVIISGDRDLTQLASERIHVHVTKKGITDMERYTPK
FT                   HVLEKYGLTPAQIVDLKGLMGDASDNIPGVPGVGEKTALKLLKEYGTVEHVLASLEHIS
FT                   GKKLKENLQTYHEQALLSKQLATIRRDVPLTLSLDELAWHSYDAERVAALFQELGFTSL
FT                   MDKIGQSSQEQLSLTDISFVTVQTIDEHMLTKEGALVVEVLDENYHQAPIVGFALVNER
FT                   GHFFIPTDIALASSRFKRWLEDEQCKKSVFDAKRAIVALKWNGIELKGVDFDLLLAAYL
FT                   LNPTDANGDVAAVAKTKQYTDVQSDEEVYGKGAKQAIPPTNVLAEHLVRKAKAIASLKE
FT                   TYIQELKRNEQFELLVHLELPLTFILAQMEFYGVKVDVDRLEQMGKEFTAQLEQIEQRI
FT                   YELAGTTFNINSPKQLGTILFEKLQLPIVKKTKTGYSTSADVLEKLAPYHEIIEQILHY
FT                   RQLGKLQSTYVEGLMKVVRKDTGKVHTIFQQALTQTGRLSSTEPNLQNIPIRIEEGRKI
FT                   RQAFVPSSDDWVIFAADYSQIELRVLAHIANDENLIAAFHHDLDIHTKTAMDIFHVKED
FT                   EVTAHMRRQAKAVNFGIVYGISDYGLSQNLGITRKEAAEFIERYFRSYPGVKRYMEEVV
FT                   QDAKQKGYVTTLLHRRRYLPDITSGNFNVRSFAERTAMNTPIQGSAADIIKKAMIDLAN
FT                   RLHEERLQTRLLLQVHDELILEAPKEEIELLKKIVPDVMENAVSLRVPLKVDYHFGPTW
FT                   YDAK"
FT   gene            551132..551953
FT                   /gene="mutM"
FT                   /locus_tag="Aflv_0511"
FT   CDS_pept        551132..551953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutM"
FT                   /locus_tag="Aflv_0511"
FT                   /product="Formamidopyrimidine-DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32895"
FT                   /db_xref="GOA:B7GGU3"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGU3"
FT                   /protein_id="ACJ32895.1"
FT                   /translation="MPELPEVETVRLTLLPLVVGKTIERVKVHWPKIIQHPDVATFCER
FT                   LKGQTIHNIGRRGKFLLFQLDDVVLVSHLRMEGRYIYEKEDAPFDQHTHIFFTFTDQTE
FT                   LRYRDVRKFGTMHLFSKGEELHVPPLSSIGVEPFDEQFTVAWLTDQLQRTKRTIKATLL
FT                   DQTIVAGLGNIYVDEVLFRSSIHPERTAATLTIREIEALHEAIVQTIQEAIEKGGSTVR
FT                   TYVNTQGKIGKFQTQLYVYGRVNKPCRRCGEPIVKTTVANRGTHYCKHCQT"
FT   gene            552020..552643
FT                   /locus_tag="Aflv_0512"
FT   CDS_pept        552020..552643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0512"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32896"
FT                   /db_xref="GOA:B7GGU4"
FT                   /db_xref="InterPro:IPR003810"
FT                   /db_xref="InterPro:IPR014205"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGU4"
FT                   /protein_id="ACJ32896.1"
FT                   /translation="MITWSLFLLAFAVSIDGLTVGITYGMRNVHVPLRSLLIISFFSCM
FT                   TFLVAMGIGRMLYMFFSPTVANAMGGGILIILGLWMLIQFMLKSDDKEEKFLMNVEIRS
FT                   LGIVIQILRKPTMADFDRSGTITGMEAVFLGIALSLDAFGAGVSAALLNYSVMFTTFLV
FT                   CLLSFSFLFSGLKIGKSFGKYDWLQKYSFLPGIMLIVIGIFKMR"
FT   gene            552646..553257
FT                   /locus_tag="Aflv_0513"
FT   CDS_pept        552646..553257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0513"
FT                   /product="Dephospho-CoA kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32897"
FT                   /db_xref="GOA:B7GGU5"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGU5"
FT                   /protein_id="ACJ32897.1"
FT                   /translation="MKVVLTIGLTGGIASGKSTVAAMFRDLHIPVIDADEIAHRVTAID
FT                   GEAYQLIVETFRSDILDSNGAIDRRKLGAIVFHDEQKRKQLNAIVHPLVRQHMLKQKEQ
FT                   YARKGEKAVVLDIPLLFESNLEHLVDHILVVYVDEQIQLRRLCERNGFSFEEAWARIKS
FT                   QMPLEQKRKKADAVIDNNGTIEQTKRQLYERLVEWGILEK"
FT   gene            553365..554393
FT                   /gene="gapB"
FT                   /locus_tag="Aflv_0514"
FT   CDS_pept        553365..554393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gapB"
FT                   /locus_tag="Aflv_0514"
FT                   /product="Glyceraldehyde-3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32898"
FT                   /db_xref="GOA:B7GGU6"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGU6"
FT                   /protein_id="ACJ32898.1"
FT                   /translation="MKARVAINGFGRIGRMVFRKAIMDNDIDIVAINASYPPETLAHLI
FT                   KYDSNHGKFDGDVVPVEDGLIVNGKKVQLLHSRDPRLLPWGELQIDIVIEATGKFNAKE
FT                   KAMMHVEAGAKRVILTAPGKDEDVTIVMGVNEHMLSPEHVIISNASCTTNCLAPVVKVL
FT                   DEAFGIENGLMTTVHAYTNDQKNIDNPHKDLRRARSCAQSIIPTTTGAAKALALVLPHL
FT                   KGKMHGMALRVPTPNVSLVDVVVDVKKDVTVDEVNEAFMQAARGTLKGILDVTMEPLVS
FT                   IDFNTNPHSAIVDGLSTMVIENRKVKVLAWYDNEWGYSCRVVDLTKLVAKQLLKNETVA
FT                   MS"
FT   gene            554634..555008
FT                   /gene="speD"
FT                   /locus_tag="Aflv_0515"
FT   CDS_pept        554634..555008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speD"
FT                   /locus_tag="Aflv_0515"
FT                   /product="S-adenosylmethionine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32899"
FT                   /db_xref="GOA:B7GGU7"
FT                   /db_xref="InterPro:IPR003826"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="InterPro:IPR017716"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GGU7"
FT                   /protein_id="ACJ32899.1"
FT                   /translation="MDTMGRHVISELWGCDFDKLNDMEFIEKTFVDAALKSGAEIREVA
FT                   FHKFAPQGVSGVVIISESHLTIHSFPEHGYASIDVYTCGHLDPTIAADYIAEALGAQTR
FT                   ETIELPRGMGPIEIKQAKAL"
FT   gene            555080..555472
FT                   /locus_tag="Aflv_0516"
FT   CDS_pept        555080..555472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0516"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32900"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGU8"
FT                   /protein_id="ACJ32900.1"
FT                   /translation="MKWKYIFTNHNETSERHPDEQLKSRYYKTTQSAALQVVKEMFEQM
FT                   DGCHIVAVSAERGEISVSLTKGRKVFVVATIVSVRPFETAIDFSVTTETKSLPIDFGFS
FT                   RQLIIRLYDQLGKRLPYIGSGIYGDK"
FT   gene            555535..556005
FT                   /locus_tag="Aflv_0517"
FT   CDS_pept        555535..556005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0517"
FT                   /product="Predicted transcriptional regulator (Zn-ribbon
FT                   and ATP-cone domains)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32901"
FT                   /db_xref="GOA:B7GGU9"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GGU9"
FT                   /protein_id="ACJ32901.1"
FT                   /translation="MKCPSCHHNGTRVLDSRPADEGRSIRRRRECERCHFRFTTFERVE
FT                   ETPLIVVKKEGTREEFSREKILRGLIKACEKRPVALEQLEEVTQQIERELRNSGINEVK
FT                   SETIGEMVMEQLSKIDEVAYVRFASVYRQFKDLNVFIEELKELIKKEQGERA"
FT   gene            556021..557436
FT                   /gene="dnaB"
FT                   /locus_tag="Aflv_0518"
FT   CDS_pept        556021..557436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaB"
FT                   /locus_tag="Aflv_0518"
FT                   /product="Replication initiation/membrane attachment
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32902"
FT                   /db_xref="InterPro:IPR006343"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGV0"
FT                   /protein_id="ACJ32902.1"
FT                   /translation="MKKVDNMEYSWKELIAVDRYIVHANGVLSELDRKVLTLLYQPLIG
FT                   AQAYSLYMTLWSELEQARLWSEETTHHSLMAIMQCSLPTIYAERLKLEGIGLLNTYMKR
FT                   TGADDERVFIYELRLPLTPEQFFTDGVLNVFLYDRVGKTKFQKLKKFFSDRAIDHTSFV
FT                   PVTRSFHDVFSSIQPEKMIHKLSDEAKQEVTLQDGHQYIGKEQAMYTMRDDIFDFDAFY
FT                   AGLSHHLVPRRAITEKVKEAIKKLAFLYGIGPLDMQKIVMGVIDPAEQIDIEALRKAAQ
FT                   EWYQFERGEALPRLYDRVQPLAERTMAHVEPKNEEEYLMKQLETVSPRQLLMDFSGGAE
FT                   PALADLQLIEEMMFKQKLPPGVMNVLIYYVMLRTDMKLPKKYVEKIASSWARKKVRTVK
FT                   QAMELAKKEAREYETFMKEKEKKGAKKPIRTELLPDWLQTDYSQFERKQTRSEEELEQK
FT                   RRELEERLKKPKS"
FT   gene            557444..558379
FT                   /gene="dnaI"
FT                   /locus_tag="Aflv_0519"
FT   CDS_pept        557444..558379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaI"
FT                   /locus_tag="Aflv_0519"
FT                   /product="Primosome component, helicase loader"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32903"
FT                   /db_xref="GOA:B7GGN7"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009928"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGN7"
FT                   /protein_id="ACJ32903.1"
FT                   /translation="MMKPIRETIHHLMNRHDFKERYEAMKRDILNDPHVQSFLRGHDVT
FT                   DAMLNRHLGKLYEFVQQSKHCERCPSLEQCPNLLKGYTPHLIWQGKNIDVQYERCARKV
FT                   QDDERKKQQSLIRSLFIPRDMLQASFEKLETDDLGRIEAIELANTFASTYEVGKRTKGL
FT                   YLYGSFGVGKTYLLSAMANELAKRHIASFLVYVPEFVRSLKSSLQTDAFQDTIEYAKQV
FT                   PVLMLDDLGAELMSSWWRDEVLGPILQYRMLEHLPTCFTSNFDLKRLTHHLAHSQRGEE
FT                   EQVKAARMIERIVYLATPIEMKGKNRRIEM"
FT   gene            558442..559296
FT                   /locus_tag="Aflv_0520"
FT   CDS_pept        558442..559296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0520"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32904"
FT                   /db_xref="InterPro:IPR014199"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGN8"
FT                   /protein_id="ACJ32904.1"
FT                   /translation="MIYIVFQDGQDAQRLFTELNKAPQPYGKLLYDDKTITVFFHESDA
FT                   SHMRTMFIPILTSCIIRAFEARWILSIISRTFFYENEEEQQQILQLTYSFIDGERHDYR
FT                   LGKKMNIPREQLIAKSLHECLHEGVFSFESLITFRLKPYYDRLMHYVELAIDEYKLEQE
FT                   YQAFVQLLREIVASRHPQMNVLHLVYENDTFQFFDDCFFHLSSQQLKQFIDRRLMVSQP
FT                   MYIDTSVLAPLVSMAPEKIYMYTDVTDVGMIQTIQNVFQERIELRTPLDFPKKYAYNDI
FT                   HNE"
FT   gene            559591..561522
FT                   /gene="thrS"
FT                   /locus_tag="Aflv_0521"
FT   CDS_pept        559591..561522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrS"
FT                   /locus_tag="Aflv_0521"
FT                   /product="Threonyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32905"
FT                   /db_xref="GOA:B7GGN9"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GGN9"
FT                   /protein_id="ACJ32905.1"
FT                   /translation="MADVVKITFPDGAVKEFPKGVTTEDIAASISPGLKKKAIAGKLNE
FT                   RMIDLRTPIEEDGAISIITQDMPEALDILRHSTAHLMAQAVKRLYKDVKLGVGPVIENG
FT                   FYYDIDVDVPITAEDLPKIEQEMKKIVKENLDIVRKEVSREEAIRRYEEIGDPLKIELI
FT                   NDIPEGEVVSIYEQGEFFDLCRGVHVPSTGKIKEFKLLSVAGAYWRGDSKNKMLQRIYG
FT                   TAFFKKEDLDEYLRLLQEAKERDHRKLGKELDLFMTSQKVGQGLPLWLPKGATIRRTIE
FT                   RYIVDKELSLGYQHVYTPVLGSVELYKTSGHWDHYKDGMFPPMEMDNEQLVLRPMNCPH
FT                   HMMVYKHKIHSYRELPIRIAELGTMHRYEMSGALTGLQRVRGMTLNDAHIFVRPDQIKD
FT                   EFKRVVNLILDVYKDFGLTDYSFRLSYRDPQDKEKYYDDDAMWEKAQSMLKEAMDELGL
FT                   DYYEAEGEAAFYGPKLDVQVRTALGKDETLSTVQLDFLLPERFDLTYIGEDGKPHRPVV
FT                   IHRGVVSTMERFVAFLIEEYKGAFPTWLAPIQVQVIPVAPSIHMDYAYEVKHALQVAGI
FT                   RVEVDEREEKIGYKIREAQMQKIPYMLVVGDNEVNERAVNVRKYGEQKSETMPLDAFVD
FT                   SIAKEVRK"
FT   gene            561789..562331
FT                   /gene="infC"
FT                   /locus_tag="Aflv_0522"
FT   CDS_pept        561789..562331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infC"
FT                   /locus_tag="Aflv_0522"
FT                   /product="Translation initiation factor 3 (IF-3)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32906"
FT                   /db_xref="GOA:B7GGP0"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019813"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGP0"
FT                   /protein_id="ACJ32906.1"
FT                   /translation="MKKPWRWLVISKDFIINENIRAREVRLVDPNGEQLGIKTKQEALE
FT                   IAARLNLDLVMVAPNAKPPVCRIMDYGKFRFEQQKKEKEARKKQKVINVKEIRLSPTIE
FT                   EHDFNTKLRNARKFLEKGDKVKATIRFKGRAITHKEIGQRVLDRFAEACADIGTVETAP
FT                   KMDGRSMFLVLAPKNDK"
FT   gene            562351..562551
FT                   /gene="rpmI"
FT                   /locus_tag="Aflv_0523"
FT   CDS_pept        562351..562551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmI"
FT                   /locus_tag="Aflv_0523"
FT                   /product="Ribosomal protein L35"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32907"
FT                   /db_xref="GOA:B7GGV1"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GGV1"
FT                   /protein_id="ACJ32907.1"
FT                   /translation="MPKMKTHKGSAKRFKKTGTGQLKRSHAFTSHLFANKTQKQKRKLR
FT                   KATLVSKGDFKRIRQLLDNVK"
FT   gene            562570..562929
FT                   /gene="rplT"
FT                   /locus_tag="Aflv_0524"
FT   CDS_pept        562570..562929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplT"
FT                   /locus_tag="Aflv_0524"
FT                   /product="Ribosomal protein L20"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32908"
FT                   /db_xref="GOA:B7GGV3"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GGV3"
FT                   /protein_id="ACJ32908.1"
FT                   /translation="MPRVKGGTVTRRRRKKILKLAKGYFGSKHRLYKVANQQVMKSLMY
FT                   AYRDRRQRKRDFRKLWITRINAAARMNGLSYSRLMHGLKLAGIEVNRKMLADLAVNDAA
FT                   AFTQLANIAKENLNK"
FT   gene            complement(562992..564224)
FT                   /locus_tag="Aflv_0525"
FT   CDS_pept        complement(562992..564224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0525"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32909"
FT                   /db_xref="GOA:B7GGV4"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="InterPro:IPR039365"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGV4"
FT                   /protein_id="ACJ32909.1"
FT                   /translation="MIRIDVSPNHSQGGSCLMNRLAHHQGIDKFFTMLGLALYFSKPVM
FT                   KHLVHIVDAMVTKGFSGTLTDLHHGSFHPNHRTTLSHFFTKSPWDEETLLHKLQQWILR
FT                   RVERSPKRENSPLFVSIDDTICQKTKPSSRATHAIQGCDWHYSHAEKKSIWGHSLVWLM
FT                   VHTMTQAFPFAFRLYDKTAGKSKGELAMEMLSSLDVSRPVYVLMDSWYPSQTLVEACLK
FT                   KGFHVIAMLKTNRILYPKGIAIQAKQFAHYIEPKDTHLVTVGKEQYRVYRYEGALNGLK
FT                   DAVVILAWKADQPMTSEHLHCVLSTDRKLSDEDILRYYAERWSIECFFRQAKDQLKLDG
FT                   YRVRGRRAVKRYWILVQLAYVYSMFESNSDFSDGLDLLRKRKGHSLVEFIYCAAKQNIP
FT                   IDTVKKQLHVA"
FT   gene            564322..564849
FT                   /gene="dutB"
FT                   /locus_tag="Aflv_0526"
FT   CDS_pept        564322..564849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dutB"
FT                   /locus_tag="Aflv_0526"
FT                   /product="dUTPase (dimeric)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32910"
FT                   /db_xref="InterPro:IPR014871"
FT                   /db_xref="InterPro:IPR016947"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGV5"
FT                   /protein_id="ACJ32910.1"
FT                   /translation="MRGWSFFVRGGEKMDIRKLFAMQRQLDERIETERGLRGERLVERK
FT                   LLALLVEIGELANETRCFKFWSSKPPAAVETILEEYVDGLHFILSLGLDLSLHEGVQWP
FT                   NVQESRPLVDQFLRVFEAVHAFGGQLNEEAYNQLVYAYAQLAHALSFTAQQIERAYIAK
FT                   NEVNHERQSHNY"
FT   gene            564896..565990
FT                   /locus_tag="Aflv_0527"
FT   CDS_pept        564896..565990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0527"
FT                   /product="Cellulase M related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32911"
FT                   /db_xref="GOA:B7GGV6"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGV6"
FT                   /protein_id="ACJ32911.1"
FT                   /translation="MTDVKKLDETLTMLKALTDAKGVPGNEREVREVMRSYIAPYADEV
FT                   TTDRLGSLIAKKVGKENGPKVMIAGHLDEVGFMVTQIDEKGFIRFQPLGGWWGQVMLAQ
FT                   RVTIVTKKGDITGVIGSKPPHILPVEARRKPVEIKDMFIDIGASSRDEALAWGVRPGDA
FT                   IVPYFEFTVMNNEKMLLAKAWDNRIGCAVAIDVLKQLKDVEHPNVVYGVGTVQEEVGLR
FT                   GARTSAFAIEPDIAFAVDVGIAGDTPGVSEKDAMGKLGGGPHIVLYDATLVSHKGLREF
FT                   VVNVAEEMNIPYRFDAMPGGGTDAGAIHMMMRGVPALTISIPTRYIHSHAALLHRDDYE
