(data stored in ACNUC7421 zone)

EMBL: CP000926

ID   CP000926; SV 1; circular; genomic DNA; STD; PRO; 6078430 BP.
XX
AC   CP000926; AAXR01000000-AAXR01000030;
XX
PR   Project:PRJNA17629;
XX
DT   07-FEB-2008 (Rel. 94, Created)
DT   11-SEP-2019 (Rel. 142, Last updated, Version 7)
XX
DE   Pseudomonas putida GB-1 chromosome, complete genome.
XX
KW   .
XX
OS   Pseudomonas putida GB-1
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales;
OC   Pseudomonadaceae; Pseudomonas.
XX
RN   [1]
RP   1-6078430
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Glavina del Rio T., Dalin E.,
RA   Tice H., Pitluck S., Bruce D., Goodwin L., Chertkov O., Brettin T.,
RA   Detter J.C., Han C., Kuske C.R., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Kim E., McCarthy J.K., Richardson P.;
RT   "Complete sequence of Pseudomonas putida GB-1";
RL   Unpublished.
XX
RN   [2]
RP   1-6078430
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Glavina del Rio T., Dalin E.,
RA   Tice H., Pitluck S., Bruce D., Goodwin L., Chertkov O., Brettin T.,
RA   Detter J.C., Han C., Kuske C.R., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Kim E., McCarthy J.K., Richardson P.;
RT   ;
RL   Submitted (24-JAN-2008) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 554a4c229cc4cc4bebcbf67b6d3da7a5.
DR   BioSample; SAMN00623059.
DR   EnsemblGenomes-Gn; EBG00001436409.
DR   EnsemblGenomes-Gn; EBG00001436410.
DR   EnsemblGenomes-Gn; EBG00001436411.
DR   EnsemblGenomes-Gn; EBG00001436412.
DR   EnsemblGenomes-Gn; EBG00001436413.
DR   EnsemblGenomes-Gn; EBG00001436414.
DR   EnsemblGenomes-Gn; EBG00001436415.
DR   EnsemblGenomes-Gn; EBG00001436416.
DR   EnsemblGenomes-Gn; EBG00001436417.
DR   EnsemblGenomes-Gn; EBG00001436418.
DR   EnsemblGenomes-Gn; EBG00001436419.
DR   EnsemblGenomes-Gn; EBG00001436420.
DR   EnsemblGenomes-Gn; EBG00001436421.
DR   EnsemblGenomes-Gn; EBG00001436422.
DR   EnsemblGenomes-Gn; EBG00001436423.
DR   EnsemblGenomes-Gn; EBG00001436424.
DR   EnsemblGenomes-Gn; EBG00001436425.
DR   EnsemblGenomes-Gn; EBG00001436426.
DR   EnsemblGenomes-Gn; EBG00001436427.
DR   EnsemblGenomes-Gn; EBG00001436428.
DR   EnsemblGenomes-Gn; EBG00001436429.
DR   EnsemblGenomes-Gn; EBG00001436430.
DR   EnsemblGenomes-Gn; EBG00001436431.
DR   EnsemblGenomes-Gn; EBG00001436432.
DR   EnsemblGenomes-Gn; EBG00001436433.
DR   EnsemblGenomes-Gn; EBG00001436434.
DR   EnsemblGenomes-Gn; EBG00001436435.
DR   EnsemblGenomes-Gn; EBG00001436436.
DR   EnsemblGenomes-Gn; EBG00001436437.
DR   EnsemblGenomes-Gn; EBG00001436438.
DR   EnsemblGenomes-Gn; EBG00001436439.
DR   EnsemblGenomes-Gn; EBG00001436440.
DR   EnsemblGenomes-Gn; EBG00001436441.
DR   EnsemblGenomes-Gn; EBG00001436442.
DR   EnsemblGenomes-Gn; EBG00001436443.
DR   EnsemblGenomes-Gn; EBG00001436444.
DR   EnsemblGenomes-Gn; EBG00001436445.
DR   EnsemblGenomes-Gn; EBG00001436446.
DR   EnsemblGenomes-Gn; EBG00001436447.
DR   EnsemblGenomes-Gn; EBG00001436448.
DR   EnsemblGenomes-Gn; EBG00001436449.
DR   EnsemblGenomes-Gn; EBG00001436450.
DR   EnsemblGenomes-Gn; EBG00001436451.
DR   EnsemblGenomes-Gn; EBG00001436452.
DR   EnsemblGenomes-Gn; EBG00001436453.
DR   EnsemblGenomes-Gn; EBG00001436454.
DR   EnsemblGenomes-Gn; EBG00001436455.
DR   EnsemblGenomes-Gn; EBG00001436456.
DR   EnsemblGenomes-Gn; EBG00001436457.
DR   EnsemblGenomes-Gn; EBG00001436458.
DR   EnsemblGenomes-Gn; EBG00001436459.
DR   EnsemblGenomes-Gn; EBG00001436460.
DR   EnsemblGenomes-Gn; EBG00001436461.
DR   EnsemblGenomes-Gn; EBG00001436462.
DR   EnsemblGenomes-Gn; EBG00001436463.
DR   EnsemblGenomes-Gn; EBG00001436464.
DR   EnsemblGenomes-Gn; EBG00001436465.
DR   EnsemblGenomes-Gn; EBG00001436466.
DR   EnsemblGenomes-Gn; EBG00001436467.
DR   EnsemblGenomes-Gn; EBG00001436468.
DR   EnsemblGenomes-Gn; EBG00001436469.
DR   EnsemblGenomes-Gn; EBG00001436470.
DR   EnsemblGenomes-Gn; EBG00001436471.
DR   EnsemblGenomes-Gn; EBG00001436472.
DR   EnsemblGenomes-Gn; EBG00001436473.
DR   EnsemblGenomes-Gn; EBG00001436474.
DR   EnsemblGenomes-Gn; EBG00001436475.
DR   EnsemblGenomes-Gn; EBG00001436476.
DR   EnsemblGenomes-Gn; EBG00001436477.
DR   EnsemblGenomes-Gn; EBG00001436478.
DR   EnsemblGenomes-Gn; EBG00001436479.
DR   EnsemblGenomes-Gn; EBG00001436480.
DR   EnsemblGenomes-Gn; EBG00001436481.
DR   EnsemblGenomes-Gn; EBG00001436482.
DR   EnsemblGenomes-Gn; EBG00001436483.
DR   EnsemblGenomes-Gn; EBG00001436484.
DR   EnsemblGenomes-Gn; EBG00001436485.
DR   EnsemblGenomes-Gn; EBG00001436486.
DR   EnsemblGenomes-Gn; EBG00001436487.
DR   EnsemblGenomes-Gn; EBG00001436488.
DR   EnsemblGenomes-Gn; EBG00001436489.
DR   EnsemblGenomes-Gn; EBG00001436490.
DR   EnsemblGenomes-Gn; EBG00001436491.
DR   EnsemblGenomes-Gn; EBG00001436492.
DR   EnsemblGenomes-Gn; EBG00001436493.
DR   EnsemblGenomes-Gn; EBG00001436494.
DR   EnsemblGenomes-Gn; EBG00001436495.
DR   EnsemblGenomes-Gn; EBG00001436496.
DR   EnsemblGenomes-Gn; EBG00001436497.
DR   EnsemblGenomes-Gn; EBG00001436498.
DR   EnsemblGenomes-Gn; EBG00001436499.
DR   EnsemblGenomes-Gn; EBG00001436500.
DR   EnsemblGenomes-Gn; EBG00001436501.
DR   EnsemblGenomes-Gn; EBG00001436502.
DR   EnsemblGenomes-Gn; EBG00001436503.
DR   EnsemblGenomes-Gn; EBG00001436504.
DR   EnsemblGenomes-Gn; EBG00001436505.
DR   EnsemblGenomes-Gn; EBG00001436506.
DR   EnsemblGenomes-Gn; EBG00001436507.
DR   EnsemblGenomes-Gn; EBG00001436508.
DR   EnsemblGenomes-Gn; EBG00001436509.
DR   EnsemblGenomes-Gn; EBG00001436510.
DR   EnsemblGenomes-Gn; EBG00001436511.
DR   EnsemblGenomes-Gn; EBG00001436512.
DR   EnsemblGenomes-Gn; EBG00001436513.
DR   EnsemblGenomes-Gn; EBG00001436514.
DR   EnsemblGenomes-Gn; EBG00001436515.
DR   EnsemblGenomes-Gn; EBG00001436516.
DR   EnsemblGenomes-Gn; EBG00001436517.
DR   EnsemblGenomes-Gn; EBG00001436518.
DR   EnsemblGenomes-Gn; EBG00001436519.
DR   EnsemblGenomes-Gn; EBG00001436520.
DR   EnsemblGenomes-Gn; EBG00001436521.
DR   EnsemblGenomes-Gn; EBG00001436522.
DR   EnsemblGenomes-Gn; EBG00001436523.
DR   EnsemblGenomes-Gn; EBG00001436524.
DR   EnsemblGenomes-Gn; EBG00001436525.
DR   EnsemblGenomes-Gn; EBG00001436526.
DR   EnsemblGenomes-Gn; EBG00001436527.
DR   EnsemblGenomes-Gn; EBG00001436528.
DR   EnsemblGenomes-Gn; EBG00001436529.
DR   EnsemblGenomes-Gn; EBG00001436530.
DR   EnsemblGenomes-Gn; EBG00001436531.
DR   EnsemblGenomes-Gn; EBG00001436532.
DR   EnsemblGenomes-Gn; EBG00001436533.
DR   EnsemblGenomes-Gn; EBG00001436534.
DR   EnsemblGenomes-Gn; EBG00001436535.
DR   EnsemblGenomes-Gn; EBG00001436536.
DR   EnsemblGenomes-Gn; EBG00001436537.
DR   EnsemblGenomes-Gn; EBG00001436538.
DR   EnsemblGenomes-Gn; EBG00001436539.
DR   EnsemblGenomes-Gn; EBG00001436540.
DR   EnsemblGenomes-Gn; EBG00001436541.
DR   EnsemblGenomes-Gn; EBG00001436542.
DR   EnsemblGenomes-Gn; EBG00001436543.
DR   EnsemblGenomes-Gn; EBG00001436544.
DR   EnsemblGenomes-Gn; EBG00001436545.
DR   EnsemblGenomes-Gn; EBG00001436546.
DR   EnsemblGenomes-Gn; EBG00001436547.
DR   EnsemblGenomes-Gn; EBG00001436548.
DR   EnsemblGenomes-Gn; EBG00001436549.
DR   EnsemblGenomes-Gn; EBG00001436550.
DR   EnsemblGenomes-Gn; PputGB1_R0001.
DR   EnsemblGenomes-Gn; PputGB1_R0002.
DR   EnsemblGenomes-Gn; PputGB1_R0003.
DR   EnsemblGenomes-Gn; PputGB1_R0004.
DR   EnsemblGenomes-Gn; PputGB1_R0005.
DR   EnsemblGenomes-Gn; PputGB1_R0006.
DR   EnsemblGenomes-Gn; PputGB1_R0007.
DR   EnsemblGenomes-Gn; PputGB1_R0008.
DR   EnsemblGenomes-Gn; PputGB1_R0009.
DR   EnsemblGenomes-Gn; PputGB1_R0010.
DR   EnsemblGenomes-Gn; PputGB1_R0011.
DR   EnsemblGenomes-Gn; PputGB1_R0012.
DR   EnsemblGenomes-Gn; PputGB1_R0013.
DR   EnsemblGenomes-Gn; PputGB1_R0014.
DR   EnsemblGenomes-Gn; PputGB1_R0015.
DR   EnsemblGenomes-Gn; PputGB1_R0016.
DR   EnsemblGenomes-Gn; PputGB1_R0017.
DR   EnsemblGenomes-Gn; PputGB1_R0018.
DR   EnsemblGenomes-Gn; PputGB1_R0019.
DR   EnsemblGenomes-Gn; PputGB1_R0020.
DR   EnsemblGenomes-Gn; PputGB1_R0021.
DR   EnsemblGenomes-Gn; PputGB1_R0022.
DR   EnsemblGenomes-Gn; PputGB1_R0023.
DR   EnsemblGenomes-Gn; PputGB1_R0024.
DR   EnsemblGenomes-Gn; PputGB1_R0025.
DR   EnsemblGenomes-Gn; PputGB1_R0026.
DR   EnsemblGenomes-Gn; PputGB1_R0027.
DR   EnsemblGenomes-Gn; PputGB1_R0028.
DR   EnsemblGenomes-Gn; PputGB1_R0029.
DR   EnsemblGenomes-Gn; PputGB1_R0030.
DR   EnsemblGenomes-Gn; PputGB1_R0031.
DR   EnsemblGenomes-Gn; PputGB1_R0032.
DR   EnsemblGenomes-Gn; PputGB1_R0033.
DR   EnsemblGenomes-Gn; PputGB1_R0034.
DR   EnsemblGenomes-Gn; PputGB1_R0036.
DR   EnsemblGenomes-Gn; PputGB1_R0037.
DR   EnsemblGenomes-Gn; PputGB1_R0038.
DR   EnsemblGenomes-Gn; PputGB1_R0039.
DR   EnsemblGenomes-Gn; PputGB1_R0040.
DR   EnsemblGenomes-Gn; PputGB1_R0041.
DR   EnsemblGenomes-Gn; PputGB1_R0042.
DR   EnsemblGenomes-Gn; PputGB1_R0043.
DR   EnsemblGenomes-Gn; PputGB1_R0044.
DR   EnsemblGenomes-Gn; PputGB1_R0045.
DR   EnsemblGenomes-Gn; PputGB1_R0046.
DR   EnsemblGenomes-Gn; PputGB1_R0047.
DR   EnsemblGenomes-Gn; PputGB1_R0048.
DR   EnsemblGenomes-Gn; PputGB1_R0049.
DR   EnsemblGenomes-Gn; PputGB1_R0050.
DR   EnsemblGenomes-Gn; PputGB1_R0051.
DR   EnsemblGenomes-Gn; PputGB1_R0052.
DR   EnsemblGenomes-Gn; PputGB1_R0053.
DR   EnsemblGenomes-Gn; PputGB1_R0054.
DR   EnsemblGenomes-Gn; PputGB1_R0055.
DR   EnsemblGenomes-Gn; PputGB1_R0056.
DR   EnsemblGenomes-Gn; PputGB1_R0057.
DR   EnsemblGenomes-Gn; PputGB1_R0058.
DR   EnsemblGenomes-Gn; PputGB1_R0059.
DR   EnsemblGenomes-Gn; PputGB1_R0060.
DR   EnsemblGenomes-Gn; PputGB1_R0061.
DR   EnsemblGenomes-Gn; PputGB1_R0062.
DR   EnsemblGenomes-Gn; PputGB1_R0063.
DR   EnsemblGenomes-Gn; PputGB1_R0064.
DR   EnsemblGenomes-Gn; PputGB1_R0065.
DR   EnsemblGenomes-Gn; PputGB1_R0066.
DR   EnsemblGenomes-Gn; PputGB1_R0067.
DR   EnsemblGenomes-Gn; PputGB1_R0068.
DR   EnsemblGenomes-Gn; PputGB1_R0069.
DR   EnsemblGenomes-Gn; PputGB1_R0070.
DR   EnsemblGenomes-Gn; PputGB1_R0071.
DR   EnsemblGenomes-Gn; PputGB1_R0072.
DR   EnsemblGenomes-Gn; PputGB1_R0073.
DR   EnsemblGenomes-Gn; PputGB1_R0074.
DR   EnsemblGenomes-Gn; PputGB1_R0075.
DR   EnsemblGenomes-Gn; PputGB1_R0076.
DR   EnsemblGenomes-Gn; PputGB1_R0077.
DR   EnsemblGenomes-Gn; PputGB1_R0078.
DR   EnsemblGenomes-Gn; PputGB1_R0079.
DR   EnsemblGenomes-Gn; PputGB1_R0080.
DR   EnsemblGenomes-Gn; PputGB1_R0081.
DR   EnsemblGenomes-Gn; PputGB1_R0082.
DR   EnsemblGenomes-Gn; PputGB1_R0083.
DR   EnsemblGenomes-Gn; PputGB1_R0084.
DR   EnsemblGenomes-Gn; PputGB1_R0085.
DR   EnsemblGenomes-Gn; PputGB1_R0086.
DR   EnsemblGenomes-Gn; PputGB1_R0087.
DR   EnsemblGenomes-Gn; PputGB1_R0088.
DR   EnsemblGenomes-Gn; PputGB1_R0089.
DR   EnsemblGenomes-Gn; PputGB1_R0090.
DR   EnsemblGenomes-Gn; PputGB1_R0091.
DR   EnsemblGenomes-Gn; PputGB1_R0092.
DR   EnsemblGenomes-Gn; PputGB1_R0093.
DR   EnsemblGenomes-Gn; PputGB1_R0094.
DR   EnsemblGenomes-Gn; PputGB1_R0095.
DR   EnsemblGenomes-Gn; PputGB1_R0096.
DR   EnsemblGenomes-Gn; PputGB1_R0097.
DR   EnsemblGenomes-Gn; PputGB1_R0098.
DR   EnsemblGenomes-Gn; PputGB1_R0099.
DR   EnsemblGenomes-Gn; PputGB1_R0100.
DR   EnsemblGenomes-Tr; EBT00001814273.
DR   EnsemblGenomes-Tr; EBT00001814275.
DR   EnsemblGenomes-Tr; EBT00001814278.
DR   EnsemblGenomes-Tr; EBT00001814279.
DR   EnsemblGenomes-Tr; EBT00001814280.
DR   EnsemblGenomes-Tr; EBT00001814281.
DR   EnsemblGenomes-Tr; EBT00001814282.
DR   EnsemblGenomes-Tr; EBT00001814283.
DR   EnsemblGenomes-Tr; EBT00001814286.
DR   EnsemblGenomes-Tr; EBT00001814287.
DR   EnsemblGenomes-Tr; EBT00001814290.
DR   EnsemblGenomes-Tr; EBT00001814292.
DR   EnsemblGenomes-Tr; EBT00001814294.
DR   EnsemblGenomes-Tr; EBT00001814296.
DR   EnsemblGenomes-Tr; EBT00001814299.
DR   EnsemblGenomes-Tr; EBT00001814302.
DR   EnsemblGenomes-Tr; EBT00001814304.
DR   EnsemblGenomes-Tr; EBT00001814306.
DR   EnsemblGenomes-Tr; EBT00001814308.
DR   EnsemblGenomes-Tr; EBT00001814311.
DR   EnsemblGenomes-Tr; EBT00001814313.
DR   EnsemblGenomes-Tr; EBT00001814315.
DR   EnsemblGenomes-Tr; EBT00001814318.
DR   EnsemblGenomes-Tr; EBT00001814319.
DR   EnsemblGenomes-Tr; EBT00001814321.
DR   EnsemblGenomes-Tr; EBT00001814322.
DR   EnsemblGenomes-Tr; EBT00001814325.
DR   EnsemblGenomes-Tr; EBT00001814328.
DR   EnsemblGenomes-Tr; EBT00001814330.
DR   EnsemblGenomes-Tr; EBT00001814331.
DR   EnsemblGenomes-Tr; EBT00001814333.
DR   EnsemblGenomes-Tr; EBT00001814335.
DR   EnsemblGenomes-Tr; EBT00001814337.
DR   EnsemblGenomes-Tr; EBT00001814339.
DR   EnsemblGenomes-Tr; EBT00001814341.
DR   EnsemblGenomes-Tr; EBT00001814343.
DR   EnsemblGenomes-Tr; EBT00001814344.
DR   EnsemblGenomes-Tr; EBT00001814347.
DR   EnsemblGenomes-Tr; EBT00001814349.
DR   EnsemblGenomes-Tr; EBT00001814350.
DR   EnsemblGenomes-Tr; EBT00001814353.
DR   EnsemblGenomes-Tr; EBT00001814355.
DR   EnsemblGenomes-Tr; EBT00001814357.
DR   EnsemblGenomes-Tr; EBT00001814359.
DR   EnsemblGenomes-Tr; EBT00001814361.
DR   EnsemblGenomes-Tr; EBT00001814363.
DR   EnsemblGenomes-Tr; EBT00001814365.
DR   EnsemblGenomes-Tr; EBT00001814367.
DR   EnsemblGenomes-Tr; EBT00001814369.
DR   EnsemblGenomes-Tr; EBT00001814371.
DR   EnsemblGenomes-Tr; EBT00001814373.
DR   EnsemblGenomes-Tr; EBT00001814375.
DR   EnsemblGenomes-Tr; EBT00001814377.
DR   EnsemblGenomes-Tr; EBT00001814378.
DR   EnsemblGenomes-Tr; EBT00001814381.
DR   EnsemblGenomes-Tr; EBT00001814383.
DR   EnsemblGenomes-Tr; EBT00001814386.
DR   EnsemblGenomes-Tr; EBT00001814388.
DR   EnsemblGenomes-Tr; EBT00001814390.
DR   EnsemblGenomes-Tr; EBT00001814392.
DR   EnsemblGenomes-Tr; EBT00001814394.
DR   EnsemblGenomes-Tr; EBT00001814396.
DR   EnsemblGenomes-Tr; EBT00001814399.
DR   EnsemblGenomes-Tr; EBT00001814401.
DR   EnsemblGenomes-Tr; EBT00001814402.
DR   EnsemblGenomes-Tr; EBT00001814404.
DR   EnsemblGenomes-Tr; EBT00001814405.
DR   EnsemblGenomes-Tr; EBT00001814406.
DR   EnsemblGenomes-Tr; EBT00001814407.
DR   EnsemblGenomes-Tr; EBT00001814408.
DR   EnsemblGenomes-Tr; EBT00001814409.
DR   EnsemblGenomes-Tr; EBT00001814410.
DR   EnsemblGenomes-Tr; EBT00001814411.
DR   EnsemblGenomes-Tr; EBT00001814412.
DR   EnsemblGenomes-Tr; EBT00001814413.
DR   EnsemblGenomes-Tr; EBT00001814414.
DR   EnsemblGenomes-Tr; EBT00001814415.
DR   EnsemblGenomes-Tr; EBT00001814416.
DR   EnsemblGenomes-Tr; EBT00001814417.
DR   EnsemblGenomes-Tr; EBT00001814418.
DR   EnsemblGenomes-Tr; EBT00001814419.
DR   EnsemblGenomes-Tr; EBT00001814420.
DR   EnsemblGenomes-Tr; EBT00001814421.
DR   EnsemblGenomes-Tr; EBT00001814422.
DR   EnsemblGenomes-Tr; EBT00001814423.
DR   EnsemblGenomes-Tr; EBT00001814424.
DR   EnsemblGenomes-Tr; EBT00001814425.
DR   EnsemblGenomes-Tr; EBT00001814426.
DR   EnsemblGenomes-Tr; EBT00001814427.
DR   EnsemblGenomes-Tr; EBT00001814428.
DR   EnsemblGenomes-Tr; EBT00001814429.
DR   EnsemblGenomes-Tr; EBT00001814430.
DR   EnsemblGenomes-Tr; EBT00001814431.
DR   EnsemblGenomes-Tr; EBT00001814432.
DR   EnsemblGenomes-Tr; EBT00001814433.
DR   EnsemblGenomes-Tr; EBT00001814434.
DR   EnsemblGenomes-Tr; EBT00001814435.
DR   EnsemblGenomes-Tr; EBT00001814436.
DR   EnsemblGenomes-Tr; EBT00001814437.
DR   EnsemblGenomes-Tr; EBT00001814438.
DR   EnsemblGenomes-Tr; EBT00001814439.
DR   EnsemblGenomes-Tr; EBT00001814440.
DR   EnsemblGenomes-Tr; EBT00001814441.
DR   EnsemblGenomes-Tr; EBT00001814442.
DR   EnsemblGenomes-Tr; EBT00001814443.
DR   EnsemblGenomes-Tr; EBT00001814444.
DR   EnsemblGenomes-Tr; EBT00001814445.
DR   EnsemblGenomes-Tr; EBT00001814446.
DR   EnsemblGenomes-Tr; EBT00001814447.
DR   EnsemblGenomes-Tr; EBT00001814448.
DR   EnsemblGenomes-Tr; EBT00001814449.
DR   EnsemblGenomes-Tr; EBT00001814450.
DR   EnsemblGenomes-Tr; EBT00001814451.
DR   EnsemblGenomes-Tr; EBT00001814452.
DR   EnsemblGenomes-Tr; EBT00001814453.
DR   EnsemblGenomes-Tr; EBT00001814454.
DR   EnsemblGenomes-Tr; EBT00001814455.
DR   EnsemblGenomes-Tr; EBT00001814456.
DR   EnsemblGenomes-Tr; EBT00001814457.
DR   EnsemblGenomes-Tr; EBT00001814458.
DR   EnsemblGenomes-Tr; EBT00001814459.
DR   EnsemblGenomes-Tr; EBT00001814460.
DR   EnsemblGenomes-Tr; EBT00001814461.
DR   EnsemblGenomes-Tr; EBT00001814462.
DR   EnsemblGenomes-Tr; EBT00001814463.
DR   EnsemblGenomes-Tr; EBT00001814464.
DR   EnsemblGenomes-Tr; EBT00001814465.
DR   EnsemblGenomes-Tr; EBT00001814466.
DR   EnsemblGenomes-Tr; EBT00001814467.
DR   EnsemblGenomes-Tr; EBT00001814468.
DR   EnsemblGenomes-Tr; EBT00001814469.
DR   EnsemblGenomes-Tr; EBT00001814470.
DR   EnsemblGenomes-Tr; EBT00001814471.
DR   EnsemblGenomes-Tr; EBT00001814472.
DR   EnsemblGenomes-Tr; EBT00001814473.
DR   EnsemblGenomes-Tr; EBT00001814474.
DR   EnsemblGenomes-Tr; EBT00001814475.
DR   EnsemblGenomes-Tr; EBT00001814476.
DR   EnsemblGenomes-Tr; EBT00001814477.
DR   EnsemblGenomes-Tr; EBT00001814478.
DR   EnsemblGenomes-Tr; EBT00001814479.
DR   EnsemblGenomes-Tr; EBT00001814480.
DR   EnsemblGenomes-Tr; PputGB1_R0001-1.
DR   EnsemblGenomes-Tr; PputGB1_R0002-1.
DR   EnsemblGenomes-Tr; PputGB1_R0003-1.
DR   EnsemblGenomes-Tr; PputGB1_R0004-1.
DR   EnsemblGenomes-Tr; PputGB1_R0005-1.
DR   EnsemblGenomes-Tr; PputGB1_R0006-1.
DR   EnsemblGenomes-Tr; PputGB1_R0007-1.
DR   EnsemblGenomes-Tr; PputGB1_R0008-1.
DR   EnsemblGenomes-Tr; PputGB1_R0009-1.
DR   EnsemblGenomes-Tr; PputGB1_R0010-1.
DR   EnsemblGenomes-Tr; PputGB1_R0011-1.
DR   EnsemblGenomes-Tr; PputGB1_R0012-1.
DR   EnsemblGenomes-Tr; PputGB1_R0013-1.
DR   EnsemblGenomes-Tr; PputGB1_R0014-1.
DR   EnsemblGenomes-Tr; PputGB1_R0015-1.
DR   EnsemblGenomes-Tr; PputGB1_R0016-1.
DR   EnsemblGenomes-Tr; PputGB1_R0017-1.
DR   EnsemblGenomes-Tr; PputGB1_R0018-1.
DR   EnsemblGenomes-Tr; PputGB1_R0019-1.
DR   EnsemblGenomes-Tr; PputGB1_R0020-1.
DR   EnsemblGenomes-Tr; PputGB1_R0021-1.
DR   EnsemblGenomes-Tr; PputGB1_R0022-1.
DR   EnsemblGenomes-Tr; PputGB1_R0023-1.
DR   EnsemblGenomes-Tr; PputGB1_R0024-1.
DR   EnsemblGenomes-Tr; PputGB1_R0025-1.
DR   EnsemblGenomes-Tr; PputGB1_R0026-1.
DR   EnsemblGenomes-Tr; PputGB1_R0027-1.
DR   EnsemblGenomes-Tr; PputGB1_R0028-1.
DR   EnsemblGenomes-Tr; PputGB1_R0029-1.
DR   EnsemblGenomes-Tr; PputGB1_R0030-1.
DR   EnsemblGenomes-Tr; PputGB1_R0031-1.
DR   EnsemblGenomes-Tr; PputGB1_R0032-1.
DR   EnsemblGenomes-Tr; PputGB1_R0033-1.
DR   EnsemblGenomes-Tr; PputGB1_R0034-1.
DR   EnsemblGenomes-Tr; PputGB1_R0036-1.
DR   EnsemblGenomes-Tr; PputGB1_R0037-1.
DR   EnsemblGenomes-Tr; PputGB1_R0038-1.
DR   EnsemblGenomes-Tr; PputGB1_R0039-1.
DR   EnsemblGenomes-Tr; PputGB1_R0040-1.
DR   EnsemblGenomes-Tr; PputGB1_R0041-1.
DR   EnsemblGenomes-Tr; PputGB1_R0042-1.
DR   EnsemblGenomes-Tr; PputGB1_R0043-1.
DR   EnsemblGenomes-Tr; PputGB1_R0044-1.
DR   EnsemblGenomes-Tr; PputGB1_R0045-1.
DR   EnsemblGenomes-Tr; PputGB1_R0046-1.
DR   EnsemblGenomes-Tr; PputGB1_R0047-1.
DR   EnsemblGenomes-Tr; PputGB1_R0048-1.
DR   EnsemblGenomes-Tr; PputGB1_R0049-1.
DR   EnsemblGenomes-Tr; PputGB1_R0050-1.
DR   EnsemblGenomes-Tr; PputGB1_R0051-1.
DR   EnsemblGenomes-Tr; PputGB1_R0052-1.
DR   EnsemblGenomes-Tr; PputGB1_R0053-1.
DR   EnsemblGenomes-Tr; PputGB1_R0054-1.
DR   EnsemblGenomes-Tr; PputGB1_R0055-1.
DR   EnsemblGenomes-Tr; PputGB1_R0056-1.
DR   EnsemblGenomes-Tr; PputGB1_R0057-1.
DR   EnsemblGenomes-Tr; PputGB1_R0058-1.
DR   EnsemblGenomes-Tr; PputGB1_R0059-1.
DR   EnsemblGenomes-Tr; PputGB1_R0060-1.
DR   EnsemblGenomes-Tr; PputGB1_R0061-1.