FT                   QTVKLLVEVIRRLDEEKVKEITFD"
FT   gene            566107..567204
FT                   /gene="araR"
FT                   /locus_tag="Aflv_0528"
FT   CDS_pept        566107..567204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araR"
FT                   /locus_tag="Aflv_0528"
FT                   /product="Transcriptional regulator araR (HTH fused to
FT                   periplasmic-binding domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32912"
FT                   /db_xref="GOA:B7GGV7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR033532"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGV7"
FT                   /protein_id="ACJ32912.1"
FT                   /translation="MSVMKEKSMPKYLQLKQEILAWIQSGKLSPNEKIPTEHEIANQFQ
FT                   LSRHTVRQALGELENEGWLYKIQGSGTFVSKPNSIGKQEVKTVAILTTYISDYIFPHIV
FT                   RGAEETLREKGYRLLLASTNNDKEKERSHLETMIQQPLSGLIIEPTKSAQGNPNLSYYL
FT                   ALNNLHIPYVMINERYLEMSCPVIKMDDEKGGYLLTEHLIQLGHRRIAGFFKTDDLQGT
FT                   NRLKGFIRAHQEYNLPLSSEHLIVYTTEEKETKPLEIARSFLRQGRGERVTAIVCYNDE
FT                   LAIKILEVIRQLGLHVPDDISIVGFDDSTFATATEVKLTTIRHPKVDMGIKAAETLIQM
FT                   LEKNGEVQDIVYQPELIVRDSAKNI"
FT   gene            567292..567987
FT                   /gene="araD"
FT                   /locus_tag="Aflv_0529"
FT   CDS_pept        567292..567987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araD"
FT                   /locus_tag="Aflv_0529"
FT                   /product="L-ribulose-5-phosphate 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32913"
FT                   /db_xref="GOA:B7GGV8"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR004661"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGV8"
FT                   /protein_id="ACJ32913.1"
FT                   /translation="MEEMLDELKRQVLDANLQLPRYRLVTFTWGNVSGIDRERGLVVIK
FT                   PSGVAYDQMTTDDLVVVDLEGRVVEGKRKPSSDTLTHLVLYSSFPSIGGIVHTHSPWAT
FT                   IWAQAGRGIPALGTTHADYFYGEIPCTRPMTSEEIQGAYELETGKVITETFRFLDPLQV
FT                   PGILVHGHGPFAWGKDPADAVHNAVVLEEVAKMAARTYMLNPNAQPISQSLLDRHYLRK
FT                   HGVNAYYGQ"
FT   gene            568003..569697
FT                   /gene="araB"
FT                   /locus_tag="Aflv_0530"
FT   CDS_pept        568003..569697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araB"
FT                   /locus_tag="Aflv_0530"
FT                   /product="Ribulose kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32914"
FT                   /db_xref="GOA:B7GGV9"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005929"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GGV9"
FT                   /protein_id="ACJ32914.1"
FT                   /translation="MGKKYVIGIDYGTESGRAVLVDLEGNEIADHVTPYPHGVIDEVLP
FT                   ESNVQLEPDWALQHPGDYIEVLATAVPAVLQKSGVNPADVIGVGIDFTACTMLPIAGSG
FT                   EPLCLKPEFKHRPHSWVKLWKHHAAQDEANLLNEMAAKRGEAFLPRYGGKISSEWMIAK
FT                   IWQILNEDPDIYDQTDLFLEATDWVIFKMTGQLVRNSCTAGYKSIWHKQDGYPSKEFFR
FT                   ALDPRLEHVTETKLRGSIVPLGTRAGVLTKEMAAMMGLLPGTAVAVGNVDAHAAVPGVG
FT                   VVEPGKMVMAMGTSICHMLLGTEEKYVEGMCGVVEDGIIPGYFGYEAGQSAVGDIFAWY
FT                   VEQSVPAYVKEAAEKEGVSVHEWLEKRAAAYRPGETGLLALDWWNGNRSVLVDTDLTGL
FT                   IIGYTLLTKPEEIYRALLEATAFGTRKIIDAFVESGINVDELYACGGLPQKNKLLMQIY
FT                   ADVTNREIKIAASKQTPAVGAAMFAAVAAGKENGGYESIIEAARNMGKVREETFKPIPE
FT                   NVAIYEQLYQEYTKLHDYFGRGENDVMKRLKHWKETARAVKESISLS"
FT   gene            569714..571216
FT                   /gene="araA"
FT                   /locus_tag="Aflv_0531"
FT   CDS_pept        569714..571216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araA"
FT                   /locus_tag="Aflv_0531"
FT                   /product="L-arabinose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32915"
FT                   /db_xref="GOA:B7GGW0"
FT                   /db_xref="InterPro:IPR003762"
FT                   /db_xref="InterPro:IPR004216"
FT                   /db_xref="InterPro:IPR009015"
FT                   /db_xref="InterPro:IPR024664"
FT                   /db_xref="InterPro:IPR038583"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GGW0"
FT                   /protein_id="ACJ32915.1"
FT                   /translation="MLLLRPYEFWFVTGSQHLYGEEVLQQVEGHSRTIVNELNRDSVFP
FT                   FSFVFKSVVTTPEEIRNVCLEANASEQCAGVITWMHTFSPAKMWIGGLLELRKPLLHLH
FT                   TQFNRDIPWDSIDMDFMNLNQSAHGDREYGFIGARMGVARKVVVGHWEDPEVRERLAKW
FT                   MRTAVAFAESRQLKVARFGDNMREVAVTEGDKVGAQIQFGWSVNGYGVGDLVQSIRDVS
FT                   EQSINELLDEYAELYDMVPAGRQDGPVRESIREQARIELGLKAFLQDGNFTAFTTTFED
FT                   LHGMKQLPGLAVQRLMAEGYGFGGEGDWKTAALVRLMKVMADGKGTSFMEDYTYHFEPG
FT                   NELILGAHMLEVCPTIAATRPRIEVHPLSIGGKEDPARLVFDGGEGAAVNASLIDLGHR
FT                   FRLIVNEVDAVKPKHNMPKLPVARILWKPRPSLRDSAEAWILAGGAHHTCFSFAVTTEQ
FT                   LQDFAEIIGVECVVINEHTSVASFKNELRWNEVFWGRKQGLL"
FT   gene            571298..573121
FT                   /locus_tag="Aflv_0532"
FT   CDS_pept        571298..573121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0532"
FT                   /product="Glycosyl hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32916"
FT                   /db_xref="GOA:B7GGW1"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGW1"
FT                   /protein_id="ACJ32916.1"
FT                   /translation="MIIMVVQRNKKNNYILCYTRLPEEDIIYSEKLACSMHLAYSDDGE
FT                   NFEPLNHNFGILFARATENDNGSLNAKSLKNPYIFYLADGTFGVVAVRTESDGTNDEES
FT                   KGKVLVFSSSDLLQYEEIGLLDLKGDAFVNDVVCNYDDEKKGYIIKWNDHLGNYYMNFI
FT                   GDILKLRDVSHPEPVEPFQLPSMRPKIQGVVPRNIIQVSEEIAHRLICKLTVPVNIKME
FT                   VPEKVIVKTERDLENVKAIAIYSDNTTDIKRVKWNKNDIDWSRPGVYRVTGTVHQDRYP
FT                   FPIAIDRADPCITKWNGKYYFIATNDADGNHSLYIREADTIPGLVHAEEILILDSETYE
FT                   DIKGLLWAPEFHIIGNDLYIFHGATSDGFYYEQSHVMKLRRGGNPTCANDWSRPYRVLK
FT                   KDGTYLCEAGKTISLDMTVIPWNEEYYVVWSQREFIPQDLGAWLYIAKIDPNEPWKLVC
FT                   DPTVLTKPEYGWENNNVFVVEGPFALIRDNRLFLTYSGSLIDETYVIGLLTAEKGSDLM
FT                   DPTSWKKCNYPLLTSMSVVGEYGPGHNSYISDDYGVIWNVYHARPGIKAPRSSGIRRVH
FT                   FDIDGYPRLDLTEDRDINKDLSKIAIDVVLV"
FT   gene            573144..574652
FT                   /gene="abfA"
FT                   /locus_tag="Aflv_0533"
FT   CDS_pept        573144..574652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="abfA"
FT                   /locus_tag="Aflv_0533"
FT                   /product="Alpha-L-arabinofuranosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32917"
FT                   /db_xref="GOA:B7GGW2"
FT                   /db_xref="InterPro:IPR010720"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGW2"
FT                   /protein_id="ACJ32917.1"
FT                   /translation="MAEKTATMIIEKDFKVAEIDKRIYGSFIEHLGRAVYGGIYEPGHP
FT                   EADENGFRQDVIELVKALQVPIIRYPGGNFVSGYNWEDGIGPKEKRPRRLDLAWKTIET
FT                   NEVGLNEFIDWTKMVGAEVNMAVNLGTRGIDEARNLVEYCNHPSGSYYSDLRISHGYKE
FT                   PHKIKTWCLGNEMDGPWQIGHKTAVEYGRIACEAAKVMKWVDPTIELVACGSSGRNMPT
FT                   FAEWEATVLDHTYEHVDYISLHQYFGNRDNDTANYLAMSLEMDDFIRSVVAIADYVKAK
FT                   KRSKKTIYLSFDEWNVWYHSNENDKRVEPWTIAPPLLEDIYNFEDALLVGCMLITLMKH
FT                   ADRVKIACLAQLVNVIAPIMTEKNGPAWKQTIYYPFMHASIYGRGVALHPIVSSPKYDS
FT                   KDFTDVPYLESIAVYNEEKEEVTIFAVNRDMEAPLLLECDIRNFENYRVIEHIVLECDN
FT                   VKQTNSVQSFPVVPHRNGDARLLDGKLLTKLSKLSWNVIRLAKH"
FT   gene            574872..575138
FT                   /pseudo
FT                   /locus_tag="Aflv_0534"
FT   misc_feature    574872..575138
FT                   /pseudo
FT                   /locus_tag="Aflv_0534"
FT                   /note="C-terminal fragment of alpha-galactosidase"
FT   gene            575151..577080
FT                   /pseudo
FT                   /locus_tag="Aflv_0535"
FT   misc_feature    575151..577080
FT                   /pseudo
FT                   /locus_tag="Aflv_0535"
FT                   /note="authentic frameshift"
FT   gene            577058..578125
FT                   /gene="msmR"
FT                   /locus_tag="Aflv_0537"
FT   CDS_pept        577058..578125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msmR"
FT                   /locus_tag="Aflv_0537"
FT                   /product="Transcriptional regulator, LacI family (HTH and
FT                   periplasmic-binding domains)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32918"
FT                   /db_xref="GOA:B7GGW3"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGW3"
FT                   /protein_id="ACJ32918.1"
FT                   /translation="MIVKSLKSSINKGVASMATLKEIAEKAGVSVATVSRVLNYDMTLS
FT                   VSDETRRRIFEIAQELNYKTPRERNQMSAKDRLRFGVVNWYSESQELDDPYYMAVRLGV
FT                   EKECFRRQIELVKLFKKEGSYESEWLTGLDGIIAVGKFGKREIDLFSSVTDHIVFVDYS
FT                   PDEDRFDSVVVDFRKATARVLQYLIDLGHKHIGYIGGREYVDDGHLIQDERERTFYEYL
FT                   YLRGMFIPEYVFTGRFIAEDGYMLMKQALQLPNRPTAFFIASDSMAIGALRALHEAGID
FT                   VPNEITVVGFNDLPTSKFVQPPLSTVQVYTEFMGETAVELLVEQIQTKRDIPKKVVVPT
FT                   KLVVRESSCAYTVKK"
FT   gene            578134..579234
FT                   /gene="galM"
FT                   /locus_tag="Aflv_0538"
FT   CDS_pept        578134..579234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galM"
FT                   /locus_tag="Aflv_0538"
FT                   /product="Aldose 1-epimerase (mutarotase)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32919"
FT                   /db_xref="GOA:B7GGW4"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR015443"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGW4"
FT                   /protein_id="ACJ32919.1"
FT                   /translation="MVRAISFMMLRKRRRRMKLVQEQRTEINGQPIIAFTLANDHGMEI
FT                   TCLNYGCIITSILVPDKNGNVENVVLAFDDFSSYFTNYPYLGAVIGRVAGRIKDSCFNL
FT                   NGKTYKLHANENKNHLHGGKKGFHHVIWQAEAFSQSEEVGVRFLRRSVDGEEGYPGNVD
FT                   VQVTYTLNNQNEFIISYHATSDQDTPLTLTNHTYFNLSGNVKRDILQHELKIKSDRFLP
FT                   LDHEFLPTGEIKDVAGTLFDLRQGKVLKEVIDSTDPQIVLVGQGYDHPFVLNAHHDEEI
FT                   VLCDRESGRTLIVETDEPAVVVYTGNQLPNEETINGVPSRKYLGICLETQAFPNALHHS
FT                   HFPSCILRAGKVYSSTTKYTFRLAHE"
FT   gene            complement(579269..579487)
FT                   /gene="sspI"
FT                   /locus_tag="Aflv_0539"
FT   CDS_pept        complement(579269..579487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sspI"
FT                   /locus_tag="Aflv_0539"
FT                   /product="Small acid-soluble spore protein SspI"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32920"
FT                   /db_xref="GOA:B7GGW5"
FT                   /db_xref="InterPro:IPR017525"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGW5"
FT                   /protein_id="ACJ32920.1"
FT                   /translation="MNQMDFNLRGAVMANVANSSKDQLEHTIVDAIQQGEEKYLPGLGV
FT                   LFEALWNHATDEQKQSMLTTLEEAVKK"
FT   gene            579526..580086
FT                   /gene="msrA"
FT                   /locus_tag="Aflv_0540"
FT   CDS_pept        579526..580086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msrA"
FT                   /locus_tag="Aflv_0540"
FT                   /product="Peptide methionine sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32921"
FT                   /db_xref="GOA:B7GGW6"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGW6"
FT                   /protein_id="ACJ32921.1"
FT                   /translation="MITTIHKRGEIKMEKATFAGGCFWCMVTPFEELDGIYGIVSGYTG
FT                   GHVENPTYEQVKTGTTGHYEAVQITFDPDVFPYEKLLELYWCQIDPTDDGGQFHDRGPQ
FT                   YRTAIFYHNERQKTLAEQSKKQLEESGRFSKPIVTEILPATTFYPAEDYHQNYHKKNPK
FT                   HYKEDRAASGRDEFIAKHWGNNE"
FT   gene            580068..580832
FT                   /locus_tag="Aflv_0541"
FT   CDS_pept        580068..580832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0541"
FT                   /product="SpoU family rRNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32922"
FT                   /db_xref="GOA:B7GGW7"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGW7"
FT                   /protein_id="ACJ32922.1"
FT                   /translation="MGEQRVKRIESPKNERVKQWKRLLTKKEREKTGLFLVEGFHLVEE
FT                   ALKSNIVELLIVSETKTIPTSWKVDHIPMVIVTEAVIGELSDTETPQGIVAVCRHLQWN
FT                   VADVQTALFIDAVQDPGNVGTIIRTADAAGIDAVVVGEGSVDIYNAKVIRATQGSLFHF
FT                   PVIKGDIGQWIAHFQNRHIPIYGTSLQNGVDYRSVSPSSSFALIVGNEGSGVNDKWLQQ
FT                   TTANLYVPIYGQAESLNVAVATGILLYHLQKK"
FT   misc_feature    580904..581154
FT                   /note="T-box leader; Aflv_R080"
FT   gene            581170..582204
FT                   /gene="pheS"
FT                   /locus_tag="Aflv_0542"
FT   CDS_pept        581170..582204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheS"
FT                   /locus_tag="Aflv_0542"
FT                   /product="Phenylalanyl-tRNA synthetase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32923"
FT                   /db_xref="GOA:B7GGW8"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GGW8"
FT                   /protein_id="ACJ32923.1"
FT                   /translation="MKERLQQLQQEALEKIEQANDLKALNDVRVAYLGKKGPITEVLRG
FT                   MGALSPEERPIMGALVNDVREAIQQALEAKQATLEQAEVEKKLAAEAIDVTLPGRPIRR
FT                   GNHHPLTRVIEEIEDLFIGMGYTIAEGPEVEQDYYNFEALNLPKGHPARDMQDSFYITE
FT                   EILLRTHTSPVQARTMEKHQGRGPVKIICPGKVYRRDNDDATHSHQFTQIEGLVVDENI
FT                   RMSDLKGTLREFARKMFGEDRDIRFRPSFFPFTEPSVEVDVSCFNCGGHGCNVCKGTGW
FT                   IEILGAGMVHPNVLEMAGFDSKKYTGFAFGMGPERIAMLKYGIDDIRHFYQNDLRFLQQ
FT                   FNRV"
FT   gene            582220..584634
FT                   /gene="pheT"
FT                   /locus_tag="Aflv_0543"
FT   CDS_pept        582220..584634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheT"
FT                   /locus_tag="Aflv_0543"
FT                   /product="Phenylalanyl-tRNA synthetase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32924"
FT                   /db_xref="GOA:B7GGW9"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGW9"
FT                   /protein_id="ACJ32924.1"
FT                   /translation="MFVSYKWLQEYVDLTGITAKQLADRITKAGIEVESVEVRNKGVQG
FT                   VVIGHVLEREQHPNADKLSKCLVDIGEGDPVQIICGAPNVAKGQKVAVAKVGAVLPGNF
FT                   KIKRAKLRGEESNGMICSLQELGVESKLVPKEYADGIFVFPSDAPVGADALELLYLDDE
FT                   VLELSLTPNRADCLSMIGVAYEVAAILGRSVKLPTIELHENNESVHDYISVRVDAQEDN
FT                   PLYAGRIVKNVKIGPSPLWMQARLMAAGIRPHNNVVDITNYILLEYGQPLHAFDYDRLG
FT                   SKEIVVRRAKNGETIVTLDDVERTLTEEHLVITNGKEPVALAGVMGGANSEVKDDTMTV
FT                   FIESAYFTSPVIRQAVKDHGLRSESSTRFEKGIDPARTKEALDRAAALMAEYAGGEVVG
FT                   GVVEANTWQPKEAVVTIALDRINQVLGTAITKDEVARILTNLQFPFTEDNGTFTITVPS
FT                   RRRDIAIEEDIIEEVARLYGYDNLPATLPIGEAKPGKLTPYQAKRRKVRRYLEDVGLFQ
FT                   AITYSLTNEAKATMFALETAEPIRLALPMSEERSVLRQSLVPHLLEAASYNRARQVENV
FT                   AVYETGAVYLSKGDNELPNEKERLAGVLTGVWHAHMWQGEKKAVDFYVAKGILDGLFAL
FT                   LGVENRIEYKQAKREHLHPGRTADILLDNKTIGFIGQLHPIVQKEYDLKETYVFELALT
FT                   DLLNAEVEDIRYSPIPRFPSITRDIALVVDEHVVAGELQKAIVEAGGELLKDVSIFDVY
FT                   KGDRLPEGKKSIAFSLRYYDPERTLTDEEVTNVHEQVIKAVEQQFGATLRG"
FT   gene            complement(585013..586068)
FT                   /locus_tag="Aflv_0544"
FT   CDS_pept        complement(585013..586068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0544"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32925"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGX0"
FT                   /protein_id="ACJ32925.1"
FT                   /translation="MYFLESPSHTFRCPHCLKALEKIKERKDYYIHKCKNDDCSFYQTN
FT                   LRRMTPQEKEQFQHTPYAFKVRYLYREFLFDFKPLAPSSPIKTKVDVSRLSVSSHTLGL
FT                   ILTYHVNYGLSARKTASIMKDVHGLSISHQTVINYANSVALIVKPFIDQFPYELSGSFC
FT                   GDETYIRIKGRWHDLFFMFDAIKKVVLSYRVSPNRDTFSAIRAIDDVLKKLPSIPEDLS
FT                   FVVDGNPIYLLAQHFFAQHGISFDVRQVIGLTNEDPVSEEYRPLKQIMERFNRTFKGNY
FT                   RPTHGFGAEEGSVSFVTLFVAYFNFLRPHSALEKRVPVVIPALESLPHMPARWAKLIAM
FT                   AQEMLAQQAAS"
FT   gene            586309..586656
FT                   /locus_tag="Aflv_0545"
FT   CDS_pept        586309..586656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0545"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32926"
FT                   /db_xref="GOA:B7GGX1"
FT                   /db_xref="InterPro:IPR025356"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGX1"
FT                   /protein_id="ACJ32926.1"
FT                   /translation="MNKILLHLEGVAILLLSLYFYSYNQFSWLLFFVLLLAPDISMIGY
FT                   LFNNKVGAVLYNLFHTYSLPIGVVILGVLLSNEVVLEIGLIWSAHIGMDRMIGYGLKYP
FT                   THFKDTHLNRV"
FT   gene            complement(587625..589073)
FT                   /locus_tag="Aflv_0546"
FT   CDS_pept        complement(587625..589073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0546"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32927"
FT                   /db_xref="GOA:B7GGX2"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGX2"
FT                   /protein_id="ACJ32927.1"
FT                   /translation="MTSLLPQLLAYLFEIIKTQYQIIIYLMGALLGKSLTNVDAEEPVR
FT                   KPYQKLQVDELPVIETLPRLDYRQLLVEYEQQHGKPLKPIKRHTNTKTTVPDALTCPQC
FT                   QAPSAYVYANNGGKGQYPCKVCHCRFNYRSRFAKQVIFRCPHCLKALEKIKERKDYYIH
FT                   KCKNDDCSFYQTNLRRMTPQEKEQFQHAPYAFKVRYLYREFLFDFKPLASSSPIKTKVD
FT                   VSRLSVSSHTLGLILTYHVNYGLSARKTASIMKNVHGLSISHQTVINYTNSVALIVKPF
FT                   IDQFPYELSGSFCGDETYIRVKGRWHDLFFVFDAVKKVVLSYRVSPNRDTFSAIRAIDD
FT                   VLKKLPSIPEDLSFVVDGNPIYLLAQHFFAQHGISFDVRQVIGLTNEDPVSEEYRPLKQ
FT                   IIERFNRTFKGNYRPTHGFGAEEGSVSFVTLFVAYFNFLRPHSALEKRVPVVIPALESL
FT                   PHMPARWAKLIAMAQEMLAQQAAS"
FT   gene            589585..590475
FT                   /gene="comQ"
FT                   /locus_tag="Aflv_0547"
FT   CDS_pept        589585..590475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comQ"
FT                   /locus_tag="Aflv_0547"
FT                   /product="Competence regulatory protein ComQ"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32928"
FT                   /db_xref="GOA:B7GGX3"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033965"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGX3"
FT                   /protein_id="ACJ32928.1"
FT                   /translation="MSEKEKIAKQMKEIVEQLMSEPQLKAHMLMAIEQHMKESDLVFGR
FT                   LAYLHYDMFSKQEHPFIYIAAAVELIVLAGDLFDDVVDQDRLEDTAIPLHIAIGFLLLG
FT                   QQAIANVPISSNKKLKALSYVTSCLLQSVHGQQTDVTCDVQTEAEYIKMVEKKSGSLVA
FT                   MACVIGALLAGKEDIAAIETYASYIGIAAQIDNDLDALYNWDKKADIHAKKKSLPILYM
FT                   LESKHDNLWKQYFNNDIDYDRMYIQKEKALEQMEQEGAIYYAKVMSQIYKEKALQEIEK
FT                   LDVDDAHKSELKTFI"
FT   gene            590494..590652
FT                   /gene="comX"
FT                   /locus_tag="Aflv_0548"
FT   CDS_pept        590494..590652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comX"
FT                   /locus_tag="Aflv_0548"
FT                   /product="DNA-directed RNA polymerase specialized sigma
FT                   factor, ComX"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32929"
FT                   /db_xref="GOA:B7GGX4"
FT                   /db_xref="InterPro:IPR009233"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGX4"
FT                   /protein_id="ACJ32929.1"
FT                   /translation="MMQQIIRFLVEHPEVIEKLQNGTVSLIGLSELEVKAVIKVFSEST
FT                   SPLGYWR"
FT   gene            590656..592917
FT                   /locus_tag="Aflv_0549"
FT   CDS_pept        590656..592917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0549"
FT                   /product="Signal transduction histidine kinase, contains
FT                   N-terminal PDZ domain"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32930"
FT                   /db_xref="GOA:B7GGX5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGX5"
FT                   /protein_id="ACJ32930.1"
FT                   /translation="MAMNREVIVIIGAFVVAVYLTVLNVTYPLIGIDVVEKKNGDVVVS
FT                   GVYEFGWAEQHGVRPNDRVIKINGKHPRFHNTVKKYHVIEQAKTITIQRRNQVQTLRVD
FT                   MKSHGVAQWAYYILLPTIFFVFTIRFSIFLLRLRPHDKSAIVLIYFLLLMGLCYVSASL
FT                   SAKYEPIGRQLFNGIFLALPTVFLHFVYKYFEKEKKVWFAKTTVFFLYGLNVSLVFALL
FT                   TAPFHSIDETNVLLLACLINMSSVFTLLAKGWKKLQGDALQHTIKGIVFAISSSTIPFL
FT                   FFYSFPMLVMKKWILPAELTVIFLFALPTVFFYLMATDQLFQLPFSIGRLKYLGLFALF
FT                   PSFFIMIVYNQWIRRSSKWAELVVLFSVVYIIVLATFYIKEWLDRKWRAKLRMQKHFYE
FT                   ESLYRISEQLKKQRTVEGAMYCLEKELQEILDVEKIEVIQSINEPLSFEYNQAHWANIV
FT                   KKINGAPLSIGRVMEHRSLFVVFIGSFHETSLWLVGKKKRPLSFRTEQKDWLSTIVYYT
FT                   SMTIENMLKVEELLKELDRLKETEHSISFTRLMFQWSERERKKLAIDLHDTLLQDLILL
FT                   RRKVENLLVQPLYVEDIQKQLNDIEEEILDVIDVTREICHELRPPFLSQMGLKQAISQL
FT                   IARFHLRTNIKVKWNVHIQAKLGEEQELAMYRIIQELLNNAVKHSQASTIQLVLDAQDE
FT                   AVQLCYVDDGVGIEMEKLNDHHDNLGLFGIKERVQGLGGTCKIASSHGSGLEITVTIPL
FT                   "
FT   gene            592857..593594
FT                   /gene="comA"
FT                   /locus_tag="Aflv_0550"
FT   CDS_pept        592857..593594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comA"
FT                   /locus_tag="Aflv_0550"
FT                   /product="DNA-binding response regulator, NarL family
FT                   (REC-HTH domains)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32931"
FT                   /db_xref="GOA:B7GGX6"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGX6"
FT                   /protein_id="ACJ32931.1"
FT                   /translation="MQNRVIAWIWIRDNGNHSIINVRKGEIDGMIHILIVDDHRLVCEG
FT                   TKNVLEREGDFQVDIVTSASEAEQIVEQRAYDVCLLDWCMPDMSGIELGKRILQKQPNA
FT                   KIVIYIGYDVVPFLNYFVEFGITGFVSKTASSEQLVTAIRCALRDEAVIPVHVLRQLCR
FT                   CGAKENMDENGQLAVLSSLEQELLMEVANGLCNKDIAEKHHTSQRTIERHLSRIFTKLH
FT                   VSSRIEAVEKAKQLGLIPEHHML"
FT   gene            593768..594166
FT                   /locus_tag="Aflv_0551"
FT   CDS_pept        593768..594166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0551"
FT                   /product="Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32932"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGX7"
FT                   /protein_id="ACJ32932.1"
FT                   /translation="MKKVKKFLAGGALSCALLMGSVSLVDAATYNYASNYFDYGVYLGG
FT                   GYGQTFELDGKARFIGTQAPYYSNSACGVGYQIRSTDGTVLKVSWKYGAGSIDTGNDLN
FT                   GYNGKKKAYLRNAYNESTPQTASGKFYY"
FT   gene            595968..597329
FT                   /locus_tag="Aflv_0552"
FT   CDS_pept        595968..597329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0552"
FT                   /product="ABC-type sugar transport system, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32933"
FT                   /db_xref="GOA:B7GGX8"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGX8"
FT                   /protein_id="ACJ32933.1"
FT                   /translation="MLEGVRKYMRVYYIFLALFTTFFLVSCSRQEEHVKMAIFLKSDWD
FT                   KYEVFAKEFEKAKGIKIQLDYIWDDTIKHDYKHLWSKIHSAIEKKLKDQEIDLIAGVPT
FT                   SYFEKLIKKNLLAELDTFMVGQSGIDVKNLYSPVLDIAKKAGNGHYYFLSPTFSTKLLV
FT                   VNLDIFKTLKVPIPEETVSWEELEYIAEKINRKNLNPHNRKIYAISFGPGGEEGLFMDF
FT                   QLLTTPLELPLQEKEEIYNHPSWGKWFKWFITMHQKYGVRNMAEDRAFFTGKVAMRITY
FT                   PHELQWLYKKARADLGLGFNPAKFEFRIYPAPYYSNKPEVASIEVHNIALSNQSEKKNL
FT                   AWEVIRYAMGKDYALSIIYNGGNTFGGNFPAYYDSDTIRAYENLYPGIDVKNVFYYGKQ
FT                   GPYIKESMTLEQLSIFHELERGYFPIILNKNISVEDGYKELKREYKQRIKELKR"
FT   gene            597330..597980
FT                   /locus_tag="Aflv_0553"
FT   CDS_pept        597330..597980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0553"
FT                   /product="VanZ family membrane protein, implicated in
FT                   glycopeptide antibiotics resistance"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32934"
FT                   /db_xref="GOA:B7GGX9"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGX9"
FT                   /protein_id="ACJ32934.1"
FT                   /translation="MIRKTITIIPFVMVACLKTWDHVYGNFPGISVWIVFIHICLNLLP
FT                   IFVFVCWSVSKVRQWIGLNMVIHACFYVYLFFVLYYTVLYIPYWRFMTQPVLPPEEQVF
FT                   PHYNLIPFKTILETSITPVNIWGNIFLLLPLGIFVPLIHPYFARIKPFLLLALLVSSGI
FT                   ESVQFMTALMDGKFAEYPSERSLDVDDIILNMSGAVIGFGLYKLRGRMKSLIS"
FT   gene            598120..598563
FT                   /locus_tag="Aflv_0554"
FT   CDS_pept        598120..598563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0554"
FT                   /product="Permease, involved in lantibiotic resistance"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32935"
FT                   /db_xref="GOA:B7GGY0"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGY0"
FT                   /protein_id="ACJ32935.1"
FT                   /translation="MSDFCYNNYYLKKKQTGYSLCHVELFFHGINRNILFRCTVNELHE
FT                   AMPFSLATFAFMISTVFCNQSLAIGLATFSLFIGPQITYFLSLKFDWAKYILFANTNLA
FT                   QYIDGTPLVKGMTMPFSLAVLLVYFVVFNALTWWTFQKRDVTA"
FT   gene            complement(598621..599181)
FT                   /locus_tag="Aflv_0555"
FT   CDS_pept        complement(598621..599181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0555"
FT                   /product="Endonuclease, Uma2 family (restriction
FT                   endonuclease fold)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32936"
FT                   /db_xref="GOA:B7GGY1"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGY1"
FT                   /protein_id="ACJ32936.1"
FT                   /translation="MKPESSKLYTYADYIQWDGRWELINGKAYNMSPSPTWEHQFAVME
FT                   LSFAFRSHFQNKNCYVAIAPFDVRLSESDDYTYAKHVVHPDISVICNRNNLTPNGCLGA
FT                   PTLIVEVLSPSTALKDRNEKFKLYEQFHVQEYWIVDPLYKTVEVFGLEDGFFKKREAFG
FT                   ENDTITSFLFTDFSLEAKRLFFQ"
FT   gene            599306..599752
FT                   /locus_tag="Aflv_0556"
FT   CDS_pept        599306..599752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0556"
FT                   /product="Transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32937"
FT                   /db_xref="GOA:B7GGY2"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGY2"
FT                   /protein_id="ACJ32937.1"
FT                   /translation="MERSIQQFIERYLSVSFLVHKRGAALMKCELDDITHDQYYVLRYI
FT                   CKRGVCTSTELADVFAVNKSAITAMTNRLVEKGMISRGKDEDDRRIISLSLTQKGEQWL
FT                   VETERKVYELVETIMTKLSHEEIEQFIQTYEKLAMILQEMEEKK"
FT   gene            599749..602871
FT                   /locus_tag="Aflv_0557"
FT   CDS_pept        599749..602871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0557"
FT                   /product="Predicted transporter of the RND superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32938"
FT                   /db_xref="GOA:B7GGY3"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGY3"
FT                   /protein_id="ACJ32938.1"
FT                   /translation="MKTIIRGKWVVLLAWVVATVVLVMTAPNMAQLVREKGQITVPEGY
FT                   SSSLASELLKEVQKQENKEGEMSAVLVFHRKERLQEKDWNEIEKAVEQLQAKKESLGLI
FT                   QIVSPLDDSSLKEKLVSKDETTALISLQLERNKRTAKEISTALYDAIENIDVPHYYTGS
FT                   WMIDEDVVESSQEGLKKTEGITVIFILVVLFLVFRSLVAPFVPLLTVGLTYIVSQAIVA
FT                   FLVDRVDFPLSTFTQTFLVAVLFGIGTDYCILLLSRFKEELAKREDRIEAIIATYQTAG
FT                   KTVIFSGLAVMIGFASIGLSTFKLYQSASAVAVGVVVLLVALVTLVPFFMATLGEKLFW
FT                   PMKGALEHKPSKLWDVAGRFSFARPLWALAIVAVITLPILLTYDGKLSFNSMTEIGDRY
FT                   PSVKAFNIISSHFSEGEAMPTKIVMKNDEAMDDEQYYYLIEKISREVANIDGVNAVRSV
FT                   TRPLGEPIDQLFVTKQAEQLKEGLGKGADGIGQIRSGLSEASSEMAKSAPKLAQATGGI
FT                   HELVNGTSKLKTGMTDLQQALKQLEEGVRSGAIGAADLEKGLQTIQTNMKKLHDGANEL
FT                   RKGYEQATDGLRQLGEQYEQIESGLRTISEQLPTLSQSLNRIEERHTSLREDAEYAHVK
FT                   QAIKQMSTEMNTLSGALVQVNDALQNVQYGLQQANESFVTVVNGQQALVTGMDEVIAGL
FT                   EKLRSGLEQAADGQGQIVQRLPEVTNGLAKVNDGQQQLLTGFSQLNDQMDQLITGLNQS
FT                   VDGLRQVENGLQSAKQYVSDLANAPDEEMAGWYMPPQLLTSEEFAQAKEAYMSKDGKVV
FT                   TFDVVFSSNPYETKTMEKIAEVKDAIARAVNGTKLEHAKVGVGGVTSIYSDLRDISAAD
FT                   YARTSVFMLAGIAIILIVLLRSFIMPAYLMLSLILTYYTSMAFTELVFVHMLGYEGVNW
FT                   AVPFFAFVILMALGIDYSIFLMDRFNEYRDKTVQEAMLEAMRHMGTVIISAAIILGGTF
FT                   AAMYPSGVLSLLQIATIILTGLFLYALIVLPLFIPVMAKTFGRANWWPFLK"
FT   gene            603526..603819
FT                   /gene="zapA"
FT                   /locus_tag="Aflv_0558"
FT   CDS_pept        603526..603819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zapA"
FT                   /locus_tag="Aflv_0558"
FT                   /product="Cell division protein ZapA (stimulator of FtsZ
FT                   polymerization and Z-ring component)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32939"
FT                   /db_xref="GOA:B7GGY4"
FT                   /db_xref="InterPro:IPR007838"
FT                   /db_xref="InterPro:IPR023688"
FT                   /db_xref="InterPro:IPR036192"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGY4"
FT                   /protein_id="ACJ32939.1"
FT                   /translation="MNGGNNLAEQKKTRITVDIYGQQYSIVGTESSSHIRLVASIVDDK
FT                   MREISAKNPTLDTSKLAVLTAVNIVHEYIKLKDEYERLLRKMNKEKDDDSDD"
FT   gene            603800..604351
FT                   /locus_tag="Aflv_0559"
FT   CDS_pept        603800..604351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0559"
FT                   /product="Membrane protein connecting MutS with
FT                   cell-division Z-ring"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32940"
FT                   /db_xref="GOA:B7GGY5"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGY5"
FT                   /protein_id="ACJ32940.1"
FT                   /translation="MMTAMIDLLICFILLMGLMIGLKRGFILQFIHMTGFLIAFIVAYN
FT                   YYDQLAPRLKLWVPYPSFGDGETIKLLIESTNLDEAYYRAIAFAVLFFAAKIVMQVIGS
FT                   MLDFVAQLPILKSVNRWAGGALGFIEVYLLLFLLLYVSALVPMSIIQQPLHDSFIASLI
FT                   VKHTPVLSNFVKHMLVQYMA"
FT   gene            604401..606110
FT                   /locus_tag="Aflv_0560"
FT   CDS_pept        604401..606110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0560"
FT                   /product="DNA polymerase IV fused to PHP family
FT                   metal-dependent phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32941"
FT                   /db_xref="GOA:B7GGY6"
FT                   /db_xref="InterPro:IPR002054"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR010996"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR022311"
FT                   /db_xref="InterPro:IPR027421"
FT                   /db_xref="InterPro:IPR029398"
FT                   /db_xref="InterPro:IPR037160"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGY6"
FT                   /protein_id="ACJ32941.1"
FT                   /translation="MEKNKKEAIRLLETIALYMEIKGENPFKVSAFRKAASALERDERA
FT                   LTDIDDFTSIAGIGKGTAAVLQQWLQTGTSDVLEQLKQEIPKGLFPLLKLPGLGGKKIA
FT                   KLYHELGVTDVETLKEACLAQRVRQLSGFGAKTEENILTALANMNARPERLPIAFMLEV
FT                   ALDIERQLANIDDIVRFSRAGSLRRVCETVKDLDFIIATNNPLYVREQLLKLEHIYDVV
FT                   ANGETKVSLQLQYDYVVNVDFRLVSPEHFATTLHHFTGSKEHNVRMRQLAKERGEKISE
FT                   YGVENIQTGEVKTFATEEQFFAHFHLPFIPPEMRESGIEVEAYDGTPLLSLSDIRGDLH
FT                   MHTTWSDGAFSIEQMAEACRKKGYRYIAITDHSQFLKVANGLTVERLKRQQEEIARLNE
FT                   KYDDFFILSGIEMDILPDGTLDFPDDILQAVDFVIASIHSAFSQSQETIMKRLKEALMN
FT                   PYVHMIAHPTGRLIGERSGYDVNIDELLQLAKETNTVLELNANPHRLDLTYTYLQKAQQ
FT                   LGVKIAINTDAHNVRMLDDMELGVAFARKGWIRKETVINTWDLEQLISFLRK"
FT   gene            605965..608475
FT                   /gene="mutSB"
FT                   /locus_tag="Aflv_0561"