DR   EnsemblGenomes-Tr; PputGB1_R0062-1.
DR   EnsemblGenomes-Tr; PputGB1_R0063-1.
DR   EnsemblGenomes-Tr; PputGB1_R0064-1.
DR   EnsemblGenomes-Tr; PputGB1_R0065-1.
DR   EnsemblGenomes-Tr; PputGB1_R0066-1.
DR   EnsemblGenomes-Tr; PputGB1_R0067-1.
DR   EnsemblGenomes-Tr; PputGB1_R0068-1.
DR   EnsemblGenomes-Tr; PputGB1_R0069-1.
DR   EnsemblGenomes-Tr; PputGB1_R0070-1.
DR   EnsemblGenomes-Tr; PputGB1_R0071-1.
DR   EnsemblGenomes-Tr; PputGB1_R0072-1.
DR   EnsemblGenomes-Tr; PputGB1_R0073-1.
DR   EnsemblGenomes-Tr; PputGB1_R0074-1.
DR   EnsemblGenomes-Tr; PputGB1_R0075-1.
DR   EnsemblGenomes-Tr; PputGB1_R0076-1.
DR   EnsemblGenomes-Tr; PputGB1_R0077-1.
DR   EnsemblGenomes-Tr; PputGB1_R0078-1.
DR   EnsemblGenomes-Tr; PputGB1_R0079-1.
DR   EnsemblGenomes-Tr; PputGB1_R0080-1.
DR   EnsemblGenomes-Tr; PputGB1_R0081-1.
DR   EnsemblGenomes-Tr; PputGB1_R0082-1.
DR   EnsemblGenomes-Tr; PputGB1_R0083-1.
DR   EnsemblGenomes-Tr; PputGB1_R0084-1.
DR   EnsemblGenomes-Tr; PputGB1_R0085-1.
DR   EnsemblGenomes-Tr; PputGB1_R0086-1.
DR   EnsemblGenomes-Tr; PputGB1_R0087-1.
DR   EnsemblGenomes-Tr; PputGB1_R0088-1.
DR   EnsemblGenomes-Tr; PputGB1_R0089-1.
DR   EnsemblGenomes-Tr; PputGB1_R0090-1.
DR   EnsemblGenomes-Tr; PputGB1_R0091-1.
DR   EnsemblGenomes-Tr; PputGB1_R0092-1.
DR   EnsemblGenomes-Tr; PputGB1_R0093-1.
DR   EnsemblGenomes-Tr; PputGB1_R0094-1.
DR   EnsemblGenomes-Tr; PputGB1_R0095-1.
DR   EnsemblGenomes-Tr; PputGB1_R0096-1.
DR   EnsemblGenomes-Tr; PputGB1_R0097-1.
DR   EnsemblGenomes-Tr; PputGB1_R0098-1.
DR   EnsemblGenomes-Tr; PputGB1_R0099-1.
DR   EnsemblGenomes-Tr; PputGB1_R0100-1.
DR   EuropePMC; PMC2687292; 19329656.
DR   EuropePMC; PMC2772449; 19734336.
DR   EuropePMC; PMC3194850; 21856827.
DR   EuropePMC; PMC3275731; 21811795.
DR   EuropePMC; PMC3656225; 23536173.
DR   EuropePMC; PMC3807495; 23995634.
DR   EuropePMC; PMC3894933; 24465371.
DR   EuropePMC; PMC3974807; 24699529.
DR   EuropePMC; PMC5854784; 29545293.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00166; PrrB_RsmZ.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00195; RsmY.
DR   RFAM; RF00444; PrrF.
DR   RFAM; RF00623; P1.
DR   RFAM; RF00624; P9.
DR   RFAM; RF00627; P15.
DR   RFAM; RF00628; P16.
DR   RFAM; RF00629; P24.
DR   RFAM; RF00630; P26.
DR   RFAM; RF01057; SAH_riboswitch.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01394; isrK.
DR   RFAM; RF01669; P14.
DR   RFAM; RF01671; P18.
DR   RFAM; RF01673; P20.
DR   RFAM; RF01674; P27.
DR   RFAM; RF01675; CrcZ.
DR   RFAM; RF01676; P31.
DR   RFAM; RF01683; P6.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01719; Pseudomon-1.
DR   RFAM; RF01720; Pseudomon-Rho.
DR   RFAM; RF01721; Pseudomon-groES.
DR   RFAM; RF01738; gabT.
DR   RFAM; RF01740; gyrA.
DR   RFAM; RF01755; rmf.
DR   RFAM; RF01756; rne-II.
DR   RFAM; RF01758; sucA-II.
DR   RFAM; RF01759; sucC.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01772; rnk_pseudo.
DR   RFAM; RF01773; rpsL_psuedo.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF01998; group-II-D1D4-1.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   RFAM; RF02243; Xoo8.
DR   SILVA-LSU; CP000926.
DR   SILVA-SSU; CP000926.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4003030
CC   Source DNA and bacteria available from James K. McCarthy
CC   (jmccarthy@ucsd.edu)
CC   Contacts: James K. McCarthy (jmccarthy@ucsd.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..6078430
FT                   /organism="Pseudomonas putida GB-1"
FT                   /strain="GB-1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:76869"
FT   gene            complement(4..408)
FT                   /locus_tag="PputGB1_0001"
FT   CDS_pept        complement(4..408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0001"
FT                   /product="ribonuclease P protein component"
FT                   /note="TIGRFAM: ribonuclease P protein component; PFAM:
FT                   ribonuclease P protein; KEGG: pen:PSEEN5558 ribonuclease P
FT                   protein component"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95917"
FT                   /db_xref="GOA:B0KEU7"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KEU7"
FT                   /protein_id="ABY95917.1"
FT                   /translation="MVSQDFSREKRLLTPRHFKAVFDSPTGKVPGKNLLILARENGLDH
FT                   PRLGLVIGKKSVKLAVQRNRLKRLMRDSFRLNQQSLAGLDIVIVARKGLGEIENPELHQ
FT                   HFGKLWKRLARSRPTPAATANSAGVDSQDA"
FT   gene            complement(422..556)
FT                   /locus_tag="PputGB1_0002"
FT   CDS_pept        complement(422..556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0002"
FT                   /product="ribosomal protein L34"
FT                   /note="PFAM: ribosomal protein L34; KEGG: pen:PSEEN5559 50S
FT                   ribosomal subunit protein L34"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95918"
FT                   /db_xref="GOA:B0KEU8"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KEU8"
FT                   /protein_id="ABY95918.1"
FT                   /translation="MKRTFQPSTIKRARTHGFRARMATKNGRAVLSRRRAKGRKRLAI"
FT   gene            1152..2684
FT                   /locus_tag="PputGB1_0003"
FT   CDS_pept        1152..2684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0003"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: pen:PSEEN0001 chromosomal replication
FT                   initiator protein DnaA; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA domain; Chromosomal replication initiator
FT                   DnaA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95919"
FT                   /db_xref="GOA:B0KEU9"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KEU9"
FT                   /protein_id="ABY95919.1"
FT                   /translation="MSVELWQQCVELLRDELPAQQFNTWIRPLQVEAEGDELRVYAPNR
FT                   FVLDWVNEKYLGRLLELLGENGSGIAPALSLLIGSRRSSAPRAAPNAPVSAAVAASLAQ
FT                   TQAHKAAPTPAAVEPIAVAAAEPVLVDELAEPSSRDSFDAMAEPASAPASSGRAEQRTV
FT                   QVEGALKHTSYLNRTFTFDTFVEGKSNQLARAAAWQVADNPKHGYNPLFLYGGVGLGKT
FT                   HLMHAVGNHLLKKNPNAKVVYLHSERFVADMVKALQLNAINEFKRFYRSVDALLIDDIQ
FT                   FFARKERSQEEFFHTFNALLEGGQQVILTSDRYPKEIEGLEERLKSRFGWGLTVAVEPP
FT                   ELETRVAILMKKADQAKVELPHDAAFFIAQRIRSNVRELEGALKRVIAHSHFMGRDITI
FT                   ELIRESLKDLLALQDKLVSVDNIQRTVAEYYKIKISDLLSKRRSRSVARPRQVAMALSK
FT                   ELTNHSLPEIGDMFGGRDHTTVLHACRKINELKESDADIREDYKNLLRTLTT"
FT   gene            2725..3828
FT                   /locus_tag="PputGB1_0004"
FT   CDS_pept        2725..3828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0004"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: pen:PSEEN0002 DNA polymerase III, beta chain;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95920"
FT                   /db_xref="GOA:B0KEV0"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:B0KEV0"
FT                   /protein_id="ABY95920.1"
FT                   /translation="MHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVQGQQLSLT
FT                   GTDLEVELVGRVQLEEPAEPGEITVPARKLMDICKSLPNDALIDIKVDEQKLLVKAGRS
FT                   RFTLSTLPANDFPTAEEGPGSLTCNLEQSKLRRLIERTSFAMAQQDVRYYLNGMLLEVS
FT                   RNTLRAVSTDGHRLALCSMTAPIEQDDRHQVIVPRKGILELARLLTDPEGMVSIVLGQH
FT                   HIRATTGEFTFTSKLVDGKFPDYERVLPKGGDKLVVGDRQALREAFSRTAILSNEKYRG
FT                   IRLQLAAGQLKIQANNPEQEEAEEEISVDYKGSSLEIGFNVSYLLDVLGVMTTEQVRLI
FT                   LSDSNSSALLQEAGNDDSSYVVMPMRL"
FT   gene            3844..4947
FT                   /locus_tag="PputGB1_0005"
FT   CDS_pept        3844..4947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0005"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: pen:PSEEN0003 DNA
FT                   replication, recombinaison and repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95921"
FT                   /db_xref="GOA:B0KEV1"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KEV1"
FT                   /protein_id="ABY95921.1"
FT                   /translation="MSLRRIMVTAVRNLHPVTLLPSPRINILYGANGSGKTSVLEAVHL
FT                   LGLARSFRSSRLNPVIQYEQPACTVFGEVELTEGGTCKLGVSRERQGEFTIRIDGQNAR
FT                   SAAQLAELLPLQLINPDSFRLLEGAPKIRRQFLDWGVFHVEPRFLPAWQRLQKALRQRN
FT                   SWLRHGTLDPASQAAWDRELCLASAEIDEYRRNYIKALKPVFERTLSELVELDGLTLSY
FT                   YRGWDKDRELQEVLASSLLRDQQMGHTQAGPQRADLRLRLAGNNAADILSRGQQKLVVC
FT                   ALRIAQGHLVSQARRGHCIYLVDDLPSELDDQHRRALCRLLEELRCQVFITCVDHELLR
FT                   EGWQTETPVALFHVEQGRITQTHDHRE"
FT   gene            4952..7372
FT                   /locus_tag="PputGB1_0006"
FT   CDS_pept        4952..7372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0006"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.6.2.3"
FT                   /note="KEGG: pen:PSEEN0004 DNA gyrase, subunit B; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: DNA gyrase subunit B domain
FT                   protein; ATP-binding region ATPase domain protein; TOPRIM
FT                   domain protein; DNA topoisomerase type IIA subunit B region
FT                   2 domain protein; SMART: DNA topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95922"
FT                   /db_xref="GOA:B0KEV2"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:B0KEV2"
FT                   /protein_id="ABY95922.1"
FT                   /translation="MSENQTYDSSSIKVLKGLDAVRKRPGMYIGDTDDGSGLHHMVFEV
FT                   VDNSIDEALAGHCDDITVIIHTDESISVRDNGRGIPVDVHKEEGVSAAEVIMTVLHAGG
FT                   KFDDNSYKVSGGLHGVGVSVVNALSEKLVLTVRRSGKIWEQTYVHGVPQAPMAVVGDSE
FT                   TTGTHIHFKPSAETFKNIHFSWDILAKRIRELSFLNSGVGILLKDERSGKEEFFKYEGG
FT                   LRAFVEYLNTNKTPVNSQVFHFNVQRDDGVGVEVALQWNDSFNENLLCFTNNIPQRDGG
FT                   THLVGFRSSLTRSLNSYIEQEGLAKKNKVATTGDDAREGLTAIISVKVPDPKFSSQTKD
FT                   KLVSSEVKTAVEQEMNKYFADFLLENPNEAKAVVGKMIDAARAREAARKAREMTRRKGA
FT                   LDIAGLPGKLADCQEKDPALSELYLVEGDSAGGSAKQGRNRRTQAILPLKGKILNVEKA
FT                   RFDKMISSQEVGTLITALGCGIGREEYNIDKLRYHNIIIMTDADVDGSHIRTLLLTFFF
FT                   RQLPELVERGYIYIAQPPLYKVKKGKQEQYIKDDEAMEEYMTQSALEDASLHLDESAPA
FT                   VSGVQLEALVNEFRSVMKTLKRLSRLYPEELTEHFIYLPEVTLEQLGDHAVMQAWLAKF
FT                   QERLNSSQKSGLVYKASLREDKERNVWLPEVEVTSHGLASYVTFNRDFFGSNDYRTVVN
FT                   IGSKLSSLLGEGAYVQRGERRKAIVEFKEGLDWLMNETTKRHTIQRYKGLGEMNPDQLW
FT                   ETTMDPTVRRMLKVTIEDAIAADQIFNTLMGDAVEPRRDFIESNALSVSNLDF"
FT   gene            8209..8847
FT                   /locus_tag="PputGB1_0007"
FT   CDS_pept        8209..8847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0007"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_C6542 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95923"
FT                   /db_xref="UniProtKB/TrEMBL:B0KEV3"
FT                   /protein_id="ABY95923.1"
FT                   /translation="MTVRKVVTRRSNHYRGYFPSLKNKKPVPWESQLEGALFRLLELSP
FT                   AVIGYVPQPSEERVPSLQGYFKYYPDVQVFLADGREWWFEVKPHDRLKIASVRQRLDAA
FT                   ERYFNATARNFSVITEKLIEAEPLATNLRRLMYHRRGPELSHQALEEVMATFNEWPPMT
FT                   VADLLYVVGEGKAWRLLGLGVVGIDLDRSIDTDSPVFLQGGHRHANLFP"
FT   gene            8828..10786
FT                   /locus_tag="PputGB1_0008"
FT   CDS_pept        8828..10786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0008"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   bur:Bcep18194_C6543 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95924"
FT                   /db_xref="GOA:B0KEV4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:B0KEV4"
FT                   /protein_id="ABY95924.1"
FT                   /translation="MQTFSLRVKLVVIVRGVLMVLEKRLIDRKLLFFDELGEPTKLSEK
FT                   EFYEAYEKREIEISADQPYLGRVPYVRNVPPDISCFPKKHGDEALRRRKYLDDLTKRGK
FT                   YKLPGDEDMIKKLRDIAKKIGDACAPSVSTIRRWAAKYIGQNVVKLIPQHAKKGRAAAI
FT                   QGELEVILEGVINKTYLQDTIPAVSVVVSEFEDQIKERNKSRLPSDQLKIPSGMTVRRY
FT                   IAKLDPYLVDKERLGKHAADKKHRVAAGVLRVHEILERWEIDHTLLDVQLVDETSGLCI
FT                   GRPYLTIVLDRFSRMVMGYLLHLSAPNTETVLRVIERSIRPKAELLKRFPKVRNEWWAR
FT                   GLPARIVPDNAAEFHAGDLIMGFNELGIEIMYPASRAPQRKGAVERFFSTQNLGLIHNL
FT                   PGTTFSNIQQRGDYDSEKNACFTLPQLEAVVVKWIVDGYHQTPHRGLDNRTPAQVWGTS
FT                   EANHVISLPVDLDSLECILAKRASVKVHHYGIEVAKVGYHSTELAELRMRLADGEKVNV
FT                   RYRDEAGHVWVHDRFRNLFFKVPAKDERMAGKSREVWKAAEKALREKYNEQPSFEATHR
FT                   CYQEIMEDADEARRSQTLRKRRAAAIAKIDKEGRVTESTPPPKVLAEVEWTGDSIPNIP
FT                   PAAFKVSVRRPAGSSKP"
FT   gene            10783..11742
FT                   /locus_tag="PputGB1_0009"
FT   CDS_pept        10783..11742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0009"
FT                   /product="AAA ATPase"
FT                   /note="SMART: AAA ATPase; KEGG: bur:Bcep18194_C6544
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95925"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008868"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0KEV5"
FT                   /protein_id="ABY95925.1"
FT                   /translation="MNAINLYECYEHGEYSFTLRDRFIHSPQVERALTRLGDIHGDSRR
FT                   TRASKGLLIQGPSGVGKSTLVKEYIRSLEELESHDPQKRTVLFVEMPSSPTKKNLAAAI
FT                   LAELKDPFAEARGHSAEVKFARVVLLLKNLGVEMLVLDEAQHLVDYRRNGAYEAADWIK
FT                   SLMNETSIAFVLIGLKRTENLLLANEQLRRRFSATVAYDRFTFSANTSLHFVMLLQAIE
FT                   GELPVQTISFVEPAMIKRFYLASYGLIDYLIKIVDRAVWLVQVQDLVGIELPVLAQAFE
FT                   DEVWSYATEDRNPFSASFNFQPLFGKREPFETFEESST"
FT   gene            11818..13734
FT                   /locus_tag="PputGB1_0010"
FT   CDS_pept        11818..13734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0010"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pst:PSPTO_0030 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95926"
FT                   /db_xref="InterPro:IPR009492"
FT                   /db_xref="UniProtKB/TrEMBL:B0KEV6"
FT                   /protein_id="ABY95926.1"
FT                   /translation="MFGLLINPRPHQDESLLGYLQRLAKANGLPRKELLTAFARADETD
FT                   VADWLQMMEGPLSWPAVSAEFRDPRPKGVKLWTTHHARYCPICLGEAGYWRESWGLTLV
FT                   TTCSVHGTELHGRCPNCLKETDPSAMSANSCQACGTSLSGTNFEIAPASDTAAWLTSGF
FT                   EDRFYADSLPADAGLAALTYEQFHELSSRLAVRSLPTERTQPLKVADSGSLEISRLMAN
FT                   AAGVVLMNWPLAFRELLSGLKAVHSDNEHWTLSRSFGPIYHDIHRDLDDSCFDFLRREF
FT                   ESFLQHAWEAPLAKRNRNLSEETIERHRWVSFDSAAEACGLGVSVIKRLHQEGQIAYRE
FT                   KVHEDRVFTVVDLDHLKAISQHLQGVADMKETSTLLSLCRNRVRQLLAGGTLQFFGGEP
FT                   RPGERWLIDCRSINELIDEKLPTSSDQSLVSINYLAKHSLPKGGGLVELVQAIRAGELR
FT                   AYGPAENGSVAVGAWLLKPQDFAAWQQARAENKSPVFPGLSVVKAAALLGVKEQCAYAF
FT                   VRLGLLWSTAVERGRRTQLMVKPQAIDRFRRGYILGPEIAVYLGKSTREAFKHLWEARF
FT                   RPVAGPSIPNAACRQYVWVRSKKLIDYLASEAAQIDDPEAITFLSTPIAQPRDCRFRHV
FT                   GSR"
FT   gene            13791..14150
FT                   /locus_tag="PputGB1_0011"
FT   CDS_pept        13791..14150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0011"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pst:PSPTO_4755 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95927"
FT                   /db_xref="InterPro:IPR035616"
FT                   /db_xref="UniProtKB/TrEMBL:B0KEV7"
FT                   /protein_id="ABY95927.1"
FT                   /translation="MSRLAEFRLLEQQLAAQLAELEALKNDSALKQEMEFETKLRSLLN
FT                   EYGYGLRQVVLILDPQAVASTDMAPKTSRKPREVKVYKNPHSGEVVETKGGNQRTLKAW
FT                   KNEYGAEVVESWLAN"
FT   gene            14522..14854
FT                   /locus_tag="PputGB1_0012"
FT   CDS_pept        14522..14854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0012"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pmy:Pmen_2213 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95928"
FT                   /db_xref="InterPro:IPR021245"
FT                   /db_xref="UniProtKB/TrEMBL:B0KEV8"
FT                   /protein_id="ABY95928.1"
FT                   /translation="MNTAKSIAALMLVIASSSALAEGGSDRLHGKMIQANEQAMRAYAA
FT                   ANGKKPPEVIHYRYGMKLDVARVISMTSLKGSCDVMPTQMNYEDSTGELKILEYRSAGI
FT                   NCRGQN"
FT   sig_peptide     14522..14587
FT                   /locus_tag="PputGB1_0012"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            complement(14952..15407)
FT                   /locus_tag="PputGB1_0013"
FT   CDS_pept        complement(14952..15407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0013"
FT                   /product="protein of unknown function DUF411"
FT                   /note="PFAM: protein of unknown function DUF411; KEGG:
FT                   pmy:Pmen_2215 protein of unknown function DUF411"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95929"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR007332"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B0KEV9"
FT                   /protein_id="ABY95929.1"
FT                   /translation="MTSKRRFLGLSTAASLLIASAAFAAEPLTIDVHRDANCGCCKKWI
FT                   AHLEANGFKVVDHVETDMRAVKQELGVAPRLASCHTAVIDGKFVEGHVPAAQVQELIKR
FT                   NDLAGVAVPGMPAGSPGMEVDGMKHAYQVIGLTKSGDDQVVASYPDT"
FT   sig_peptide     complement(15333..15407)
FT                   /locus_tag="PputGB1_0013"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            complement(15397..16176)
FT                   /locus_tag="PputGB1_0014"
FT   CDS_pept        complement(15397..16176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0014"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pmy:Pmen_2216 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95930"
FT                   /db_xref="GOA:B0KEW0"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B0KEW0"
FT                   /protein_id="ABY95930.1"
FT                   /translation="MKKTITTLVAAGAVTSAAVLGAAYFGLVNVGADDPHFPAVHAFLA
FT                   MARDRSIEVRASDIEVPNLKDPALIQAGAGNYNAMCIGCHLAPGVEKTELSQALYPSPP
FT                   NLTEIGVSGDPAAAFWTIKHGIKATGMPAWGKSMDDQYIWGIVAFLDQLPQLNAEQYQM
FT                   MVASSGGHQHGGGESDMHNHEGQHGGAKSGHGNHDDSAANGVAEESHDHGSSHSESSSV
FT                   AEHHGEHESGEAHSDHHTGSTPKTHVHKDGKEHTHDK"
FT   sig_peptide     complement(16111..16176)
FT                   /locus_tag="PputGB1_0014"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.647 at
FT                   residue 22"
FT   gene            complement(16186..17301)
FT                   /locus_tag="PputGB1_0015"
FT   CDS_pept        complement(16186..17301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0015"
FT                   /product="copper resistance B precursor"
FT                   /note="PFAM: copper resistance B precursor; KEGG:
FT                   pmy:Pmen_2217 copper resistance B precursor"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95931"
FT                   /db_xref="GOA:B0KEW1"
FT                   /db_xref="InterPro:IPR007939"
FT                   /db_xref="UniProtKB/TrEMBL:B0KEW1"
FT                   /protein_id="ABY95931.1"
FT                   /translation="MANSVARPSLLAFAVSLGVLGVSPSFAAEMDHSGMDHSAMGHGAM
FT                   QMDHASSQAAMPGMDHSQMGASKQPTQPAPVDHSKMGHGQPKAKPASMDHSKMDHGSMK
FT                   GMDHGSMEGMDHGAMGHSTMGNGNADSPTPTSRTPIPVLTDADRQAAFPPLDGHKMDDS
FT                   GFNSFFLLDQLEYQDADEGSTLAWDASGWVGGDINRLWIRSEGERTNGVTEDAELQLLY
FT                   GRSVSPWWDVVAGVRQDFKPEDPQTWAAFGIQGLALYDFEAEATAFIGENGQTAARLEG
FT                   EYDILLTNRLILQPTAEANFYGKNDPERGVGSGLANTEVGLRLRYEIVRQFAPYIGVTW
FT                   SRSYGKTADFIRDEGGDVDEARFVAGIRMWF"
FT   sig_peptide     complement(17218..17301)
FT                   /locus_tag="PputGB1_0015"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 28"
FT   gene            complement(17291..17614)
FT                   /locus_tag="PputGB1_0016"
FT   CDS_pept        complement(17291..17614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0016"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: psa:PST_3382 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95932"
FT                   /db_xref="UniProtKB/TrEMBL:B0KEW2"
FT                   /protein_id="ABY95932.1"
FT                   /translation="MSKPMKRSAFFLSAAMVGLLAVYAPSSWSSDNHDQHSQKSSNAAQ
FT                   SNGSKSKQAQGMNHEGMDHGSMKGMDHGSMEGMDHGSMEGMDHSKMMESHGSDKAKAGK
FT                   NGQ"
FT   sig_peptide     complement(17525..17614)
FT                   /locus_tag="PputGB1_0016"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 30"
FT   gene            complement(17629..19587)
FT                   /locus_tag="PputGB1_0017"
FT   CDS_pept        complement(17629..19587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0017"
FT                   /product="copper-resistance protein, CopA family"
FT                   /note="TIGRFAM: copper-resistance protein, CopA family;
FT                   PFAM: multicopper oxidase type 1; multicopper oxidase type
FT                   2; multicopper oxidase type 3; KEGG: pmy:Pmen_2219
FT                   copper-resistance protein, CopA family"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95933"
FT                   /db_xref="GOA:B0KEW3"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006376"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR033138"
FT                   /db_xref="InterPro:IPR034279"
FT                   /db_xref="InterPro:IPR034282"
FT                   /db_xref="InterPro:IPR034284"
FT                   /db_xref="UniProtKB/TrEMBL:B0KEW3"
FT                   /protein_id="ABY95933.1"
FT                   /translation="MQSKTTRRSFVKGLAATGLLGGLGMWRAPVWAVTSPGQPNVLTGT
FT                   DFDLYIGELPVNITGAARTAMAINGSLPGPILRWREGDTVTLRVRNRLKQDTSIHWHGI
FT                   ILPANMDGVPGLSFHGIAPDGMYEYKFKVHQNGTYWYHSHSGFQEQVGVYGALVIDAKD
FT                   PEPFTYDRDYVVMLSDWTDEDPARVMSKLKKQSDYYNFHKRTVGDFVDDVSEKGWSAAV
FT                   ADRKMWAEMKMSPTDLADVSGHTYTYLMNGQAPNGNWTGIFKPGEKIRLRFINGSAMTY
FT                   FDVRIPGLKMTVVAADGQYVKPVSIDEFRIAVAETYDVIVEPENEQAYTIFAQSMDRTG
FT                   YSRGTLAVREGLQAPVPAVDPRPLISMSDMGMDHGSMGGMDHGSMAGMDHSKMAGMDHG
FT                   SMAGMDHSKMAGMDHGSMAGMDHSKMAGMDHGSMAGMDHSKMAGMDHGSMAGMDHSKMA
FT                   GMDHGNMTGMDQSNMAASGAMQNHPASETNNPLVDMQTMTPTPKLSDPGIGLRDNGRRV
FT                   LTYSDLRSTFIDPDGREPGRTIELHLTGHMEKFAWSFDGIKFSDAEPLRLKYGERLRIT
FT                   LVNDTMMTHPIHLHGMWSDLEDEDGNFMVRKHTIDMPPGSKRSYRVTADALGRWAYHCH
FT                   LMYHMEMGMFREVRVDE"
FT   sig_peptide     complement(19489..19587)
FT                   /locus_tag="PputGB1_0017"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 33"
FT   gene            complement(19770..19976)
FT                   /locus_tag="PputGB1_0018"
FT   CDS_pept        complement(19770..19976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0018"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pmy:Pmen_2220 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95934"
FT                   /db_xref="UniProtKB/TrEMBL:B0KEW4"
FT                   /protein_id="ABY95934.1"
FT                   /translation="MNMIKAIVMVVTFGMASLALAEGGADRTFARMEAARASSMQAYQV
FT                   AQEKKAEAPVTAQSQKHPGHESC"
FT   sig_peptide     complement(19911..19976)
FT                   /locus_tag="PputGB1_0018"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 22"
FT   gene            20143..20820
FT                   /locus_tag="PputGB1_0019"
FT   CDS_pept        20143..20820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0019"
FT                   /product="two component heavy metal response
FT                   transcriptional regulator, winged helix family"
FT                   /note="TIGRFAM: heavy metal response regulator; PFAM:
FT                   response regulator receiver; transcriptional regulator
FT                   domain protein; KEGG: psa:PST_3390 transcriptional
FT                   activator CopR"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95935"
FT                   /db_xref="GOA:B0KEW5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR006291"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B0KEW5"
FT                   /protein_id="ABY95935.1"
FT                   /translation="MKLLVAEDEPKIGAYLQQGLTEAGFTVDRVVTGTDALQYALSEAY
FT                   DLLILDVMMPGLDGWEVLRMVRAAGKEVPVLFLTARDGVDDRVKGLELGADDYLVKPFA
FT                   FSELLARVRTLLRRGSSGYAQTTMKMADLEVDLLKRRATRNGKRIDLTAKEFSLLELLM
FT                   RRRGEVLPKSLIASQVWDMNFDSDTNVIEVAVRRLRAKIDDDFAPKLIHTVRGMGYLMD
FT                   VPE"
FT   gene            20820..22226
FT                   /locus_tag="PputGB1_0020"
FT   CDS_pept        20820..22226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0020"
FT                   /product="heavy metal sensor signal transduction histidine
FT                   kinase"
FT                   /note="TIGRFAM: heavy metal sensor kinase; PFAM:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   HAMP region domain protein; histidine kinase A domain
FT                   protein; KEGG: pmy:Pmen_2235 heavy metal sensor signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95936"
FT                   /db_xref="GOA:B0KEW6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006290"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B0KEW6"
FT                   /protein_id="ABY95936.1"
FT                   /translation="MRAQSSLVKRLTLMFMFAVIAVLVVAGVSFYMLSQHHFQMLDEQA
FT                   LAEKLESTRHILSLSAARDELEDQEPQLRALLGAHQDLSAEILDADGTVLFSDSKASRI
FT                   PERFKQASSGAVWDWQIDSRNFRGITSQLAIAQAQAPVTVMLMLDVTSHAHFFKTLQWW
FT                   FGIGLVISALVSAGLGWIVAKSGLRPVGQITKVATSMSARSLRERIPLEPVPLELQELI
FT                   LSFNGMLARLEDAFVRLSNFSADIAHELRTPVSNLLTHTEVVLTKKRDLDAYEDNLYSN
FT                   LEDLKRMSRMIDDMLFLAKADNGLIIPEQVDIDLVGLVSRLIEYYQLAAEDRSIRLALQ
FT                   GEGTIRGDRLMIDRAVSNILSNALRYTPEGHDIAVRIVEAADQVNLSVQNNGATIDPEH
FT                   INKIFDRFYRADPARREGSPSNAGLGLAITRSIIEAHGGRIWCTSADGVTSFHIALPHA
FT                   KQSTSKPQTA"
FT   sig_peptide     20820..20900
FT                   /locus_tag="PputGB1_0020"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.913 at
FT                   residue 27"
FT   gene            22263..22610
FT                   /locus_tag="PputGB1_0021"
FT   CDS_pept        22263..22610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0021"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pfo:Pfl_2393 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95937"
FT                   /db_xref="UniProtKB/TrEMBL:B0KEW7"
FT                   /protein_id="ABY95937.1"