FT   CDS_pept        605965..608475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutSB"
FT                   /locus_tag="Aflv_0561"
FT                   /product="DNA mismatch repair protein, MutSB"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32942"
FT                   /db_xref="GOA:B7GGY7"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR005747"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGY7"
FT                   /protein_id="ACJ32942.1"
FT                   /translation="MRLIQTHTTFACLMIWSLEWRLPEKVGFEKKRSSIHGISNNLSLF
FT                   CENKQLEGYLVHAKTLHILEFDKVKAQLAEYVSSSLGKEKVVALMPSSHVEEVVRWQEE
FT                   TDEAATVLRLRGHVPLGGIFDVRMQTKRASIGGTLSPHELLDIASTMRAARQLKKFLEA
FT                   TEADLPHMIAYAAQIVPLPELEQRIYHCIDESGDVLDGASDRLRSLRHQLRTIEGRVRD
FT                   KLESIIRSSSAQKTLSDAIITIRNDRYVIPVKQEYRHTYGGIVHDQSSSGATLFIEPQS
FT                   VVELNNELQQLRVKEKQEIERILSELSASVGEQATTIIENVELLAQLDFLFAKAKYAKA
FT                   IKATKPAINERGYIRLIQARHPLIPSDEVVPNDIELGSNYTTMVITGPNTGGKTVTLKT
FT                   IGLFTVMAQAGLQVPALDGSQLAVFRAVYADIGDEQSIEQSLSTFSSHMVNIVDILKQV
FT                   DEHSLVLFDELGAGTDPQEGAALAIAILDEVHNRGARVVATTHYPELKAYGYNRQGVMN
FT                   ASVEFDIETLSPTYKLLIGIPGRSNALDISRRLGLDEHIIARARTYISAESNEVENMIA
FT                   SLEQSKKRAEEEWEQAEKLRQEAEQLRNELEKQWTEFNEQQDRLLERAKEEAEFIVKKA
FT                   MKTAEEIIQNLREMQKKQVIAMKEHELIDARKKLEEAIPQIDTKKKKQAQKAKQSLHPG
FT                   DEVKVIHLNQKGQLIEKVSDKEWLVQIGILKMKVDEENLQYVSSPAPIETKPIATVKGR
FT                   DYHVPLELDLRGERYEDALLRVEKYIDDAVLAGYPRVSIIHGKGTGALRKGVQQYLQNH
FT                   RSVKSIRFGEATEGGTGVTIVELQ"
FT   gene            608487..608894
FT                   /locus_tag="Aflv_0562"
FT   CDS_pept        608487..608894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0562"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32943"
FT                   /db_xref="GOA:B7GGY8"
FT                   /db_xref="InterPro:IPR007140"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGY8"
FT                   /protein_id="ACJ32943.1"
FT                   /translation="MNAFWENETIHIAANFSVVILCLVLFLAIFELVTKYKNWEEIKKG
FT                   NMAVAMATGGKIFGIANIFRYSIDHHDSLLTMIGWGVYGFVLLLIGYFIYEFLTPKFNI
FT                   DDEIANDNRAVGFISMVISIGLSFVIGASIR"
FT   gene            608907..608990
FT                   /locus_tag="Aflv_0563"
FT   CDS_pept        608907..608990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0563"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32944"
FT                   /db_xref="GOA:B7GGY9"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGY9"
FT                   /protein_id="ACJ32944.1"
FT                   /translation="METLAKVLLVLCGVFLLIGVIYLTFFA"
FT   gene            609086..610762
FT                   /gene="lcfA"
FT                   /locus_tag="Aflv_0564"
FT   CDS_pept        609086..610762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lcfA"
FT                   /locus_tag="Aflv_0564"
FT                   /product="Acyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32945"
FT                   /db_xref="GOA:B7GGZ0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGZ0"
FT                   /protein_id="ACJ32945.1"
FT                   /translation="MEKPWLALYPQQVPHSIDYPRKPLQQFLQEAAEQFPHKTAIHFLG
FT                   KELTYKEVYEQALKLASYLQQLGLEKGDRVSIMLPNCPQAVISYYAVLFAGGIVVQTNP
FT                   LYTERELEYQLNDSGAKVIIGLDLLYPRITKVKTHTKIKHMIITSIKDYLPFPKNVLYP
FT                   FVQKKQTGMIVRVKHEGDCHLFTKALSLASGKVKETDVDPIEDVALLQYTGGTTGFPKA
FT                   AMLTHHNLTANTLMCTKWMYKCERGNESILGVLPFFHVYGMTAVMNLSIMEGYKMILLP
FT                   KFDVETTLKTIEKQRPTLFPGAPTIYIALLNHPNLKKYDLSSIKICISGSAPLPVEVQE
FT                   QFETVTGGKIIEGYGLTEASPVTHSNFIWDGKRIKGSIGVPWPDTEAMIVSLETGEKAN
FT                   VNEIGEIVVRGPQVMKGYWNRPEETAATLRDGWLYTGDLGYMNEEGYFFVVDRKKDMII
FT                   ASGYNVYPREVEEVLYEHPKVQEAVVIGVPDAYRGETVKAFIVLKEGEQCTEEELDQFM
FT                   RSKLAAYKVPRIYEFRKELPKTAVGKILRRALVEEEKEKQK"
FT   gene            610860..611441
FT                   /locus_tag="Aflv_0565"
FT   CDS_pept        610860..611441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0565"
FT                   /product="Transcriptional regulator, TetR/AcrR family"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32946"
FT                   /db_xref="GOA:B7GGZ1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013570"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGZ1"
FT                   /protein_id="ACJ32946.1"
FT                   /translation="MKRDKPKFKQIIDAAVIVIAENGYHQAQVSKIAKQAGVADGTIYL
FT                   YFKNKEDILISLFQEKMGYFIEKIEEEIEGISSPSEKLFLLIQKHFQMLAADPHLAIVT
FT                   QLELRQSNKSLRLKINEILKGYLKVVDRIVQEGIDKGEFRADLNVRLARQMIFGTIDEM
FT                   VTTWVMNEQKYDLVALAKPVHQLLTKGCCV"
FT   gene            611480..612247
FT                   /locus_tag="Aflv_0566"
FT   CDS_pept        611480..612247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0566"
FT                   /product="Enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32947"
FT                   /db_xref="GOA:B7GGZ2"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGZ2"
FT                   /protein_id="ACJ32947.1"
FT                   /translation="MFSIQQEGYVAILALHRPPANALASSVLKELSERLDALKEDEQVR
FT                   VIVLHGEGRFFSAGADIKEFTAIEASEQAAELARAGQQVMEKIEQFPKPIIAAIHGAAL
FT                   GGGLELAMSCHLRIVAENAKLGLPELQLGIIPGFAGTQRLLRHVGMAKALEMMWTSEPI
FT                   TGAEAVQWGLANKAVPEEQLLDTAKQLAQKIAQKSPISVQAVLKLVNEARTKTFHECVE
FT                   KEAQLFGQVFVTEDAKEGISAFIEKRTPQFQGK"
FT   gene            612263..613036
FT                   /gene="etfB"
FT                   /locus_tag="Aflv_0567"
FT   CDS_pept        612263..613036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="etfB"
FT                   /locus_tag="Aflv_0567"
FT                   /product="Electron transfer flavoprotein, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32948"
FT                   /db_xref="GOA:B7GGZ3"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGZ3"
FT                   /protein_id="ACJ32948.1"
FT                   /translation="MNIFVLMKRTFDTEEKIVIQNGKVSEEGAEFIINPYDEYAIEEAI
FT                   QVRDQHGGEVTVVTIGNEDAEKELRTALAMGADKAVLINIEDDVENRDQYTTAKVLAEY
FT                   LKDKEADLILAGNVAIDGGSGQVGPRVAELLGIPYITTITKLEIDGTNVKVVRDVEGDE
FT                   EVIETSLPLLVTAQQGLNEPRYPSLPGIMKAKKKPLEELELDDLDLEEDDVEAKTKTIE
FT                   IFLPPKKDAGKILQGDIADQVKELVSLLHTEAKVI"
FT   gene            613044..614030
FT                   /gene="etfA"
FT                   /locus_tag="Aflv_0568"
FT   CDS_pept        613044..614030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="etfA"
FT                   /locus_tag="Aflv_0568"
FT                   /product="Electron transfer flavoprotein, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32949"
FT                   /db_xref="GOA:B7GGZ4"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGZ4"
FT                   /protein_id="ACJ32949.1"
FT                   /translation="MGSMARKVLTLAEVRDGALRNVSFEAISAAKTIAEGGEVVAVVVG
FT                   ASVRSLANELIAYGADRVIVVEHEKLATYTSDGYAQALQAVVEQEKPEGLVFGHTALGK
FT                   DLSPKLAAKWQSGLVSDVVAVEATGGNIVFTRPIYSGKAFEKKIVTDGLMFVTVRPNNI
FT                   APLEKDESRTGAVVDVQVDIKDLRTIVRDIVRKTAEGVDLSEAKVIVAGGRGVKSAEGF
FT                   EPLKELANVLGGAVGASRGACDAGYCDYSLQIGQTGKVVTPDLYIACGISGAIQHLAGM
FT                   SNSKVIVAINKDPEANIFKVADYGIVGDLFEVVPLLTEEFKKLKVHS"
FT   gene            614177..614491
FT                   /gene="trxA"
FT                   /locus_tag="Aflv_0569"
FT   CDS_pept        614177..614491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxA"
FT                   /locus_tag="Aflv_0569"
FT                   /product="Thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32950"
FT                   /db_xref="GOA:B7GGZ5"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGZ5"
FT                   /protein_id="ACJ32950.1"
FT                   /translation="MAIVNATDQTFVNEVKEGVVLVDFWAPWCGPCKMIAPVLEEVDRE
FT                   LAGKVKVVKVNVDDNPETAGKYGVMSIPTLFVFKDGEVVDKTVGFQPKEALVGFLSKHL
FT                   "
FT   gene            614617..615828
FT                   /locus_tag="Aflv_0570"
FT   CDS_pept        614617..615828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0570"
FT                   /product="Uncharacterized conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32951"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGZ6"
FT                   /protein_id="ACJ32951.1"
FT                   /translation="MKKRQLKAVFAMFLLAGGVLAGCGNAEKTETTEKKEETKVEEKQG
FT                   EQQPAETEQAEEQVNVQTFIDAYKAIKAETEKAKEGQPVDWNLVEKTYVEQLQKPINEL
FT                   DGTFAQTIEAAIQGGKSGELNVHPARQIVDKVTQSYFYQLQKKLQKDVVAALEAGDQQQ
FT                   ATTLFDQIKLLAAEIFVPTAMKRDEYYQLTGESSLEQSINAGLAAQEEALKANNVDDFK
FT                   VYIQLTDKSIYRSYYLASKSYAEKIEAGVKEGKAEDELKGQQAEAWGFLQAIKGSLAEG
FT                   DEAATTRLDEILSLNNDYKNIKAEEVGALFAKALFGKMKGYHEKASAQLDENNVVEAKV
FT                   KALEGNMFLKAIELDVKAKLGEQKAADVFATAEKWYNAIAENKKDEAAQHSKAVLDAVS
FT                   AIVQ"
FT   gene            615881..616855
FT                   /locus_tag="Aflv_0571"
FT   CDS_pept        615881..616855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0571"
FT                   /product="Nucleoside-diphosphate-sugar epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32952"
FT                   /db_xref="GOA:B7GGZ7"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGZ7"
FT                   /protein_id="ACJ32952.1"
FT                   /translation="MMSDEGVTQMAKVCITGGAGFIGSHLGRKLLELDHELIVIDNFHP
FT                   YYSTCRKQRQLQQIKNVGFFHFYDVDILQLDSLKQIFFHHQPDVVFHLAALPGVQPSLL
FT                   EPLAYIDYDVKATVNVLQAAGEAEVQHVLFASSSSVYGNRAFQPLKEEMATGQVISPYA
FT                   AAKYSAESFCHAYAHIYGYTMTIFRYFTVYGPWGRPDMAISKFIRQLLRNEPITVYGDH
FT                   TARDYTYIDDIVAGMIQALERKGESDVFNLGAGQPVTMKQLLAELRNHFPHMRVHYEPP
FT                   RLGDVVATWADITKAKEKIGYEPRVSLREGLSKTIEWAKQYEK"
FT   gene            616827..617762
FT                   /locus_tag="Aflv_0572"
FT   CDS_pept        616827..617762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0572"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32953"
FT                   /db_xref="GOA:B7GGZ8"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGZ8"
FT                   /protein_id="ACJ32953.1"
FT                   /translation="MNGRSNMKNKQIKILMRLISLICIVAFIWMTIHHFDAQLLFDLMH
FT                   KLVSQPWHTSYMVTMYGFAFVLRAMAWKLYLPQARFQTCIDGLFASLFINHIFPIKIGD
FT                   VARVGICAKQNRIPFSIVAESVIVLRLLDLVVLFFFAFLGTIVYMHMIIRSAVIFPLIF
FT                   GGIVFLFFFLRRMDLSWVQKHKQHWNMIRGSHRFVLIVIAIVFSWICEAVVLFEMAKMV
FT                   AFPLSFSEALWVNSMAVGGQVFQMTPGGLATYEAVMAFALTRIHSYWEQAYALALVTHL
FT                   FKFLFSYVVGLYVWWRIPTLWTFVRKEDVA"
FT   gene            617708..619198
FT                   /locus_tag="Aflv_0573"
FT   CDS_pept        617708..619198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0573"
FT                   /product="Membrane-associated sulfatase family enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32954"
FT                   /db_xref="GOA:B7GGZ9"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGZ9"
FT                   /protein_id="ACJ32954.1"
FT                   /translation="MVAHPNAMDIRSKGGRSMKKASKFEKVAARCWNLLNEGKPFTPIF
FT                   VIGTMVLFHLFDGITFEEGKQLWNSLLFTIPLFVLYYVYDYPLFLRNYLWVPYVVFLMI
FT                   WSFVPTGLLLLAVSLYFFFTVFFWGTLYYHLRIGTTWLNFTRFWKLVLKNSDSTSGNAQ
FT                   EQLPKVLLLLSVWEYGVQHDIHVPSFIAFYAFVFVWSFILHRYLFDWKPKVIDRYTDNV
FT                   PPNDQPLSDRVIVLVVDGMRKDRFEQANAPFLKSLRANGTDFTQMETVYPARTVVCFTS
FT                   MLTGTYPFEHGIRSNMVWKLGIRVESIFDSLRKVGKKGKVLGIAHLVDSLGNDVETVTA
FT                   VMHNDVADRNIMERAKQIMGEQDLHLFVVQFIGTDQTGHSRGVHYDEYVQKIEEVDQLI
FT                   QQFVEWLHEQGKMDNTTLIVCADHGQADGIGGHGHLDEGERYVPFFMYGPMIEKGKRID
FT                   EKRSLVSLAPTIAHLLGAPYPSHSRGPVLVEALKKEGK"
FT   gene            619195..619920
FT                   /locus_tag="Aflv_0574"
FT   CDS_pept        619195..619920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0574"
FT                   /product="Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32955"
FT                   /db_xref="GOA:B7GH00"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B7GH00"
FT                   /protein_id="ACJ32955.1"
FT                   /translation="MMKVVIFLPAHNEEEVIGEVIRRIPRQMLPNIEVSVLVVDDGSTD
FT                   RTVDVAKQAGADFIYRHERNRGLGAAVRTGLQQCVELGADIGVMIDADNEYPPEQIPDL
FT                   IMPILRGEADYTMGSRFLGTIHGMKWHRRIGNYIFTFIQSLLLKTWIYDGQSGMRAFSR
FT                   QAMEEAEIIHDYNYAQVLTLNLVRKGFRLKEVPIVYQVRTTGQSFIKFTAYLKHVIPAI
FT                   VKEMYRPVKRKQIHSVQQR"
FT   gene            619979..620743
FT                   /locus_tag="Aflv_0575"
FT   CDS_pept        619979..620743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0575"
FT                   /product="Uncharacterized conserved secreted or membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32956"
FT                   /db_xref="GOA:B7GH01"
FT                   /db_xref="UniProtKB/TrEMBL:B7GH01"
FT                   /protein_id="ACJ32956.1"
FT                   /translation="MEEEIGVKKCLFFCMLMILVFTSAPISSFAYSYGDPNEEAVAEAY
FT                   KEMIAKVQEKKFDEVKAIYETVQKEIDMHMGPEPSAIILEAIDEKDGDTVVSAMQKVLV
FT                   LNVARRLENVEKNFDNYDTSKRLLAKAFATYKALSPIVQQKDAELDEKLKQQFDIALQS
FT                   LGNPGLFGVGKKESNIDQFKESKRTILEALQDQFELENIETGHFTEEDLDRLAAAKKKE
FT                   WTDLSDVKNWIPIIAIVMVIVAVVVYAVRKRK"
FT   gene            620759..621676
FT                   /locus_tag="Aflv_0576"
FT   CDS_pept        620759..621676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0576"
FT                   /product="High-affinity Fe2+ permease"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32957"
FT                   /db_xref="GOA:B7GH02"
FT                   /db_xref="InterPro:IPR004923"
FT                   /db_xref="UniProtKB/TrEMBL:B7GH02"
FT                   /protein_id="ACJ32957.1"
FT                   /translation="MLEVQALLITFREALEALLIVGIITSYLKRIDQSRYVKYVWLGAG
FT                   LAVFASAIVALLFQVVLTGFSTMASEMYLKVSIIFISSILLTQMVFWMAEHSKDIKSSM
FT                   EGKMSKYVSKGDVFGMVMHSFLVVLREGVETVFFFAAITGGNIGAAVQGWGAFTGLTIA
FT                   AIVSYMFFKGTMRVPLKTFFKVTGAFIILIAAGLLVQGISMLQDLKIIGSVMPHVYDIT
FT                   WFMPEHPIDHEHFVRDTGREPIFSGDVGIFLKALFGYSSMPSLEEVLAYIGYFIVIYLL
FT                   VKTRYHVKEEKKEKSEKVLEQQVM"
FT   gene            621721..623121
FT                   /locus_tag="Aflv_0577"
FT   CDS_pept        621721..623121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0577"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32958"
FT                   /db_xref="GOA:B7GH03"
FT                   /db_xref="UniProtKB/TrEMBL:B7GH03"
FT                   /protein_id="ACJ32958.1"
FT                   /translation="MRFVSIIVLVAIWMSYFVYASPFAATWDEVDFALALERYDLLAMQ
FT                   PHFPGYPYFIFGGMLVHSFVDNPAKALAIWNGLLMISATIPIYLLAKVFVEKKYAWAVT
FT                   VLVQSLSYVMLIVSQPMSEGSALAVLWWYVWSLQRALHSDRVDVQLLPLWLFSVMLGIR
FT                   LSYIPFGIGILYVWWKRAYRFKKLLLYSLIAVAFQFIWIVAVAATEGEGLWQLALSFTA
FT                   GHFTKWGGAISTDELPFWKRICILIFYNIIWTGMAKQSIWLLSCFVALLAMTWKRITMP
FT                   SLYRLLLLTYFLWALFAQNIEKPRHILPIVVIVSFFLFVSALQSSSRFRLTVMLILLLS
FT                   QTIIGIQGVKQQATQLPATYQLAYDFEQKEKPFILFTWEETRVLEYLRVSFPHARVFSF
FT                   HVFQREKAAFPHAKVYVTDHVVKGFQAQGVDVRPYIRPVRMYESSLVSDPVYGRITVYE
FT                   WREEEKRE"
FT   gene            623072..624895
FT                   /gene="uvrC"
FT                   /locus_tag="Aflv_0578"
FT   CDS_pept        623072..624895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrC"
FT                   /locus_tag="Aflv_0578"
FT                   /product="Excinuclease ABC subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32959"
FT                   /db_xref="GOA:B7GH04"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/TrEMBL:B7GH04"