FT                   /translation="MNRLLRLFTILLLIASLPLNGMAGVDSAIEPCPMQTMGMEMMAGM
FT                   DHDCCQDTDPGSAADHSKACKVGQECRTASTVQVEIINPTLTYSAPRPVDTYAVSLVNR
FT                   APPDPWRPPRA"
FT   sig_peptide     22263..22334
FT                   /locus_tag="PputGB1_0021"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.818 at
FT                   residue 24"
FT   gene            22697..23950
FT                   /locus_tag="PputGB1_0022"
FT   CDS_pept        22697..23950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0022"
FT                   /product="outer membrane efflux protein"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   pap:PSPA7_4013 heavy metal RND efflux outer membrane
FT                   protein, CzcC family"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95938"
FT                   /db_xref="GOA:B0KEW8"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:B0KEW8"
FT                   /protein_id="ABY95938.1"
FT                   /translation="MTPPRYRLGMACLAALISLLSTLPAQATPLSLEEALQLAERNAPI
FT                   LQARQEQMTAARHAVIPAGELPDPRLNLGVQNLPVDGSDRWSMNRDFMTMQVVGLSQEV
FT                   PNRDKREARVETARASVERADAEAVFERLKVRAATAQAWVAAYTVQRKLQQFEDFYKEN
FT                   RLLAAAIRARLAGGTGATADALAPDQEAAQLDEQKDVLLTQAAQARAALKRWIGEDADP
FT                   QAQAFPRWPVSAPDYLHAIHAHPELATYNALTREAQAQVHQALAEKKSDWGWQVDYQRR
FT                   GPEFSNMVSLQVSFQLPLFAGSRQDPMIAARRAQVRQLEDEQEAALREHKAQLETDLAD
FT                   YQRLQRAVQRSRETLLPLAEDRVRLALADYRAGKSPLSEVLTARRQRVETRLQDIDLQG
FT                   QLAATAARLHFAYGEVRA"
FT   sig_peptide     22697..22780
FT                   /locus_tag="PputGB1_0022"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 28"
FT   gene            23947..25413
FT                   /locus_tag="PputGB1_0023"
FT   CDS_pept        23947..25413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0023"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; KEGG: pap:PSPA7_4014 heavy metal RND efflux
FT                   membrane fusion protein, CzcB family"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95939"
FT                   /db_xref="GOA:B0KEW9"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR021647"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B0KEW9"
FT                   /protein_id="ABY95939.1"
FT                   /translation="MRNSTISLVVLAALAIGGGVGYQLAKRGQVSTASPETLQKVLYWY
FT                   DPMYPQQHFPAPGKSPFMDMPLVPKYQESTAAEVSPAVQVSQGLQQNLGVRLATVAKGQ
FT                   LARTLQVSGVLTFDERDFSVLQARTGGYVERTYGRATGDVVAKGAPLADVLTPEWAGLQ
FT                   EEYLALQRSGDNELRAAARQRLLLAGMPADLINRIDRTGRVQNSVTLLAPTAGVLQALE
FT                   LRPGMTMTPGATLAKINGIANVWLEAAVPEAQAQGLQEGQAVQANLAAFPGEPVPGKLT
FT                   ALLADADLQSRTLRLRIELPNPGGRLRPGMTAQVSLHPSGQQDDSLLVPAEAIIRTGKR
FT                   DLVMVSEDGGRFRPVEVVLGQESAGQVVVLRGLQAGQRVVASGQFLLDSEASLKGIEAV
FT                   TAGDAPLAQPVQPALHQANGRIVQIEGNQLTIAHGPFVTLGMPGMTMTFPVADPRLIAG
FT                   LKVGERIRFGVRERDEGMVIEQITQQENQP"
FT   sig_peptide     23947..24024
FT                   /locus_tag="PputGB1_0023"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.841 at
FT                   residue 26"
FT   gene            25410..28568
FT                   /locus_tag="PputGB1_0024"
FT   CDS_pept        25410..28568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0024"
FT                   /product="heavy metal efflux pump, CzcA family"
FT                   /note="TIGRFAM: heavy metal efflux pump, CzcA family; PFAM:
FT                   acriflavin resistance protein; KEGG: pap:PSPA7_4015 heavy
FT                   metal efflux pump, CzcA family"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95940"
FT                   /db_xref="GOA:B0KEX0"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B0KEX0"
FT                   /protein_id="ABY95940.1"
FT                   /translation="MIANLIRWSVGNRVLVLLATLFAVAWGVFSLRSLPIDALPDLSDV
FT                   QVIIRTSYPGQAPQIVENQVTYPLTTTMLSVPGAKTVRGFSAFGDSFVYVLFEDGTDLY
FT                   WARSRVLEYLSQVQSRLPASAKPVLGPDATGVGWIYQYALVDRSGTHDLAQLRSLQDWF
FT                   LRFELKTLPDVAEVATIGGMVKQYQVVLDPLRMASLGITQVEVSDAIAKANQETGGGVL
FT                   EQGEAEFMVRASGYLKSLDDFRAIPLRLAAKGIPVTLGDVATVQLGPEARRGIGELDGQ
FT                   GEAVGGVVILRSGKNAKDAIAHVKSKLESLEKSLPAGVELVTTYDRSQLIDRAVENLSQ
FT                   KLIEEFIVVALVCAAFLWHLRSSLVAIVSLPVGVLIALIVMRHQGINANIMSLGGIAIA
FT                   IGAMVDAAVVMIENAHKRVEAWHTWHPGKSLRGEDHWKVMTEAAVEVGPALFFSLMIIT
FT                   LSFIPVFTLQAQEGRLFAPLAFTKTYAMAAAAGLSVTLVPVLMGYWIRGRLPAEERNPL
FT                   NRTLIRLYRPALEIVLRRPKLTLAGALLILLSSVWPLSQLGGEFLPPLDEGDLLYMPTA
FT                   LPGLSAQKASELLQRTDRLIRTVPEVASVFGKAGRAESATDPAPLEMFETTVRLKPKDQ
FT                   WRAGMTTEKLIEELDRTVQVPGLTNIWIPPIRNRIDMLATGIKSPIGVKVAGSNLNEID
FT                   RVTLAIEKVAKTVPGVTSALAERLTGGRYIDLDIDRQFAARYGLNIADVQAIVAGAVGG
FT                   ENIGETVEGLARYPISVRYPREWRDSVDALRQLPIYTSQGGRITLGTVARVRIADGPPM
FT                   LKSENARPSGWVYIDVRRRDLSSVVADLRRLVDQQVKLDPGISLSYSGQFEYLERANAR
FT                   LAWVVPATLAIIFVLLYLTFGRLGEALLIMATLPFALTGGVWLLYMMGYNLSVATGVGF
FT                   IALAGVAAEFGVIMLIYLNNAWTERNGNGTQGQPALLDAIREGAVQRIRPKAMTVAVIV
FT                   AGLMPILWSSGTGSEVMSRIAVPMVGGMLTAPLLSLFVIPAAYWLVRRRGLAVHDNPQT
FT                   GVTR"
FT   sig_peptide     25410..25487
FT                   /locus_tag="PputGB1_0024"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.699) with cleavage site probability 0.282 at
FT                   residue 26"
FT   gene            28565..28912
FT                   /locus_tag="PputGB1_0025"
FT   CDS_pept        28565..28912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0025"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pap:PSPA7_4016 heavy metal efflux system
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95941"
FT                   /db_xref="InterPro:IPR021647"
FT                   /db_xref="UniProtKB/TrEMBL:B0KEX1"
FT                   /protein_id="ABY95941.1"
FT                   /translation="MKKLLISAGLVFAVAAAVQAQDMYGTDMKNMPMEGNETQGSQAAP
FT                   TASAEGTIKALEPGKVTLAHGPVSALKWPAMTMGFSATEQQLKGLKVGDKVSFDFRMNG
FT                   GTATIVGIRKQ"
FT   sig_peptide     28565..28627
FT                   /locus_tag="PputGB1_0025"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 21"
FT   gene            complement(29327..29986)
FT                   /locus_tag="PputGB1_0026"
FT   CDS_pept        complement(29327..29986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0026"
FT                   /product="isoprenylcysteine carboxyl methyltransferase"
FT                   /note="KEGG: ajs:Ajs_1466 isoprenylcysteine carboxyl
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95942"
FT                   /db_xref="GOA:B0KEX2"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="UniProtKB/TrEMBL:B0KEX2"
FT                   /protein_id="ABY95942.1"
FT                   /translation="MNHGESAYGLWSLVFINSAIFIMFAFSFFKPATARDWRSFGAFSA
FT                   FIVALFVEMYGFPLTIYLLSGWLQARFPNLDLLSHESGHLWSTLLGDQGNPHFSVLHIA
FT                   SYLFLGFGFYLLSAAWNVLYHAQRRRSLATVGPYGWIRHPQYVAFVLILLGFLLQWPTL
FT                   LTLAMFPVLLVMYGRLAVSEEREMHKQFGAAYEAYTRVTPRFVPHLRERLGGGHRG"
FT   gene            complement(29983..30258)
FT                   /locus_tag="PputGB1_0027"
FT   CDS_pept        complement(29983..30258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0027"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_1465 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95943"
FT                   /db_xref="GOA:B0KEX3"
FT                   /db_xref="InterPro:IPR021682"
FT                   /db_xref="UniProtKB/TrEMBL:B0KEX3"
FT                   /protein_id="ABY95943.1"
FT                   /translation="MNPHFDENGSPHSFWRSRYAIGLVVIGGIAVYFLLTEHLAHVVGA
FT                   LPYLLLLACPLMHVFMHRGHGGHHHQGQSKPAPSDKADIHKPGDPS"
FT   gene            complement(30284..30739)
FT                   /locus_tag="PputGB1_0028"
FT   CDS_pept        complement(30284..30739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0028"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_1464 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95944"
FT                   /db_xref="UniProtKB/TrEMBL:B0KEX4"
FT                   /protein_id="ABY95944.1"
FT                   /translation="MNNVRNLLIGLCLAAASVGAMAQNTDEHSTHHPADAPSAAATEKT
FT                   PSQPMDKGQMAAMDQQMKAMQAMHEKMAAAKTPEARQALMAEHMALMKNGMAMMKSMEG
FT                   GMPEMGGMHGGMGGDMAARHQMMEKRMDMMESMMQMMMDRMPSAASK"
FT   sig_peptide     complement(30671..30739)
FT                   /locus_tag="PputGB1_0028"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            complement(30878..31900)
FT                   /locus_tag="PputGB1_0029"
FT   CDS_pept        complement(30878..31900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0029"
FT                   /product="40-residue YVTN family beta-propeller repeat
FT                   protein"
FT                   /note="TIGRFAM: 40-residue YVTN family beta-propeller
FT                   repeat protein; KEGG: net:Neut_0066 40-residue YVTN family
FT                   beta-propeller repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95945"
FT                   /db_xref="InterPro:IPR011045"
FT                   /db_xref="InterPro:IPR011964"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:B0KEX5"
FT                   /protein_id="ABY95945.1"
FT                   /translation="MMTAKRFSSMALGISLLIPLGLVMANPTGNVYTANERSASISQVN
FT                   LATGDVSTVALPIAPHNLQVSPDGSLLLVVGVAGHAGHSSGEKPGGQLLVFSTSALDRP
FT                   PFSFPAGDHPAHVVTDVTGLRAFVTDSAANQVRVFDLEQRIELPGIPTGRYPHGLRLSP
FT                   DGRTLYIANMKSDSVSLIDVVTLKETAQIPVGKGPVQVGFAPDGRLAFVSLSATNQLGI
FT                   IDTARRKVISKVDVGRTPIQMMATVDGRQVYVANQGSGQNPDDRVSIVDLQTRSSLGTV
FT                   TTGKGAHGVAISSDGAYVFVSNIEAGTVSVIDTSSRKVVATHKVGAGPNGISFEPPSAQ
FT                   "
FT   sig_peptide     complement(31823..31900)
FT                   /locus_tag="PputGB1_0029"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 26"
FT   gene            complement(32166..32357)
FT                   /locus_tag="PputGB1_0030"
FT   CDS_pept        complement(32166..32357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0030"
FT                   /product="Heavy metal transport/detoxification protein"
FT                   /note="PFAM: Heavy metal transport/detoxification protein;
FT                   KEGG: pmy:Pmen_2225 heavy metal transport/detoxification
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95946"
FT                   /db_xref="GOA:B0KEX6"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:B0KEX6"
FT                   /protein_id="ABY95946.1"
FT                   /translation="MEVSGMGCGSCVNKITKAIQAADGDAKVIVDRAAGTVSVQSNIEA
FT                   ERVGALVQALGYPTKVSR"
FT   gene            complement(32704..35220)
FT                   /locus_tag="PputGB1_0031"
FT   CDS_pept        complement(32704..35220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0031"
FT                   /product="copper-translocating P-type ATPase"
FT                   /note="KEGG: pmy:Pmen_2229 copper-translocating P-type
FT                   ATPase; TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; copper-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; YHS domain
FT                   protein; E1-E2 ATPase-associated domain protein; SMART:
FT                   TRASH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95947"
FT                   /db_xref="GOA:B0KEX7"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR007029"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR011017"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR021682"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B0KEX7"
FT                   /protein_id="ABY95947.1"
FT                   /translation="MATCHRHYSYLILLLCPLTQLFGHNHGGYSHQKGENSSKPDNKGN
FT                   YFMHTESCQHDHDHDHSHPYEQPDGSQRDLVCGMTVPPDSRYFELYEGRTYRFCSEKCL
FT                   TKFRAAPVHYLSPPQDQEHAGHLHSAAPQPSNAADAEYTCPMHPQIRQRGPGSCPICGM
FT                   ALEPVIPELEEDENPELKDFSRRFWWTLPLTVIVTVLAMTAHQLQLLHGATQNWVELIL
FT                   ATPVTLWAGWPFFVRGVASIRNRSPNMWTLIGLGTAAAYLYSVAATVFPQVFPTTFMQD
FT                   GRIGVYFEAAAVIISLTLLGQMLELKARSQTSAAIKSLLGLAPKTARRIGADGQEEDIP
FT                   LTHVHTGDHLRVRPGEKVPVDGVVLEGESAIDESMLTGEPVPVMKKAGDALIGATLNTH
FT                   GSLVMAAQKVGAETVLSQIVQMVARAQRSKAPMQRMADTVAGYFVMGVILVALVTLFGW
FT                   GLFGPEPGWVFGLINAVAVLIIACPCALGLATPMSIMVATGKAASSGVLFRDASAIENL
FT                   CKIDTLIVDKTGTLTEGRPVFHSVVGTGQFMPPEVLRLAASLDQGSEHPLAHAIVDHAR
FT                   AHGHSLSKPEAFESGSGIGVRGQVNGKRLQLGNTTLMEEAGLDTSPLRDRAEQLRLEGM
FT                   SIMYLAVDGVLAGLLAVSDPVKPTSKEAVTRLQAEDVKVIMATGDGLTTARAVAKQLGI
FT                   EEVHGEVKPEDKEQLVALLQGDKRRVAMAGDGINDAPALARADVGIAMGTGTDVAMNSS
FT                   QLTLVKGDLMGILRARTLSVATVKNMRQNLGFAFFYNAMGIPLAAGLFYPLTGHLLSPM
FT                   IAALAMSVSSASVVFNALRLKRVVTD"
FT   gene            35491..35697
FT                   /locus_tag="PputGB1_0032"
FT   CDS_pept        35491..35697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0032"
FT                   /product="putative transcriptional regulator"
FT                   /note="KEGG: pap:PSPA7_3842 probable transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95948"
FT                   /db_xref="UniProtKB/TrEMBL:B0KEX8"
FT                   /protein_id="ABY95948.1"
FT                   /translation="MLILLLHQWLPFDNALAALYPGEGVPKPLEEYDAGSRWGTPSMLS
FT                   CLDGLYLLDPFYQACQEGLPSGL"
FT   gene            36052..37248
FT                   /locus_tag="PputGB1_0033"
FT   CDS_pept        36052..37248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0033"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rxy:Rxyl_2639 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95949"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B0KEX9"
FT                   /protein_id="ABY95949.1"
FT                   /translation="MRVEPKASAIHHPQAATAARQFYAGTTRQKIGECLPGRQWATIEP
FT                   YIYPKGLAPLPGNCMQAIDIENAIVLPWGLGSRSPHDLFSVCAEIINCPGDIVLDASNL
FT                   SYIDPLGMATLRALFENQLVQKRVSMQFLSRDLTSYLARMDFFKDIDVEGVDLSGVGRR
FT                   NDRSTSLVEITKISEHHQAEAAASRLARAITGRLTQSDPDAPVDEHTGRNEFDSYRGPL
FT                   EYSLKELLENSLTHARREGRGDAAVWLTCQFYPKLNLVRMAIVDNGCGFLATLRNHPEL
FT                   HDRTHLHAIEAALKPRVSCNRGAMAQILGSENQGIGLTTTAKIADAAGGGLIIVSGNGI
FT                   HDTKRRQSQELHDALWNGVSIAFSCTRELLPTISISDLLPKDDAGQVDDDLDLDLNFR"
FT   gene            complement(37432..37764)
FT                   /locus_tag="PputGB1_0034"
FT   CDS_pept        complement(37432..37764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95950"
FT                   /db_xref="UniProtKB/TrEMBL:B0KEY0"
FT                   /protein_id="ABY95950.1"
FT                   /translation="MGATQDGYLLPGTNEKALNIEGLKFNADPSRGHFLQLSNSIMDHK
FT                   FNDSFDIVGAVFKGKARYHLATLLQNQRPDQLVDEGLSDIVPSEIYDNALTTAERAFDF
FT                   GTVGDR"
FT   gene            38080..38328
FT                   /locus_tag="PputGB1_0035"
FT   CDS_pept        38080..38328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95951"
FT                   /db_xref="UniProtKB/TrEMBL:B0KEY1"
FT                   /protein_id="ABY95951.1"
FT                   /translation="MVFRFLTKREHARRANELHDQLNEVLGVARNLNDGLYFGGADVTV
FT                   LQDFTMLDAEDFVRYNLHDWLSVGDTDEDEEGADDAD"
FT   gene            38639..39562
FT                   /locus_tag="PputGB1_0036"
FT   CDS_pept        38639..39562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0036"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pap:PSPA7_4526 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95952"
FT                   /db_xref="UniProtKB/TrEMBL:B0KEY2"
FT                   /protein_id="ABY95952.1"
FT                   /translation="MDVYKLRIEDTESKIIDKEGFEAETFRRDPWYQPGSAGKLAQFAV
FT                   CPACDNPVQLVGLYELPPNVKNPFGKHATKSIRGIAPFDSEARNDCPYFKPRQHKKTER
FT                   KTRFDGVPRKILKLLIEQFDRVVYILEKETQLVLSENALRGMLQRYKGERGYLYTGATL
FT                   RNVPWIFAYMSDATRLFGQKVSGNAELVKAIAAEVPGAEISSTGRLESKKVPGSKAAYF
FT                   DLKMSFIRHRIVKDSEASGLVESMEFVVSQPRGGELEHIHKEVIKFDSAWFESLIRMPV
FT                   DHPYRRMDRVKMAREELGDLLELTQA"
FT   gene            complement(39747..39911)
FT                   /locus_tag="PputGB1_0037"
FT   CDS_pept        complement(39747..39911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0037"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95953"
FT                   /db_xref="UniProtKB/TrEMBL:B0KEY3"
FT                   /protein_id="ABY95953.1"
FT                   /translation="MKTLYLKVWQSSSLRFVGLSDSFKRLPHQWLTSLDHSNECALHNI
FT                   LLHSAEDEL"
FT   gene            complement(40357..40485)
FT                   /locus_tag="PputGB1_0038"
FT   CDS_pept        complement(40357..40485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0038"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sbn:Sbal195_4409 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95954"
FT                   /db_xref="UniProtKB/TrEMBL:B0KEY4"
FT                   /protein_id="ABY95954.1"
FT                   /translation="MSIKPGPKRTNEDGTPDKRQRVTPEKQKDHPDLKPHKHKKGE"
FT   gene            complement(40608..42305)
FT                   /locus_tag="PputGB1_0039"
FT   CDS_pept        complement(40608..42305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0039"
FT                   /product="protein of unknown function DUF1705"
FT                   /note="PFAM: sulfatase; protein of unknown function
FT                   DUF1705; KEGG: pau:PA14_39020 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95955"
FT                   /db_xref="GOA:B0KEY5"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012549"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR040423"
FT                   /db_xref="UniProtKB/TrEMBL:B0KEY5"
FT                   /protein_id="ABY95955.1"
FT                   /translation="MTPSKSIVHTLLSKWIFAIRNARQKGISTNLLIGLVTFWLLLFAN
FT                   AELWNVLWKLVFKTDEVNWQLAASLPVIVFAWVFTVLSLLSWGRLAKPILCLVLISASF
FT                   ASYFMNAYGIVIDYTMFTNVVETDVAEATELLNWKLGLWVAMVGVLPVYLIARVPLRRK
FT                   PWAKALVSRFIALSLALLTLSGIALSQYQSYASLLRNNREIRLILVPTNLFAAGHGYLK
FT                   RQLASPKTLTAIGTDAVVNRQGAARKPRLLVLAVGETARSANFSLNGYSRETNPELEKR
FT                   NVISFTNVSSCGTATAVSLPCMFLDVGKAQYKDGLAKSREGLLDVLQRAGISVMWTDNN
FT                   SGCKGVCDRVPNHKAASHADSQLCTSEECKDGVLLTEMQDFIKRQEGDAVLVLHYKGSH
FT                   GPAYYKRYPSQFKKFAPVCETNELDKCKQEEVVNAYDNSILYTDYVTANLIDILAANTK
FT                   FDTALMYVSDHGESLGEGGLYLHGLPYAMAPDEQTKVPLVLWMSDSLAKSEKVNVGCLK
FT                   AQTTSPLSHDNLFHTVLGMMNVQTSSYRSALDFTAPCKPFVGGSYSGL"
FT   sig_peptide     complement(42165..42305)
FT                   /locus_tag="PputGB1_0039"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.923) with cleavage site probability 0.823 at
FT                   residue 47"
FT   gene            43189..44094
FT                   /locus_tag="PputGB1_0040"
FT   CDS_pept        43189..44094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0040"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG:
FT                   pfl:PFL_5222 cobalt/cadmium/zinc transporter, CDF family"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95956"
FT                   /db_xref="GOA:B0KEY6"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:B0KEY6"
FT                   /protein_id="ABY95956.1"
FT                   /translation="MGSNHDHGSAAVREGHQKKLIMALGLTGSFMIAEVIGAWITGSLA
FT                   LLSDASHMFTDTAALAISLIALQIAKRPADQKRTFGYARLEILASTFNAVLLFLVAMYI
FT                   LYEAYQRFFMPAEIATGAMMWIAIAGLIINLISMRLLASASNESLNVKGAYLEVWSDML
FT                   GSLGVIIAALIIRFTGWTWVDTIVAVAIGLWVLPRTWQLLRESLGILMEGVPRGLDVTA
FT                   IEATILGVDGVTDVHDLHVWAVSSGSNVMTSHVVVRDSADGDAVLAAVVDAVSDAFEIH
FT                   HCTIQIERAAFHESVPSPSH"
FT   gene            44252..44602
FT                   /locus_tag="PputGB1_0041"
FT   CDS_pept        44252..44602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0041"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mms:mma_3055 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95957"
FT                   /db_xref="GOA:B0KEY7"
FT                   /db_xref="UniProtKB/TrEMBL:B0KEY7"
FT                   /protein_id="ABY95957.1"
FT                   /translation="MAWIITKYLLTAGIVILVSELAKRSDKLGGLVAALPLVTVVTLVW
FT                   LYLENQSMEKISNHAWYTFWYVLPTLPMFIAFPLLLPKLGFWPTLISSILITMASFGGF
FT                   AILLRRFGIELL"
FT   gene            complement(44635..44961)
FT                   /locus_tag="PputGB1_0042"
FT   CDS_pept        complement(44635..44961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0042"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: psb:Psyr_4809 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95958"
FT                   /db_xref="InterPro:IPR021245"
FT                   /db_xref="UniProtKB/TrEMBL:B0KEY8"
FT                   /protein_id="ABY95958.1"
FT                   /translation="MNTTVSAIAVFLLFTSLTANAQSGMEINKRIERTAREATADYAQR
FT                   VKKPMPQLEDYAYGMDLDVGKLVYVSPSVRYCGNVRSMMTYEDSKGELHMVRYLVKGEC
FT                   VNSR"
FT   sig_peptide     complement(44896..44961)
FT                   /locus_tag="PputGB1_0042"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 22"
FT   gene            45651..46325
FT                   /locus_tag="PputGB1_0043"
FT   CDS_pept        45651..46325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0043"
FT                   /product="two component heavy metal response
FT                   transcriptional regulator, winged helix family"
FT                   /note="TIGRFAM: heavy metal response regulator; PFAM:
FT                   response regulator receiver; transcriptional regulator
FT                   domain protein; KEGG: pmy:Pmen_1174 two component heavy
FT                   metal response transcriptional regulator, winged helix
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95959"
FT                   /db_xref="GOA:B0KEY9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR006291"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B0KEY9"
FT                   /protein_id="ABY95959.1"
FT                   /translation="MRVLVVEDEIKTAEYLQQGLSESGYVVDIVHNGVDALHLFNTNVY
FT                   SLVLLDVNLPGIDGWDLLETIRKTSRVRIIMLTARGRINDKLKGLDGGADDYLVKPFEF
FT                   PELLARIRSLQRRGDELVEKSSLKIADLELDSVRHRVFRGGTRIDLTTKEFALLHLLMS
FT                   RTGEALTRSQIISLVWDMNFDCDTNVIDVAIRRLRSKIDDPFETKLIHTLRGVGYVFEE
FT                   RA"
FT   gene            46322..47740
FT                   /locus_tag="PputGB1_0044"
FT   CDS_pept        46322..47740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0044"
FT                   /product="heavy metal sensor signal transduction histidine
FT                   kinase"
FT                   /note="TIGRFAM: heavy metal sensor kinase; PFAM:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   HAMP region domain protein; histidine kinase A domain
FT                   protein; KEGG: pfl:PFL_3148 heavy metal sensor histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95960"
FT                   /db_xref="GOA:B0KEZ0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006290"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B0KEZ0"
FT                   /protein_id="ABY95960.1"
FT                   /translation="MRPFSLAAKLGLKVGLMSAALLLLFATFGYLMVGKALERNARADL
FT                   EVKMAGMAHNLSTIPDISGVNADAHQLVDLVMGHNNLYVSIFDTSQNQTPLLSIGSKQV
FT                   NLEVHKFQPAAQPKEHEWRDTQDRPLLSASRIMRLGDGTEVSVYMTMDQSSSEALLDAL
FT                   LTWALMMSPVILALILAIGWWTVRRGLLPLTKFLKIASKISTESLDHRLPTDGMPAELK
FT                   MLADGINIMLARLDDGVQQLSQFSDDLAHELRAPLSNLMGKAQVALTRERSLSEYREVL
FT                   ESCTEELDRMSRMVSDMLFLAQVSHPASMVEFESVSLVDEVQRVCELFSISAEEGEIQL
FT                   QISGSDDVVRGNRLMVQRAVSNLVSNAIRYCPRGRTVYVKVQHSASGTTLSVGNPGRGI
FT                   AKEHHAHLFERFYRVDKSRARSEGGTGLGLAIVQSIMSLHQGSASVEVTEENFTWFHLH
FT                   FPEAQQMQPAMTAA"
FT   sig_peptide     46322..46423
FT                   /locus_tag="PputGB1_0044"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.951) with cleavage site probability 0.406 at
FT                   residue 34"
FT   gene            complement(47798..48385)
FT                   /locus_tag="PputGB1_0045"
FT   CDS_pept        complement(47798..48385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0045"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95961"
FT                   /db_xref="GOA:B0KEZ1"
FT                   /db_xref="UniProtKB/TrEMBL:B0KEZ1"
FT                   /protein_id="ABY95961.1"
FT                   /translation="MNDIEPWAVAIGDFRRCTEKLTVQLDELTSQTRTSSAVLERSNEL
FT                   VEQVDAVGRQIQEEVRKAEKAWSNAEEVALRAAASAYSAACRGVDTAIQPLISELTAAT
FT                   KAADASIQELKRAPVLAKRYVMVVATAFFILALICVYSTMRLIDAAGSVSAQEKVNAQY
FT                   FSHLWKNANPDEQKIIKSVILRSPMDPVVLRH"
FT   gene            48652..48873
FT                   /locus_tag="PputGB1_0046"
FT   CDS_pept        48652..48873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0046"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95962"
FT                   /db_xref="UniProtKB/TrEMBL:B0KEZ2"
FT                   /protein_id="ABY95962.1"
FT                   /translation="MKFVKSIAIGSLLLGLMGTAYAEGGFERTKQFNENFRTEQARLWS
FT                   DDSSDQNKQQVAQEQKKESKDGKEQADN"
FT   sig_peptide     48652..48720
FT                   /locus_tag="PputGB1_0046"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            complement(48956..50410)
FT                   /locus_tag="PputGB1_0047"
FT   CDS_pept        complement(48956..50410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0047"
FT                   /product="glycosyl transferase family 39"
FT                   /note="PFAM: glycosyl transferase family 39; KEGG:
FT                   pap:PSPA7_5537 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95963"
FT                   /db_xref="GOA:B0KEZ3"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="UniProtKB/TrEMBL:B0KEZ3"
FT                   /protein_id="ABY95963.1"
FT                   /translation="MLNLKNERTLWWVLGSILLLRLVGLGIYPLMDTSEARYAEMARKM
FT                   VELNDWITPMFDYGVPFWGKPPLSFWTQAASMTVFGVNEFAARFPAWLLHLASCFIIIK
FT                   LGTQQISRNAGIWAAIIFSSTTLGLVSSGVVLTDPVLSFSILLASYGFWRWMKCASKAD