FT                   /protein_id="ACJ32959.1"
FT                   /translation="MGASPYMNGGRRKNVNEQLKQKLAILPDQPGCYLMKDAHGTVIYV
FT                   GKAKVLKNRVRSYFTGTHDGKTLRLVNEIADFEYIVTSSDLEALILEMNLIKKYDPKYN
FT                   VMLKDDKSYPFIKITGETHPRLIITRTVKKDKGKYFGPYPNAQAAHETKKLLDRLYPLR
FT                   KCEKIPKKVCLYYHMGQCLGPCEYKVSEEENKQIVEQITRFLNGGYKEVKEALTEKMME
FT                   AAEQLQFERAKEYRDQIAYIEALMEKQKMILHDFVDRDIFGYAYDKGWMCVQVFFIRQG
FT                   KLIERNVSIFPLYQEPEEEFLTFLGQFYSKHYHLKPREIVLPREIDGEMAMKLLEVSVT
FT                   QPKSGKKKELVDLACKNAQIALQEKFFLIERDEERTIRAVERIGGALGISTPHRIEVFD
FT                   NSNIQGTDAVAAMVVFIDGKPEKKEYRKYKIKTVQGADDYESMREVIRRRYTRVLRERL
FT                   PLPNLIVVDGGKGQIQAAKEVLECELGLSIPIAGLVKDEKHRTSHLLFGDPPSVISLEK
FT                   NSQEFYLLQRMQEEVHRFAITFHRQVRSKSAFHSILDQIPGVGTKRKQALLQHFGSIKK
FT                   MKEATVEQIQEANIPKHIAQKIYEALQTYES"
FT   gene            complement(624899..625342)
FT                   /locus_tag="Aflv_0579"
FT   CDS_pept        complement(624899..625342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0579"
FT                   /product="Predicted hydrocarbon binding protein (V4R
FT                   domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32960"
FT                   /db_xref="InterPro:IPR019642"
FT                   /db_xref="InterPro:IPR024096"
FT                   /db_xref="UniProtKB/TrEMBL:B7GH05"
FT                   /protein_id="ACJ32960.1"
FT                   /translation="MIVIGYEQWKQTSISAFSDFLFRQELLPNLFGKETPFILYWAGKD
FT                   LARKYPLATIDDVIAFFEQAGWGNLSLLGEKKDECELQLDGPLVAMRFDYSEDCTFQLE
FT                   AGFLAQQFEQQKGYVTEAFEKQKRRVKTVLFTIKWDRKDEADR"
FT   gene            625622..626230
FT                   /gene="sdhC"
FT                   /locus_tag="Aflv_0580"
FT   CDS_pept        625622..626230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhC"
FT                   /locus_tag="Aflv_0580"
FT                   /product="Succinate dehydrogenase, cytochrome b subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32961"
FT                   /db_xref="GOA:B7GH06"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR011138"
FT                   /db_xref="InterPro:IPR016002"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:B7GH06"
FT                   /protein_id="ACJ32961.1"
FT                   /translation="MAQNREFFYRRLHSLLGVIPVGLFLTQHLVVNHFATRGADAFNKA
FT                   AAFMEQLPFRYFLEIFVIFLPLLFHAIYGLYIAFTAQNNVSRYGYFRNWMFMLQRLTGI
FT                   ITLIFVVWHVWETRVQAAFGAEVNYDMMANIVANPFMLAFYIVGIVSAVFHFANGLWSF
FT                   FVSWGITVTPRSQQISTYVTMGIFVALSIVGIRAILAFV"
FT   gene            626254..628014
FT                   /gene="sdhA"
FT                   /locus_tag="Aflv_0581"
FT   CDS_pept        626254..628014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhA"
FT                   /locus_tag="Aflv_0581"
FT                   /product="Succinate dehydrogenase, flavoprotein subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32962"
FT                   /db_xref="GOA:B7GH07"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011280"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:B7GH07"
FT                   /protein_id="ACJ32962.1"
FT                   /translation="MSKGKIIVVGGGLAGLMATIKIAEAGVKVDLFSLVPVKRSHSVCA
FT                   QGGINGAVNTKGEGDSPWEHFDDTVYGGDFLADQPPVKAMCEAAPGIIHLLDRMGVMFN
FT                   RTPEGLLDFRRFGGTQHHRTAYAGATTGQQLLYALDEQVRRHEVAGLVTKYEGWEFLGA
FT                   VLDDEQVCRGIVAQNLTTMEIKAFPADAVIMATGGPGIIFGKSTNSIINTGSAASIVYQ
FT                   QGAYYANGEFIQIHPTAIPGDDKLRLMSESARGEGGRVWTYKDGKPWYFLEEKYPAYGN
FT                   LVPRDIATREIFHVCVDLKLGINGENMVYLDLSHKDPKELDIKLGGIIEIYEKFMGEDP
FT                   RKVPMKIFPAVHYSMGGLWVDYDQMTNIKGLFAAGECDFSMHGANRLGANSLLSAIYGG
FT                   MVAGPKAVEYMKGLEKSADAMPSSLYDRYLKQEEEKWAQIMAMDGTENAYVLHKELGEW
FT                   MTDNVTVVRYNDKLLKTDEKIQELLERYKNININDTAKWSNQGASFTRQLYNMLQLARV
FT                   ITLGAYNRNESRGAHYKPEFPERNDEEWLKTTMASFTPDGPSFHYRDVDTSLIKPRKRD
FT                   YTKKKGEVKS"
FT   gene            628011..628772
FT                   /gene="sdhB"
FT                   /locus_tag="Aflv_0582"
FT   CDS_pept        628011..628772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhB"
FT                   /locus_tag="Aflv_0582"
FT                   /product="Succinate dehydrogenase, Fe-S protein subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32963"
FT                   /db_xref="GOA:B7GH08"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:B7GH08"
FT                   /protein_id="ACJ32963.1"
FT                   /translation="MSENKTIRIIVTRQDRPDTAPYEEEFVIPYRPNMNIISALMEIRR
FT                   NPVNAKGEKTTPVAWEMNCLEEVCGACSMVINGKPRQSCTALIDQLEQPIRLEPMRTFP
FT                   VIRDLQVDRSRMFDSLKKVKAWIPIDGTYDLGPGPRMPERKRQWAYELSKCMTCGVCLE
FT                   ACPNVNSKSNFIGPAPLSQVRLFNAHPTGAMHKAERLEAIMGDGGLANCGNSQNCVQSC
FT                   PKGIPLTTSIAALNRAATIQMFRNFFGSDEV"
FT   gene            628830..629279
FT                   /locus_tag="Aflv_0583"
FT   CDS_pept        628830..629279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0583"
FT                   /product="Thioesterase superfamily enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32964"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B7GH09"
FT                   /protein_id="ACJ32964.1"
FT                   /translation="MKISYIGDIKEWEQRFSFFHPVRVRFSETDMFGHLNNTVPFVYFE
FT                   EARIAFFEHLGFMNDWLGKELDAIPVVANLQCDFLQQVYFGEQLQIGVKVAHIGNSSVD
FT                   LHYVGKKQNGAIAFTGRGTMVQMSKTTGKGVAWDENARARLIENM"
FT   gene            629306..629575
FT                   /gene="gerE"
FT                   /locus_tag="Aflv_0584"
FT   CDS_pept        629306..629575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerE"
FT                   /locus_tag="Aflv_0584"
FT                   /product="Transcriptional regulator GerE family"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32965"
FT                   /db_xref="GOA:B7GGV2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B7GGV2"
FT                   /protein_id="ACJ32965.1"
FT                   /translation="MLTKYIPIRFGLVKARRVIHLNQKPLLTKREREVFELLLQDKTTK
FT                   EIASELFISEKTVRNHISNAMQKLGVKGRSQAVVELLRMGELEL"
FT   gene            629646..630482
FT                   /gene="racE"
FT                   /locus_tag="Aflv_0585"
FT   CDS_pept        629646..630482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="racE"
FT                   /locus_tag="Aflv_0585"
FT                   /product="Glutamate racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32966"
FT                   /db_xref="GOA:B7GH10"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/TrEMBL:B7GH10"
FT                   /protein_id="ACJ32966.1"
FT                   /translation="MFCHTSTKNEANTLERPIGVIDSGVGGLTVAKEIMRQLPKEQIVY
FT                   LGDTARCPYGPRPREEIRQFTWEMTNYLLGYDIKMLVIACNTATAVALEEIRHTLNIPV
FT                   IGVVHPGARTALKITKNYHIGVIGTIGTVKSGAYEQALKSINSDVKIESLACPKFVPLV
FT                   ESGQFEGEEAKQIVAESLEPFKDRPIDTLILGCTHYPLLSPLIQQYMGEHVKLICSGDE
FT                   TAREVSTILHHSGLLYTGNKRREHIFFTTGSKETFQQIASKWFGHPIEHVETIQLS"
FT   gene            630574..631620
FT                   /gene="gerM"
FT                   /locus_tag="Aflv_0586"
FT   CDS_pept        630574..631620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerM"
FT                   /locus_tag="Aflv_0586"
FT                   /product="Spore germination protein GerM"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32967"
FT                   /db_xref="InterPro:IPR019606"
FT                   /db_xref="UniProtKB/TrEMBL:B7GH11"
FT                   /protein_id="ACJ32967.1"
FT                   /translation="MRRVWVIATMFIFILSGCGLFGGEKATKEIDPPKDVTYVENEQAL
FT                   QEKEAAEKETATETVQRELYLIDKNGFVVPQTFALPKTNAAAKQVLEYLVENGPISELL
FT                   PNGFRAVLPADTQVLSVNLKQDGTLVIDFSKEFANYRPEDEKRILQAITWTVTQFDNVK
FT                   RVKIRMNGHDQNVMPVNGTPISNELSRDDGINIETNGVVDITNTRPIIVYFLAQDGKQT
FT                   YYVPVTRRVPNSEQDELAAVVNELIKGPSYGSGLLSDFQADTKLLEAPKYENGKVTLNF
FT                   NEAIYGSVEKNVVSTHVLNCLVLSLTEQPGVESVAITVNGKAELVDESGKPLSEPVTRP
FT                   QNVNTGSF"
FT   gene            631714..632481
FT                   /gene="rph"
FT                   /locus_tag="Aflv_0587"
FT   CDS_pept        631714..632481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rph"
FT                   /locus_tag="Aflv_0587"
FT                   /product="Ribonuclease PH"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32968"
FT                   /db_xref="GOA:B7GH12"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GH12"
FT                   /protein_id="ACJ32968.1"
FT                   /translation="MRVDGRTNDELRPVHIEPNYLKHPEGSVLISIGDTKVICTASIED
FT                   KVPPFMRGGGKGWITAEYAMIPRATEQRNIREASKGKLSGRTMEIQRLIGRALRSVVDL
FT                   QKLGEKTIWIDCDVIQADGGTRTASITGAFVAMTLALGKMVEEKKLPALPITDFLAATS
FT                   VGIDGEHGIILDLNYIEDSKAQVDMNIVMTGSGRFVEIQGTGEEATFSYEQLLDLLTVA
FT                   EKGIHELIARQKEALGSLAEQIMQHCSEGEEAK"
FT   gene            632454..633089
FT                   /locus_tag="Aflv_0588"
FT   CDS_pept        632454..633089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0588"
FT                   /product="Inosine triphosphate pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32969"
FT                   /db_xref="GOA:B7GH13"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:B7GH13"
FT                   /protein_id="ACJ32969.1"
FT                   /translation="MFGRGRSKMKRIIVATKNKGKVAEFQQLFSKKGIDVLSLLAYDDI
FT                   PDVEETGTTFSENAILKATTIANMLHETVIADDSGLIVDALNGEPGVYSARYAGEGKND
FT                   QANIEKVLKKLQGVPFEQRTARFHCTLAVAKPNGDVTTVDGVCEGYITEEPVGENGFGY
FT                   DPIFFVPEKQRTMAQLTKEEKNEISHRAKALQHLLHIWDKLFEKENES"
FT   gene            633086..633598
FT                   /locus_tag="Aflv_0589"
FT   CDS_pept        633086..633598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0589"
FT                   /product="Predicted phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32970"
FT                   /db_xref="GOA:B7GH14"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041802"
FT                   /db_xref="UniProtKB/TrEMBL:B7GH14"
FT                   /protein_id="ACJ32970.1"
FT                   /translation="MNVLIVSDSHGLTKELQTIVSRHKQHVDAIIHCGDSELTSDHEAL
FT                   QGMLVVRGNCDDERRFPTDLVEEVNGVRFFITHGHLYNVKMTLMNLYYKAKEVGARVVC
FT                   FGHSHIAGCEQIDDVLFINPGSVYLPRLRREKTYAILHIDETTTTVHFYNIDGKPLHDL
FT                   TTTYTTK"
FT   gene            633690..633766
FT                   /gene="trnR"
FT                   /locus_tag="Aflv_R081"
FT                   /note="tRNA_Arg4"
FT   tRNA            633690..633766
FT                   /gene="trnR"
FT                   /locus_tag="Aflv_R081"
FT                   /product="tRNA-Arg"
FT   gene            634216..635118
FT                   /gene="dat"
FT                   /locus_tag="Aflv_0590"
FT   CDS_pept        634216..635118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dat"
FT                   /locus_tag="Aflv_0590"
FT                   /product="Branched-chain amino acid aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32971"
FT                   /db_xref="GOA:B7GH15"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:B7GH15"
FT                   /protein_id="ACJ32971.1"
FT                   /translation="MSEQWIFLNDEFVTKENAKISVYDHGFLYGDGVFEGIRVYSGNVF
FT                   RMKEHIDRLYNSAKSILLNIPYTKEELTNIIVETVQKNGFEDAYIRVVVSRGVGDLGLD
FT                   PYKCPKPQVVVIVEPLAIFPKHLYETGIEVITVATRRNRPDVLSPKVKSLNYLNNVLVR
FT                   IEAHLANVSEALMLNDQGYVAEGSADNVFIVKNGVLYTPPGYVGALEGITRDAIIDIAK
FT                   DLGYVVKEEPFTRHDVYTADEVFLTGTAAEVIAVVKVDGRVIGDGVPGEHTKRLLEEFR
FT                   KRVVSEGVKVYAAQNVNAG"
FT   gene            635365..637173
FT                   /gene="ilvB"
FT                   /locus_tag="Aflv_0591"
FT   CDS_pept        635365..637173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvB"
FT                   /locus_tag="Aflv_0591"
FT                   /product="Acetolactate synthase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32972"
FT                   /db_xref="GOA:B7GH16"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:B7GH16"
FT                   /protein_id="ACJ32972.1"
FT                   /translation="MQAFSPLWSARTDGGVRRLFLFHISFRGEKMAANMKVKERVAKKQ
FT                   TLCGALMLIEALKAENVKVIFGYPGGAVLPIYDKLYESGVFHVLTRHEQGAIHAAEGYA
FT                   RISGKPGVVIATSGPGATNIVTGLTDAMMDSIPLVVFTGQVASSVIGSDAFQEADVLGI
FT                   TMPITKHSYQVRDVHELPKIIKEAFHIATTGRPGPVLIDIPKDMAVAEAEFDYEQDVQL
FT                   PGYQPTTKPNHLQIRKLVEAVSQAKRPVILAGAGVLHANAHEQLKQYAEQQHIPVIHTL
FT                   LGLGGFPADHPLFLGMAGMHGTYTANMALYECDLLINVGARFDDRVTGNLAHFAPKATV
FT                   AHIDIDPAEIGKNVPTKIPIVGDAKEALIQLIEQNGKRPDVSEWLKQLNEWKREYPLMY
FT                   KREPGVLKPQRLIEMIHEYTNGEAVVTTDVGQHQMWVAQYYKFKQPHRWVTSGGLGTMG
FT                   FGLPAAIGAQLAQPEATVVSIVGDGGFQMTLQELSVIQELNLPIKIVIVNNQALGMVRQ
FT                   WQEIFYEKRYSHSLIPNQPDFVRLAEAYGMKAMRATTEEEAEYVLKEALATNAPVLLDF
FT                   HVCPGENVYPMVAPGKGLHEMVGVKW"
FT   gene            637167..637688
FT                   /gene="ilvH"
FT                   /locus_tag="Aflv_0592"
FT   CDS_pept        637167..637688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvH"
FT                   /locus_tag="Aflv_0592"
FT                   /product="Acetolactate synthase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32973"
FT                   /db_xref="GOA:B7GH17"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:B7GH17"
FT                   /protein_id="ACJ32973.1"
FT                   /translation="MVKRIITMTVNNRPGVLNRITGLFTKRHYNIESITVGHTESEGIS
FT                   RMTFVVNVEDERIAEQITKQLNKQIDVLKVVDITDQAIIVRELALIKVAVTPATRGEIY
FT                   TLIEPFRAAIVDVARDSLVVQVTGEPEKIDALIDLLKPYGLKEVARTGTTAFPRGSQRA
FT                   SSTNKSLFII"
FT   gene            637706..638731
FT                   /gene="ilvC"
FT                   /locus_tag="Aflv_0593"
FT   CDS_pept        637706..638731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvC"
FT                   /locus_tag="Aflv_0593"
FT                   /product="Ketol-acid reductoisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32974"
FT                   /db_xref="GOA:B7GH18"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GH18"
FT                   /protein_id="ACJ32974.1"
FT                   /translation="MVKVYYNGDANEAYIQGKKVAIIGYGSQGHAHAQNLRDSGVEVII
FT                   GLRKGKSWEKAEQDGFVVLPVSEATKQADVVMILLPDEHQPKVYKEEIAPNLQPGNALV
FT                   FAHGFNIHFNQIVPPSDVDVFLVAPKGPGHLVRRTYTEGAGVPALIAVYQDVSGEAKET
FT                   ALAYAKAIGSARAGVIETTFKEETETDLFGEQAVLCGGLTALVKAGFETLVEAGYQPEI
FT                   AYFECLHELKLIVDLMYEGGLAGMRYSISDTAQWGDFVTGPRIINDAVKAEMKKVLEDI
FT                   QTGKFAKGWILENEANRPEFNAINRRENEHLIEVVGRELRKMMPFVNAKQKDVVTVGAK
FT                   N"
FT   gene            638718..640262
FT                   /gene="leuA"
FT                   /locus_tag="Aflv_0594"
FT   CDS_pept        638718..640262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuA"
FT                   /locus_tag="Aflv_0594"
FT                   /product="2-isopropylmalate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32975"
FT                   /db_xref="GOA:B7GH19"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005671"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GH19"
FT                   /protein_id="ACJ32975.1"
FT                   /translation="MRKINIFDTTLRDGEQSAGVNLNLHEKLEIARQLERLGVDIIEAG
FT                   FPAASKGDFQAVQAIAQTVRNCSVTGLSRSVQSDIDAAWEALKDGAEPRLHVFIATSPI
FT                   HMQYKLRMTPEQVVETAVESVRYAKKYFPIVQWSAEDACRSDLPFLATIVEKVIEAGAN
FT                   VINIPDTVGYITPKQYGDIFSFLKKNVRNIEKISLSAHCHDDLGMAVANSLAAIEAGAT
FT                   QIEGTINGIGERAGNAAIEEVAVALYIRKDYYQAETRLNLQEIKRTSSLVSKLTGMIVP
FT                   ANKAIVGKNAFAHESGIHQDGVLKEKTTYEIISPQLVGVQSNSMVLGKHSGRHAFRTRI
FT                   QELGYSLTEEEVNRLFVRFKDLADKKKDITDDDLIALILDEKLDTYKNFYQLCSIQVQY
FT                   GTNQIPTAVVVLKDGEGNDIQEAATGAGSVEALYNALEKALQLPVTLLDYRIESVGSGR
FT                   DALAQVYVKVSLDRKEASGRGTAQDVLEASAKAYIHAVNRMFVIEKMKEEQALAAQ"
FT   gene            640280..641389
FT                   /gene="leuB"
FT                   /locus_tag="Aflv_0595"
FT   CDS_pept        640280..641389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuB"
FT                   /locus_tag="Aflv_0595"
FT                   /product="Isocitrate/isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32976"
FT                   /db_xref="GOA:B7GH20"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:B7GH20"
FT                   /protein_id="ACJ32976.1"
FT                   /translation="MYRIAVLPGDGIGKEVTRGAVKVLQAISDRFGHTFQFSYGLIGGE
FT                   AIDREGTPLPEQTLHMCKQSDAVLLGAVGGPKWDKNPPHVRPEKGLLQIRKEMNLFANV
FT                   RPVTFYESLAASSPLKPHVIEGADFVIVRELTGGLYFGKPSERRVEKGEEAVVDTLFYK
FT                   RAEIERIITFAFTLAQKRKKKVTSVDKANVLESSRMWREVAEQVAKRFPDVQLEHMLVD
FT                   NAAMQLVRSPKQFDVIVTENMFGDILSDEASMLTGSLGMLPSASLSVDGPALYEPIHGS
FT                   APDIAGKNKANPLATILSVAMMLRLSFGLTEEADVIERAVKQVLNAGYRTADIAQHGDC
FT                   VLSTTEMVEKVKDAILDDVAIERIMQVYV"
FT   gene            641401..642816
FT                   /gene="leuC"
FT                   /locus_tag="Aflv_0596"
FT   CDS_pept        641401..642816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuC"
FT                   /locus_tag="Aflv_0596"
FT                   /product="3-isopropylmalate dehydratase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32977"
FT                   /db_xref="GOA:B7GH21"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GH21"
FT                   /protein_id="ACJ32977.1"
FT                   /translation="MVPKTIIEKIWDEHVVYREDGKPDLLYIDLHLVHEVTSPQAFEGL
FT                   RQKGRKVRRPDLTFATMDHNVPTINRSVVEDEVAKNQMTALERNCREFGVPLADLNSPE
FT                   QGIVHVIGPELGLTQPGKTIVCGDSHTSTHGAFGALAFGIGTSEVEHVLATQTLWQHRP
FT                   KTMQVNVTGSLAPGVSAKDVILAIIGKFGVDFGTGYVLEFTGDVIRRMSMEERMTICNM
FT                   SIEAGARAGLIAPDDVTFAYLKERKYAPKGEAFEQAVEKWKQLCTDEGAVYDRVVHIDG
FT                   SEIAPTVTWGTTPAMSSPIDGTVPDPNEFATETERKAVQLALQYMGLKPGTKMTDIAVQ
FT                   HVFIGSCTNSRISDLREAAQIVKGKKVAPGVRALVVPGSQQVKKQAEEEGIAQTFIDAG
FT                   FEWRDSGCSMCLGMNPDTVPAGEHCASTSNRNFEGRQGKGARTHLVSPAMAAAAAIYGH
FT                   FVDVRTLYKEVVR"
FT   gene            642828..643412
FT                   /gene="leuD"
FT                   /locus_tag="Aflv_0597"
FT   CDS_pept        642828..643412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuD"
FT                   /locus_tag="Aflv_0597"
FT                   /product="3-isopropylmalate dehydratase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32978"
FT                   /db_xref="GOA:B7GH22"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GH22"
FT                   /protein_id="ACJ32978.1"
FT                   /translation="MEPFVVHKGKVAGLDRANIDTDQIIPKQFLKRIERTGFGQFLFYD
FT                   WRYLSDGTPNPHFELNRPENEGATILVANENFGCGSSREHAPWALADYGFRAIIAPSFA
FT                   DIFYNNCLKNSLLPIKLPKEDVAYLLKQAERADYELTISLEQQVVFDDEGFTSSFDIDP
FT                   YRKQLLLKGWDEIDLTFVYEPYIIAYEKKRS"
FT   gene            643496..644428
FT                   /locus_tag="Aflv_0598"
FT   CDS_pept        643496..644428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0598"
FT                   /product="TPR repeats containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32979"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR024503"
FT                   /db_xref="UniProtKB/TrEMBL:B7GH23"
FT                   /protein_id="ACJ32979.1"
FT                   /translation="MKNRKIVPHPYLKERLLAEGMEALKGKRYKEAYTYFVQLEQLQWH
FT                   DDDVQMALVVCLFEMGQIEEAKERCEQLLERGSGDWAVYISMLVHLQQYDEVVAVIHNI
FT                   QRKGIDCTPFLPLLQFSEKMIRSQYEQQAKQYEIIFESEQWSKQLRILHQLHSPIVLRI
FT                   VPIFARYLCDETKHPIVKTTMLHILKKEQVTEPITVKKFAQTMTVVPAELDEQKQNDWI
FT                   EQVLDIVEQKWAKQNPTMYEWGKQIWLRYMFVMYPFLPTESVQQWANALYTYIEQCETG
FT                   QTISTSPLVSKLYKQKNYGSLLKVYDCMV"
FT   gene            644523..645809
FT                   /gene="tig"
FT                   /locus_tag="Aflv_0599"
FT   CDS_pept        644523..645809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tig"
FT                   /locus_tag="Aflv_0599"
FT                   /product="FKBP-type peptidyl-prolyl cis-trans isomerase
FT                   (trigger factor)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32980"
FT                   /db_xref="GOA:B7GH24"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GH24"
FT                   /protein_id="ACJ32980.1"
FT                   /translation="MSAKWEKLEGNQGVLTVEVDAEKVNEGLDEAFKKVVKKVQIPGFR
FT                   KGKIPRSLFEKRFGVESLYADALDILLPEAYAKAVEETGIEPVDRPEIDVEQMEKGKSL
FT                   IFTAKVTVKPEVTLGEYKGLEVEKLDDTVTDEDVEQELKRLQERHAELVVKEEGTVENG
FT                   DTVVIDFEGFVDGEAFEGGKAENYSLVIGSGTFIPGFEEQLIGMAAGEEKDIEVTFPEE
FT                   YHAEQLAGKPAVFKIKLHEIKTKQLPALDDEFAKDVDEEVETLDALKEKIKERLTKEKK
FT                   EEAEAALRDAVVQKATENAQMDIPEVMVKNETDRMIREFEQRLQMQGLNLDLYYQFSGQ
FT                   DEAALREQMKEEAEKRVRVTLTLEAIVKAENIDVTEEEVEKELQEMASLYNLSVDKLKE
FT                   LLGTLDGLKEDLKMRKAIDFLVENSKVVA"
FT   gene            646003..647265
FT                   /gene="clpX"
FT                   /locus_tag="Aflv_0600"
FT   CDS_pept        646003..647265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpX"
FT                   /locus_tag="Aflv_0600"
FT                   /product="ATP-dependent Clp protease ATP-binding subunit
FT                   (class III heat-shock protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32981"
FT                   /db_xref="GOA:B7GH25"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GH25"
FT                   /protein_id="ACJ32981.1"
FT                   /translation="MFKFNDEKGQLKCSFCGKTQEQVRKLVAGPGVYICDECIELCTEI
FT                   VQEELGSEEEVEFKDVPKPKEIRDILDEYVIGQDEAKKALSVAVYNHYKRINSNSKIDD
FT                   VELAKSNILMIGPTGSGKTLLAQTLARILNVPFAIADATSLTEAGYVGEDVENILLKLI
FT                   QAADYDIERAEKGIIYIDEIDKIARKSENPSITRDVSGEGVQQALLKILEGTIASVPPQ
FT                   GGRKHPHQEFIQIDTTNILFICGGAFDGLEPIIKRRLGKKVIGFSSDAQAEVEEKDLLS
FT                   KVLPEDLLKFGLIPEFVGRLPVITSLQPLDEDALVDILVKPKNALVKQYEKMLELDDVE
FT                   LEFEEEALREIAKRAIERKTGARGLRSIIEGIMLDVMFELPSREDVQKCIITAETVRGE
FT                   KAPLLILHDGTIIEYERKTSA"
FT   gene            647308..649029
FT                   /gene="lonB"
FT                   /locus_tag="Aflv_0601"
FT   CDS_pept        647308..649029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lonB"
FT                   /locus_tag="Aflv_0601"
FT                   /product="Lon-like ATP-dependent protease"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32982"
FT                   /db_xref="GOA:B7GH26"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014251"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B7GH26"
FT                   /protein_id="ACJ32982.1"
FT                   /translation="MFISFFARRYYAYSTYAGGTAMNWTNIALLIQLFFGIIIGLYFLN
FT                   LLKSQRTQKISIDKEARKEMEQLRKMRSISLTEPLAEKVRPKTFDDIVGQEDGIKALKA
FT                   ALCGPNPQHVIIYGPPGVGKTAAARLVLEEAKKNPLSPFRKDAVFVELDATTARFDERG
FT                   IADPLIGSVHDPIYQGAGAMGQAGIPQPKQGAVTNAHGGVLFIDEIGELHPIQMNKLLK
FT                   VLEDRKVFFESAYYSEENPNIPNHIHDIFQNGLPADFRLVGATTRTPNEIPPAIRSRCM
FT                   EVFFRELEQEEIAQIVKKAAEKVNLPIEEQAVHELAMYARNGREAVNTLQIAAGIVISE
FT                   KRSKILRQDIEWVIQSSQLSPRYEKKVGQEAKIGLVNGLAVYGPNSGALLEIEVAVLPT
FT                   KEKGTINMTGIVEEEQIGGQGKSIRRKSMARGSIENVITVLRSLGVPADQYDIHVNFPG
FT                   GVPIDGPSAGVAMAIGIYSAIYRLPVHPTIAMTGEIGVHGNVKPVGGIFPKVKAAKQAG
FT                   AKTVIIPRENMQSILRQVTGIEIVPVDHIGDVLSFLFHEHVRSVPMRHHLPKTERM"
FT   gene            649143..651467
FT                   /gene="lonA"
FT                   /locus_tag="Aflv_0602"
FT   CDS_pept        649143..651467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lonA"
FT                   /locus_tag="Aflv_0602"
FT                   /product="Class III heat-shock ATP-dependent Lon protease"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32983"
FT                   /db_xref="GOA:B7GH27"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/TrEMBL:B7GH27"
FT                   /protein_id="ACJ32983.1"
FT                   /translation="MARKKNKVIPLLPLRGLLVFPTTVLHLDVGREKSVQALEKAMVEE
FT                   NLVLLTSQKDVQIDDPELEDLYEMGTIARVKQLLKLPNGTFRVLVEGISRGKVVKWVSE
FT                   EPCYVVQVEPFADQENEDMEFEALRRTMLEYFEQYIKLSKKLSADIYTSVMDIQQAGRM
FT                   ADIIASHLPLKLEEKQRLLEAVDVKERVHQIIQILHNEKEILHLEKRISQRVKQSMERT
FT                   QKEYYLREQMKAIQKELGEKEGKAGEIELLREKIEQAGMPEHVKATALKELDRYEKVPA
FT                   ASAESGVIRNYLDWLLALPWTKQTEDIHDIHRAEKILNEEHYGLETVKERVLEYLAVQQ
FT                   LTNSLRGPILCLVGPPGVGKTSLARSIAKTLNRHFVRISLGGVRDESEIRGHRRTYVGA
FT                   LPGRIIQGMKKAGTINPVFLLDEIDKMSSDFRGDPSAALLEVLDPEQNHSFSDHYIEEP
FT                   YDLSKVMFIATANTLATIPRPLLDRMEVITIPSYTEIEKLHIAKEHLLPKQMEAHGLQK
FT                   RMLHMRDDAILQVIRYYTREAGVRNLERQLASICRKAAKTIVSEGRKRIVVTEKNVSEF
FT                   LGKPKYHYGQAENEDQVGVATGLAYTTAGGDTLAIEVSIAPGKGKLTLTGQLGDVMKES
FT                   AQAAFTYIRSKAKELGIDPEFHEKLDIHIHVPEGAVPKDGPSAGITMATALISALTGKP
FT                   VSRFVGMTGEITLRGRVLAIGGVKEKVLSAHRAGLKKVILPKENEKDLEDIPEVVKKQL
FT                   QFVLVSHIDDVLEHALVGGEK"
FT   gene            651464..652045
FT                   /gene="ysxC"
FT                   /locus_tag="Aflv_0603"
FT   CDS_pept        651464..652045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ysxC"
FT                   /locus_tag="Aflv_0603"
FT                   /product="GTP-binding protein YscX, possible signaling
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32984"
FT                   /db_xref="GOA:B7GH28"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GH28"
FT                   /protein_id="ACJ32984.1"
FT                   /translation="MKITNVEMVISAVKQEQYPAGQLPEFALAGRSNVGKSSFINKMIN
FT                   RKNFARTSSKPGKTQTLNFYRINDAFYFVDVPGYGFAKVSKTEREAWGKMIETYFTTRE
FT                   QLKAALLIVDLRHPPTKDDVMMYEFLKHYNIPTLVIATKADKIPRGKWQQHAKVAKETL
FT                   RLISDDELIIFSAETGQGKDEAWGALQKWM"
FT   gene            complement(652081..652581)
FT                   /locus_tag="Aflv_0604"
FT   CDS_pept        complement(652081..652581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0604"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32985"
FT                   /db_xref="GOA:B7GH29"
FT                   /db_xref="UniProtKB/TrEMBL:B7GH29"
FT                   /protein_id="ACJ32985.1"
FT                   /translation="MSHGIGGFSMKKRGIFSGIILIGFGMYFLLERFSLFPSFHTWPTL
FT                   LFITGIAFLGQAYIGKDYSAILSGVVFTGIGVHFHLASHLSSWPDHISMVTFMIALGLL
FT                   LQYIKTKQALLPTVLLFVLSIIFLFSHRLQQVFTSVTFDSLIHIWPLSFILIGLYLLFI
FT                   KKG"
FT   gene            652732..654066
FT                   /gene="hemA"
FT                   /locus_tag="Aflv_0605"
FT   CDS_pept        652732..654066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemA"
FT                   /locus_tag="Aflv_0605"
FT                   /product="Glutamyl-tRNA reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32986"
FT                   /db_xref="GOA:B7GH30"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR015896"
FT                   /db_xref="InterPro:IPR018214"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036343"
FT                   /db_xref="InterPro:IPR036453"
FT                   /db_xref="UniProtKB/TrEMBL:B7GH30"
FT                   /protein_id="ACJ32986.1"
FT                   /translation="MYVVVVSVNYRTAPVEIREKLTFNQTELAEAMKALQKQKSMLENV
FT                   IVSTCNRTEIYAVVDQLNTGRYYIKTFLADWFGLDKEQIAPYLRIYEEREAIEHLFRVA
FT                   CGLDSMILGETQILGQVRTSFLLAQQENTIGTVFKQLFKQAITLAKRAHAETEIGANAV
FT                   SVSYAAVELAKKIFGDLKNKHVLILGAGKMGELALQNLYGSGVKRVTVVNRTFEKAQQL
FT                   AERFNGDAKPLSQLQCALLEADILISSTGAKQYVITKETMAVIEKMRKGRPFFMIDIAV
FT                   PRDLDPALAELDSVFLYDIDDLQDIVEANLAERKKAAEQIERMIAEEMDEFEQWLHMLG
FT                   VVPIIAALREKAMLIQEETMKSLERKLPNLSERDKKVLNKHTKSIVNQLLRDPILRAKE
FT                   LAAEDNAEEALQLFMKIFNIEQQVKQQQKEMSCVHERAAEPSFQS"
FT   gene            654079..654894
FT                   /gene="hemX"
FT                   /locus_tag="Aflv_0606"
FT   CDS_pept        654079..654894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemX"
FT                   /locus_tag="Aflv_0606"
FT                   /product="ABC-type transport system involved in cytochrome
FT                   c biogenesis, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32987"
FT                   /db_xref="GOA:B7GH31"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="UniProtKB/TrEMBL:B7GH31"
FT                   /protein_id="ACJ32987.1"
FT                   /translation="MFDMTRWYELSLLLHASSVLFYFIDFLHHNRKANRIAFGLLSIVW
FT                   GMQTFFFFARMVETGRFPVLTLAEGLSFYAWLLITLSLAINEWLRVDFLVFFTNVLAFF
FT                   ILSLHTFAPTPYTVGIAEQLMSELLFIHITMAILSYGAFSISFMFSLLYLLQYELLKKK
FT                   KWGKRLWRLGDLAKLDDLSYVLNGVGVPVLLLSLILGMVWAYMKVDHFVLYDAKVLGSF
FT                   TVLATYSFYLYKRAVKGIQGKEMALWNIGSFLILLINFFLFGTLSQFHF"
FT   gene            654901..655842
FT                   /gene="hemC"
FT                   /locus_tag="Aflv_0607"
FT   CDS_pept        654901..655842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemC"
FT                   /locus_tag="Aflv_0607"
FT                   /product="Porphobilinogen deaminase (hydroxymethylbilane
FT                   synthase)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32988"
FT                   /db_xref="GOA:B7GH32"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/TrEMBL:B7GH32"
FT                   /protein_id="ACJ32988.1"
FT                   /translation="MEESMMRKIIVGSRRSKLALTQTNWVIEQLKQLGAPFEFEVKEIV
FT                   TKGDQILHVTLSKVGGKGLFVKEIEQAMLDGEIDFAVHSMKDMPAVLPDGLVIGCVPKR
FT                   EDHRDVLISKGHIPFEQLPSGAIVGTSSLRRSAQLLAVRPDLQIQWIRGNIDTRLAKLQ
FT                   TDAYDAIILAAAGLHRMGWAKEVITQYLPTDICVPAVGQGALAIECRENDAELLHWLNK
FT                   LTDKQTERATRAERAFLQHIEGGCQVPVAGYAYVDEDAIVLTALVATPNGTEVLKEVVK
FT                   GTEPEKVGTEAAKRLIERGAKQLIERVLKELE"
FT   gene            655843..656592
FT                   /gene="hemD"
FT                   /locus_tag="Aflv_0608"
FT   CDS_pept        655843..656592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemD"
FT                   /locus_tag="Aflv_0608"
FT                   /product="Uroporphyrinogen-III synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32989"
FT                   /db_xref="GOA:B7GH33"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:B7GH33"
FT                   /protein_id="ACJ32989.1"
FT                   /translation="MLRGKRVLVTREKSQAKALSQALERYGAIPIELPLIRIERAKQVG
FT                   QDLLHKWHTFDWIVFTSQNGVKYFFELIGEMKPPTWPKVAAVGEKTAKALRKRNVVVDL
FT                   IPNEFVAESLVEALKPLLSTHARVLLVKGNLARDTLREQLSNIADVKDWIVYETTYNED
FT                   AKPKIIELLQQRMIDAITFTSSSTVHSFVEAIAGENVDLSFVTIACIGPITKQTALHLG
FT                   IPVHVCPHTYTIDAMIEELNQYFTRRE"
FT   gene            656594..657568
FT                   /gene="hemB"
FT                   /locus_tag="Aflv_0609"
FT   CDS_pept        656594..657568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemB"
FT                   /locus_tag="Aflv_0609"
FT                   /product="Delta-aminolevulinic acid dehydratase
FT                   (porphobilinogen synthase)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32990"
FT                   /db_xref="GOA:B7GH34"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:B7GH34"
FT                   /protein_id="ACJ32990.1"
FT                   /translation="MQFARHRRLRQTANLRAMVRETHLHMEDFIYPIFVIEGENIKNEV
FT                   PSMPGVYQQSLDYALEDVKEAVQLGVRSIIVFGVPNEKNEIASQAYCEHGVVQRAIRAI