FT                   AYLMFAGLGLGLLAKGPLTLVLMGAPAFAWFVIYKEWGRVLRLPWISGLVLMFGISVPW
FT                   YVAAEMKTPGFMEYFFVGEHWSRYVVSNWAGDLYGSAHAKPYGSIWIQLGLSLLPWALF
FT                   LPLLIRKRGSMQRFKAYLWLWALATPVFFTFAGNILWTYLLPALPAWALLLSARVSEVG
FT                   PKTTWAAAASALVLPIIGAGIIYAGVLEERPQNQRDVVQAWLNVQSAHSAPLIYPGRRS
FT                   YSSEFYSSGKSENIKDPAKWPRDGSFYLSRRLRDSKDGLPADLACTSITEANASQLLLC
FT                   HWKRPAQGAEGLAGESNAETPRKNEG"
FT   gene            complement(50404..51387)
FT                   /locus_tag="PputGB1_0048"
FT   CDS_pept        complement(50404..51387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0048"
FT                   /product="Ribonuclease III"
FT                   /EC_number="3.1.26.3"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   vha:VIBHAR_02791 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95964"
FT                   /db_xref="GOA:B0KEZ4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B0KEZ4"
FT                   /protein_id="ABY95964.1"
FT                   /translation="MQTLHRFPERPDPLLTIVVPCFQEEETIPEFHQRITRVVKRLPVS
FT                   CEILYVDDGSNDRTADILRHYQDGSSVRCLSLSRNFGKEAALSAGIDHARGSALIFIDV
FT                   DLQDPPELIAAMVDYWQRGYDVVNMQRNLRIGDSWFKRMSARAYYWVMQRLVEKVDMPA
FT                   DVSDFRLIGPAPLAALRALDERSRILKGMIGWVGFRTIELPYNRTVRHAGSTKWNAAGL
FT                   FNLAIESIVSFSRKPLRIFSLISFGLFVSSICYMLASLVAGSFDIHHLIVGMASFMCVG
FT                   VAMVGEYLGVTLAEVKRRPLYFLKHSNKADPVSLHPSMASIEGKKC"
FT   gene            complement(51353..51772)
FT                   /locus_tag="PputGB1_0049"
FT   CDS_pept        complement(51353..51772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0049"
FT                   /product="GtrA family protein"
FT                   /note="PFAM: GtrA family protein; KEGG: sde:Sde_0136
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95965"
FT                   /db_xref="GOA:B0KEZ5"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:B0KEZ5"
FT                   /protein_id="ABY95965.1"
FT                   /translation="MENQTPPLTTLLIRYLGIGFIATGVHYAVFLLLVTTEFVTPLLAS
FT                   ICGGMVGAIASFIGNRALCFVADGSRKFQPVRFALVALTTNFGNGVGMWFLIKSNLSPL
FT                   ISQVVVTLSLTALGFIAHRFWTFNHADITSLSRAP"
FT   gene            52030..52998
FT                   /locus_tag="PputGB1_0050"
FT   CDS_pept        52030..52998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0050"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: pfl:PFL_2828 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95966"
FT                   /db_xref="GOA:B0KEZ6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0KEZ6"
FT                   /protein_id="ABY95966.1"
FT                   /translation="MVTQNETYTSSVVPYSPDILDDLPIDDQLAVEFFATARCASFKQA
FT                   ARGLNVPVVGLRKRLEKLEEHIGAPVFVYKHNKLALTRTGERVSHYLCQLFGPDGLGKS
FT                   GEKEVPRLTIAITEPVLNDIVNRDLVAYVRDHAEMQLEIHSECTTQMLSECEVDVGIAL
FT                   VSPDDKGALDRHPTYRFERLGRIGHALFISSRYSRSVTLPVESLDLHNFMLVVPWDEEI
FT                   LAGSRKWASIMAEHQGGTTRVKSYNLSRGLVVGGACIGVLPDYSRKLERNILPVPGFLD
FT                   DLEEKDVYLVIKTKLVRNPQVLEIRRLIKKSFFDKKDWLVR"
FT   gene            53209..54516
FT                   /locus_tag="PputGB1_0051"
FT   CDS_pept        53209..54516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0051"
FT                   /product="phosphate-selective porin O and P"
FT                   /note="PFAM: phosphate-selective porin O and P; KEGG:
FT                   pau:PA14_21620 phosphate-specific outer membrane porin OprP
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95967"
FT                   /db_xref="InterPro:IPR010870"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:B0KEZ7"
FT                   /protein_id="ABY95967.1"
FT                   /translation="MIRSSNMREKLLAAAIIGTFSSQAFSGTVTTDGADIVLKTKGGLE
FT                   VSTSDKEFSFKLGGRVQADYGRFDGVFTKNGDTADAGYFRRAYLELGGVLYRDWKYQLN
FT                   YDLSRNTGNDSDGYFDEASLTYTGFKPVQLRFGRFYTDFGLEKATSSKWTTAMERNLSY
FT                   DLADWINDNAGMGVQATSTIADMAYVSGSVFSETNNNSDGDSTKRYNVRGVFAPLHSDG
FT                   NVLHVGAQYAYRDLKNSAVDTRIRSRLGVRGVDTNGGGDAGTNGNRMLFGGAAAQDGLW
FT                   KDDSVWGLEGAWATGPFSVQAEYLRRKLKADQANNDMKASGYYAQMAYTLTGEPRIYKL
FT                   DGAKFDTIKPENKELGAWEVFYRFDDIKVEDGNLVTAADQSNERKAKSHTVGVNWYVNE
FT                   AVKVSANYINVRTDNNENTVGDDSGNAIVTRLQYVF"
FT   sig_peptide     53209..53289
FT                   /locus_tag="PputGB1_0051"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.978 at
FT                   residue 27"
FT   gene            54536..54670
FT                   /locus_tag="PputGB1_0052"
FT   CDS_pept        54536..54670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0052"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95968"
FT                   /db_xref="UniProtKB/TrEMBL:B0KEZ8"
FT                   /protein_id="ABY95968.1"
FT                   /translation="MRKPEALNVLPAFLFLEVIKHGAPSSYLLSLTDDRSCQSSANLM"
FT   gene            54815..55840
FT                   /locus_tag="PputGB1_0053"
FT   CDS_pept        54815..55840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0053"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95969"
FT                   /db_xref="UniProtKB/TrEMBL:B0KEZ9"
FT                   /protein_id="ABY95969.1"
FT                   /translation="MSAKKLLQPLAAQLHASFSASGRPYSHLHLHQLFHAAIGSVAPQV
FT                   AIQDKLPIQVCRDNETRQYNLYAAVERAKTCLGLTDLQAVGVAEEVIEVLRTAGIGVNQ
FT                   VRLLLDPSFSSKTRKKAFKALCKNLDLNELGDRFVPKTATLAIAAGIAPPPKMSWKDRF
FT                   ALAANSPMRGPSELISMVNRDECYLWVFPPTDHHATAPATHDRFFGEKTHPSAEMGMGF
FT                   SIIDSGWTRPKYPLSRQSQETFIQYSLSAPMWSWRAQSDTWRLGNILRSRILDGAPWHN
FT                   EPLSDVLPSGLKSLPRIYGCETCRTLFIENHSDYPDVPTQCQCGEASSTGDQNESSALN
FT                   S"
FT   gene            55968..56192
FT                   /locus_tag="PputGB1_0054"
FT   CDS_pept        55968..56192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0054"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95970"
FT                   /db_xref="UniProtKB/TrEMBL:B0KF00"
FT                   /protein_id="ABY95970.1"
FT                   /translation="MQKSKNKQDTLAAINALVEIAYDQGFADGHGVGNQVGFVAGVMSL
FT                   KAALACGLRHGSPECGKALESLKRIGIDE"
FT   gene            complement(56285..58282)
FT                   /locus_tag="PputGB1_0055"
FT   CDS_pept        complement(56285..58282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0055"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; cadmium-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; E1-E2
FT                   ATPase-associated domain protein; KEGG: mes:Meso_4435 heavy
FT                   metal translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95971"
FT                   /db_xref="GOA:B0KF01"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B0KF01"
FT                   /protein_id="ABY95971.1"
FT                   /translation="MKSLLERPDDQAGHEGHSHEHGGIFGMNTELIFALICGALLGAGA
FT                   LAGKLGLIDRLPLILYVSAYVFGGWFTTKEAVTNIRQKRFEIDSLMLLAAVGAASIGAW
FT                   AEGALLLFLFSLGHSLESYAMGRAKKAIEALSKLAPATAIVRRANGTVEMPVELLVPGD
FT                   VVIVRPNDRLPADGFVVVGSSSINQAPVTGESVPVDKQPVPDAELARSKPDAVDAASKV
FT                   FAGTINGETLIEVEVTRRSTESTLARVIKMVSEAEVRKSPTQRFTDRFQRIFVPLVLLL
FT                   VVGLLFAGIFLDEPFRDSFYRAMAVLVAASPCALAIATPSAILSGIARAARGGVLIKGG
FT                   APLEELGSLNAMAFDKTGTLTEGRPRITDVIPIGGTQIEDLLNVAIAVESMSDHPLAAA
FT                   IVRDGEEMIGTRRRFQAKNMSNMIGRGVRAELDGQFVWIGKVEMFGTNGIPALSKAALE
FT                   AAERLRQSGRTTMVVRRADKDLGAIGLLDTPREGAKEALQKLREMGIERMVMISGDHNR
FT                   VAEAVAKQVGLDEAWGDLMPEDKVKAIKNLRLSAKVAMVGDGVNDAPAMASSSVGIAMG
FT                   AAGSDVALETADIALMADDIRQLPFAVGLSRHTRSIIHQNLFVSLGIVAILVPSTIMGL
FT                   SIGAAVAIHEGSTLLVVFNALRLLAYRRST"
FT   gene            complement(58485..58808)
FT                   /locus_tag="PputGB1_0056"
FT   CDS_pept        complement(58485..58808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0056"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: psp:PSPPH_4839 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95972"
FT                   /db_xref="InterPro:IPR021245"
FT                   /db_xref="UniProtKB/TrEMBL:B0KF02"
FT                   /protein_id="ABY95972.1"
FT                   /translation="MKKLIIAAALVVFSVASQANTFSESKQLQYTKEHQTAVAKYAEKN
FT                   GKPMPEIQDYKYGMKIDVAKFVRQSQDPRTCQVYPRLMTFEDSQGTLKTVRYSMYSQCI
FT                   NNK"
FT   sig_peptide     complement(58749..58808)
FT                   /locus_tag="PputGB1_0056"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.984 at
FT                   residue 20"
FT   gene            complement(58971..62132)
FT                   /locus_tag="PputGB1_0057"
FT   CDS_pept        complement(58971..62132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0057"
FT                   /product="heavy metal efflux pump, CzcA family"
FT                   /note="TIGRFAM: heavy metal efflux pump, CzcA family; PFAM:
FT                   acriflavin resistance protein; KEGG: pen:PSEEN2024 RND
FT                   divalent metal cation efflux transporter CzcA"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95973"
FT                   /db_xref="GOA:B0KF03"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B0KF03"
FT                   /protein_id="ABY95973.1"
FT                   /translation="MFERIIRFAIEQRIVVMIAVLIMAGIGIYSYQKLPIDAVPDITNV
FT                   QVQINTAAPGYSPLETEQRITFPVETAMAGLPGLQQTRSLSRSGLSQVTVIFKDGTDIF
FT                   FARQLINERLQVAKEQLPEGVEAVMGPVSTGLGEIFLWTVEAEDGAVKEDGTPYTPTDL
FT                   RVIQDWIIKPQLRNVPGVAEINTIGGYAKQFLVAPDPKRLATYKLTLNDLVAALESNNA
FT                   NVGAGYIERNGEQLLIRAPGQVGNIEDIANIVITSVDGAPIRISSVADVSIGKELRTGA
FT                   ATENGREVVLGTVFMLIGENSRTVSQAVAAKLADINRTLPKGVVAVTVYDRTNLVEKAI
FT                   ATVKKNLVEGAILVIAILFLFLGNIRAALITAMVIPLSMLFTFTGMFNNKVSANLMSLG
FT                   ALDFGIIVDGAVVIVENAIRRLAHAQHKHGRMLTKTERFHEVFAAAREARRPLIFGQLI
FT                   IMVVYLPIFALTGVEGKMFHPMAFTVVMALLGAMVLSVTFVPAAIAMFVTGKVKEEEGV
FT                   VMRTARLRYEPVLQWVLGHRNIAFSAAVALVVLSGLLASRMGSEFIPSLSEGDFAMQAM
FT                   RVPGTSLTQSVEMQQRLEKAVIAQVPEVERMFARSGTAEIASDPMPPNASDAYIMLKPQ
FT                   DQWPNPKKPRDELIAEVQKAAAGVPESNYELSQPIQLRFNELISGVRSDVAVKVFGDDM
FT                   DVLNNTANKIAAALKAVPGSSEVKVEQTSGLPVLTINIDREKAARYGLNIADVQNSIAI
FT                   AVGGRQAGTLYEGDRRFDMVVRLPETVRTDVAGMSSLLIPVPANAAQGANQIGFIPLSQ
FT                   VANLDLQLGPNQISRENGKRLVIVSANVRGRDLGSFVEEATASLDKKVQIPAGYWTTWG
FT                   GQFEQLQSAAKRLQIVVPVALLLVMTLLFLMFNNLKDGMLVFTGIPFALTGGVVALWLR
FT                   DIPLSISAGVGFIALSGVAVLNGLVMIAFIRGLREEGRTLRQAVDEGALTRLRPVLMTA
FT                   LVASLGFIPMALATGTGAEVQRPLATVVIGGILSSTALTLLVLPALYHWAHRKDEDGDE
FT                   AEVVS"
FT   gene            complement(62157..63407)
FT                   /locus_tag="PputGB1_0058"
FT   CDS_pept        complement(62157..63407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0058"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   pen:PSEEN2023 cobalt-zinc-cadmium resistance protein CzcB"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95974"
FT                   /db_xref="GOA:B0KF04"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B0KF04"
FT                   /protein_id="ABY95974.1"
FT                   /translation="MDNKRKIALAVAAVAALGFGSLAWNNSSGQQAASTAEHGANDGHG
FT                   DEKKAASAAKEEGDEGHGEEGHSEEGGEEEGKLTLSAEQIKAAGVALEAAAPRDLGTVV
FT                   SFPGEIRFDEDRTAHVVPRVPGVVEAVQANLGETVKKGQVLAVIASQQISDLRSEQQAA
FT                   QRRVELARVTFEREKQLWQDKISAEQDYLQARQALQEAEISLANAKQKVGAIGASVNSV
FT                   GGNRYELRAPFDAVVVEKHLTVGEVVSEATNAFILSDLNQVWATFAVPPTDLGKVTTGR
FT                   AVKVSSPDMNVEVEGKVGYVGSLLGEQNRAATVRVTLTNPNGAWRPGLFVNIAVTFQTD
FT                   RVAVAVPEHAVQTVEDKPSVFVRTPDGFDTRPVKLGRRDNGYVEIIDGIEAGAQVATSG
FT                   SFTLKSELGKASAEHGH"
FT   sig_peptide     complement(63336..63407)
FT                   /locus_tag="PputGB1_0058"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.600 at
FT                   residue 24"
FT   gene            complement(63476..64747)
FT                   /locus_tag="PputGB1_0059"
FT   CDS_pept        complement(63476..64747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0059"
FT                   /product="outer membrane efflux protein"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   pen:PSEEN2022 cobalt-zinc-cadmium resistance protein CzcC"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95975"
FT                   /db_xref="GOA:B0KF05"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:B0KF05"
FT                   /protein_id="ABY95975.1"
FT                   /translation="MPRYNRNVLPKTPVSPWKIAALCAVISGLMAPAALAQSISLPQAL
FT                   STAMDANPDLAAARQEIGIADGARKQAGLIPNPTISYDVEDTRRNTSQTTVSLSQTLEL
FT                   GGKRGARVDVATYGQTAAQLELDRRVNGLRADVVQAFYAALRAQTGLDLAKQSLELTER
FT                   GLRIVDGRVRAGKSSPVEATRAQVQLAEAQLQVRRAETEKATAYQQLAQITGSSVTVFD
FT                   RLESPTLSPGLPPRTEDLLAKLDQTAEMRQAVVQIDKSDASLGSEKAQRIPNLTVSVGS
FT                   QYDRSVRERVNTVGLSMPLPLFDRNQGNILSASRRADQARDQRNAVELRLRTETQTALN
FT                   QWSTAMQEVESYDKTILPSAQQAVETATRGFEMGKFGFIEVLDAQRTLIVARGQYLESL
FT                   AAATNARAQVERVYGEVGSTAGTR"
FT   sig_peptide     complement(64637..64747)
FT                   /locus_tag="PputGB1_0059"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 37"
FT   gene            65151..66494
FT                   /locus_tag="PputGB1_0060"
FT   CDS_pept        65151..66494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0060"
FT                   /product="outer membrane porin"
FT                   /note="PFAM: outer membrane porin; KEGG: pen:PSEEN2340
FT                   porin, OprD family"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95976"
FT                   /db_xref="GOA:B0KF06"
FT                   /db_xref="InterPro:IPR005318"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:B0KF06"
FT                   /protein_id="ABY95976.1"
FT                   /translation="MKIKVPLYLAAVSALSGSYAISAQAEDKPEGFIEGSSLTVLNRNF
FT                   YFNRDNRDSTAPTYNSGKGNTNGYSEAWAHAIISKFNSGFTQGTVGFGVDAFAMIGLKL
FT                   DTGDGRNGGRSSFDVLPVDNKGEARDEYTKVGGAAKVRLFDTIVKVGDVFPSTPVVASG
FT                   DSRLLPESFRGVTVENTSIQGLTLQGGRLHAMSQPVSSNLNDNFVTFYGGPVNSPWIGY
FT                   GGGDYSINDNWTVSVYASQLKDVWNQYYAGTSVVYPLSDDLALIGGFNYYKAVDEGKKR
FT                   LGEFDNNIWSAKVGVRYGAHTLALSHQRNNGDDDFDYLRQSDSIFVDNSIQYSDFNSPK
FT                   ERSWMLRYDLNFTSYGIPGLTFMTRYARGSGADYSNANQFYMRTDDNGNPLDNQKRWER
FT                   DVEVKYVVQTGPAKDLSFRLRQATTRATAFESDLDETRVIIEYPLSIL"
FT   sig_peptide     65151..65228
FT                   /locus_tag="PputGB1_0060"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.988 at
FT                   residue 26"
FT   gene            66984..67658
FT                   /locus_tag="PputGB1_0061"
FT   CDS_pept        66984..67658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0061"
FT                   /product="two component heavy metal response
FT                   transcriptional regulator, winged helix family"
FT                   /note="TIGRFAM: heavy metal response regulator; PFAM:
FT                   response regulator receiver; transcriptional regulator
FT                   domain protein; KEGG: pfl:PFL_5221 DNA-binding heavy metal
FT                   response regulator, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95977"
FT                   /db_xref="GOA:B0KF07"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR006291"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B0KF07"
FT                   /protein_id="ABY95977.1"
FT                   /translation="MRILVIEDEVKTAEYVRQGLTECGYVVDCVHTGSDGLFLAKQHEY
FT                   ELIILDINLPEMDGWQVLELLRRKNCPSRIMMLTARSRLADKVRGLENGADDYLIKPFE
FT                   FPELLARVRALMRRSDHPASVEVIRVADLELDQSRHRAFRDGQRIDLTTKEFALLHYLM
FT                   RNTGVVLSRTQIISQVWDMNFDCDTNVVEVSIRRLRAKIDDPFETKLIHTLRGVGYVLE
FT                   KR"
FT   gene            67776..68099
FT                   /locus_tag="PputGB1_0062"
FT   CDS_pept        67776..68099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0062"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: yen:YE1651 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95978"
FT                   /db_xref="UniProtKB/TrEMBL:B0KF08"
FT                   /protein_id="ABY95978.1"
FT                   /translation="MRYSIDYQQVSQGQSDASIDACPADIVFNSDHGLALIPCVGDVIN
FT                   LPSTAVKEGVCGIVRSRIFNYLRGPEELYCHVNILVEEADINFESLISEYMRNQSRARS
FT                   PSS"
FT   gene            complement(68201..68728)
FT                   /locus_tag="PputGB1_0063"
FT   CDS_pept        complement(68201..68728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95979"
FT                   /db_xref="GOA:B0KF09"
FT                   /db_xref="UniProtKB/TrEMBL:B0KF09"
FT                   /protein_id="ABY95979.1"
FT                   /translation="MSIQGLKRYFGNKIHAVIMMAPLKREMIRLGICTLMAIILNIILY
FT                   TGVEVDGTIKPWAETPIKLFASSMLFAFMIKAFLPVLGWTILKAMLLSANNAFSGILSF
FT                   LGNQFTGVMYCTGIIMGSITIKLYMVSGVLDSEFAYLSAIVFASGVLYFYVLQCAIQKT
FT                   MSPALRTPAVPR"
FT   gene            complement(68918..70345)
FT                   /locus_tag="PputGB1_0064"
FT   CDS_pept        complement(68918..70345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0064"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nwi:Nwi_0260 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95980"
FT                   /db_xref="UniProtKB/TrEMBL:B0KF10"
FT                   /protein_id="ABY95980.1"
FT                   /translation="MHFDGCRDQRMKEIAAPMFDLIALSLPRGLGFGDSPPVGAWLSED
FT                   GISCAALTRNINSGSFGIVTLRRRVDSVWVLLSHGECTTGESEARASISHFLYTQAHPL
FT                   PLPSGERRRAPLSRMGKRTPSVVFKSLFDPSRRIGAWALNQLYLALPSPDRNWVPDCQT
FT                   ENFHTRLWEAHLLAIFREQGLLVTQPKESPDFHIENRLGDEAWVEAVTANPEERYEHFG
FT                   ASPVPPPADRHERFLGAAAERFARTIQNKLDKRYESLPHVEGKPLILALADFHAPSSML
FT                   WSRESLISYLYGFAVHSSAHRGTHLITVEEETSLLSGRPNGLFTLMENAHLSAVIFTNA
FT                   CTVPKLSRVPISGGAHLDGYRYLRFGEFFDRSPGASRGIPFLLDVASSDYGQLWPQYGY
FT                   EPWSAEVEVFHNPMALYPVPNELIPEVTHWREVNGRVECESFFDVSILRSRTLVLSANA
FT                   KVPSLDELLTAASPPEL"
FT   gene            complement(70397..70798)
FT                   /locus_tag="PputGB1_0065"
FT   CDS_pept        complement(70397..70798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0065"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95981"
FT                   /db_xref="UniProtKB/TrEMBL:B0KF11"
FT                   /protein_id="ABY95981.1"
FT                   /translation="MANPNLLALFRDEVLLTGPESSLPSNLSQFWLEELQSHLERYFDG
FT                   LNSDSDAEEKDLDISLPLAAIIHILFAKNGGEEISESSEKLYEYFQDYRLELALEEITR
FT                   KTHVAAEAATIETIFTNRDVLVEQGPLLQ"
FT   gene            complement(71537..71944)
FT                   /locus_tag="PputGB1_0066"
FT   CDS_pept        complement(71537..71944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0066"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B1530 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95982"
FT                   /db_xref="InterPro:IPR024572"
FT                   /db_xref="UniProtKB/TrEMBL:B0KF12"
FT                   /protein_id="ABY95982.1"
FT                   /translation="MKKTLTVICAALVLSAPLASFAQSGPPDRHDGGPSHQGNPPHGQP
FT                   QQQGRHDNGRGPAYRDPNFHPQQGMPVPHQQWQRGHAVDPHYRGDRYWVTDWKARHLYA
FT                   PPRDHRWLYVNGDYVLVAIASGVIVNILSGY"
FT   sig_peptide     complement(71876..71944)
FT                   /locus_tag="PputGB1_0066"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.938 at
FT                   residue 23"
FT   gene            complement(72074..73366)
FT                   /locus_tag="PputGB1_0067"
FT   CDS_pept        complement(72074..73366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0067"
FT                   /product="putative sigma54 specific transcriptional
FT                   regulator"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; ATPase associated with
FT                   various cellular activities AAA_5; PAS fold-4 domain
FT                   protein; SMART: AAA ATPase; KEGG: pen:PSEEN0005 sigma-54
FT                   dependent transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95983"
FT                   /db_xref="GOA:B0KF13"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B0KF13"
FT                   /protein_id="ABY95983.1"
FT                   /translation="MPEAHPLILALVSYLEHDALPTIVLDTDYNILAANAAYRRQFGRH
FT                   DQAPLGEKCHKVSHHYAVPCDQAGEHCPMRKAWDSKVPERVLHIHHTPRGPEHVDVELR
FT                   PILDEQGRVVAFVERLTTITLASAQPQEQGLVGRAPTFKAALASLQRAAPAQIPVLLQG
FT                   ESGTGKELFARALHMGSPRANGPLVVVDCTGLTESLFESELFGYEKGAFTGAHQRKIGL
FT                   AEAAHGGTLFLDEIGEVPLAMQVKLLRLIESGSFRPVGSLRTVHSDFRLVSATHKPLKQ
FT                   MVADGTFREDLYYRISGFPIRLPALRERVEDLPLLAQSLLQRMAGKPTPRLSDDALQQL
FT                   GLHPFPGNIRELRNILERARLFADDGLIRPEHFPADIGPAGAITTGSRRNDLGALAQAL
FT                   EQFKGSRSELASHLGMSERTLYRRLKALGLN"
FT   gene            73589..74473
FT                   /locus_tag="PputGB1_0068"
FT   CDS_pept        73589..74473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0068"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   pen:PSEEN0007 metallo-beta-lactamase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95984"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B0KF14"
FT                   /protein_id="ABY95984.1"
FT                   /translation="MIIGNNLHVDAFFDEATSTISYLVMDRETRQCALIDSVLDYDPKS
FT                   GRTCSASADRLIERVSELNASVRWVLETHVHADHLSAAAYLKEKLGGHTAIGAHITQVQ
FT                   KVFGALFNAEPGFARDGSQFDVLLEDEEGFRIGNLHARALHTPGHTPACMSFMIEDAGE
FT                   IAVFVGDTLFMPDYGTARCDFPGADARTLYRSIRRLLAFPDQTRLFMCHDYLPGGRDMQ
FT                   YVTTVAEQRAHNIHIHQGIDEDSFVAMREARDKTLDMPVLILPSVQVNMRSGQLPAPEA
FT                   NGVSYLKIPLNKL"
FT   gene            74514..75782
FT                   /locus_tag="PputGB1_0069"
FT   CDS_pept        74514..75782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0069"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: pen:PSEEN0008 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95985"
FT                   /db_xref="GOA:B0KF15"
FT                   /db_xref="InterPro:IPR015904"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B0KF15"
FT                   /protein_id="ABY95985.1"
FT                   /translation="MPALLSPANTDHHKVVIVGAGAAGIATASSLISRDPSLDVALIDP
FT                   AEVHYYQPGWTMVGAGVFKAPSTARTMASTIPRGVRWVKARVEGFDPLSQLVMLEGGRS
FT                   ISYEQLIVCPGLKLDWAAIDGLSETLGRNGVTSNYRYDLAPYTWELVQKLKQGHAVFSQ
FT                   PPMPIKCAGAPQKALYLSCDHWLRHGYLGAVKASFFNAGAVLFGVADYVPALMKYIEKY
FT                   AVDLNFSHRLVAVDGPNKRATFVRTLADGSSETRIESFDMLHVVPPQVAPDFIRESPLA
FT                   DSTGWVDVDPHTLRHRKYTNVHALGDVANTSNAKTAAAARKQAPVVANNVLVALGRLPS
FT                   LAQYDGYGSCPLTVERGKIVLAEFTYGGKLAPSFPSWLLDGRKPTRLAWLLKAQALPPL
FT                   YWQGMLKGREWLARPQLVAEGGQ"
FT   gene            75779..76597
FT                   /locus_tag="PputGB1_0070"
FT   CDS_pept        75779..76597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0070"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   pen:PSEEN0009 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95986"
FT                   /db_xref="GOA:B0KF16"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:B0KF16"
FT                   /protein_id="ABY95986.1"
FT                   /translation="MIEHQLLGAGLGAIIGAVLALTGAGGGILAVPLLVFGLGLSMVEA
FT                   APVGLLAVGLAAAVGAVLGLRQGLVRYRAALFIALVGVAAAPFGLMLAHRLPNTPLQLV
FT                   FAGVLVYACLRIWRKAAKELRGEANDAHRYIEPCVLNPLQGRLRWTLPCARALAFTGAL
FT                   SGLLSGLLGVGGGFVIIPALNRYTNLRMASIVSTSLAVIALVSTGSVVSASLAGVMHWQ
FT                   VGAPFAVGAVLGLLLARPLAARLAGPRLQQMFAVAGWTAALLLAGKSLLG"
FT   sig_peptide     75779..75841
FT                   /locus_tag="PputGB1_0070"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.936) with cleavage site probability 0.692 at
FT                   residue 21"
FT   gene            complement(76586..77473)
FT                   /locus_tag="PputGB1_0071"
FT   CDS_pept        complement(76586..77473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0071"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: pen:PSEEN0010 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95987"
FT                   /db_xref="GOA:B0KF17"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0KF17"
FT                   /protein_id="ABY95987.1"
FT                   /translation="MFDWNDLRFFLELQRSGRLLTAAKRLNTTHSTVARHIESIEQSLG
FT                   TALFVQHAQGYELTPSGQALLKHAEAMENVALLAQEEITQAITPLGKIRLGVTEGIGIM
FT                   FFTPRMNALFERYPGLEVELVAVPRFVSILNREAEISIHLERPNADLLITRKLTDYRLA
FT                   LYASQDYLHRAPPLRNREDLARHSWIGYVDDLLFSQELLFLNSFCRAPNVVFRSTSVIA
FT                   QQAAARAGLGIAVLPNYMARHDPTLVRVLPGETIQRSYWICTRRELHKSVRLRVVWDYL
FT                   LALCAAQQDELLAQ"
FT   gene            77652..79298
FT                   /locus_tag="PputGB1_0072"
FT   CDS_pept        77652..79298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0072"
FT                   /product="glucose-methanol-choline oxidoreductase"
FT                   /note="PFAM: glucose-methanol-choline oxidoreductase; GMC
FT                   oxidoreductase; KEGG: pen:PSEEN0012 oxidoreductase, GMC
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95988"
FT                   /db_xref="GOA:B0KF18"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B0KF18"
FT                   /protein_id="ABY95988.1"
FT                   /translation="MPSADSVFDYVVVGAGPAGCLLANRLSADPSCRVLLLEAGGRDNY
FT                   PWIHIPVGYLYCIGNPRTDWCFRTEAQPGLGGRALGYPRGKVLGGCSSINGMIYMRGQA
FT                   ADYDQWAEQGNGGWAWKDVLPLFKASENHFAGASEHHGADGEWRVERQRYSWPILDAFR
FT                   DAAEQSGIGKVDDFNTGDNEGCGYFQVNQRSGVRWNASKAFLRPIKGRANLTVLTGVQV
FT                   EQVLLNNTRARAVKAFWQGAWHEFAARREIILCAGAVGSPGILQRSGIGPRQLLETLGI
FT                   GVRHDMPGVGGNLQDHLQLRLIYQIRNTRTLNQMANSLWGKMGMGLRYLYDRSGPLAMA
FT                   PSQLGAFVRSSTDQATANLQYHVQPLSLERFGEPLHQFPAFTASVCNLHPASRGRIDIC
FT                   STDMNSTPLINPNYLSDPQDLRVAADAIRLTRRIVQAPALAAFEPKEYLPGPALQSEEE
FT                   LFDAAGKIGTTIFHPVGTCRMGNGAMDVVDNQLRVHGIPGLRVADASIMPQITSGNTCS
FT                   PTLMIAEKAAQLILKGAATQTYLNEDALPTP"
FT   gene            79396..81015
FT                   /locus_tag="PputGB1_0073"
FT   CDS_pept        79396..81015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0073"
FT                   /product="General substrate transporter"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: pen:PSEEN0013 major
FT                   facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95989"
FT                   /db_xref="GOA:B0KF19"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B0KF19"
FT                   /protein_id="ABY95989.1"
FT                   /translation="MSDYIQEQGAAASSSSRREERKIIFASSLGTVFEWYDFFLYGALA
FT                   AVISKQFFAGVNDTTAFIFALMAFAAGFLVRPFGALVFGRLGDMIGRKYTFLVTIVLMG
FT                   LSTFAVGLLPTYASIGIAAPIILVILRMLQGLALGGEYGGAATYVAEHAPPGKRGLHTG
FT                   FIQSTATLGLLLSLLVVLGSRYISGDQFETWGWRLPFLLSIVLLAISTWIRMSMHESPA
FT                   FVKMKAQGKISKSPIRESFTSWPNLKVVLTALFSINAGQAVTFYTAQFYVLFFMTQMLK
FT                   MDPAQANTLLIISVVIGAPFFVFFGWLSDRIGRKPILMLGLLLATVLYFPLFKALSHYA
FT                   NPQIDAASRQAPIVVTADPQSCTFQFDPVGKARFDSPCDKVKTFLVKQGLPYSSVSVAG
FT                   SDVVVNIGEKTINGFDETAMRSAIEQAGYPAKADPEQVNQVMVVVLIVAMILIATMTYG
FT                   PLAAVMVELFPTRIRYTSMSLPYHIGNGWFGGFLPTVSFALVVYTGDIFYGLWYPVLVT
FT                   GISLVVGIFCLKETKDVDIDKV"
FT   gene            complement(81193..81978)
FT                   /locus_tag="PputGB1_0074"
FT   CDS_pept        complement(81193..81978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0074"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; KEGG:
FT                   pen:PSEEN0014 N-acylhomoserine lactone synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95990"
FT                   /db_xref="GOA:B0KF20"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:B0KF20"
FT                   /protein_id="ABY95990.1"
FT                   /translation="MVQATMSILQAIRIFLFYLLLGTSSLLWCSLSFFIAPFLSFPKRY
FT                   KFINVYWCRCALFLVRTILGIDYKITGAENVPDEPCVILSNHQSTWETFFLSQYFSPLS
FT                   QVLKRELLYVPFFGWAMAMLRPIAINRDNPKEALRQVASKGDELLKQKTWVLIFPEGTR
FT                   VPFGTIGKFSRGGTALAVNAGLPVLPIAHNAGKFWPKTGWGKRAGTIEVVIGEPMYANG
FT                   TGPRAIAELNDRAAAWNEATQRAMGSLPPAAEKPQEQMA"
FT   gene            complement(82025..82552)
FT                   /locus_tag="PputGB1_0075"
FT   CDS_pept        complement(82025..82552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0075"
FT                   /product="histidinol-phosphate phosphatase family protein"
FT                   /note="TIGRFAM: histidinol-phosphate phosphatase family
FT                   protein; hydrolase, HAD-superfamily, subfamily IIIA; KEGG:
FT                   pen:PSEEN0015 histidinol-phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95991"
FT                   /db_xref="GOA:B0KF21"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B0KF21"
FT                   /protein_id="ABY95991.1"
FT                   /translation="MKLLILDRDGVINYDSDAYIKTLEEWVPIPGSVEAIAQLSKAGWT
FT                   VAVATNQSGIARGYYPLATLEAMHARLRALVAEQGGEVGHIVYCPHGPDEGCDCRKPKP
FT                   GMLRAIAAHYQAGLEGVWFVGDSKGDLEAALAVGAQPVLVKTGKGERTLEKGVPETTLI
FT                   FDDLAAIARELI"
FT   gene            complement(82556..84607)
FT                   /locus_tag="PputGB1_0076"
FT   CDS_pept        complement(82556..84607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0076"
FT                   /product="glycyl-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="KEGG: pen:PSEEN0016 glycyl-tRNA synthetase, beta
FT                   chain; TIGRFAM: glycyl-tRNA synthetase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95992"
FT                   /db_xref="GOA:B0KF22"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KF22"
FT                   /protein_id="ABY95992.1"
FT                   /translation="MSAQDFLVELGTEELPPKALASLGDAFLAGIEKGLQAAGLNYTGK
FT                   QVYAAPRRLAVLIRQLDVQQPDRSINIDGPPMQAAFKDGEPTQAALGFAKKCGVELAEI
FT                   DQSGAKLRFSQHIPGKATASLLPTIIEDSLNDLPIPKRMRWAASREEFVRPTQWLVMLL
FT                   GDQVVDCTILSQKAGRESRGHRFHHPENVVITTPANYVEDLRKAYVLADFAERRELISK
FT                   RTAELAMQQEGTAIVPPALLDEVTALVEWPVPLVCSFEERFLEVPQEALITTMQDNQKY
FT                   FCLLDSEGKLLPRFITVANVESRDPKQIVQGNEKVVRPRLTDAEFFFKQDKKQPLETFN
FT                   ERLKNVVFQAQLGTVYDKAERVSKLAAFIAPLIGGDAQRAGRAGLLSKCDLATEMVGEF
FT                   PEMQGVAGYYYALNDGEPQDVALALNEQYMPRGAGAELPQTLTGAAVAIADKLDTLVGI
FT                   FGIGMLPTGSKDPYALRRAALGVLRILIEKQLDLNLTGAVEFAVKQFGAKVKAAGLAEQ
FT                   VLEFIFDRLRARYEDEGIDVATYLSVRALQPGSALDFDQRVQAVQAFRKLPEAEALAAV
FT                   NKRVSNLLSKAEGAIAEQVEPKYFDNANEFSLYSAIQQADQAVQPMAAARQYSESLARL
FT                   AALRDPVDAFFEAVMVNAEDAKVRANRYALLSRLRGLFLGVADISLLG"
FT   gene            complement(84604..85551)
FT                   /locus_tag="PputGB1_0077"
FT   CDS_pept        complement(84604..85551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0077"
FT                   /product="glycyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="KEGG: pen:PSEEN0017 glycyl-tRNA synthetase, alpha
FT                   chain; TIGRFAM: glycyl-tRNA synthetase, alpha subunit;
FT                   PFAM: glycyl-tRNA synthetase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95993"
FT                   /db_xref="GOA:B0KF23"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KF23"
FT                   /protein_id="ABY95993.1"
FT                   /translation="MSQPTPAVRTFQDLILALQNYWAAQGCVVLQPYDMEVGAGTFHTA
FT                   TFLRAVGPETWNAAYVQPSRRPADGRYGENPNRLQHYYQFQVVLKPNPANFQELYLGSL
FT                   KAIGLDPLVHDIRFVEDNWESPTLGAWGLGWEIWLNGMEVTQFTYFQQVGGIECYPVTG
FT                   EITYGLERLAMYIQGVDSVYDLVWADGPFGKVTYGDVFHQNEVEQSTYNFEHANVDKLF
FT                   ELFDFYESEANRLIKLDLPLPTYEMVLKASHTFNLLDARRAISVTERQRYILRVRTLAR
FT                   DVAQSYLQARARLGFPMATPELRDEVLAKLEAAQ"
FT   gene            85635..86186
FT                   /locus_tag="PputGB1_0078"
FT   CDS_pept        85635..86186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0078"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /EC_number="3.2.2.20"
FT                   /note="KEGG: pen:PSEEN0018 3-methyl-adenine DNA glycosylase
FT                   I, constitutive; TIGRFAM: DNA-3-methyladenine glycosylase
FT                   I; PFAM: methyladenine glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95994"
FT                   /db_xref="GOA:B0KF24"
FT                   /db_xref="InterPro:IPR004597"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:B0KF24"
FT                   /protein_id="ABY95994.1"
FT                   /translation="MPRCFWCTDDPLYQAYHDQEWGTPQRDPALLFEMLLLEGFQAGLS
FT                   WITVLRKRERYRQVMYGFDPVKLAAMSDERIEELMQDAGIIRNRLKLKAARRNAQAWLA
FT                   VDNPAQWLWSFVGGEPKINHFKGRGEVPAVTDEATAMSKALQKAGFTFVGPTICYAFMQ
FT                   ATGMVMDHTTDCDRYAALLR"
FT   gene            86228..87115
FT                   /locus_tag="PputGB1_0079"
FT   CDS_pept        86228..87115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0079"
FT                   /product="lipid A biosynthesis acyltransferase"
FT                   /note="PFAM: lipid A biosynthesis acyltransferase; KEGG:
FT                   pen:PSEEN0019 lipid A biosynthesis lauroyl acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95995"
FT                   /db_xref="GOA:B0KF25"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:B0KF25"
FT                   /protein_id="ABY95995.1"
FT                   /translation="MEKFKGALMVGVLRLFAKLPWGAVQRVGAGIGWLMWKVPNGSRNV
FT                   VRINLAKCFPEMDPVAREQLVGQALRDIGKSFVESACAWIWPPQRSLELVKEVHGLEVL
FT                   EQALASGKGVVGITSHLGNWEVLNHFYCNQCKPIIFYRPPKLKAVDDLLREQRVQMGNR
FT                   VAPSTKEGILSVIKEVRRGGQVGIPADPEPAESAGVFVPFLGTQALTSKFVPNMLAGGK
FT                   AVGVFLHALRLPDGSGFKVFLEAAPEEMYSTDVNVSAAAMSKVVERYVREYPSQYMWSM
FT                   KRFKKRPAGEPRWY"
FT   gene            complement(87233..87541)
FT                   /locus_tag="PputGB1_0080"
FT   CDS_pept        complement(87233..87541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0080"
FT                   /product="Tetratricopeptide domain protein"
FT                   /note="SMART: Tetratricopeptide domain protein; KEGG:
FT                   pen:PSEEN0021 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95996"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B0KF26"
FT                   /protein_id="ABY95996.1"
FT                   /translation="MRESLEKMLAKGVDNPLLRFGLGKAWLDEGNGVEAAVHLARCVEQ
FT                   DPKYSAAWKLLGKAYQLQGDLTAARKAWEDGIVAAQAHGDKQAEKEMTVFLKKLNKV"
FT   gene            complement(87553..88926)
FT                   /locus_tag="PputGB1_0081"
FT   CDS_pept        complement(87553..88926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0081"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; TrkA-C domain protein;
FT                   KEGG: pen:PSEEN0022 potassium transport protein,
FT                   NAD(P)-binding (trk family)"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95997"
FT                   /db_xref="GOA:B0KF27"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:B0KF27"
FT                   /protein_id="ABY95997.1"
FT                   /translation="MKIIILGAGQVGGTLAEHLASEANDITVVDTDGDRLRDLGDRLDI
FT                   RTVQGRGSLPTVLRQAGADDADMLVAVTNSDETNMVACQVAYSLFHTPTKIARVRESSY
FT                   LTREELFDNDHIPVDVLISPEQVVTNYIKRLIEHPGSLQVIDFAEGKAQLVAVKAYYGG
FT                   PLVGQQLRQIRAHMPNVDTRVAAIFRRDRPITPRGDTVIEADDEVFFIAAKKDIRAVMG
FT                   ELRRIDETNKRIVIAGGGQIGERLAEAIESRYQVKIIEMSPARCRHLSDTLESTVVLQG
FT                   SASDKDLMLEENIADADIFLALTNDDEANIMSSLLAKRLGAGKVMTIINNPAYVDLVQG
FT                   GDIDIAISPQLATIGTLLAHVRRGDIVSVHSLRRGAAEAIEAVAHGDSKSSKVVGKAIE
FT                   DIALPPGTTIGAIIRDEEVMIAHDDTMIESGDHVILFVVDKKHIRDVEKLFHVGLSFF"
FT   gene            complement(88950..90260)
FT                   /locus_tag="PputGB1_0082"
FT   CDS_pept        complement(88950..90260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0082"
FT                   /product="sun protein"
FT                   /note="TIGRFAM: sun protein; PFAM: Fmu (Sun) domain
FT                   protein; NusB/RsmB/TIM44; KEGG: pen:PSEEN0023 ribosomal RNA
FT                   small subunit methyltransferase B (rRNA
FT                   (cytosine-C(5)-)-methyltransferase) (16S rRNA m5C967
FT                   methyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95998"
FT                   /db_xref="GOA:B0KF28"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:B0KF28"
FT                   /protein_id="ABY95998.1"
FT                   /translation="MNPRLAAARALAAVLSGKASLNSSLPAQLDKVDERDRGLTQDLAF
FT                   GTARWQPRLDLLAAQLLQKPFKAADADVQALLLVGLYQLFYTRIPAHAAIGETVGCADK
FT                   LKKPWAKGLLNAVLRRAQREGEELLASMERDPVVRTAHPRWLQKALKAFWPAQWEAICA
FT                   ANNAHPPMILRVNRRHHSRDAYLALLAEAGIGASACQYSRDGIVLAEACDVRGLPGFAE
FT                   GWVSVQDEAAQLSADLLELAPGQRVLDACCAPGGKTCHLLEAEAGLAHVVAIDLEAKRL
FT                   IRVRENLDRLKLDAELIACDARDTASWWDGKPFQRILLDAPCSATGVIRRHPDIKLTRQ
FT                   ADDIPALAALQGELLDALWPTLEVGGMLLYATCSSLPTENTEVIDAFLARTPGARELDL
FT                   ATEAGLRQPHGRQLLAQEGGHDGFYYAKLIKIAASRG"
FT   sig_peptide     complement(90195..90260)
FT                   /locus_tag="PputGB1_0082"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.884) with cleavage site probability 0.547 at
FT                   residue 22"
FT   gene            complement(90257..91189)
FT                   /locus_tag="PputGB1_0083"
FT   CDS_pept        complement(90257..91189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0083"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /note="TIGRFAM: methionyl-tRNA formyltransferase; PFAM:
FT                   formyl transferase domain protein; KEGG: pen:PSEEN0024
FT                   methionyl-tRNA formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABY95999"
FT                   /db_xref="GOA:B0KF29"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KF29"
FT                   /protein_id="ABY95999.1"
FT                   /translation="MRIVFAGTPEFAAEHLKALLDSPYEIVAVYTQPDRPAGRGQKLMP
FT                   SAVKALAVAHDIPVFQPQTLRNADAQAELAALKPDLMVVVAYGLILPQAVLDIPRLGCI
FT                   NSHASLLPRWRGAAPIQRAVEAGDAESGVTVMRMEAGLDTGPMLLKVVTPISADDTGGT
FT                   LHDRLAEMGPPAVVQAIAGLADGSLQGEVQDDALATYAHKLNKDEARIDWSRPAVELER
FT                   LIRAFNPWPVCHSTLDGESVKVLAANLSTGKGAPGEILSASKDGLVVACGDQALSLTRL
FT                   QLPGGKALSFSDLFNSRREKFAAGKVLGQ"
FT   gene            complement(91250..91756)
FT                   /locus_tag="PputGB1_0084"
FT   CDS_pept        complement(91250..91756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0084"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="KEGG: pen:PSEEN0025 peptide deformylase 1; TIGRFAM:
FT                   peptide deformylase; PFAM: formylmethionine deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96000"
FT                   /db_xref="GOA:B0KF30"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:B0KF30"
FT                   /protein_id="ABY96000.1"
FT                   /translation="MAILNILEFPDPRLRTIAKPVTEFDDALRQLIDDMFETMYEAPGI
FT                   GLAATQVNVHLQVVVMDLSEDRSEPRVFINPTVEELTHDMGQYQEGCLSVPGFYENVDR
FT                   PLRVRVKAQDRDGKPFELECEGLLAVCVQHEFDHLNGKLFVDYLSQLKRDRIKKKLEKQ
FT                   HRQQA"
FT   gene            91963..93060
FT                   /locus_tag="PputGB1_0085"
FT   CDS_pept        91963..93060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0085"
FT                   /product="DNA protecting protein DprA"
FT                   /note="TIGRFAM: DNA protecting protein DprA; PFAM: SMF
FT                   family protein; KEGG: pen:PSEEN0026 smf protein, DNA
FT                   processing chain A"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96001"
FT                   /db_xref="GOA:B0KF31"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:B0KF31"
FT                   /protein_id="ABY96001.1"
FT                   /translation="MPRYHSSLCPPAELEARLRLHRLPETGLRRFRTLLDAFGSASCAL
FT                   SAPGAAWRALGIPQATIDARRSAEVRDGALAAMAWLERPGQHLLMWDDPGYPALLAETD
FT                   DAPPLLFVAGEPALLDRPQLAIVGSRRATPPALDTARAFSRYLAQAGFTITSGLAVGVD
FT                   GAAHRAALQAGGCTIAVLGTGLQKLYPQRHHELAQAMIDNGSALVSEYPLDAGPLPGNF
FT                   PRRNRIISGLSLGVLVVEASLASGSLITARLAAEQGREVYAIPGSIHHPGAKGCHQLIR
FT                   DGALLVESVEQILESLKGWQNLPPAVVDRFEHPLLALLHAAPQTSESLAHCSELPLAEV
FT                   LAQLTELELDGRVSNEAGRWFARAG"
FT   gene            93103..93660
FT                   /locus_tag="PputGB1_0086"
FT   CDS_pept        93103..93660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0086"
FT                   /product="SUA5/yciO/yrdC domain"
FT                   /note="PFAM: SUA5/yciO/yrdC domain; KEGG: pen:PSEEN0027
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96002"
FT                   /db_xref="GOA:B0KF32"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR023535"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KF32"
FT                   /protein_id="ABY96002.1"
FT                   /translation="MVSSFRVQQAAREIRAGAVIAYPTEAVWGLGCDPWNEDAVYRLLA
FT                   LKSRPVDKGLILIADNIRQFDFLFEDFPEDWIERMGSTWPGPNTWLVPHQDLLPEWVTG
FT                   KHDTVALRVTDHPQVRELCALVGPLISTSCNPGGRPAAKTRLRVEQYFHGQLDLVLGGA
FT                   LGGRKNPSVIRNLATGEVVRPG"
FT   gene            94569..94874
FT                   /locus_tag="PputGB1_0087"
FT   CDS_pept        94569..94874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0087"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN0028 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96003"
FT                   /db_xref="UniProtKB/TrEMBL:B0KF33"
FT                   /protein_id="ABY96003.1"
FT                   /translation="MFQIHPLPCTSTRSFGRCDAGHDPLFTVNPNISAEDALVHVALYL
FT                   RSAYETGYKALDYMREEGRGMFWSNLHAIEMAEGVIEAILDGIESTPPPANRPLKA"
FT   gene            complement(95002..95979)
FT                   /locus_tag="PputGB1_0088"
FT   CDS_pept        complement(95002..95979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0088"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   pen:PSEEN0029 quinone oxidoreductase, NADPH-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96004"
FT                   /db_xref="GOA:B0KF34"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0KF34"
FT                   /protein_id="ABY96004.1"
FT                   /translation="MAKRIQFSQHGGPEVLQFVEFEPAPPAPQQVRVRNHAIGLNFIDT
FT                   YFRSGLYAPPSLPSGLGTEAAGVVEAVGEGVTRLKVGDRVAHAGGPLGAYSEVHTLPEA
FT                   NLVKLPDNISFEQAAAVMLKGLTVQYLLKQTYEVKPGDVILFHAAAGGVGSLACQWAKA
FT                   LGAKLIGTVSSAEKAERAKALGAWETIDYSHEDVAKRVLELTDGKKCPVVYDGVGADTW
FT                   LTSLDCLQPRGLMVSFGNASGAVSGVNLGILAQKGSLYVTRPTLATYANNAENTQAMAD
FT                   DLFAMIGSGKLVVDIQQRYPLSEAAKAQAELSARRTVGSTVLIP"
FT   gene            96114..97025
FT                   /locus_tag="PputGB1_0089"
FT   CDS_pept        96114..97025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0089"
FT                   /product="Coproporphyrinogen oxidase"
FT                   /EC_number="1.3.3.3"
FT                   /note="PFAM: coproporphyrinogen III oxidase; KEGG:
FT                   pen:PSEEN0030 coproporphyrinogen III oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96005"
FT                   /db_xref="GOA:B0KF35"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KF35"
FT                   /protein_id="ABY96005.1"
FT                   /translation="MTSRTEAVKAYLLDLQDRICSALETEDGGARFVEDAWVREAGGGG
FT                   RTRVIGDGKVIEKGGVNFSHVFGAGLPPSASAHRPELAGRGFEALGVSLVIHPHNPHVP
FT                   TSHANVRFFIAEKEGEEAVWWFGGGFDLTPYYGNEEDCIHWHRVAEQACAPFGADVYPR
FT                   YKAWCDRYFHLKHRGEPRGIGGLFFDDLNEWDFDTCFAFIRAIGDAYVNAYLPIVQRRK
FT                   DTPYTPQQREFQEYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPQVRWGYDWKA
FT                   APGSEEARLTEYFLQDRDWLGQ"
FT   gene            97051..97875
FT                   /locus_tag="PputGB1_0090"
FT   CDS_pept        97051..97875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0090"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /note="TIGRFAM: shikimate 5-dehydrogenase; PFAM:
FT                   Shikimate/quinate 5-dehydrogenase; Shikimate dehydrogenase
FT                   substrate binding domain protein; KEGG: pen:PSEEN0031
FT                   shikimate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96006"
FT                   /db_xref="GOA:B0KF36"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/TrEMBL:B0KF36"
FT                   /protein_id="ABY96006.1"
FT                   /translation="MDQYVVFGNPIGHSKSPLIHRLFAEQTGQDMEYATLLAPLDEFSD
FT                   CARGFFKQGSGGNVTVPFKEEAYRLCDSLTPRAQRAGAVNTLSKLADGTLQGDNTDGAG
FT                   LVRDLTVNAGVVLAGKRILILGAGGAVRGVLEPILAHKPQSLVIANRTVEKAEQLAREF
FT                   DELGPVVASGFAWLQEPVDVIINATSASLAGEMPPIADSLVEAGRTVCYDMMYGKEPTP
FT                   FCQWAADLGAAKVLDGLGMLAEQAAEAFFIWRGVRPDTAPVLAELRRQLARG"
FT   gene            complement(98019..99584)
FT                   /locus_tag="PputGB1_0091"
FT   CDS_pept        complement(98019..99584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0091"
FT                   /product="sulphate transporter"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; sulphate transporter; KEGG: pen:PSEEN0032
FT                   sulfate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96007"
FT                   /db_xref="GOA:B0KF37"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:B0KF37"
FT                   /protein_id="ABY96007.1"
FT                   /translation="MHRIIHLLPFLSWLPRQSGHSLRQDLLVGLSGAILALPQSIAYAL
FT                   IAGLPAEYGLYAAIVPVLVACLWGSSWHLICGPTAAISIVLYASISPLAVAGSADYITL
FT                   VLLLTFLGGIFQLLLGLLRFGALVNFVSHSVVLGFTLGAAIVIALGQLPNLLGMDLPSQ
FT                   ATALKTMQDLASHAGEVDLPSLVLGLATVMIGVAFKLWRPRWPSLLISLMLVSLLAWLL
FT                   PGYFGHVPRVTAFTGQLPPFSPLPLLDVELMLRLLPSAVAVGMLGLVTSLSIARSLSAR
FT                   SEQLIDPDQEIRAQGLSNIAGAFFSGYLSAGSFTRSGLSYEAGARSPMAGVFSALWVAL
FT                   FAVTGAGLIAHLPIPAMAGSILLICWGLVDHRGIRALFRVSRSEFLVMALTAAATLLLE
FT                   LQTAIYAGVLASLFFYLKRTSRPRVQQSREGDADVLRVGGSIFFGAAHYLQVRLQRCQG
FT                   PHVVIDARQVNFIDYSGVDMLHREARRLRRLGGSLTLHRARPQVIEELQKLEGVALCPI
FT                   RFEE"
FT   gene            complement(99712..100635)
FT                   /locus_tag="PputGB1_0092"
FT   CDS_pept        complement(99712..100635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0092"
FT                   /product="choline ABC transporter, periplasmic binding
FT                   protein"
FT                   /note="TIGRFAM: choline ABC transporter, periplasmic
FT                   binding protein; PFAM: Substrate-binding region of ABC-type
FT                   glycine betaine transport system; KEGG: pen:PSEEN0033
FT                   glycine betaine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96008"
FT                   /db_xref="GOA:B0KFV7"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR017783"
FT                   /db_xref="UniProtKB/TrEMBL:B0KFV7"
FT                   /protein_id="ABY96008.1"
FT                   /translation="MHKFSAAVFALAISTATAHAADSDAQCSTVKMADPGWSDIASTNA
FT                   VARLLLESLGYQVKIDSLAVPIIYGGLKDGRVDAFLGNWMPAQQGFHDKFIANGDVQQL
FT                   SRNLEGTEFTLAVPDYVWNAGVKDFADLQKHADQFDKKLYGIGSGAPANLSLKEIIDKN
FT                   EFNLGQWKLVESSEQAMLAQVDRAVKKQQFITFLGWTPHPMNVKLKMHYLTGGEKWFGS
FT                   KGEVYTLTRKGYPQACPNAAKLLGNLKFTLDMENSIMAEVVDKKISFDDAAKAWVKTYP
FT                   EVLDGWLAGVTTKADGNALEAVKAKL"
FT   sig_peptide     complement(100573..100635)
FT                   /locus_tag="PputGB1_0092"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 21"
FT   gene            complement(100650..102167)
FT                   /locus_tag="PputGB1_0093"
FT   CDS_pept        complement(100650..102167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0093"
FT                   /product="choline-sulfatase"
FT                   /note="TIGRFAM: choline-sulfatase; PFAM: sulfatase; KEGG:
FT                   pen:PSEEN0034 choline sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96009"
FT                   /db_xref="GOA:B0KFV8"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017785"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="InterPro:IPR025863"
FT                   /db_xref="UniProtKB/TrEMBL:B0KFV8"
FT                   /protein_id="ABY96009.1"
FT                   /translation="MTRPNILFIMADQMAAPLLPIYAPSPIQMPHLSRLAEQAVVFESA
FT                   YCNSPLCAPSRFTLVSGQLPSRIGAYDNAADFPADVPTYAHYLRRLGYRTALSGKMHFC
FT                   GPDQLHGYEERLTSDIYPADYGWAVNWDEPDVRPSWYHNMSSVLQAGPCVRTNQLDFDE
FT                   EVVFKARQYLYDHVRDNDGRPFCLTVSMTHPHDPYTIPKRYWDRYEGVDIPMPRAEFGQ
FT                   AELDPHSQRLLKVYDLWNKPLPMEKIRDARRAYFGACSYIDDNIGQLLQTLEECNLADD
FT                   TLIVFSGDHGDMLGERGLWYKMHWFEMSARVPLLVHAPKRFAAGRVSASVSTCDLLPTL
FT                   VELAGGAVDKSLHLDGRSLVGHLQGQGGHDEVIGEYMAEGTVGPLMMIRRGPYKFVYSE
FT                   DDPSLLYDLSRDPHERENLTGSPEHQALLQAFVDEAQQRWDIPSLRQQVLASQRRRRLV
FT                   AEALAIGTLKSWDHQPLVDASQQYMRNHIDLDDLERKARYPQPAPLD"
FT   gene            102276..103175
FT                   /locus_tag="PputGB1_0094"
FT   CDS_pept        102276..103175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0094"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="TIGRFAM: choline sulfate-utilization transcription
FT                   factor; PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: pen:PSEEN0035 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96010"
FT                   /db_xref="GOA:B0KFV9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR017786"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0KFV9"
FT                   /protein_id="ABY96010.1"
FT                   /translation="MFDHLAELSLDTLRVFEAAARLRGFTAAALALGTTQPAVSQQVKR
FT                   LEAQLGTRLFDRIYRGIELTEAGQVLFQQVHQGLQAMDDGIAQATGRGQREVLQVATDF
FT                   AFAAFWLMPRLQRFHEAYPQVDVSLVTGERSQGMLRPDIDVAVLFGDGRFHQGESRWLF
FT                   DEEVFPVCSPRLTDGKPLSAVALQRLPLLHLKGEQASRWFDWAGVFRGFGVASPPAAGQ
FT                   LRFDNYTLLIQAAIAGQGVAIGWGHLVDKLVEQGLLCRPLEGSLRSERGYYAVLPPRKR
FT                   RGALIERFVGWLEHERSL"
FT   gene            complement(103291..103845)
FT                   /locus_tag="PputGB1_0095"
FT   CDS_pept        complement(103291..103845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0095"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pfo:Pfl_0028 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96011"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0KFW0"
FT                   /protein_id="ABY96011.1"
FT                   /translation="MKNAETPVYKLVLFGPESSLGNALMAELLSRQHEVTAVVDDLNRH
FT                   TARPGLHFKIGGLHDADQAEQGAAGGSAVIALLSALAPGDLPGQARLSEALVAGLERTT
FT                   IRRLLLVGDFAVLDEPGKYSEAERECVDHVVDGLQRSALRWTLINTPQALPDEGWARVA
FT                   AGMADMLELDLHRGEHLNFVV"
FT   gene            103898..104230
FT                   /locus_tag="PputGB1_0096"
FT   CDS_pept        103898..104230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0096"
FT                   /product="Dopa 45-dioxygenase"
FT                   /note="PFAM: Dopa 45-dioxygenase; KEGG: pen:PSEEN0036
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96012"
FT                   /db_xref="GOA:B0KFW1"
FT                   /db_xref="InterPro:IPR014980"
FT                   /db_xref="InterPro:IPR023389"
FT                   /db_xref="UniProtKB/TrEMBL:B0KFW1"
FT                   /protein_id="ABY96012.1"
FT                   /translation="MQRIKGYHAHVYYDAATMEQARELCEEAARLFPVTMGRMHQKPVG
FT                   PHPDWSCQLAFEPEFVGVVLPWLALYRKGLVVFMHPLTGDELADHRDHAIWMGALRPLD
FT                   LSIFGG"
FT   gene            complement(104350..105159)
FT                   /locus_tag="PputGB1_0097"
FT   CDS_pept        complement(104350..105159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0097"
FT                   /product="tryptophan synthase, alpha subunit"
FT                   /EC_number="4.2.1.20"
FT                   /note="KEGG: pen:PSEEN0037 tryptophan synthase alpha