FT                   KDAFPELVVIADTCLCHYTSHGHCGIVENGTIVNDDTLELLAKTAVSQAKAGADIIAPS
FT                   NMMDGFVAAIRQALDEEGFTYVPIMSYAVKYASAFYGPFRDAAHSAPQFGDRKTYQMDP
FT                   ANRLEAFREAEADVEQGADFLMVKPALSYLDIIRDLKNHFHLPIVAYNVSGEYAMVKAA
FT                   AQNGWIDEKSVVLEMLTSMKRAGADLILTYFAKDVARWLKEGK"
FT   gene            657547..658863
FT                   /gene="hemL"
FT                   /locus_tag="Aflv_0610"
FT   CDS_pept        657547..658863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemL"
FT                   /locus_tag="Aflv_0610"
FT                   /product="Glutamate-1-semialdehyde aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32991"
FT                   /db_xref="GOA:B7GH35"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GH35"
FT                   /protein_id="ACJ32991.1"
FT                   /translation="MVKGGEMMRSYERSKAAYAEAVKLMPGGVNSPVRAFKAVKMDPIF
FT                   MARGKGSKIYDIDGNEYIDYVLSWGPLILGHANDQVVEALKRVAETGTSFGAPTLIENE
FT                   LAKLVMERMPSIEIIRMVSSGTEATMSALRLARGYTGRNKIVKFEGCYHGHGDSLLIKA
FT                   GSGVATLGLPDSPGVPETVAQHTITVPYNDLQSVRYAFEKFGEDIAAVIVEPVAGNMGV
FT                   VPPEPGFLQGLRDVTNEYGALLIFDEVMTGFRVDYYSGQGYYGVTPDLTCLGKVIGGGL
FT                   PVGAYGGRADIMEKIAPSGPIYQAGTLSGNPMAMTAGYETLRQLTPETYEAFKKKANRL
FT                   AEGLSEAAKAYHIPHTINQAGSMIGMFFTNERVTNYETAKTSNLDLFARYYQEMANEGI
FT                   FLPPSQFEGMFLSTAHTDEDIEKTIEAARRAFAKMSDCL"
FT   gene            658927..659835
FT                   /gene="spoVID"
FT                   /locus_tag="Aflv_0611"
FT   CDS_pept        658927..659835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVID"
FT                   /locus_tag="Aflv_0611"
FT                   /product="Stage VI sporulation protein D (LysM domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32992"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:B7GH36"
FT                   /protein_id="ACJ32992.1"
FT                   /translation="MDVEGEMSMLRFSIEEAIAFRREHHVDQLLSISLQPTITIEEQED
FT                   YVYIRGVLELSGEYTKGEEDGEDNQPFEAARYVEHVRITDEQIGEFLHQFPIDVTVPKE
FT                   RIDDLEQVYVMIESFDYDFKQQQLRLIAEVAIHGIQMDDREDDEWEPYNVDEFEPFETV
FT                   ARQEVYQQEETEEEQESIVNVPPFYMFHEENDQVEEQHEAERAEERKEEQQSFQLEMKG
FT                   RDTNEKRNENALYLTKLFGKNEEQAFARLKICIVQQGDSLDKIAERYDVSVQQLLRTNQ
FT                   LESGADIHEGQLLYIPTPTKV"
FT   gene            659845..660759
FT                   /locus_tag="Aflv_0612"
FT   CDS_pept        659845..660759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0612"
FT                   /product="Aminoglycoside phosphotransferase family enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32993"
FT                   /db_xref="GOA:B7GH37"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B7GH37"
FT                   /protein_id="ACJ32993.1"
FT                   /translation="MKMNTMQQRERVQKWKTPNGTYALKRIQSLAHWQAIEQAYRLRIP
FT                   LAIPIYETKKRNGQWYYTMPWLKEKTQPASSFFQDLARWHTHSVKDIQTTEAEIERYYE
FT                   ERKHSLEQVKKTITHYIETCEKQWYMSPFQLQCCTHFLDVMRAISFSEHTLNEWRERMR
FT                   EKKTVRICYIHGRPSFQHYVEREDGKSYFISFEQARWAPPFHDLLFFFRQYLRTYPITC
FT                   DEAVQWLAQYEQILKLEEDERLLFFHLLVDPHRFVRLIHRYEQQRHDRQLTAAWQRAYW
FT                   QMKNIEYVIGKWEEEKQTNQIQS"
FT   gene            complement(660744..660968)
FT                   /locus_tag="Aflv_0613"
FT   CDS_pept        complement(660744..660968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0613"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32994"
FT                   /db_xref="GOA:B7GH38"
FT                   /db_xref="UniProtKB/TrEMBL:B7GH38"
FT                   /protein_id="ACJ32994.1"
FT                   /translation="MELNIRKGSEHMRKRYNPYAWPPWLRKLRFIAEQCIIPITVVQAI
FT                   RTILFPTTIDVILLAIFILLSFALHHDWI"
FT   gene            661326..663953
FT                   /locus_tag="Aflv_0614"
FT   CDS_pept        661326..663953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0614"
FT                   /product="Valyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32995"
FT                   /db_xref="GOA:B7GH39"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR019499"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7GH39"
FT                   /protein_id="ACJ32995.1"
FT                   /translation="MMLPPKYDHRAVEANRYEWWLKGKFFEATSDETKKPFTIVIPPPN
FT                   VTGKLHLGHAWDTTLQDIITRMKRMQGYDVLWLPGMDHAGIATQAKVEEKLRNEGKTRY
FT                   DLGREKFVEETWKWKEEYAGHIRSQWAKLGLGLDYTRERFTLDEGLSKAVREVFVSLYK
FT                   KGLIYRGEYIINWDPVTKTALSDIEVVYKDVQGALYHMRYPLADGSGYIEVATTRPETM
FT                   LGDTAVAVHPEDERYKHLIGKTVILPIVGREIPIIGDEYVDMSFGSGAVKITPAHDPND
FT                   FEIGNRHHLPRILVMNEDGTMNDNALQYKGLDRFECRKQIVKDLQEQGVLFKIEEHMHS
FT                   VGHSERSGAVVEPYLSTQWFVKMKPLAEAAIEQQKTEGKVNFVPERFEKTYLHWMENIR
FT                   DWCISRQLWWGHRIPAWYHKETGEVYVDHEPPADIENWEQDQDVLDTWFSSALWPFSTM
FT                   GWPDKTSADYNRYYPTDVLVTGYDIIFFWVSRMIFQALEFTGKRPFKDVLIHGLVRDAQ
FT                   GRKMSKSLGNGVDPMDVIDQYGADSLRYFLATGSSPGQDLRFSTEKVEATWNFVNKIWN
FT                   ASRFALMNMEGFTYEDIDLHGEKSVADHWILTRLNETIETVTKLADKYEFGEVGRVLYN
FT                   FIWDDLCDWYIEMAKLPLYGDDEQAKKTTRSVLAYVLDQTMRLLHPFMPFVTEEIWQQL
FT                   PHEGESITVASWPQVRPELSNHEAAETMRLLVDIIRAVRNIRAEVNTPLSKPITLYIKA
FT                   KDEHVKATLETNRAYIERFCNPSELVIDTTIPTVEKAMTAVVTGAELSLPLEGLINIEE
FT                   EVKRLEKELQKLDQEVERVQKKLSNEGFLAKAPAHVVEEERKKERDYIEKREAVRARLA
FT                   QLKQ"
FT   gene            664017..665321
FT                   /gene="folC"
FT                   /locus_tag="Aflv_0615"
FT   CDS_pept        664017..665321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folC"
FT                   /locus_tag="Aflv_0615"
FT                   /product="Folylpolyglutamate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32996"
FT                   /db_xref="GOA:B7GH40"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B7GH40"
FT                   /protein_id="ACJ32996.1"
FT                   /translation="MVRTYREAVEWIHGRLKLGVKPGLKRMEWMMEKLDHPERRIKAIH
FT                   VGGTNGKGSTVCFLRHILQEAGYRVGTFTSPYVEQFNERISINGKPISDVDLIKLVQII
FT                   QPLAEELEQTELGGPTEFEVITAMALYYFGKMNVQDVVIFEVGLGGRLDSTNVIYPLLS
FT                   VITNVGYDHIHILGNTLEQIAFEKAGIIKAGIPVMTAIDQPEALQVVEQKATSVRAKVY
FT                   VLGRDFTIFAHEPTTNGERFSLQTPFTTYSDVTTTMLGAHQVKNASLALMVADYLRTYY
FT                   SFLIEREHMYNGIRKAAWLGRFEKMDERPLIIIDGAHNEEGMDSLVATMKDHYPNRRVH
FT                   VLFTALGDKPVTAMIHKLETIAETMTFTTFDFPRALSAEQLAEQATHPNVQQTNDWQQW
FT                   LKEKRKQVAKDDIILITGSLYFISNVRNFIKNKYK"
FT   gene            665380..668802
FT                   /locus_tag="Aflv_0616"
FT   CDS_pept        665380..668802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0616"
FT                   /product="Bacterial surface protein containing Ig-like
FT                   domains"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32997"
FT                   /db_xref="InterPro:IPR003343"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR032480"
FT                   /db_xref="UniProtKB/TrEMBL:B7GH41"
FT                   /protein_id="ACJ32997.1"
FT                   /translation="MKRAVSVFLTLLLLIPLFIPAAAVRANDNITYNVLEIVSHASQLS
FT                   SSPLKKELGSTSNISVTTMTMKRFVALRDELDGKYDAIVISQGDYNPAKLGMTTSKNRS
FT                   ASHNTTNSLNDLTDLKARQIKQFYIDKGLPVFLHENSVKNYSTSKLYSYSQSNDWKSKQ
FT                   NVMFFTTNTNIKNYFATNGTKRPHLVLTTFPSSTQTYKKGDTLSFAYQIVNDTQFQNKL
FT                   LTVNLYIDSDFNDKYTSEEIVASKQVQGATGTISYTLPAGYSGPRYWKIEIVDETSALK
FT                   DYEKGFVKFQDVPATIKVLQIRKGNDASSLLNTKNMNPSFLTRANEYSISIDVTTLTDF
FT                   QKSKIYEPNYSHEVINGKYDMIIFGFADCYNGCSPVTSLSSNVVQSVKNFIQSGQSVMF
FT                   THDVMFGANNVWVNEFGSIVGQIQPQTDLGNGAPNPSTSTKQVNSGLMTNYPFALGDNI
FT                   TIATTHNQYYTLDLEDENVITWYNIDGSPRDVYDSWNHYYTYSKGNVTYSGTGHVGTTS
FT                   AFPEEEQKLFVNTMYRAFFGSNHAPQLTVITPQENETIPSNQPIELSYKVEDLDLVDRT
FT                   FSTKVWVNDQEVYAQNDVPNGTTIIQSLPHNMPNGGTARMKIEATDARGAKVTKEFQVV
FT                   IEKVSANMEVNRTISKTLAPVDESITMQYTITPKPLSLLTNTLLKVTNIAFEEKLPAGV
FT                   EVVSLPSGFTKQGTVTEGYTIKGTLPDISFVKSGTTYIAEPQTFAIQVKPTTKGTFSLS
FT                   QAKLTYKDINTQLVNLSFNTLSFVSDYKITDVTLPSTIFVNRGVPKNARLLLNVLPQEA
FT                   TIASVEWSENSNGQIISIDKNGVITAVKEGTAQVTAKVKDMFGNVKTTTMTVIVRIPVD
FT                   SITINDFTVHVGETISIPITVSPADAKKAVSYSLGNSLYAEINGANGTITGLKEGVTTL
FT                   TVQAFNKNDELLEKTVTVTVQAIPVTAVVVSPTVANINIGETTTLTATVAPNNATYQAV
FT                   EWRSSNPNIASVDANGRVTGLSTGQVTITAQAHNGVVGTAIVHVGSPLTGISLPSTLIV
FT                   QKGKTINVLPYIAPIPANATTKIVSRSFTIENSYYAVVDGNGEVTAKRLGETPLTVKLT
FT                   DENGKTWTASTVIRVVEHATGPTKGGNKDGWLY"
FT   gene            668950..669669
FT                   /locus_tag="Aflv_0617"
FT   CDS_pept        668950..669669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0617"
FT                   /product="Ankyrin repeats containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32998"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:B7GH42"
FT                   /protein_id="ACJ32998.1"
FT                   /translation="MKKEKNINFKIKNETPLDVAMRTGQRDIAAQLLKAGGKSAVMPLP
FT                   PLHFALVSSLAQGNEENIEIVKQIVNEQTVREKDKQYNTPLHIAAGSGNVDLVQLVCQY
FT                   DVDINAVNKHGETPLLLAVQAGNVDVVRFLYERGANVEIANEAGETPLYKAVERNLIDV
FT                   ATYLLEKGADVNTKTNIKKTPLMVAAEYGYDEFVTLLLRYGADVHVKDDTGNTALSLAQ
FT                   YWKHENIIKQLKEKGAK"
FT   gene            complement(669684..671321)
FT                   /locus_tag="Aflv_0618"
FT   CDS_pept        complement(669684..671321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0618"
FT                   /product="Uncharacterized conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ32999"
FT                   /db_xref="GOA:B7GH43"
FT                   /db_xref="UniProtKB/TrEMBL:B7GH43"
FT                   /protein_id="ACJ32999.1"
FT                   /translation="MNEKGYSLVLVMLTVTVFFIIGLTILSVSIYQAKFTQVRVEDVTS
FT                   LHDAVKAVEETVAELKVKVEQLSLSTPMQLDLDLGNAQAGFLKELIDRHDVTIEDITDA
FT                   KGIARNQLFTRVFRISAPYGNKTVTREVIITNAPSFLKYAIGSRENVTLNGGSYIDGNI
FT                   YAGNDIYVTNVANYIYNSTLDSVQTTFPTTSGKSILFVEGNRYTCDHGNGAKSCYSIST
FT                   QFTKNRNDFSLGSLSFQHQEPSVQKEQDEFIDVDFDFTLKDKLLSAAGIDGFDQSKQAQ
FT                   YQSLISLSLSELIEQIKSSFVPVVVNDSIDLPTALEGAIASGKSIFLDTSTIPYFDVTS
FT                   LTLNDGQWLIVNGDFVLENAGENPLQIKGNIIVLGDLTITGQVAFDSTVYVDGDTSIYN
FT                   TTISGLNGKEVVLLTKGELEIARVNEFANNFSLTTPNLKGFFYTDSNAVIYAVGSYINI
FT                   EGGLFARGNSSTIPYTDESGLVINTYRGETNDTGTSLSFQTPISTEEEQKQYARFVVKH
FT                   NKDVFINRGLGLPLVKQLAVIVDEIRVQ"
FT   gene            complement(671334..671903)
FT                   /locus_tag="Aflv_0619"
FT   CDS_pept        complement(671334..671903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0619"
FT                   /product="Uncharacterized conserved secreted protein,
FT                   predicted component of Type II secretory pathway"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ33000"
FT                   /db_xref="GOA:B7GH44"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:B7GH44"
FT                   /protein_id="ACJ33000.1"
FT                   /translation="MKVFANERGLTLIELLVGLAITSIIAASAYGVFTAGTKAYKRIGI
FT                   ENQLRSEADILMTTMFNELYAFAPDGLKTDESNDDTLTFVNEIKKEIDTNTGLVEDREQ
FT                   AGQTLQITIDKTNEALLINGNQVTPSNLRIVSDQSKLTYTCVRAQQNVCKSGVISIRLS
FT                   VQDNDHRNPDDPLYIEPFTLQSQFGF"
FT   gene            complement(671887..672519)
FT                   /locus_tag="Aflv_0620"
FT   CDS_pept        complement(671887..672519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0620"
FT                   /product="Uncharacterized conserved protein, predicted
FT                   component of Type II secretory pathway"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ33001"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:B7GH45"
FT                   /protein_id="ACJ33001.1"
FT                   /translation="MYNKVMYFKRRGRKMCQKKMNIFYDKRAFTLIEVLLSIVILSFVV
FT                   SGMFMFFTNAMTYTAYNQSKTVAVNIARGVIHYMERLDFQTMKAYVDDHITEQTPFVHF
FT                   DASACSNTSLFPDENVCKAIFSPTINNVTYNEEDVQAWLIPYDQAIWSQIKTNPPNEFP
FT                   DRLKQTIQQEKEMTENVSDYLLRLYVTVRSNNELIVLKGVIANESIR"
FT   gene            672469..673752
FT                   /locus_tag="Aflv_0621"
FT   CDS_pept        672469..673752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0621"
FT                   /product="Uncharacterized conserved secreted protein,
FT                   predicted component of Type II secretory pathway"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ33002"
FT                   /db_xref="GOA:B7GH46"
FT                   /db_xref="UniProtKB/TrEMBL:B7GH46"
FT                   /protein_id="ACJ33002.1"
FT                   /translation="MTHFPSPSFKIHNFIIQYVRVKCCIMLNGGSDLPYLFFVIFFLIL
FT                   IPIYIRLPFGWTKKGIALLLTVACLLSVFGMIAIEQFPLWQAALFLFLLVVTSTYLLEQ
FT                   KLGHLFYARIYEHDFMIEDDEKGEQENELPSAIEEVIEQQDKEIQQEEIENVDEESFQV
FT                   EWPEEIEQQASIEPLRENDFDHMIEPIESVDDVIEPLRMVDIDDTSVNETIQDMTEEQW
FT                   LDLFSEEAIEIIHDENEMKEEKDSELFDIETIAVVEETSEHVSDELYNIEPIVEDDDIH
FT                   TGASADLVEEQESIQNVEEAIGQVSEEEQGTADDEFITVEENNEGVHMLPRPFMKNLLA
FT                   SLYAMRPLLSDEQYEQLIHKHLHPRLHEQDYYTFANVLMEHYIATKQYEKLYHIAKQLY
FT                   GQYDGYPMIQQQLAHMIHYAEQKMGWKK"
FT   gene            673740..674495
FT                   /locus_tag="Aflv_0622"
FT   CDS_pept        673740..674495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0622"
FT                   /product="PRC-barrel domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ33003"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:B7GH47"
FT                   /protein_id="ACJ33003.1"
FT                   /translation="MEKMKSSAQVIGLPVISIQNGVQLGQVKSLVVNPEKGTIDFLIVD
FT                   QENWEISMKAIPFRHVIGIGEFAVTVEEERAVLDLNVIPIANELVNKKITIKQAKVMTR
FT                   KGQLLGEATEFYMDEETGHITGIEVQIGNELRIVRADHVITYGKDLLIVHEDAQQTLVS
FT                   NVDTLVTLKGTQVEPLIEQIVPKTVDDELDELRQKQVDMLKGKRVLKDIVDVNGQVLIS
FT                   KDTILTKEHIVRAQEEGPDVVIELSMNVE"
FT   gene            674485..675753
FT                   /locus_tag="Aflv_0623"
FT   CDS_pept        674485..675753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0623"
FT                   /product="Uncharacterized conserved secreted, VanW family"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ33004"
FT                   /db_xref="InterPro:IPR007391"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="UniProtKB/TrEMBL:B7GH48"
FT                   /protein_id="ACJ33004.1"
FT                   /translation="MSSKEAYVMRQIVSLKLFFTLLLTVSYLLTTTKVATWAYESFISH
FT                   DTFAEGTMIGPVDLSHRSREEAYEQMNEKVNEWKQSATIKLVLEQKEATVQTDYFSFHI
FT                   EESMKQAVSGKRTPLLVSVDGQALQDAMSSIGASSDWIDVEKVKNQLEQAAASLTSAQL
FT                   SLQQYVREDMQQETVLSQATIPSHEELRAISQTAITIEPKQVFSVLDFFKKQGLGISKE
FT                   AMTLFASALYEAMMPTNFEIVERHTSAVLPNGVKAGFEAAVEQNKKDFIFFNPNDRAYT
FT                   FEWKMEGDRIQVTLIGPPFIYQYALKTDPIEYYDPKTIVQYSALLKPNEKRVKEEGKKG
FT                   MLIRLYKEVYDRNRTLVETVLISEDFYPPVHRVELRGLQAGANNGASETPISSDTPSAQ
FT                   PPQQDDIWGNENEQIKGNEDDAS"
FT   gene            675750..677411
FT                   /gene="pilB"
FT                   /locus_tag="Aflv_0624"
FT   CDS_pept        675750..677411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilB"
FT                   /locus_tag="Aflv_0624"
FT                   /product="Type II secretory pathway, ATPase PulE/Tfp pilus
FT                   assembly pathway, ATPase PilB"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ33005"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="InterPro:IPR042181"
FT                   /db_xref="UniProtKB/TrEMBL:B7GH49"
FT                   /protein_id="ACJ33005.1"
FT                   /translation="MKKQERKRLGDLLIEAGLITKEQLEETLKEKAPGQKLGDALLQRG