FT                   subunit; TIGRFAM: tryptophan synthase, alpha subunit; PFAM:
FT                   tryptophan synthase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96013"
FT                   /db_xref="GOA:B0KFW2"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KFW2"
FT                   /protein_id="ABY96013.1"
FT                   /translation="MSRLEQRFAELKAEGRSALVTFVTAGDPGYDASLQILKGLPAAGA
FT                   DVIELGMPFTDPMADGVAIQLATLRALEAGQTLAKTLQMVREFRVDNQTTPIVLMGYYN
FT                   PIHRFGVEPFVAEAKAAGVDGLIIVDLPPEHDAELATPAQAAGIDFIRLTTPTTDDARL
FT                   PRVLERSSGFVYYVSVAGVTGAGSATTEHVTEAIARLRRHTDLPISVGFGIRTPEQAAN
FT                   IARLADGVVVGSALVDKIAQAKSADQAVNDVLSLCSALAEGVRGARR"
FT   gene            complement(105156..106373)
FT                   /locus_tag="PputGB1_0098"
FT   CDS_pept        complement(105156..106373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0098"
FT                   /product="tryptophan synthase, beta subunit"
FT                   /note="TIGRFAM: tryptophan synthase, beta subunit; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   KEGG: pen:PSEEN0038 tryptophan synthase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96014"
FT                   /db_xref="GOA:B0KFW3"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KFW3"
FT                   /protein_id="ABY96014.1"
FT                   /translation="MTQSQYRPGPDANGLFGSFGGRYVAETLMPLVLDLAREYEAAKAD
FT                   PKFLEELAYFQRDYIGRPNPLYFAERLTEHCGGAKIFFKREELNHTGAHKVNNCIGQVL
FT                   LAKRMGKKRLIAETGAGMHGVATATVAARFGLPCVIYMGATDIERQQANVFRMKLLGAE
FT                   IVPVTAGTGTLKDAMNEALRDWVTNVEDTFYLIGTVAGPHPYPAMVRDFQSIIGKETRA
FT                   QLQEKEGRLPDSLVACVGGGSNAMGLFHEFLEEPSVQIIGVEAGGHGVHTDKHAASLNG
FT                   GVPGVLHGNRTYLLQDADGQITDAHSISAGLDYPGIGPEHAYLHEVKRVEYVSITDDEA
FT                   LDAFHATCRLEGIIPALESSHALAEAIKRAPKLPKDHLMVVCLSGRGDKDMQTVMNHMA
FT                   AQEKQA"
FT   gene            106484..107380
FT                   /locus_tag="PputGB1_0099"
FT   CDS_pept        106484..107380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0099"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: pen:PSEEN0039 transcriptional
FT                   regulator TrpI"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96015"
FT                   /db_xref="GOA:B0KFW4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037418"
FT                   /db_xref="UniProtKB/TrEMBL:B0KFW4"
FT                   /protein_id="ABY96015.1"
FT                   /translation="MAHDLPPLNALRAFEATARLNSVSQAAEALHVTHGAVSRQIKVLE
FT                   EHLGVALFVKDGRGIKLTDAGVRLRDASGEAFDRLRSVCAELSRDVSEAPFVLGCSGSL
FT                   LARWFIPRLGRLKAELPELRLHLSAGEGDLDPRRPGLDALLVYAEPPWPADMQVHVLAE
FT                   ERIGPVLSPHFAGFERLRGAPVSALLEEALLHTTSRPQAWPTWVRQQGLDPAGLHYGQA
FT                   FEHLYYLLEAAVAGLGVAIAPQPLVADDLRAGRLSAPWGFSPTRAALALWVPRRAADGR
FT                   AEQLAQWLRRELQRQAG"
FT   gene            complement(107377..107700)
FT                   /locus_tag="PputGB1_0100"
FT   CDS_pept        complement(107377..107700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0100"
FT                   /product="protein of unknown function DUF883 ElaB"
FT                   /note="PFAM: protein of unknown function DUF883 ElaB; KEGG:
FT                   pen:PSEEN0040 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96016"
FT                   /db_xref="GOA:B0KFW5"
FT                   /db_xref="InterPro:IPR010279"
FT                   /db_xref="UniProtKB/TrEMBL:B0KFW5"
FT                   /protein_id="ABY96016.1"
FT                   /translation="MHRNSLRKTSLESMEAEIESLLKSLENLKHDASEESQKSVKAIRS
FT                   NAESALKHSRSLLSDAYEEVKTRTRQTGIATRDYAQEHPITTAGVAIGALGLLAAYLLS
FT                   RRN"
FT   gene            107851..108066
FT                   /locus_tag="PputGB1_0101"
FT   CDS_pept        107851..108066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0101"
FT                   /product="protein of unknown function DUF1458"
FT                   /note="PFAM: protein of unknown function DUF1458; KEGG:
FT                   pen:PSEEN0041 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96017"
FT                   /db_xref="InterPro:IPR009923"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036694"
FT                   /db_xref="UniProtKB/TrEMBL:B0KFW6"
FT                   /protein_id="ABY96017.1"
FT                   /translation="MTDHHTYKKIELVGSSPTSIEDAINNALAEAGKSIKHLEWFEVVD
FT                   TRGHIRDNKAAHFQVTLKVGFRIANS"
FT   gene            108168..108389
FT                   /locus_tag="PputGB1_0102"
FT   CDS_pept        108168..108389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0102"
FT                   /product="protein of unknown function DUF1161"
FT                   /note="PFAM: protein of unknown function DUF1161; KEGG:
FT                   pen:PSEEN0042 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96018"
FT                   /db_xref="InterPro:IPR010595"
FT                   /db_xref="UniProtKB/TrEMBL:B0KFW7"
FT                   /protein_id="ABY96018.1"
FT                   /translation="MNKLILALGLMTLAGGALAAGKPCEELKAEIAAKLDAKGVTGYKL
FT                   EIVKKGDPAGKVIGSCEAGTKEIVYRRG"
FT   sig_peptide     108168..108227
FT                   /locus_tag="PputGB1_0102"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 20"
FT   gene            complement(108427..109431)
FT                   /locus_tag="PputGB1_0103"
FT   CDS_pept        complement(108427..109431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0103"
FT                   /product="luciferase family protein"
FT                   /note="PFAM: luciferase family protein; KEGG: pen:PSEEN0043
FT                   luciferase-like monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96019"
FT                   /db_xref="GOA:B0KFW8"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019949"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B0KFW8"
FT                   /protein_id="ABY96019.1"
FT                   /translation="MTQLRDLKISTLDLVPVRAGAGPAQSLRNSLDLAQHVERFGYNRF
FT                   WVAEHHNMDGIASSATSVLIGYLAGGTSTIRVGSGGVMLPNHAPLVIAEQFGTLASLYP
FT                   GRIDLGLGRAPGSDQMTAYALRRDRAGGPDDFPDDVEELSRYLGPRTDDQKVIAVPGHD
FT                   TDVPMWLLGSSLFSAQLAGIRGMPYAFSSHFAPRYMHEAIRVYRNHFKPSTTLDKPYVM
FT                   LGIPMVVAETDEKAEFLATSVYQRILALIRGQSLMQKPPVESMDGLWLPHERDAVGSFL
FT                   GLAMIGSPQKVRAKVEVLLEQTGADELIFTCDLYEHEDRIRSYELMAQALKAE"
FT   gene            109584..110009
FT                   /locus_tag="PputGB1_0104"
FT   CDS_pept        109584..110009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0104"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: pap:PSPA7_0059
FT                   osmotically inducible protein OsmC"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96020"
FT                   /db_xref="GOA:B0KFW9"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019904"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:B0KFW9"
FT                   /protein_id="ABY96020.1"
FT                   /translation="MKKTASAIWQGGLKDGKGLLSTESGALKQNPYGFNTRFEGTPGTN
FT                   PEELIGAAHAGCFSMALSMMLGEAGLTADRIDTAAEVTLDKQADGFAITAVHLVLRAKV
FT                   PGASEAQFLEIANKAKEGCPVSKVLNAKISLDAALVG"
FT   gene            110084..110317
FT                   /locus_tag="PputGB1_0105"
FT   CDS_pept        110084..110317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0105"
FT                   /product="protein of unknown function DUF1161"
FT                   /note="PFAM: protein of unknown function DUF1161; KEGG:
FT                   pen:PSEEN0044 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96021"
FT                   /db_xref="InterPro:IPR010595"
FT                   /db_xref="UniProtKB/TrEMBL:B0KFX0"
FT                   /protein_id="ABY96021.1"
FT                   /translation="MIRVAIAVLASLVATSALAAVKPCEELKAEIEAKIQAQGVTSYTL
FT                   EIVPNSEAKDQNMVVGSCDGGTKKIIYQKNDR"
FT   sig_peptide     110084..110143
FT                   /locus_tag="PputGB1_0105"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT   gene            complement(110353..110766)
FT                   /locus_tag="PputGB1_0106"
FT   CDS_pept        complement(110353..110766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0106"
FT                   /product="lipoprotein"
FT                   /note="KEGG: pen:PSEEN0045 lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96022"
FT                   /db_xref="UniProtKB/TrEMBL:B0KFX1"
FT                   /protein_id="ABY96022.1"
FT                   /translation="MRQPMMLIALSALGACASPLPPVDPKQAWVDLYTMTPGRVIMADR
FT                   LDGKRLDDGRYFQVTPGKHELVVRFDYEIYSGGIMSEPRDRTCYLTVRFDDFKAGERYR
FT                   LEARAPVMEPQVLLYDASRKVVVNEPSNVFCIP"
FT   sig_peptide     complement(110713..110766)
FT                   /locus_tag="PputGB1_0106"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.992 at
FT                   residue 18"
FT   gene            complement(110822..111235)
FT                   /locus_tag="PputGB1_0107"
FT   CDS_pept        complement(110822..111235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0107"
FT                   /product="lipoprotein"
FT                   /note="KEGG: pen:PSEEN0046 lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96023"
FT                   /db_xref="UniProtKB/TrEMBL:B0KFX2"
FT                   /protein_id="ABY96023.1"
FT                   /translation="MRALLVAGSLLMISACSTLPDPDPNQAWIDLTPYDNTSLDALQVD
FT                   ERDWADSRYFEVQPGSHELTVRYQFPVTPSNIGPVSEPLWRDCQVKLTFKDFGAGQRYQ
FT                   LHAGSIGFRPWIKLYDDQQKMVGQGLPAGCQRT"
FT   sig_peptide     complement(111179..111235)
FT                   /locus_tag="PputGB1_0107"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.727) with cleavage site probability 0.476 at
FT                   residue 19"
FT   gene            111321..112394
FT                   /locus_tag="PputGB1_0108"
FT   CDS_pept        111321..112394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0108"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN0047 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96024"
FT                   /db_xref="InterPro:IPR014553"
FT                   /db_xref="InterPro:IPR034016"
FT                   /db_xref="UniProtKB/TrEMBL:B0KFX3"
FT                   /protein_id="ABY96024.1"
FT                   /translation="MQRSGPGALDRVFTRLVPLLAALLLNGCTSAAYYGQLAEGQWQLL
FT                   RARQPVEQVVADPATPAPLRAHLQQAERARVFASQQLKLPDNRSYRVYADLGRPYVVWN
FT                   VFATPELSLQPVTHCFPIAGCVAYRGYYQQGAARGAAALMRQDGLDVYVGGVEAYSTLG
FT                   WFDDPILSSMVGWGDERLATLIFHELAHQRFYVQDDTEFNESFASFVEQEGSRQWRAAR
FT                   GLAAGGEAQGQQRDQFIRLVLASRERLQAIYAGPLDDAHKRLAKRAEFDRLRQEYRRLR
FT                   DGQWGGDKRYDVWVYGPMNNAKLLPFGLYDQWVPAFTAVFREVGGDWARFYQRVEQLGR
FT                   LPIDERKAALQGLMVSQ"
FT   gene            complement(112428..113102)
FT                   /locus_tag="PputGB1_0109"
FT   CDS_pept        complement(112428..113102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0109"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 1; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: pen:PSEEN0048 hydrolase, HAD family"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96025"
FT                   /db_xref="GOA:B0KFX4"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B0KFX4"
FT                   /protein_id="ABY96025.1"
FT                   /translation="MNPTTETNMHQQNILFDLDGTLTDPRLGITRSIQYALAKLGIDEP
FT                   DLARLEHFIGPPLLQAFMQFYSFDEAKAWDAVNFYRERFRVTGLYENLVFEGVPALLET
FT                   LNGQGRTLYIATSKPWEFAREIARHFAFDHHFKVIYGSELDGTRTNKVELIRHLLDEEG
FT                   LDPAQTLMIGDRKHDLIGARSNGLQAVAVGYGFGSQEELMAEEPAFHFATVAELHQAFS
FT                   KG"
FT   gene            complement(113099..113647)
FT                   /locus_tag="PputGB1_0110"
FT   CDS_pept        complement(113099..113647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0110"
FT                   /product="transferase"
FT                   /note="KEGG: pen:PSEEN0049 transferase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96026"
FT                   /db_xref="GOA:B0KFX5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:B0KFX5"
FT                   /protein_id="ABY96026.1"
FT                   /translation="MAIRNFQQHTPKVGPRAFVDRSAVVLGDVEIGEDSSVWPLTVVRG
FT                   DMHRIRIGARTSVQDGSVLHITHAGPFNPDGFPLIIGDEVTIGHKVMLHGCTLGNRILV
FT                   GMGSTIMDGAIVEDEVIIGAGSLVPPGKRLVSGYLYMGSPVKQARLLNDKERAFFSYSA
FT                   GNYVKLKDQHLAEGYDQPE"
FT   gene            113714..115801
FT                   /locus_tag="PputGB1_0111"
FT   CDS_pept        113714..115801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0111"
FT                   /product="Oligopeptidase A"
FT                   /EC_number="3.4.24.70"
FT                   /note="PFAM: peptidase M3A and M3B thimet/oligopeptidase F;
FT                   KEGG: pen:PSEEN0050 oligopeptidase A"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96027"
FT                   /db_xref="GOA:B0KFX6"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:B0KFX6"
FT                   /protein_id="ABY96027.1"
FT                   /translation="MGQCFFCQGIQTVTANNPLLQSHDLPPFSQIRAEHVLPAIEAILA
FT                   DNRKAIAEILEKQGKNPTWAGLVLAMDELNDRLGAAWSPVSHLNAVCNSAELREAYESC
FT                   LPALSAYSTELGQNRALFEAYQALIDSPEAAGFDVAQKTILEHALRDFRLSGIDLPADK
FT                   QQRYAEVQSKLSELGSRFSNQLLDATQAWTKHVTDEAALAGLTDSAKAQMAAAAQAKGL
FT                   DGWLITLEFPSYYAVMTYASDRALREELYAAYCTRASDQGPNAGQFDNGPVMGEILDLR
FT                   QELAELLGYKNYAELSLATKMAESSDQVLSFLRDLAKRSKPFAAQDLQQLKAYAAEQGC
FT                   PELASWDTGYFGEKLREQRYSVSQEALRAYFPIDKVLGGLFSIVQRLYGIEIAELKGFD
FT                   SWHPDVRLFEIKENGQHVGRFFFDLYARANKRGGAWMDGARDRRRTAGGQLQSPVANLV
FT                   CNFTPAAPGKPALLTHDEVTTLFHEFGHGLHHMLTRIEHAGVSGINGVAWDAVELPSQF
FT                   MENWCWEPEGLALISGHYETGAALPQDLLDKMLAAKNFQSGMMMVRQLEFSLFDFELHA
FT                   SHGDGRSVLQVLEGVRDEVSVMRPPAYNRFPNSFAHIFAGGYAAGYYSYKWAEVLSADA
FT                   FSRFEEEGVLNAETGRAFREAILARGGSREPMELFVDFRGREPSIDALLRHSGLTEDAA
FT                   A"
FT   gene            115798..116079
FT                   /locus_tag="PputGB1_0112"
FT   CDS_pept        115798..116079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0112"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   pen:PSEEN0051 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96028"
FT                   /db_xref="InterPro:IPR012658"
FT                   /db_xref="UniProtKB/TrEMBL:B0KFX7"
FT                   /protein_id="ABY96028.1"
FT                   /translation="MSEVAVNKTKKRFIAGAVCPACSEPDKLMMWNEDGVPHRECVACG
FT                   FTDTLNEQGLSVPKELGTRVNNLAPKAAPAKVQTVQFFPNPKLKKPTE"
FT   gene            116160..117218
FT                   /locus_tag="PputGB1_0113"
FT   CDS_pept        116160..117218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0113"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: pen:PSEEN0052 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96029"
FT                   /db_xref="GOA:B0KFX8"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR040086"
FT                   /db_xref="UniProtKB/TrEMBL:B0KFX8"
FT                   /protein_id="ABY96029.1"
FT                   /translation="MNPPAPLKGRGTAHNPHNRFAPSHSLVEDDGWYQEVPQTQGTEVR
FT                   SETAKSVITRNTSPDLPFDRSINPYRGCEHGCIYCYARPSHAYWDLSPGLDFETKLIAK
FT                   TNAAEVLAQQLSKPGYVCAPINLGSNTDPYQPIEREQMLTRRLLEVLLRFRHPVTIVTK
FT                   GSLVLRDLDLLAEMARQRLARVMISLTTLDDDLKRVLEPRAASPNARLRAIRVLREAGV
FT                   PVGVLCSPMIPMINDSELERLLEAAKDAGAQSAAYMMLRLPLEVAPLFEQWLQDHYPQR
FT                   AAHVLSLIRQSRGGELYDSRFGTRMRGEGVFAELLGQRFAKAMKRLEFEGREAQGLDCS
FT                   AFCPPGGQMALF"
FT   gene            117511..118230
FT                   /locus_tag="PputGB1_0114"
FT   CDS_pept        117511..118230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0114"
FT                   /product="Carbonate dehydratase"
FT                   /EC_number="4.2.1.1"
FT                   /note="PFAM: carbonic anhydrase; KEGG: pen:PSEEN0053
FT                   carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96030"
FT                   /db_xref="GOA:B0KFX9"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:B0KFX9"
FT                   /protein_id="ABY96030.1"
FT                   /translation="MPVKDPSKVVPQVPAESADAALKHIVDGFLRFHHDVFPDQQELFK
FT                   KLATAQTPRAMFITCADSRIVPELITQSSPGDLFVTRNVGNVVPPYGQMNGGVSSAIEY
FT                   AVLALKVHHIIICGHSDCGAMRAVLNPHSLDKMPTVGAWLRHAEVARTVVENNCSCGSE
FT                   HETMQVLTKENVIAQLHHLRTHPSVASRLAAGQLYIHGWVYDIETSRIEAYDAASDSFL
FT                   PLAAGEPVPCATPRGRY"
FT   gene            118423..119955
FT                   /locus_tag="PputGB1_0115"
FT   CDS_pept        118423..119955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0115"
FT                   /product="sulphate transporter"
FT                   /note="PFAM: Xanthine/uracil/vitamin C permease; sulphate
FT                   transporter; KEGG: pen:PSEEN0054 sulfate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96031"
FT                   /db_xref="GOA:B0KFY0"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="UniProtKB/TrEMBL:B0KFY0"
FT                   /protein_id="ABY96031.1"
FT                   /translation="MNITQLKAALPRELLASVVVFLVALPLCMGIAIASGMPPAKGLIT
FT                   GIIGGIVVGFLAGSPLQVSGPAAGLAVLVFELVRQHGMPMLGPILLLAGLLQLLAGRLR
FT                   LGCWFRVTAPAVVYGMLAGIGVLIVLSQVHVMFDTAPQPSGLQNLLTFPSTVAAALPQE
FT                   RAGAGWMAGALGLGTIAIMWGWERLRPQRLRFVPGALLGVASMTAISLWLALPVNRVQV
FT                   PADLSEAIDWIRPDDLMQLADPTLLVAAFALAFIASAETLLSAAAVDRMHSGQRSDFDR
FT                   ELSAQGIGNMLCGALGALPMTGVIVRSSANVQAGAQTRASAIFHGLWLLAFVVALSSVL
FT                   QQIPVASLAGVLVYTGVKLVDFKAFRGLGRYGRMPMFTYAVTALAIIFTDLLTGVMLGF
FT                   ALTLLKLAFKAARLKINLVSLEKAGDMELRLSGAATFLKVPALTQVLDTVPAGTTLHVP
FT                   LGNLSYIDHSCLELLEDWNRSNGANGSRLLIEQRRLKRRIEGRLRTTAGIGA"
FT   sig_peptide     118423..118527
FT                   /locus_tag="PputGB1_0115"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.909 at
FT                   residue 35"
FT   gene            complement(120088..120729)
FT                   /locus_tag="PputGB1_0116"
FT   CDS_pept        complement(120088..120729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0116"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN0055 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96032"
FT                   /db_xref="UniProtKB/TrEMBL:B0KFY1"
FT                   /protein_id="ABY96032.1"
FT                   /translation="MNIAAVREQVSQAHQHEGQTGQLKQRLELQLPHLHPSIQLPEQDA
FT                   QGTLARFVSAYIDQVPELLEAAHEVAREAGIESQIKPVLKIAEAYFLQPPSVMQGHVGL
FT                   DCLLDEAYLAHRLVEEVNDLYIRHFQQPLIPVDTTVANLIAHQLIGESFANQLDEVVHH
FT                   SVDEMLDDESFAVESVEAYREKLSSPATGEAWKRWPCLSRQLGVELGQPA"
FT   gene            121099..122226
FT                   /locus_tag="PputGB1_0117"
FT   CDS_pept        121099..122226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0117"
FT                   /product="cytochrome c oxidase, subunit II"
FT                   /note="TIGRFAM: cytochrome c oxidase, subunit II; PFAM:
FT                   cytochrome c oxidase subunit II; cytochrome c class I;
FT                   cytochrome C oxidase subunit II transmembrane region; KEGG:
FT                   pen:PSEEN0056 cytochrome c oxidase, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96033"
FT                   /db_xref="GOA:B0KFY2"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B0KFY2"
FT                   /protein_id="ABY96033.1"
FT                   /translation="MMRHPHVWMGLLLWSVFGQANAAWTVNMHPGATEVSNAVFDLHMT
FT                   IFWICVIIGIVVFGAMFWSMVIHRRSTGQQAAHFHEHTWVEILWTVVPFLILVVMAIPA
FT                   TKTLIDIYDASESDIDIQVTGYQWKWHYKYLGQDVEFFSNLATPADQIHNKAPKDEHYL
FT                   LEVDQPLVLPVGAKVRFLVTAADVIHSWWVPAFAVKRDAIPGFVNEAWTRIEKPGIYRG
FT                   QCTELCGKDHGFMPVVVEVKSKADYDTWLGERKAEAAKLKELTSKEWTLEELVERGDKI
FT                   YHTTCVACHQAEGQGLPPMFPALKGSKIATGPKEGHLSIVFHGKPGTAMAAFGKQLSEV
FT                   DIAAVVTYERNAWGNNKGDMVTPKDVLALKQAEAK"
FT   sig_peptide     121099..121167
FT                   /locus_tag="PputGB1_0117"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.996 at
FT                   residue 23"
FT   gene            122270..123859
FT                   /locus_tag="PputGB1_0118"
FT   CDS_pept        122270..123859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0118"
FT                   /product="cytochrome c oxidase, subunit I"
FT                   /EC_number="1.9.3.1"
FT                   /note="KEGG: pen:PSEEN0057 cytochrome c oxidase, subunit I;
FT                   TIGRFAM: cytochrome c oxidase, subunit I; PFAM: cytochrome
FT                   c oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96034"
FT                   /db_xref="GOA:B0KFY3"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033944"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:B0KFY3"
FT                   /protein_id="ABY96034.1"
FT                   /translation="MSAVIDDHAHGHEHAHGPAKGLMRWVLTTNHKDIGTMYLWFAFMM
FT                   FLLGGSFAMVIRAELFQPGLQIVEPAFFNQMTTMHGLIMVFGAVMPAFVGLANWMIPLM
FT                   IGAPDMALPRMNNFSFWLLPAAFLLLVSTLFSPGGGPNFGWTFYAPLSTTYAPASVTFF
FT                   IFAIHLMGISSIMGAINVIATILNLRAPGMTLMKMPLFVWTWLITAFLLIAVMPVLAGV
FT                   VTMMLMDIHFGTSFFSAAGGGDPVLFQHVFWFFGHPEVYIMILPAFGAVSSIIPAFSRK
FT                   PLFGYTSMVYATGAIAFLSFIVWAHHMFVVGIPVVGELFFMYATMLIAVPTGVKVFNWV
FT                   STMWEGSLTFETPMLFAIAFVILFTIGGFSGLMLAIAPADFQYHDTYFVVAHFHYVLVP
FT                   GAIFGIFASAYYWLPKWTGHMYDETLGKLHFWLSFIGMNMAFFPMHFVGLAGMPRRIPD
FT                   YNLQFADFNMVSSIGAFMFGATQIFFLFIVIKCIRGGAPAPAKPWDGAEGLEWSIPSPA
FT                   PYHTFQTPPEVK"
FT   gene            123870..124436
FT                   /locus_tag="PputGB1_0119"
FT   CDS_pept        123870..124436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0119"
FT                   /product="cytochrome c oxidase assembly protein CtaG/Cox11"
FT                   /note="PFAM: cytochrome c oxidase assembly protein
FT                   CtaG/Cox11; KEGG: pen:PSEEN0058 cytochrome c oxidase
FT                   assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96035"
FT                   /db_xref="GOA:B0KFY4"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/TrEMBL:B0KFY4"
FT                   /protein_id="ABY96035.1"
FT                   /translation="MNGLSLKRLVTRLLMLTVVMFAFGFALVPIYDVMCKAFGINGKTG
FT                   GQYEGSQVSDPTRSVRVQFMSTNASDMVWDFYSTADQLEVNPGAVNQMIFVAHNPTDRP
FT                   MSAQAIPSITPAEAAAYFHKTECFCFTQQVLQPGERIEMPVRFIVDRDLPASVKHLTLA
FT                   YTLFDITARHPPVAHVAAQDVQGAR"
FT   sig_peptide     123870..123950
FT                   /locus_tag="PputGB1_0119"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.917) with cleavage site probability 0.612 at
FT                   residue 27"
FT   gene            124453..125340
FT                   /locus_tag="PputGB1_0120"
FT   CDS_pept        124453..125340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0120"
FT                   /product="cytochrome c oxidase subunit III"
FT                   /note="PFAM: cytochrome c oxidase subunit III; KEGG:
FT                   pen:PSEEN0059 cytochrome c oxidase, subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96036"
FT                   /db_xref="GOA:B0KFY5"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:B0KFY5"
FT                   /protein_id="ABY96036.1"
FT                   /translation="MASHEHYYVPAQSKWPIIATIGMFITVFGLGTWFNDMKAGHPDSH
FT                   GPLIFFIGALFLAYMLFGWFGAVVKESRAGLYSPQLDRSFRWGMSWFIFSEVMFFLAFF
FT                   GALFYVRVLAGPWLGGEGAKGVAHMLWPTFEFTWPLLHTPDPKLFPPPKEVIDPWHLPL
FT                   INTILLVSSSVTITLAHHALRRDHRGPLKFWMALTIVLGISFIALQAFEYHEAYTKLGL
FT                   TLGSGIYGATFFMLTGFHGAHVTLGTIILIVMFVRILRGHFNPEKHFGFEAASWYWHFV
FT                   DVVWVGLFIFVYVL"
FT   gene            complement(125402..125605)
FT                   /locus_tag="PputGB1_0121"
FT   CDS_pept        complement(125402..125605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0121"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN0060 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96037"
FT                   /db_xref="GOA:B0KFY6"
FT                   /db_xref="InterPro:IPR021313"
FT                   /db_xref="UniProtKB/TrEMBL:B0KFY6"
FT                   /protein_id="ABY96037.1"
FT                   /translation="MLKAAIVLMLLATIASLFSGLVFLVKDDENSTRLLKALTVRVTLA
FT                   ALTIGLVAWGFISGQLVSHAPF"
FT   sig_peptide     complement(125531..125605)
FT                   /locus_tag="PputGB1_0121"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.685 at
FT                   residue 25"
FT   gene            125657..126394
FT                   /locus_tag="PputGB1_0122"
FT   CDS_pept        125657..126394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0122"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN0061 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96038"
FT                   /db_xref="GOA:B0KFY7"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:B0KFY7"
FT                   /protein_id="ABY96038.1"
FT                   /translation="MRPFRPGWVPTLVVLALLPGLIALGCWQLGRAEEKRGLLASYAER
FT                   RVEAPLAAAQLTSSDDNAFRRVHLYGRFDAEHSLLLDNRMRDGQAGVELLQPFHDQASG
FT                   LWLLVNRGWLPWPDRRVPVHFETPSQALALDASVYVSPGSTFQLHPDPEGGQWPHLLTA
FT                   IDAVQLWPQLDREGFAHELRLEPGPATYRLDWPVVAMGPEKHLGYAVQWFALATALVLL
FT                   YLYFGWHQNKEKRHGHRHSTGPA"
FT   sig_peptide     125657..125734
FT                   /locus_tag="PputGB1_0122"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.863) with cleavage site probability 0.793 at
FT                   residue 26"
FT   gene            126363..126944
FT                   /locus_tag="PputGB1_0123"
FT   CDS_pept        126363..126944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0123"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN0062 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96039"
FT                   /db_xref="GOA:B0KFY8"
FT                   /db_xref="UniProtKB/TrEMBL:B0KFY8"
FT                   /protein_id="ABY96039.1"