FT                   YITEQQLIEVLEFQLGIPHVSLYRYPIDPKLMNLVPKEFAKRNMLIPLKQEGDRLFVAM
FT                   ADPMDFFAIDDLRLSTGFHIEVAIASKDDILRAINKYYDIDDSVEEFLNIAPVQEVREQ
FT                   EKLAEDDSPIVKLVNQILQLAVEQRASDIHIDPHETKVVIRYRVDGILRTERALPKHMQ
FT                   GMLTARIKILANMDITEHRVPQDGRIKMNIDFHPIDLRVSTLPTIYGEKIVMRVLDLGA
FT                   ALNDLNKLGFNKVNLQRFIQLIEQPTGIVLITGPTGSGKSSTLYAALNRLNGEHVNIIT
FT                   IEDPVEYQLEGVNQIQVNSSVGMTFAEGLRSILRQDPNIIMVGEIRDRETAEVAIRASL
FT                   TGHLVLSTLHTNDALSTVARLIDMGVEPFLVATSLSGVVSQRLVRRVCRDCQEEHEPTK
FT                   REIDIFARRGLKIEKVMRGRGCPTCNMTGYKGRIALHELMVMSDDMRKVILNGEPLSKL
FT                   RDMAIKNKMIFLIDDGLLKVKQGLTTTEEVLRVSIL"
FT   gene            677413..678456
FT                   /gene="pilT"
FT                   /locus_tag="Aflv_0625"
FT   CDS_pept        677413..678456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilT"
FT                   /locus_tag="Aflv_0625"
FT                   /product="Tfp pilus assembly protein, pilus retraction
FT                   ATPase PilT"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ33006"
FT                   /db_xref="GOA:B7GH50"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B7GH50"
FT                   /protein_id="ACJ33006.1"
FT                   /translation="MMKMKQKVDAMLRAAFELKASDIHLTVGIPPIFRVNGDLKRYGQD
FT                   ALSSADTEQMAKAIVPENMWHHVEENGELDLSYSLHGVSRFRVNVFKQRGCISLAIRIV
FT                   PTKIPTLEELQLPDVLKKIVTKPQGLVLVTGPTGSGKSTTLAAMIDYMNKTMRKHIITL
FT                   EDPIEYVHKHGSCVIDQREVGTDTNNFANGLRAALRQDPDVILVGEMRDLETIQTAITA
FT                   AETGHLVFGTLHTSSAPATIDRIIDVFQPEQQTQIRIQLATVLVAIISQRLFPRAQKNG
FT                   RIAATEILINNAPVANLIRNGKVHQIPSVMQTSRALGMHTLAANIKELVQQGLVAKEAV
FT                   EPYLQEG"
FT   gene            678463..679674
FT                   /gene="pulF"
FT                   /locus_tag="Aflv_0626"
FT   CDS_pept        678463..679674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pulF"
FT                   /locus_tag="Aflv_0626"
FT                   /product="Type II secretory pathway component PulF"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ33007"
FT                   /db_xref="GOA:B7GH51"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:B7GH51"
FT                   /protein_id="ACJ33007.1"
FT                   /translation="MAQFRYEARDMRGRVKKGTMVASSRRDVMMKLREQRLKVIDVREV
FT                   PQTLLTKEITFGNPVKLQHFVIYLRQFATLLKAGVTIVDATRILAEQTESKALKKALVH
FT                   IEEQLRSGQPLSTAMTDHPNIFPPLVINMIRAGEASGNMDETLERLADHFEKVHRTRQK
FT                   IVSALAYPVVVGIIAVIVVIFLLVQVVPTFVSMFADFGADLPAITKFVLRASEVMQTYW
FT                   WGVILLMLLMYGLLVLLKKQKKTKYYLDVIVLRMPIFGSMMQKAVLARMTRTLSSLFSS
FT                   AVPILQALAIVESVVENEVVARVIRTSRDALERGESLTEPMKRHWAFPPLVTQMIAIGE
FT                   QTGSLDAMLAKVADFYEAEVEAATDRLKSLIEPLMIVLLAGVVGTIVTSILVPMFDIFN
FT                   HIQQ"
FT   gene            679750..680289
FT                   /gene="pulG"
FT                   /locus_tag="Aflv_0627"
FT   CDS_pept        679750..680289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pulG"
FT                   /locus_tag="Aflv_0627"
FT                   /product="Type II secretory pathway pseudopilin PulG"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ33008"
FT                   /db_xref="GOA:B7GH52"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:B7GH52"
FT                   /protein_id="ACJ33008.1"
FT                   /translation="MLKRFIRNEKGLTLIELLAVIVILGIIAAIAIPSIGGLIDNSKKD
FT                   AHVANAQQMINAAKIAVTADKSLIPANGKAKTISLKYLEDNGYLETVKDPDGGTYTKDS
FT                   NGGVSNDLDITGSPVKDGTLNEPDSDSYVVIINDNTKLYYRVKLVNGNRGVRTGGTGGA
FT                   AGKAVKEEDLKRSEVR"
FT   gene            680330..681079
FT                   /gene="pulO"
FT                   /locus_tag="Aflv_0628"
FT   CDS_pept        680330..681079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pulO"
FT                   /locus_tag="Aflv_0628"
FT                   /product="Type II secretory pathway, prepilin signal
FT                   peptidase PulO"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ33009"
FT                   /db_xref="GOA:B7GH53"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="InterPro:IPR010627"
FT                   /db_xref="UniProtKB/TrEMBL:B7GH53"
FT                   /protein_id="ACJ33009.1"
FT                   /translation="MLFFISFLLGLLLGSFYNVVGLRVPKGESIVAPRSHCPHCKRTLT
FT                   AFELIPVVSYVLQKGKCRACSARISFVYPFVELSTAILFALAPLFVGWSAEVAVSWTLI
FT                   SLFIIIFVSDVHYMIIPNRVLLFLAPLLLIERLSFAPLTPWWDSLLGSFVGFTMLFVIA
FT                   LLSKGGMGGGDIKLFAVIGLALGAKLTVLAFFLSTLVGTVFGLIGMALGRVRRGQPMPF
FT                   GPAIVVGTLIAYFFGETIIDAYVKVMM"
FT   gene            681092..682060
FT                   /locus_tag="Aflv_0629"
FT   CDS_pept        681092..682060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0629"
FT                   /product="Tfp pilus assembly protein, ATPase PilM"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ33010"
FT                   /db_xref="InterPro:IPR005883"
FT                   /db_xref="UniProtKB/TrEMBL:B7GH54"
FT                   /protein_id="ACJ33010.1"
FT                   /translation="MRLFTMKNKVGNIVIKDHVIRYVELKQKQPLVLHTCEEWPLPEGI
FT                   VRDGKIVDEEQLTHIMEQCVDMWKMKHRRIRFLVPDPLVVVRNIPLPKDIAHEDIRSYL
FT                   FMEIGASIPLPFEDAVFDYTVLEKTKEALHVLLFAAPETNVMQYVELFETVKLKPIVAD
FT                   ISPLSLYRLFYHFHLANDVDHFLFVQFDLSSLNVSVFYQHRPLFTRQLAFDAQWTHWEK
FT                   TKEGWKWENEGQPEWQLEDIYKELDRVMNFYRFSLQKGEAQITRVVVTGDHPLVHTFSD
FT                   RLKERLDVAVETLTLPLPIDRAYYLPIGLGLKEGNAHVSRN"
FT   gene            682038..682625
FT                   /locus_tag="Aflv_0630"
FT   CDS_pept        682038..682625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0630"
FT                   /product="Fimbrial assembly protein PilN"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ33011"
FT                   /db_xref="GOA:B7GH55"
FT                   /db_xref="UniProtKB/TrEMBL:B7GH55"
FT                   /protein_id="ACJ33011.1"
FT                   /translation="MHMLVEINLLPKRERKSQIIPMISIVVAVLLIVGATTFYFTVQRM
FT                   EQQIAQLKTELDQTKALRIAEEEKQKTATNASGGAQLQEAIQWAEQYPVHTVALLHELI
FT                   ERLPERGFLMNVSYARDGAIQLTAQFDTTSESAAYLQALKDAPFIADVKLTSLTAVEGK
FT                   AEEEGTMPRYIGQFSIQLNMEEWKKQQQGGEA"
FT   gene            682592..683248
FT                   /locus_tag="Aflv_0631"
FT   CDS_pept        682592..683248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0631"
FT                   /product="Pilus assembly protein PilO"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ33012"
FT                   /db_xref="GOA:B7GH56"
FT                   /db_xref="InterPro:IPR007445"
FT                   /db_xref="UniProtKB/TrEMBL:B7GH56"
FT                   /protein_id="ACJ33012.1"
FT                   /translation="MEKTATRRGSMRKTLIISLSLLLLTLLSFVLYMYIYKPLDDRREQ
FT                   MKTELQTEKKLLQTLQAKQTPDELRVSIVELQKRVPVQPFVEQFLLDIEKAEVVSNSEV
FT                   LSLTFQEGENVEGPPTPIQKLTVNLSVRSPSYFALEQFIDTLERSKRIVSVDSLSFTGY
FT                   EEWTTVMDEVPELSYSLTVSTFYAPELRQWIKQLPPLDLPQPSEKRNPFPSLTEQ"
FT   gene            683262..683702
FT                   /gene="pulE"
FT                   /locus_tag="Aflv_0632"
FT   CDS_pept        683262..683702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pulE"
FT                   /locus_tag="Aflv_0632"
FT                   /product="Pilus assembly protein PilE"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ33013"
FT                   /db_xref="GOA:B7GH57"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:B7GH57"
FT                   /protein_id="ACJ33013.1"
FT                   /translation="MKDERGMTLIELLAVIVILSILTMIATVSVVEIIKKSRDQAFVAT
FT                   AYSLYEAALLHVGAQKVEFLTPNKSEKLTYEQLVDDGVLEAIIDPYTSKRLPPNDDSYV
FT                   IVTKQSDGTITYAVCLKGETKQICKENGVPVDQLSVNDIQDK"
FT   gene            683835..684590
FT                   /gene="spoIIB"
FT                   /locus_tag="Aflv_0633"
FT   CDS_pept        683835..684590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoIIB"
FT                   /locus_tag="Aflv_0633"
FT                   /product="Stage II sporulation protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ33014"
FT                   /db_xref="GOA:B7GH58"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:B7GH58"
FT                   /protein_id="ACJ33014.1"
FT                   /translation="MIKVNGKEQPYTTVTNTLPQWSSEEHDKQDETQDEFTPFETGKRY
FT                   TKRFPWRSFMLAVVLAVVLGTSFGFLVLTIIPTTENKPASTATLEQEQKEETSIAKRTE
FT                   TVFVIQGGVFQDEKAANVYVQKIKAQQRPSVMIGKQPVYVFLGMALTKEEAKQIASLYE
FT                   SLGIDTYVKAWNVSIDEKESEPFVMVLSVISRLLHGQQLQNEQWQQLQSYSPHNEQMKK
FT                   AYEALFAFRQSNDEKQLWEAQQHMLHVLH"
FT   gene            684693..685271
FT                   /gene="maf"
FT                   /locus_tag="Aflv_0634"
FT   CDS_pept        684693..685271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maf"
FT                   /locus_tag="Aflv_0634"
FT                   /product="Nucleotide-binding protein implicated in
FT                   inhibition of septum formation"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ33015"
FT                   /db_xref="GOA:B7GH59"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:B7GH59"
FT                   /protein_id="ACJ33015.1"
FT                   /translation="MMAMQLVLASSSPRRKQLLHMLGLPFDILVSDVDESFDAKLSPSE
FT                   IVQQLAHKKAHAVWQQKKDACVIGADTIVVCEGEVLGKPVSEQDAFRMLKRLSGTTHEV
FT                   WTGVAICTANECVTFAEKTDVTFWSLSDDDIWAYIATKEPLDKAGAYGIQQRGALFVQK
FT                   IDGDYFSVVGLPIAKLARELKKFGFYPFR"
FT   gene            685300..685695
FT                   /pseudo
FT                   /locus_tag="Aflv_0635"
FT   misc_feature    685300..685695
FT                   /pseudo
FT                   /locus_tag="Aflv_0635"
FT                   /note="DNA repair RadC protein N-terminus"
FT   gene            complement(685706..687112)
FT                   /gene="spoIVCA"
FT                   /locus_tag="Aflv_0636"
FT   CDS_pept        complement(685706..687112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoIVCA"
FT                   /locus_tag="Aflv_0636"
FT                   /product="Site-specific recombinase spoIVCA"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ33016"
FT                   /db_xref="GOA:B7GH60"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:B7GH60"
FT                   /protein_id="ACJ33016.1"
FT                   /translation="MAVALYIRVSTEEQAREGYSISAQREKLIAYCKVHDWYDYRFYID
FT                   EGVSAKNLDRPQLKEMIKHIKEGAIDTVLVYRLDRLVRSVTDLYKLLEIFEQHGCKFKS
FT                   ATEVYDTSTAIGRLFITLVAAMAQWERENLGERVRMGQIEKARQGFYSAKAPFGFDKTP
FT                   DDKLIINENEKKIVLDIIKKIFDGYSIRQISDYMNNSGIPPIRGYKWHIATIMDIVKNP
FT                   ALYGAIKWRDEIIENTHEGIITKEEFEKIQNILHGRKNFKKRNTSSIFIFQGKLICPNC
FT                   KNRLASERSVYFRKKDKAYTETNHYRCQSCALNKRKAINVSEKRVEKGLIEYFSNMRFH
FT                   VVPTVVEDEKEKELEALEERLRQIERQREKYQKAWAADLISDEEFTERMRETKRAMAEI
FT                   QEVLKNVEIDETKNKKHDIESIKAIATNFLLNWNTLTALEKREFMNNFVDGIEFDKQGI
FT                   NVKIKEVSFY"
FT   gene            complement(687170..687757)
FT                   /gene="lexA"
FT                   /locus_tag="Aflv_0637"
FT   CDS_pept        complement(687170..687757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lexA"
FT                   /locus_tag="Aflv_0637"
FT                   /product="SOS-response transcriptional repressor LexA (HTH,
FT                   RecA-mediated autopeptidase)"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ33017"
FT                   /db_xref="GOA:B7GH61"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:B7GH61"
FT                   /protein_id="ACJ33017.1"
FT                   /translation="MTQADLAKKLNVAPTAVSAWERNENRPLMDKIAIMSEMFDVPISY
FT                   FFEDFKTIQEVREEPAQYICTEFSRLPIIGSISCGDGVIAYEEIKGYEEVPSSWLNGGE
FT                   YFFLEARGDSMINAHITDGALLLIRRQNDVDNGEIAAVLIDGEAVLKRVYKTEDTIILQ
FT                   SENPMYKPIILKRNDMKDVRIIGKLKKVILNF"
FT   gene            complement(687735..687899)
FT                   /locus_tag="Aflv_0638"
FT   CDS_pept        complement(687735..687899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0638"
FT                   /product="Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ33018"
FT                   /db_xref="UniProtKB/TrEMBL:B7GH62"
FT                   /protein_id="ACJ33018.1"
FT                   /translation="MIFFIVFFTLNKAILYKITVLLYNIVRKEVIENAIRKQNKGVTEE
FT                   KSHDTSGLG"
FT   gene            687974..688189
FT                   /locus_tag="Aflv_0639"
FT   CDS_pept        687974..688189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0639"
FT                   /product="Predicted transcriptional regulator, xre family"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ33019"
FT                   /db_xref="GOA:B7GH63"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B7GH63"
FT                   /protein_id="ACJ33019.1"
FT                   /translation="MKYTIAQARALASLSQKEMAKRLGVCEKTYIDYEKYRKIFRMDMA
FT                   YKFSKITGIEMDQIIFFDKDVQKICS"
FT   gene            688339..688515
FT                   /locus_tag="Aflv_0640"
FT   CDS_pept        688339..688515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0640"
FT                   /product="Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ33020"
FT                   /db_xref="UniProtKB/TrEMBL:B7GH64"
FT                   /protein_id="ACJ33020.1"
FT                   /translation="MTLPSAYDFAKLEEAIAFYTRTVVEVMKARNRDMHNELMRFKKEL
FT                   HERIAKEEAEFAL"
FT   gene            688484..688963
FT                   /locus_tag="Aflv_0641"
FT   CDS_pept        688484..688963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0641"
FT                   /product="Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ33021"
FT                   /db_xref="UniProtKB/TrEMBL:B7GH65"
FT                   /protein_id="ACJ33021.1"
FT                   /translation="MQRKKLNSPSRASFRKENWTSRGGRRVDRQKLGYRNLLVLGRNIK
FT                   HGARYTPEEIIAFVSKIEEQLMWTPTKDFFRLFPPIKRYEDDGSWSYHDTLKMINREFG
FT                   ERFGKNDFLKLLMTHCYENKFVQMVGIKFMLATSEIYRKKTGLSLAQQAIRVLEE"
FT   gene            688969..689172
FT                   /locus_tag="Aflv_0642"
FT   CDS_pept        688969..689172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0642"
FT                   /product="Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ33022"
FT                   /db_xref="UniProtKB/TrEMBL:B7GH66"
FT                   /protein_id="ACJ33022.1"
FT                   /translation="MEMDAVNEIKKFVTSLRSLVGDLCSLVDSKQTNKSEYTEGVTDGH
FT                   KIAMVILDILEKKIDSVGGKTK"
FT   gene            689169..689933
FT                   /locus_tag="Aflv_0643"
FT   CDS_pept        689169..689933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0643"
FT                   /product="Phage related anti-repressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ33023"
FT                   /db_xref="InterPro:IPR018873"
FT                   /db_xref="UniProtKB/TrEMBL:B7GH67"
FT                   /protein_id="ACJ33023.1"
FT                   /translation="MNLTVIEQNGQRVLTTQQLAEAYGTDTERIRINFNRNKDRFVEGK
FT                   HFFALTGQEKHEFINSYQIDTTWLKAPVFYIWTEKGAWLHAKSLNTDEAWEAYERLVDE
FT                   YYTIKENALNIQMLSPQLQALISIELRQKQLEQELAAVRKEADEAKKQIAATSNEVTDL
FT                   KRGMVDVNMPLRKQFNDAVRALSKKEQIGFDEAYSRVYELLGAQHHVDIKRRVENRKAK
FT                   GDKNVKPLDIVEELNLLVPAIRLAKALAGVTQ"
FT   gene            690166..690429
FT                   /locus_tag="Aflv_0644"
FT   CDS_pept        690166..690429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aflv_0644"
FT                   /product="Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aflv_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ACJ33024"
FT                   /db_xref="UniProtKB/TrEMBL:B7GH68"
FT                   /protein_id="ACJ33024.1"
FT