FT                   /translation="MATATPLDLPERSKPRARGRLQLLLILLVVLGPMILATSMYKLNF
FT                   WVPEGRSYHGAMIGNGESRADLGVAGEDERWQLLVSAPQACAEDCQRLVYLARQIQVGL
FT                   GRDASRASHALAAAQPLSADYQALLGREYPQLQRYPLDAQRYQQKVAEPGPQLWIVDPH
FT                   GNLVLRYDGKVNGKHVLDDLRHLLKLSNIG"
FT   gene            126954..128033
FT                   /locus_tag="PputGB1_0124"
FT   CDS_pept        126954..128033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0124"
FT                   /product="cytochrome oxidase assembly"
FT                   /note="PFAM: cytochrome oxidase assembly; KEGG:
FT                   pen:PSEEN0063 cytochrome oxidase assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96040"
FT                   /db_xref="GOA:B0KFY9"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:B0KFY9"
FT                   /protein_id="ABY96040.1"
FT                   /translation="MARPGFRLAVFATLLALLVVLLGAYTRLTHAGLGCPDWPGCYGFI
FT                   SVPKSEAQLAHAELHFPEHPVEAAKGWAEMVHRYFAGTLAVVIALLAFQALRRHARDGQ
FT                   PYRLPVLLLGVVLAQAAFGMWTVTLKLWPQVVTAHLLGGFTTLSLLFLLSLRLSRAFAP
FT                   LPKLPLSLRRLAALALLVVIGQIALGGWVSANYAAVACIDLPTCHGQWWPAADFSNGFH
FT                   LTQHVGPNYLGGQLDSDARTAIHISHRLGALLVTCVLLMLSWKLHRCGLPGLARVVLLA
FT                   LTLQVGLGISNVVFHLPLAVAVAHNAGGAMLLLSMVLVNYRIRVVDRVRVGVGNGWRLR
FT                   PVAGVGISHHMRNDSWRRF"
FT   sig_peptide     126954..127049
FT                   /locus_tag="PputGB1_0124"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.979) with cleavage site probability 0.596 at
FT                   residue 32"
FT   gene            128018..128911
FT                   /locus_tag="PputGB1_0125"
FT   CDS_pept        128018..128911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0125"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /note="TIGRFAM: protoheme IX farnesyltransferase; PFAM:
FT                   UbiA prenyltransferase; KEGG: pen:PSEEN0064 protoheme IX
FT                   farnesyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96041"
FT                   /db_xref="GOA:B0KFZ0"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KFZ0"
FT                   /protein_id="ABY96041.1"
FT                   /translation="MATLLSARRASWRDYLELTKPKVVVLMLITSLAGMFLATRAGVSW
FT                   SVLLFGNLGIGLCAGGAAVVNHVVDRRIDALMARTHKRPLAQGRVEPLPALLFALALAL
FT                   LGMALLLAFTNALTAWLTLASLLGYAVLYTGFLKRATPQNIVIGGLAGAAPPLLGWVAV
FT                   SGHVSAEPLLLVLIIFAWTPPHFWALAIHRKEEYAKADIPMLPVTHGERYTKLHILLYT
FT                   LILLAVSLLPYAIHMSGPLYLACALVLGLRFLQWAWVLYRGSRPHAAIGTFKYSIAYLF
FT                   ALFIALLLDHYLLLNL"
FT   sig_peptide     128018..128143
FT                   /locus_tag="PputGB1_0125"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.844) with cleavage site probability 0.809 at
FT                   residue 42"
FT   gene            128908..129540
FT                   /locus_tag="PputGB1_0126"
FT   CDS_pept        128908..129540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0126"
FT                   /product="electron transport protein SCO1/SenC"
FT                   /note="PFAM: electron transport protein SCO1/SenC; KEGG:
FT                   pen:PSEEN0065 electron transport protein, Sco1/SenC family"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96042"
FT                   /db_xref="GOA:B0KFZ1"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B0KFZ1"
FT                   /protein_id="ABY96042.1"
FT                   /translation="MTRTQKTVFILVALVALILGLTVNKVLNGRDQPNPTELIDAGIIL
FT                   LPQSRTVADVTMTNQDGQPVRLDDLKGKWSLLFFGYTYCPDICPTTLAQLRQVKSELPK
FT                   EAVDRLQVVLVSVDPNRDTPNQLKQYLGYFDKDFVGVAGSIEDTQKLANALSIPFIPAD
FT                   TSKPGYTVDHSGNLAVVGPDGRQRGFIRAPFNNQKLVAQLPGLVKRD"
FT   sig_peptide     128908..128985
FT                   /locus_tag="PputGB1_0126"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.945) with cleavage site probability 0.535 at
FT                   residue 26"
FT   gene            complement(129664..130434)
FT                   /locus_tag="PputGB1_0127"
FT   CDS_pept        complement(129664..130434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0127"
FT                   /product="NLPA lipoprotein"
FT                   /note="PFAM: NLPA lipoprotein; KEGG: pen:PSEEN0066
FT                   D-methionine-binding lipoprotein MetQ"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96043"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:B0KFZ2"
FT                   /protein_id="ABY96043.1"
FT                   /translation="MKKLLAVAAAVAAFSAHADTLTVAATPVPHAEILNFVKPQLAKEG
FT                   VELKVKEFTDYIQPNVQVAEKRLDANFFQHQPYLDEFNKAKGTNLVSVAGVHIEPLGVY
FT                   STKIKKLDELSSGATVVIPNDATNGGRALLLLDKAGVIKLKDNKNILSTVKDVAENPKS
FT                   IKFRELEAATIPRVLTQVDAALINTNYALEAKLNPEKDALAIEGSDSPYVNILVARPDN
FT                   KDSEDMKKLAAALHSPEVKQFIIEKYKGAVVPAF"
FT   sig_peptide     complement(130378..130434)
FT                   /locus_tag="PputGB1_0127"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 19"
FT   gene            complement(130499..131170)
FT                   /locus_tag="PputGB1_0128"
FT   CDS_pept        complement(130499..131170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0128"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: pen:PSEEN0067 D-methionine
FT                   ABC transporter MetI, membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96044"
FT                   /db_xref="GOA:B0KFZ3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B0KFZ3"
FT                   /protein_id="ABY96044.1"
FT                   /translation="MDALNFFANVDWAEIWLATIDTMIMLFGSLFFTVLLGLPLGVLLF
FT                   LCGPKQMFEQKGVYALLSLVVNILRSLPFIILLIVMIPFTVLITGTSLGVAGAIPPLVV
FT                   GATPFFARLVETALREVDRGIIEATQSMGATTRQIITSALLPEARPGIFAAITVTAITL
FT                   VSYTAMAGVVGAGGLGDLAIRFGYQRFQTDVMVVTVVLLLVLVQVLQSVGDKLVVHFSR
FT                   K"
FT   gene            complement(131170..132177)
FT                   /locus_tag="PputGB1_0129"
FT   CDS_pept        complement(131170..132177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0129"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pen:PSEEN0068 D-methionine ABC transporter MetN,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96045"
FT                   /db_xref="GOA:B0KFZ4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/TrEMBL:B0KFZ4"
FT                   /protein_id="ABY96045.1"
FT                   /translation="MIEFQQVHKTYRVAGREIPALNPTSLTIEDGQVFGLIGHSGAGKS
FT                   TMLRLINRLEEPSGGKIIVDGEDVTAFNASQLRGFRQQVGMIFQHFNLLASKTVADNVA
FT                   LPLTLAGELSRSEIDTRVTELLARVGLSDHAKKYPAQLSGGQKQRVGIARALSTNPKIL
FT                   LCDEATSALDPQTTASVLQLLAEINRELKLTIVLITHEMDVIRRVCDRVAVMDAGQIVE
FT                   QGSVAEVFLHPQHPTTKRFVQEDEQVDEGEQRDDFAHVPGRIVRLTFQGDATYAPLLGT
FT                   VARETGVDYSILAGRIDRIKDVPYGQLTLALIGGDMEAAFARFKAADVHMEVLR"
FT   gene            132405..134540
FT                   /locus_tag="PputGB1_0130"
FT   CDS_pept        132405..134540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0130"
FT                   /product="Catalase"
FT                   /EC_number="1.11.1.6"
FT                   /note="PFAM: Catalase domain protein; KEGG: pfl:PFL_0074
FT                   catalase HPII"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96046"
FT                   /db_xref="GOA:B0KFZ5"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024708"
FT                   /db_xref="InterPro:IPR024712"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="InterPro:IPR041399"
FT                   /db_xref="UniProtKB/TrEMBL:B0KFZ5"
FT                   /protein_id="ABY96046.1"
FT                   /translation="MPSKKTDAPKHSEAAGTQTPDRANTNAKLQSLEAFRSDATGQALR
FT                   TNQGVKIADNQNSLKAGVRGPSLLEDFIMREKITHFDHERIPERIVHARGTGAHGYFQS
FT                   YGCHAELTKAGFLQDPEKITPVFVRFSTVQGPRGSGDTVRDVRGFAVKFYTDEGNFDLV
FT                   GNNMPVFFIQDAIKFPDFVHAVKPEPQNEMPTGGSAHDTFWDFVSLVPESAHMVIWAMS
FT                   DRAIPRSLRMMEGFGVHTFRLINAEGVASFVKFHWKPRQGVHSVLWDEAQKLAGKDTDY
FT                   HRRDLWEAIETGDYPEWELGVQVVPEADEHKYDFDLLDPTKLIPEELVPVKLLGKMVLN
FT                   RNPDNFFAETEQVAFCPGHIVPGIDFTNDPLLQGRLFSYTDTQISRLGGPNFHEIPINR
FT                   PVAPNHSSQRDAMHRMTIDKGRASYEPNSIDGGWPKETPPAAQDGGFESYQERIDAHKI
FT                   RQRSESFGDHFSQARLFFQSMSPTEQQHIIKAYSFELGKVEREAIRAREVNEILANIDL
FT                   KLAAAVAANLGLPAPKQGTVKVKGSKLAQSKALSQMSHPGDVGIKGRKIALLVADGVDG
FT                   ASVDKLVKALEAHSTRPMLLGPTSAPVKTADGKQLPVDASMEGMPSIMFDGIVVPGGKA
FT                   SADALVASGLAKHFLLEGYKHLKAMVLTKELASGLGLKEDKGLLLGDDQKTVDAFVKAV
FT                   EGHRVWEREAAAEAVPA"
FT   gene            complement(134637..135344)
FT                   /locus_tag="PputGB1_0131"
FT   CDS_pept        complement(134637..135344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0131"
FT                   /product="lipoprotein"
FT                   /note="KEGG: pen:PSEEN0069 lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96047"
FT                   /db_xref="UniProtKB/TrEMBL:B0KFZ6"
FT                   /protein_id="ABY96047.1"
FT                   /translation="MKPFASRYLLVAAFSLFLAACSSAPVEQATAPAQADAWQQLQQNI
FT                   ASNELATAEDQLAALQAQSPDDPRSEQYQRQLAEAYLQRSQIVLQKGDVNAAATALARA
FT                   RALMPQAPAVTGGDPLSQARKAELEKAEAALKAAEAKPKARIIDPTAPSTVVALKTTDS
FT                   RAMRRQLDDIAADVVSYDCEVVLQVPRTDDAPWLKTLLEKRVRKIDSGFDLKQTHEIQR
FT                   SLPAQVVLVPHQQ"
FT   sig_peptide     complement(135258..135344)
FT                   /locus_tag="PputGB1_0131"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.674 at
FT                   residue 29"
FT   gene            complement(135472..136254)
FT                   /locus_tag="PputGB1_0132"
FT   CDS_pept        complement(135472..136254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0132"
FT                   /product="ABC-3 protein"
FT                   /note="PFAM: ABC-3 protein; KEGG: pen:PSEEN0070 zinc ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96048"
FT                   /db_xref="GOA:B0KFZ7"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B0KFZ7"
FT                   /protein_id="ABY96048.1"
FT                   /translation="MADFLLYALLAGLSLALVAGPLGSFVVWRRMAYFGDTLSHAALLG
FT                   VALGFALDVSPALAVTVGCLLLAILLVTLQQRQPLASDTLLGILAPSTLSLGLVVLSFM
FT                   HDVRIDLMAYLFGDLLAISTTDLAWILGGSALVLLLLAVLWRPLLAVTVHEELAMVEGL
FT                   PVAGLRLALMLLIAVVIAVAMKIVGVLLITSLLIIPAAAAQRHARSPEQMALGASLLGV
FT                   TAVCGGLAMSWFKDTPAGPSIVVCAAVLFLLSLALPKR"
FT   sig_peptide     complement(136195..136254)
FT                   /locus_tag="PputGB1_0132"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.984) with cleavage site probability 0.828 at
FT                   residue 20"
FT   gene            complement(136247..137020)
FT                   /locus_tag="PputGB1_0133"
FT   CDS_pept        complement(136247..137020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0133"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pen:PSEEN0071 zinc ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96049"
FT                   /db_xref="GOA:B0KFZ8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017882"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0KFZ8"
FT                   /protein_id="ABY96049.1"
FT                   /translation="MSDALIRLEQVGVTFGGEAVLDSIDLSVAPGQIVTLIGPNGAGKT
FT                   TLVRAVLGLLKPHRGKVWRKPKLRIGYMPQKIQVDATLPLSVLRFLRLVPGVDRAAALS
FT                   ALQEVGAEQVIDSPIQTISGGEMQRVLLARALLREPQLLVLDEPVQGVDVVGQTELYNL
FT                   ITRLRDRHGCGVLMVSHDLHLVMSATDQVVCLNRHVCCSGHPEQVSGDPAFVELFGQTA
FT                   PSLAIYHHHHDHSHDLHGSVVAPGTHVHGEHCKHG"
FT   gene            complement(137017..137502)
FT                   /locus_tag="PputGB1_0134"
FT   CDS_pept        complement(137017..137502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0134"
FT                   /product="putative ferric uptake regulator, Fur family"
FT                   /note="KEGG: pen:PSEEN0072 transcriptional repressor of Zn
FT                   transport system Zur"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96050"
FT                   /db_xref="GOA:B0KFZ9"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0KFZ9"
FT                   /protein_id="ABY96050.1"
FT                   /translation="MSITPLANRPHDHSHCVHSALAEADALCTRLGLRLTALRRRVLEL
FT                   VWQSHKPLGAYDILAVLSEQDGRRAAPPTVYRALDFLLENGLVHRIASLNAFIGCSHPE
FT                   HVHQGQFLICRACHVAIELEQSSISDAIIDSAKGVGFTVETQTVEVVGLCGSCRSAA"
FT   gene            137521..138477
FT                   /locus_tag="PputGB1_0135"
FT   CDS_pept        137521..138477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0135"
FT                   /product="periplasmic solute binding protein"
FT                   /note="PFAM: periplasmic solute binding protein; KEGG:
FT                   pen:PSEEN0073 zinc ABC transporter ZnuA, periplasmic
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96051"
FT                   /db_xref="GOA:B0KG00"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR035520"
FT                   /db_xref="UniProtKB/TrEMBL:B0KG00"
FT                   /protein_id="ABY96051.1"
FT                   /translation="METLLCYLFLTTRVSTVSRFLALFVAFIAFSAQADVRVLTSIKPL
FT                   QQIAAAVQDGIGSPDVLLPPGASPHHYALRPSDVRRVGDADLLYWIGPDMENFLPRVLA
FT                   SRSKATVAVQSLTGMKLRHFGEDSHSHEEESHDDHDHDHRPGSLDAHLWLSSVNARVIA
FT                   AKMAADLAQVDPANAARYQSNLKAFDERLDALDARIKARVDGIAGKPYFVFHEAFDYFE
FT                   AEYGLKHTGVFSVASEVQPGAQHVAAMRKRLQEVGKTCVFSEPPLRPRLAETLTAGLPV
FT                   RLAELDALGGTDPVDGKGYERLLEKLGGDLAGCLEQL"
FT   sig_peptide     137521..137625
FT                   /locus_tag="PputGB1_0135"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.981 at
FT                   residue 35"
FT   gene            complement(138528..139478)
FT                   /locus_tag="PputGB1_0136"
FT   CDS_pept        complement(138528..139478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0136"
FT                   /product="homoserine kinase"
FT                   /EC_number="2.7.1.39"
FT                   /note="KEGG: pen:PSEEN0074 homoserine kinase; TIGRFAM:
FT                   homoserine kinase; PFAM: aminoglycoside phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96052"
FT                   /db_xref="GOA:B0KG01"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR005280"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B0KG01"
FT                   /protein_id="ABY96052.1"
FT                   /translation="MSVFTPVTRPELETFLAPYQLGRLLDFQGIAAGTENSNFFVSLEQ
FT                   GEFVLTLIERGPSEDMPFFIELLDTLHAADMPVPYAIRDRDGNGLRELCGKPALLQPRL
FT                   SGKHIKAPNNQHCAQVGELLAHIHLATRAHIIERKTDRGLDWMLASGAELLPRLTAEQA
FT                   KLLQPALDEITAHKAQILALPRANLHADLFRDNVMFEGTHLTGVIDFYNACSGPMLYDI
FT                   AITVNDWCLDEQGAVDVPRAQALLAAYAALRPFTAAEAELWPEMLRVGCVRFWLSRLIA
FT                   AESFAGMDVMIHDPSEFEVRLAQRQQVALHLPFAL"
FT   gene            complement(139548..139835)
FT                   /locus_tag="PputGB1_0137"
FT   CDS_pept        complement(139548..139835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0137"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN0075 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96053"
FT                   /db_xref="InterPro:IPR021357"
FT                   /db_xref="UniProtKB/TrEMBL:B0KG02"
FT                   /protein_id="ABY96053.1"
FT                   /translation="MRTLNRLLLLGLLATMPVVTLAADDAPSADPEVTIRTEGDKTIQE
FT                   YRQNGFLYAIKITPKNGKPYFLVRADGTDANFIRSDQPDMLIPSWKIFEW"
FT   sig_peptide     complement(139767..139835)
FT                   /locus_tag="PputGB1_0137"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.955 at
FT                   residue 23"
FT   gene            139911..142658
FT                   /locus_tag="PputGB1_0138"
FT   CDS_pept        139911..142658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0138"
FT                   /product="DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: pen:PSEEN0076 DNA polymerase I, 3'--> 5'
FT                   polymerase, 5'--> 3' and 3'--> 5' exonuclease; TIGRFAM: DNA
FT                   polymerase I; PFAM: DNA-directed DNA polymerase; 5'-3'
FT                   exonuclease; 3'-5' exonuclease; SMART: Helix-hairpin-helix
FT                   domain protein class 2"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96054"
FT                   /db_xref="GOA:B0KG03"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B0KG03"
FT                   /protein_id="ABY96054.1"
FT                   /translation="MSQAPLVLVDGSSYLYRAFHALPPLTTSKGMPTGAVKGVLNMLKS
FT                   LRKQYPDSLFAVVFDAKGGTFRDAMFAEYKANRPSMPDDLRVQVEPLHASVKALGYPLL
FT                   CVEGVEADDVIGTLARSAAAKGRPVIISTGDKDMAQLVDGHITLVNTMTGSVLDVAGVH
FT                   EKFGVGPEHIIDFLALMGDKVDNIPGVPGVGEKTAVGLLTGIGGGLSDLYANLDKVPAL
FT                   AIRGAKTLPAKLEEHRDAAFLSYELATIKVDVPLDVEVDALVCGEPDREALQALYTEME
FT                   FKSWVAEVQREAARAGNEVAPVEEPAAKVEPTYETILDQARFEAWLDKLRQAPLFAFDT
FT                   ETTGLDAQKAQLVGLSFAVAPHEAAYVPLAHDYEGAPAQLDRDAVLLALKPLLEDPAKA
FT                   KVGQNAKYDINILANGSPAIEMRGVAYDTMLESYVLNSTATRHDMDSLAQKYLDHTTIA
FT                   FEDIAGKGAKQLTFNQINLDKAGPYAAEDADITLRLHQALQARLAQTPSVQPVLMDIEM
FT                   PLVPVLAKIERQGALVDAALLHVQSGELGVKMGELEQRAYELAGEEFNLGSPKQLGAIL
FT                   YDKLGMPVLSKTAKGQPSTAEAVLDELALLGYPLPEVLMQYRSLSKLKSTYTDKLPGQI
FT                   NPRTGRIHTSYQQAVAATGRLSSSDPNLQNIPIRTAEGRRIRQAFIASPGYKLLAADYS
FT                   QIELRIMAHLAKDEGLLHAFRNDLDVHRATAAEVFGVALQDVTTDQRRKAKAINFGLIY
FT                   GMSAFGLAKQIGVDRKQSQDYIDRYFARYPGVLAYMERTRAQAAEQGFVETLFGRRLYL
FT                   PDINAKNPALRKGAERTAINAPMQGTAADIIKRAMVNVDNWLSESGLDARVILQVHDEL
FT                   VLEVREDLVQQVKDEIRQHMSQAAQLDVPLLVEAGIGANWDEAH"
FT   gene            complement(142993..143625)
FT                   /locus_tag="PputGB1_0139"
FT   CDS_pept        complement(142993..143625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0139"
FT                   /product="small GTP-binding protein"
FT                   /note="TIGRFAM: small GTP-binding protein; PFAM:
FT                   GTP-binding protein HSR1-related; KEGG: pen:PSEEN0078
FT                   GTP-binding protein EngB"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96055"
FT                   /db_xref="GOA:B0KG04"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KG04"
FT                   /protein_id="ABY96055.1"
FT                   /translation="MQVKNPILGLCQKATFALSAAKVEQCPDDQGYEVAFAGRSNAGKS
FT                   SALNTLTHASLARTSKTPGRTQLLNFFSLDDERRLVDLPGYGYAKVPIPLKQHWQKHLE
FT                   AYLGSRECLRGVILMMDVRHPMTDFDKMMLDWAKASGMPMHILLTKADKLTHGAGKNTL
FT                   LKVQSEIRKGWGDGVTIQLFSAPKRLGVEDAYRVLAGWMELEDKPVA"
FT   gene            143827..144129
FT                   /locus_tag="PputGB1_0140"
FT   CDS_pept        143827..144129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0140"
FT                   /product="cytochrome c-type protein"
FT                   /note="KEGG: pen:PSEEN0079 cytochrome c-type protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96056"
FT                   /db_xref="GOA:B0KG05"
FT                   /db_xref="InterPro:IPR002323"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B0KG05"
FT                   /protein_id="ABY96056.1"
FT                   /translation="MAKWLLAVGMFLPVFSAQATQDPEVLYNRTCAACHTGQLPQAPRQ
FT                   GDRAAWEPRLAQGMEVLVKHVTQGFKAMPPRGLCMDCSAEDYRLVILWMSGSPDT"
FT   sig_peptide     143827..143886
FT                   /locus_tag="PputGB1_0140"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.965 at
FT                   residue 20"
FT   gene            144161..144778
FT                   /locus_tag="PputGB1_0141"
FT   CDS_pept        144161..144778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0141"
FT                   /product="cytochrome c class I"
FT                   /note="PFAM: cytochrome c class I; KEGG: pen:PSEEN0080
FT                   cytochrome c4"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96057"
FT                   /db_xref="GOA:B0KG06"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR024167"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B0KG06"
FT                   /protein_id="ABY96057.1"
FT                   /translation="MNKLVVSLLLTLGVAGAATAAQPIKGDAAAGQAKTAVCGACHNPD
FT                   GNSLAPNFPKLAGQGQRYLEKQLHDIKSGKRTVLEMTGMLTAFSDQDLADIAAYFSSQK
FT                   GSVGAADPKLVERGRSLFNGGDLEKGMPACTGCHSPNGAGIALAGFPHLGGQHSQYVTK
FT                   QLTDFREGNRTNDGDAMTMRTIAGKLSNHDIEALASYIQGLH"
FT   sig_peptide     144161..144223
FT                   /locus_tag="PputGB1_0141"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 21"
FT   gene            144929..145561
FT                   /locus_tag="PputGB1_0142"
FT   CDS_pept        144929..145561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0142"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: pen:PSEEN0081
FT                   thiol:disulfide interchange protein, periplasmic,
FT                   alkali-inducible"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96058"
FT                   /db_xref="GOA:B0KG07"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B0KG07"
FT                   /protein_id="ABY96058.1"
FT                   /translation="MRKLILSAALVAASVFGMTAVQAAEPVAGKEYIELSNPVQVSVPG
FT                   KIEVVELFWYGCPHCYHFEPVINPWVDKLPKDVNFKRVPAMFGGPWDAHGQMFLTLEAM
FT                   GVEHKVHAAVFDAIQNQRKHLTKPEEMADFLATQGVDKDKFLATFNSFAIKGQVNQAKE
FT                   LAKKYEITGVPSMVVNGKYRFDLGTAGGPEGVLNVADQLIEKERAAK"
FT   sig_peptide     144929..145000
FT                   /locus_tag="PputGB1_0142"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 24"
FT   gene            145574..146428
FT                   /locus_tag="PputGB1_0143"
FT   CDS_pept        145574..146428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0143"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase; KEGG:
FT                   pen:PSEEN0082 DNAse I-like hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96059"
FT                   /db_xref="GOA:B0KG08"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:B0KG08"
FT                   /protein_id="ABY96059.1"
FT                   /translation="MPRLRATRGIGLHQPQVNEHHLQAPGLPEDGRLRLLSFNIQVGIS
FT                   TERYRHYLTRSWQHLLPHNGRAGNLQKIGKLLGDFDLVALQEADGGSLRSGYVNQVEHL
FT                   AHLGAFPYWYQQLNRNLGRFAQHSNGVLSRLKPQLLEDHPLPGPAGRGAILVRFGEGKD
FT                   ALIVVMMHLALGAKTRALQLGYIRELIGGYRHQVLMGDMNTHATDLLEHSPLRDLGLVA
FT                   PQVEATFPSWRPQRCLDHILLSPSLTLERVEVLAQPISDHLPVAVEIRLPDALTVDTLP
FT                   VLS"
FT   gene            146456..148384
FT                   /locus_tag="PputGB1_0144"
FT   CDS_pept        146456..148384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0144"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: pen:PSEEN0083 diguanylate cyclase
FT                   (GGDEF domain protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96060"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B0KG09"
FT                   /protein_id="ABY96060.1"
FT                   /translation="MTEDAERWKEKYLKSIEQQERLERRWDARLDLLRRGLVRSTLAAE
FT                   GSDKIVDECMKEMRDVIRSDNMDAGLAGLIPRLEKAVLDSEQRRETRMNQVSDALTALV
FT                   GQLQGLPLPSDISRPLKKLAKKLDGGVAQSRELPPLLGELSGLQGRALSALGKPGEDAR
FT                   PGFLQRLFGSREEETLAEAEHAPVAEAQPQAAGSIALLPPDDVDALQPLPGPAASCAEV
FT                   TDAPEAELEVSGPALIESVETQPASLPQMPQDEAPVAEAAASEPLAEAEPLPTLEETFG
FT                   EDGPYALPYAVEPPYSQVAAHIEQTLIGLLDDLSLPERHKAQALEMRERVARGLNWYEL
FT                   IPVLDDLAVLMLAITDSGQHEFETYLQQLNERLEGFQSHLHEASAGHADNSSAARELDS
FT                   QLREHVDGLQSSVQGAADVDSLKHILENRLEGLLVTMDEHKHERDRREQELAGRLQGLS
FT                   ERVANMEHEALGYREHLEEQRQKALLDPLTGLPNRAAWSERVEREMLDWQENGGHLAMA
FT                   ILDLDHFKRINDSYGHLAGDKVLKIVADQLRKRLRGRDFIARFGGEEFVLLLPQTPPAA
FT                   AAQVAELLRATVEACPFHFKGERVVITTSIGLGAFRPGERSDQVLKRADAALYRAKEHG
FT                   RNRVEQG"
FT   gene            148463..149251
FT                   /locus_tag="PputGB1_0145"
FT   CDS_pept        148463..149251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0145"
FT                   /product="N-acetylmuramyl-L-alanine amidase, negative
FT                   regulator of AmpC, AmpD"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein;
FT                   N-acetylmuramoyl-L-alanine amidase family 2; KEGG:
FT                   pen:PSEEN0084 N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96061"
FT                   /db_xref="GOA:B0KG10"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:B0KG10"
FT                   /protein_id="ABY96061.1"
FT                   /translation="MLSTLKKTLISFLLLSVAGCSTGLRIDRSHPSANQDNRIQFVVLH
FT                   YTNASLERSLALLTHGEVSSHYLIGDGPATVYQLVDENRRAWHAGDSQWQGRTWLNSSS
FT                   IGIEIVNPGFTDTPNGRVWHPYSEAQVQSLIALLKDIVKRNNIEPRHIIGHSDIAPLRK
FT                   LDPGPLFPWKRLADAGLGIWPDANAVARQQAYFSVNPPSVGWYQQELARFGYQVEQTGV
FT                   LDVATRHVIAAFQMRFRPQRFDGMPDAQTAAMLQVLNRMR"
FT   sig_peptide     148463..148534
FT                   /locus_tag="PputGB1_0145"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.885) with cleavage site probability 0.573 at
FT                   residue 24"
FT   gene            149339..150937
FT                   /locus_tag="PputGB1_0146"
FT   CDS_pept        149339..150937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0146"
FT                   /product="EAL domain protein"
FT                   /note="PFAM: EAL domain protein; KEGG: pen:PSEEN0085 signal
FT                   transduction protein; EAL domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96062"
FT                   /db_xref="GOA:B0KG11"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR024744"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B0KG11"
FT                   /protein_id="ABY96062.1"
FT                   /translation="MSALIALLRQIFYRPWMLATLAALASAALLLSASIGIALQQMKQS
FT                   ESEQMNAQGERFLDRLEQVFGQLREGVDLLQAQPLRGCSPAMLAALQQVGLSSRFIYEA
FT                   AYVDGDVACSNRGDERAFVPLRAPDIQGPTYSYWLNTTTEPNENLAALMLGRGKFLVST
FT                   SRGHLTDVVDLPPGGSLVVVLDNGARAIPVLGPPQVWPPPSAWSTSHKSLLELSDRLIY
FT                   RMPTKSPDYQLVLIAPRASLPLRMNGMLWLLFPGSVLAACCIGWLVLQLILQRRSMSSE
FT                   LQNALRRGELQVLYQPIIELDSRRCVGAEALVRWRRPDGTLTSPDLFIPLAENTGQIRQ
FT                   ITDFVLQRVLEQLGQLLRSHPKLYISVNLAACDVMVPRIGRVAARLLALHRVAPSQIAF
FT                   EVTERGLIDVVVARDNLQALRAVGHQVLIDDFGTGYCSLAYLQTLPVDCLKIDKAFIDA
FT                   LGHDAASSGVAPHIIRMAHDLHLRVIAEGIEFEDQAVLLNSEGVNYGQGWLFARPLNAR
FT                   QFAELVTRGHLPRRV"
FT   sig_peptide     149339..149440
FT                   /locus_tag="PputGB1_0146"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.280 at
FT                   residue 34"
FT   gene            complement(150952..152718)
FT                   /locus_tag="PputGB1_0147"
FT   CDS_pept        complement(150952..152718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0147"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: pen:PSEEN0086 alginate biosynthesis sensor
FT                   protein KinB; TIGRFAM: PAS sensor protein; PFAM:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   HAMP region domain protein; histidine kinase A domain
FT                   protein; PAS fold-4 domain protein; PAS fold domain
FT                   protein; SMART: PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96063"
FT                   /db_xref="GOA:B0KG12"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR031909"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038320"
FT                   /db_xref="UniProtKB/TrEMBL:B0KG12"
FT                   /protein_id="ABY96063.1"
FT                   /translation="MKLRTRLFLSISALVTVALLGLLLGLVSVLQMAAVQQQLVRETTH
FT                   ALEVGLKLRQNLGEQLTLILDEETAPDNLRLLQDNFQALLNQGLEQGGERTGFSKASSN
FT                   YQAFLQAYRDSAAPARSMGVDQPLGAAFNQVRTDLIDAHKQALDLITRSEEHTRDRALL
FT                   VSGVLGLMGLVVLVLGFITAHNIARRFGQPIEALAKAADQLGKGNFDVTLPVTQATELN
FT                   QLTRRFGLMADALRKHQATNVDELLAGQQRLQAVLDSIDDGLLIIDRQGRLEHLNPVAQ
FT                   RQLGWSDSRVGSGLANALQRPELEQQLRQVLRGGSLDRQPDDLNIEVDEETRLLTYSLT
FT                   PVSHPQGPILGAVMVLHDVTEQRAFERVRSEFVLRASHELRTPVTGMHMAFGLLRERVK
FT                   FPPDARENDLLETIGEEMQRLTQLINDLLNFSRYQSGLQKLELAPCALDELLERAQLRF
FT                   AEQAQQKQIELLKELEAPLPRIQADVAQLDRVLDNLLHNAIRHTANGGRIRLHARRHAE
FT                   RVIISIEDNGEGIAYGQQGRIFEPFVQVGRKKGGAGLGLALCKEIVQLHGGRMGVFSRP
FT                   GQGTQFYMALPV"
FT   sig_peptide     complement(152617..152718)
FT                   /locus_tag="PputGB1_0147"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 34"
FT   gene            complement(152730..154076)
FT                   /locus_tag="PputGB1_0148"
FT   CDS_pept        complement(152730..154076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0148"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: response regulator receiver; sigma-54 factor
FT                   interaction domain-containing protein; helix-turn-helix
FT                   Fis-type; ATPase associated with various cellular
FT                   activities AAA_5; SMART: AAA ATPase; KEGG: pen:PSEEN0087
FT                   alginate biosynthesis response regulator AlgB"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96064"
FT                   /db_xref="GOA:B0KG13"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0KG13"
FT                   /protein_id="ABY96064.1"
FT                   /translation="MESAQDNQGRILLVDDESAILRTFRYCLEDEGYSVATANSAAQAE
FT                   SLLQRQVFDLCFLDLRLGEDNGLDVLAQMRIQAPWMRVVIVTAHSAIDTAVDAIQAGAA
FT                   DYLVKPCSPDQLRLATAKQLEVRQLSARLEALEGEIRKPKDGLDSHSPAMMAVLETARQ
FT                   VATTDANILILGESGTGKGELARAIHGWSKRARKACVTINCPSLNAELMESELFGHTRG
FT                   AFTGASESTLGRVSQADGGTLFLDEIGDFPLTLQPKLLRFIQDKEYERVGDPVTRRADV
FT                   RILAATNLNLEEMVRESRFREDLLYRLNVITLHLPPLRERSEDILTLADRFLARFVKEY
FT                   SRPARGFSDEARAALLNYRWPGNIRELRNVVERASIICPQERVEISHLGMGEQPTGNAP
FT                   RVGAALSLDELERAHIGAVLAASDTLDQAAKTLGIDASTLYRKRKQYNL"
FT   gene            154286..155107
FT                   /locus_tag="PputGB1_0149"
FT   CDS_pept        154286..155107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0149"
FT                   /product="transport-associated"
FT                   /note="PFAM: transport-associated; SMART:
FT                   Transport-associated and nodulation region; KEGG:
FT                   psp:PSPPH_0251 osmotically inducible protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96065"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:B0KG14"
FT                   /protein_id="ABY96065.1"
FT                   /translation="MPFSLRTAVLAATLLPAFTPAFADPVQDARLEGALQTALSLNRML
FT                   DPFRITVEVDGKQARLSGEVENEVERQLAEDVARATRGIEQVENQLRVNPQLVERPLEL
FT                   RAYAQRLEDATLAAVIRARLLWSRTTEKAPIEVQSSEGVVTLRGKVDSAEAKELAGVVA
FT                   RTTDGVHLVNNLVSLDTTAMAKARETPVGAPTGPQPSDSWIIDKIQNSYRFSRNLDGLN
FT                   LKVASEAGMVRLSGEVVSAEQKTIAVEIARQIIGVRGVDADLLKVAIKVEG"
FT   sig_peptide     154286..154357
FT                   /locus_tag="PputGB1_0149"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            155282..155572
FT                   /locus_tag="PputGB1_0150"
FT   CDS_pept        155282..155572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0150"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN0089 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96066"
FT                   /db_xref="GOA:B0KG15"
FT                   /db_xref="UniProtKB/TrEMBL:B0KG15"
FT                   /protein_id="ABY96066.1"
FT                   /translation="MNRQSVNRSQIAALPLRQMLTLGMALLLTLAAGLFYYSWQTARLA
FT                   EQVAAQTALLTQIQATRANTLVKAAEPLPTGQATASPATLETVVPQDRWVF"
FT   sig_peptide     155282..155419
FT                   /locus_tag="PputGB1_0150"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.933) with cleavage site probability 0.444 at
FT                   residue 46"
FT   gene            155616..155777
FT                   /locus_tag="PputGB1_0151"
FT   CDS_pept        155616..155777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0151"
FT                   /product="protein of unknown function DUF1328"
FT                   /note="PFAM: protein of unknown function DUF1328; KEGG:
FT                   pen:PSEEN0090 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96067"
FT                   /db_xref="GOA:B0KG16"
FT                   /db_xref="InterPro:IPR009760"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KG16"
FT                   /protein_id="ABY96067.1"
FT                   /translation="MLSWAITFLIIAIVAAVLGFGGIAGAATGIAKILFIVFLVLFVAS
FT                   FFFGRGRG"
FT   sig_peptide     155616..155696
FT                   /locus_tag="PputGB1_0151"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.985 at
FT                   residue 27"
FT   gene            155780..156250
FT                   /locus_tag="PputGB1_0152"
FT   CDS_pept        155780..156250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0152"
FT                   /product="Inhibitor of vertebrate lysozyme"
FT                   /note="PFAM: Inhibitor of vertebrate lysozyme; KEGG:
FT                   pen:PSEEN0091 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96068"
FT                   /db_xref="GOA:B0KG17"
FT                   /db_xref="InterPro:IPR014453"
FT                   /db_xref="InterPro:IPR036501"
FT                   /db_xref="UniProtKB/TrEMBL:B0KG17"
FT                   /protein_id="ABY96068.1"
FT                   /translation="MSRKLCSALAAALLLGGSTAAMAANDGQVRVDQLLGSDPEYRETW
FT                   QDTLKGEERLPDWVVNLTGSAQQQMSAVTEDGDKYLVGPLCEAKDNCTYKRLIVAFSWD
FT                   KDDAYGMLVEVPEGLPSDKSPTRHAQYRWLGEPDDGMKAMLQEQLKRDPNWY"
FT   sig_peptide     155780..155851
FT                   /locus_tag="PputGB1_0152"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 24"
FT   gene            156995..158323
FT                   /locus_tag="PputGB1_0153"
FT   CDS_pept        156995..158323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0153"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="PFAM: sodium:dicarboxylate symporter; KEGG:
FT                   pen:PSEEN0093 glutamate:aspartate symport protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96069"
FT                   /db_xref="GOA:B0KG18"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR034703"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:B0KG18"
FT                   /protein_id="ABY96069.1"
FT                   /translation="MKKAKLSLAWQIVIGLVLGVAIGALLNHFSAEKAWWISNVLQPAG
FT                   DIFIRLIKMIVVPIVISSLIVGIAGVGDAKKLGSIGLKTIIYFEVVTTIAIVVGLVLAN
FT                   LFHPGAGIDMSTLGTVDISKYQATAAEVQHEHAFIETLLNLIPSNIFAALMRGEMLPII
FT                   FFSVMFGLGLSSLQAELRDPLVRTFQAVSETMFKVTHMIMNYAPIGVFALIAVTVANFG
FT                   FSSLLPLAKLVLLVYFAIAFFAFMVLGLVARVFGFSVIKIMRIMKDELILAYSTSSSET
FT                   VLPRVIEKMEKYGAPKSICSFVVPTGYSFNLDGSTLYQSIAAIFIAQLYGIDLSWSQQL
FT                   LLVLTLMVTSKGIAGVPGVSFVVLLATLGSVGIPLEGLAFIAGVDRIMDMARTALNVVG
FT                   NALAALVIARWEGMYDAAKGEKYYASLMADKQEAAVVGETAKR"
FT   sig_peptide     156995..157066
FT                   /locus_tag="PputGB1_0153"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.740) with cleavage site probability 0.347 at
FT                   residue 24"
FT   gene            158467..159696
FT                   /locus_tag="PputGB1_0154"
FT   CDS_pept        158467..159696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0154"
FT                   /product="nucleoside recognition domain protein"
FT                   /note="PFAM: nucleoside recognition domain protein; KEGG:
FT                   pen:PSEEN0094 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96070"
FT                   /db_xref="GOA:B0KG19"
FT                   /db_xref="InterPro:IPR011415"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:B0KG19"
FT                   /protein_id="ABY96070.1"
FT                   /translation="MLNGLWLGFFLVAAVSALAQWLVAGNAGIFAAMVESIFAMAKLSV
FT                   EVMVLLFGTLTLWLGFLKIAEKAGIVEWLAKVLGPLFARLMPEVPPGHPALGLITMNFA
FT                   ANGLGLDNAATPIGLKAMRALQELNPSSTTASNAQILFLVLNASSLTLLPVTIFMYRAQ
FT                   QGAPDPTMVFLPILLATSVSTLVGLLSVAVMQRLRLWDPVVLAYFIPGALLLGGFMAFL
FT                   GTLSAAALASLSSILGNLTLFGVIMLFLVIGALKRVKVYEAFVEGAKEGFDVAKNLLPY
FT                   LVAMLVAVGVLRASGALELALDGIRHAVNWMGLDTRFVEGLPTALVKPFSGSAARAMLI
FT                   ETMQTQGVDSFPALVAATIQGSTETTFYVLAVYFGAVGIQRVRHAVGCALLAELSGVIA
FT                   AIFICYWFFA"
FT   sig_peptide     158467..158526
FT                   /locus_tag="PputGB1_0154"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 20"
FT   gene            complement(159678..160313)
FT                   /locus_tag="PputGB1_0155"
FT   CDS_pept        complement(159678..160313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0155"
FT                   /product="lipoprotein"
FT                   /note="KEGG: pen:PSEEN0095 lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96071"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:B0KG20"
FT                   /protein_id="ABY96071.1"
FT                   /translation="MKPSLRLLALAAALSLASACSILPKSEPVDLYRLPVNQPSRTAPA
FT                   LDWSLRLNKPLASEVLAGPRIAVIPQGDMVSSYKGARWSDAAPVLLRNRLLDGFQRDGQ
FT                   VQRLSADDSNLQADYELAGELQAFQSEYRPGGAVEVVIRYDARLVQGRNQRILASKRFE
FT                   IRQPLTDKQVSAVVIGFGQASDQLVGQVVSWTIAQANQAQPRVQAKNQ"
FT   sig_peptide     complement(160254..160313)
FT                   /locus_tag="PputGB1_0155"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.747 at
FT                   residue 20"
FT   gene            complement(160310..161248)
FT                   /locus_tag="PputGB1_0156"
FT   CDS_pept        complement(160310..161248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0156"
FT                   /product="Mammalian cell entry related domain protein"
FT                   /note="PFAM: Mammalian cell entry related domain protein;
FT                   KEGG: pen:PSEEN0096 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96072"
FT                   /db_xref="GOA:B0KG21"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:B0KG21"
FT                   /protein_id="ABY96072.1"
FT                   /translation="METRAHHVLIGLVTVLVVAGAMLFGLWLAKSSVDDAFKDYEVVFN
FT                   EAVSGLSRGSPVQYNGIKVGDVSTLRLDPKDPRRVLARVRLSGDTPVKEDTQAKLTLAG
FT                   VTGNSFIQLSGGTPQSPELKGKDGKLPVIIASPSPISRLLNDSSDLVTNINLLLHNANQ
FT                   MFSEDNIGHLSNTLANLDKTTGAFAGQHGSIAEAIEQLVQVGKQASATLAETQTLMRNA
FT                   NGLLGSEGKQAIGSAERAMQSLAESTATINNLLKNNSEAIGDGAQGLNQLTPAIRELRE
FT                   TLNALKGISRQLEADPSGYLLGRDNNKEFQP"
FT   gene            complement(161252..162043)
FT                   /locus_tag="PputGB1_0157"
FT   CDS_pept        complement(161252..162043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0157"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pen:PSEEN0097 ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96073"
FT                   /db_xref="GOA:B0KG22"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0KG22"
FT                   /protein_id="ABY96073.1"
FT                   /translation="MSDQDRVIEARGICNRFGRQVVHENLDLDLYRGEILAVVGGSGSG
FT                   KSVLLRSIIGLRRPNEGQIKVFGQDLAGLHEEQRSLVERRFGVLFQKGALFSSLTVTEN
FT                   VALPLIEHAGLSRADAEHLAGVKLALAGLPISAADKYPASLSGGMIKRAALARALALDP
FT                   DILFLDEPTAGLDPIGAAAFDQLILTLRDALGLSVFLITHDLDTLYTITDRIAVLSQKK
FT                   VLVAGPLAEVEQTNDAWIQEYFHGPRGRAAEQAATRAGQER"
FT   gene            complement(162040..163173)
FT                   /locus_tag="PputGB1_0158"
FT   CDS_pept        complement(162040..163173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0158"
FT                   /product="protein of unknown function DUF140"
FT                   /note="PFAM: protein of unknown function DUF140; KEGG:
FT                   pen:PSEEN0098 ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96074"
FT                   /db_xref="GOA:B0KG23"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:B0KG23"
FT                   /protein_id="ABY96074.1"
FT                   /translation="MEPMTTPSAILDTSSQPPCLRITGDWTLAHYANLKRESEQLRTQY
FT                   AADTVADLSQLGRLDTAGASLLAELLGSERLSRCTQDLPEASRALLKNVYCSVQDYCIP
FT                   VKEPERNVLLMLLERIGRAVGTLWQDSMQLLGFVGVILETLLRRALQPHRWRFTPVVAH
FT                   IEQTGLDAAPIVALLTFLVGAVVAFLGATVLADFGATIFTVDLVAFSFLREFAVLLTAI
FT                   LMAGRTASAFTAQIGSMKANEEIDAIRTLGLNPMELLVVPRVLALLISLPLLTFVAMIC
FT                   GMIGGAVVCALTLDISPAMFLSLLQSDIGVQHFLVGLAKAPFFAFLIAAIGCLEGFKVS
FT                   GSAESVGAHTTSAVVQSIFVVIVLDAVAALFFMEMGW"
FT   gene            complement(163288..164310)
FT                   /locus_tag="PputGB1_0159"
FT   CDS_pept        complement(163288..164310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0159"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN0099 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96075"
FT                   /db_xref="GOA:B0KG24"
FT                   /db_xref="InterPro:IPR016937"
FT                   /db_xref="InterPro:IPR022606"
FT                   /db_xref="UniProtKB/TrEMBL:B0KG24"
FT                   /protein_id="ABY96075.1"
FT                   /translation="MPQIPHIVQRIIELLKRYPGIIALGGFLSGIGSFILVDRQAGLAS
FT                   WVAILMLVSWVWLMLENTLTGLFARTFNREIPQPLLRYATQMIHQETLFFVLPFFFITT
FT                   TWNSGQLVFTGLLGAAGLISITDPLYYKWLAPRRWLFLALHTLTLFAALLTALPIILHL
FT                   TTAQSFKLALIAAMALSFPSLASSFPINNWRRAVALVVVTLSVGAGGWLLRSWVPPATL
FT                   WMTEVAVSTEVLNRQPGESLDEIAASRIRSSGLYAYTAINAPRGLNERIYHVWQKDGQE
FT                   VDRIALDIHGGRKEGYRAWTHKQNFPPNPVGKWQVRVLTEDGQVIGVLRFKVVDDAPAQ
FT                   "
FT   gene            complement(164405..165811)
FT                   /locus_tag="PputGB1_0160"
FT   CDS_pept        complement(164405..165811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0160"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   pen:PSEEN0100 metalloprotease, M16 family"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96076"
FT                   /db_xref="GOA:B0KG25"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:B0KG25"
FT                   /protein_id="ABY96076.1"
FT                   /translation="MRCLMFVCLLICSLPSIALDRSRVEGYLLPNGLQVILKNGYERDH
FT                   VAIRLVVGVGLDDFDCEQKELPHLLEHLLFSGIDEMGEGGLEERLQALGGEWNAYTSSA
FT                   DTTFVIEAPARNQRKVLDLLLAVIRDTRIDAKALATAKRIIEREDGGHYGHLQRWLDRQ
FT                   DIGHPASDQLATELGLKCPERSNLDDMTLEQVQALRDRWYAANNMTLIVVGGLDRLLPA
FT                   YLERTFGELPATEPEERRNLESITQQAEQRRDLTRGWLGDSVKLHWLFIEPVLDNDHQA
FT                   TLDLLSRYLDWALYDQLRLRNGLSYGPSVQRESFGDTGLLSLNADLERDDIDKAVKVMQ
FT                   ALFDHLRKEGLDPDTFARIKDASVAKESWSTQGNSALADYYWGALNDYTDGRFANPVRK
FT                   LRQVSLAQANEALKALLKEDGYLRIEKPLLGYDELYGLVALIVGLILAAGLLRWRRQGP
FT                   QRPSGATRQR"
FT   sig_peptide     complement(165755..165811)
FT                   /locus_tag="PputGB1_0160"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.983 at
FT                   residue 19"
FT   gene            complement(165842..167500)
FT                   /locus_tag="PputGB1_0161"
FT   CDS_pept        complement(165842..167500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0161"
FT                   /product="sodium-dependent inorganic phosphate (Pi)
FT                   transporter"
FT                   /note="TIGRFAM: sodium-dependent inorganic phosphate (Pi)
FT                   transporter; Na/Pi-cotransporter II-related protein; PFAM:
FT                   Na+/Picotransporter; KEGG: pen:PSEEN0101 Na+/Pi
FT                   cotransporter"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96077"
FT                   /db_xref="GOA:B0KG26"
FT                   /db_xref="InterPro:IPR003841"
FT                   /db_xref="InterPro:IPR004633"
FT                   /db_xref="UniProtKB/TrEMBL:B0KG26"
FT                   /protein_id="ABY96077.1"
FT                   /translation="MLTLLNLLSAVTLLVWGTHIVRTGILRVFGSNLRRIISQNMDKRP
FT                   LAFIAGILVTAMVQSSNATAMLVTSFVGQGLMAMTPALAIMLGADVGTALMARVLTFDL
FT                   SWLSPLLIFLGVIFFLSRKQTRAGQLGRVGIGLGLIILALELIVQAAAPITHAQGVKVL
FT                   FASLTGDIMLDALVGAMFAMISYSSLAAVLLTATLAGAEVISLPVAIGLVVGANIGSGL
FT                   LAFIGTSMQNAAGRRVALGSLLYKLIGLVLIIPVLHPLVEWMDSLSFSPQELVIGFHLL
FT                   YNTLRCLLMLPTVKPMGRLCNALLPERETGNGQVRPRHLDASALETPSLALANACRETL
FT                   RLGDIVDSLLEAMLGALRGTQAALPQQVRALGEDAEALYSAIKLYLAQMSREDLSEQDN
FT                   RRWAEIIELAINLKLACDLIERMLRKVQQQKTSQRREFSQVGLEELTGLQEQLLANLRL
FT                   GLSVFLSADPESARLLLREKRRFRAQERRLAHAHVSRLQRKVVQSIETSSLHLELIADM
FT                   KRLNSLFCSSAYVVLGGSDTGGLMLDSVPDEARQP"
FT   gene            complement(167698..168468)
FT                   /locus_tag="PputGB1_0162"
FT   CDS_pept        complement(167698..168468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0162"
FT                   /product="Integral membrane protein TerC"
FT                   /note="PFAM: Integral membrane protein TerC; KEGG:
FT                   pen:PSEEN0103 efflux transporter, TerC family"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96078"
FT                   /db_xref="GOA:B0KG27"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="UniProtKB/TrEMBL:B0KG27"
FT                   /protein_id="ABY96078.1"
FT                   /translation="MEWLTSPEIWVAFFTLTALEIVLGIDNIIMISILVSRMPKHMQPR
FT                   TRIFGLALAMVTRIMLLLSITWVMRLTADLFVVFGQGISGRDLILFFGGLFLLWKSSQE
FT                   IYHGLEGEDENPDEPKGAGGKFFYTIIQIAIIDIVFSLDSVITAVGMVSHVPVMIAAIV
FT                   VAVLVMMLCAGAISDFIDKHPSLKMLALSFLIVVGTVLIAEAFDVHVPKGYVYFAMAFS
FT                   LAVEAINIRMRTAAARKAGKEHDPVKLRKDIPGQ"
FT   gene            complement(168538..169845)
FT                   /locus_tag="PputGB1_0163"
FT   CDS_pept        complement(168538..169845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0163"
FT                   /product="citrate/H+ symporter, CitMHS family"
FT                   /note="TIGRFAM: citrate/H+ symporter, CitMHS family; PFAM:
FT                   C4-dicarboxylate anaerobic carrier; Citrate transporter;
FT                   TRAP C4-dicarboxylate transport system permease DctM
FT                   subunit; KEGG: pen:PSEEN0104 citrate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96079"
FT                   /db_xref="GOA:B0KG28"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR014738"
FT                   /db_xref="UniProtKB/TrEMBL:B0KG28"
FT                   /protein_id="ABY96079.1"
FT                   /translation="MLTFLGFAMVITFMYLIMTKRLSALIALILVPILFALFGGFSAKI
FT                   GPMMLEGISKLAPTGVMLMFAILYFALMIDSGLFDPAVRKILKLVKGDPLKVSVGTAVL
FT                   ALVVSLDGDGATTYMICCAAMLPMYSRLGMSPRIMAGLIILAGGVMNMTPWGGPTARAA
FT                   SALHVDPSDIFVPMIPAMLFGVLAILAIAYMYGKRERARLGELHLPTDDIDHSEITVSQ
FT                   YPDARRPKLLYFNGALTAALMVALIAGVLPLPVLFMIAFSIAMIVNYPCLQQQKDRIAA
FT                   HAGSVLAVTGLIFAAGIFTGILSGTGMVDAMSKSLLAVIPEALGPYLAVITAIVSMPFT
FT                   FFMSNDAFYYGVLPVLAEAASHYGITPVEMARASIVGQPVHLLSPLVPSTYLLVALAGI
FT                   EFGDHQRFTLKWAVLVCLCIMLAALLMGIFPLFSSL"
FT   sig_peptide     complement(169735..169845)
FT                   /locus_tag="PputGB1_0163"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.616) with cleavage site probability 0.185 at
FT                   residue 37"
FT   gene            170112..170513
FT                   /locus_tag="PputGB1_0164"
FT   CDS_pept        170112..170513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0164"
FT                   /product="glutathione-dependent formaldehyde-activating
FT                   GFA"
FT                   /note="PFAM: glutathione-dependent formaldehyde-activating
FT                   GFA; KEGG: pen:PSEEN0106 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96080"
FT                   /db_xref="GOA:B0KG29"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:B0KG29"
FT                   /protein_id="ABY96080.1"
FT                   /translation="MQNVTEGGCHCGALRYRLEGDLTDIAHCHCSICRRVSGGLVVTWL
FT                   TLPRSGFQWLAGEPNCYVAPASCSRYFCGHCGAHVALVTTHSPETVDVTVATLDHPELV
FT                   RANRHIWVGSRLPWLHLDEQLPSEAEEKL"
FT   gene            complement(170638..172584)
FT                   /locus_tag="PputGB1_0165"
FT   CDS_pept        complement(170638..172584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0165"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN0107 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96081"
FT                   /db_xref="InterPro:IPR025178"
FT                   /db_xref="UniProtKB/TrEMBL:B0KG30"
FT                   /protein_id="ABY96081.1"
FT                   /translation="MRAWLLGCALTLLGTPALADLQLELQASGLDPQQTQASQALLDEA
FT                   MGRLPPRFKQQLDRRVRVSWSDNMPADAYGQASLVSTLELNRRLLPSLTDGSAATERTN
FT                   RPHGTVREELLATVLHELTHIYDRARLWPGAERSLIARCKRQQGTLGKIGLPEECRGQA
FT                   ERRFTLSDDPRLLDLAGWPQYVGRRGEREQHNGQFVRSPDSYELSSPKEYIAVNMEYFL
FT                   LDPSYGCRRPALNQYLRQHFGWAPQQDTCAKGLPFINAGSDFARQPLGEIDPERVYEVD
FT                   YLLAEANQNLVSRWGHSMLRLVICKPGRPRGPDCRLDLDQSLVLSYRAFVNDVQLSSWD
FT                   GLVGNYPSRLFVLPLGQVIDEYTKTELRSLASVPLKLNREEIENLVRQAAEMHWSYDGN
FT                   YWFLSNNCAVESLKLLRSGTANPRINDLDSIMPNGLLAVLKGRGLADTSVLDDPREALR
FT                   LGYRFDSYRDRYQAMFEVLRKQLPIKQALVEDWLALEADQRRSWFAKADLRTSAALLLL
FT                   EQASLRRQLLLAQDEVKQRYLNAAALKDGSVNKADATLKQMLANSGFLSRPAELLDAKG
FT                   YGLPQPEERKHLEQVSSERQAQLLRLSTSLDKEVRALLEPSRAKEIAAIEANVKQIGEH
FT                   LRALHKAAGGLQL"
FT   sig_peptide     complement(172525..172584)
FT                   /locus_tag="PputGB1_0165"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT   gene            complement(172590..172910)
FT                   /locus_tag="PputGB1_0166"
FT   CDS_pept        complement(172590..172910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0166"
FT                   /product="conserverd hypothetical protein"
FT                   /note="TIGRFAM: conserverd hypothetical protein; PFAM:
FT                   conserved hypothetical protein; KEGG: pen:PSEEN0108
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96082"
FT                   /db_xref="InterPro:IPR012661"
FT                   /db_xref="UniProtKB/TrEMBL:B0KG31"
FT                   /protein_id="ABY96082.1"
FT                   /translation="MRKPLIAASLGMLLLADLAQAQTLVATSNIIVRAFGRSIDFTSDT
FT                   TTSIRDSKVVREAHDDAASFVASNGDIRGVQLEAAFNTLRERVPEARAASDQVLAEAIL
FT                   AL"
FT   sig_peptide     complement(172845..172910)
FT                   /locus_tag="PputGB1_0166"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.789 at
FT                   residue 22"
FT   gene            complement(172946..173239)
FT                   /locus_tag="PputGB1_0167"
FT   CDS_pept        complement(172946..173239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0167"
FT                   /product="conserverd hypothetical protein"
FT                   /note="TIGRFAM: conserverd hypothetical protein; PFAM:
FT                   conserved hypothetical protein; KEGG: pen:PSEEN0110
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96083"
FT                   /db_xref="InterPro:IPR012661"
FT                   /db_xref="UniProtKB/TrEMBL:B0KG32"
FT                   /protein_id="ABY96083.1"
FT                   /translation="MRYLLPLLFSVVGMASAHAMDTTTQGLVISGYATSQVTTAPFDRK
FT                   LIRQARDDAAAFVASDGVIRGARLEAALESLRHNCARHTVGDLELAQAILVQ"
FT   sig_peptide     complement(173180..173239)
FT                   /locus_tag="PputGB1_0167"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT   gene            complement(173329..173646)
FT                   /locus_tag="PputGB1_0168"
FT   CDS_pept        complement(173329..173646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0168"
FT                   /product="conserverd hypothetical protein"
FT                   /note="TIGRFAM: conserverd hypothetical protein; PFAM:
FT                   conserved hypothetical protein; KEGG: pen:PSEEN0111
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96084"
FT                   /db_xref="InterPro:IPR012661"
FT                   /db_xref="UniProtKB/TrEMBL:B0KG33"
FT                   /protein_id="ABY96084.1"
FT                   /translation="MSRKHLLGAALLLGLAGTAHATSFVVTTDTVVRAVAASTDATSDL
FT                   SSSFRDDKIVQAARDDAATFVGTQGDIRGARLESAFVHIRSNMPALQASDAQLAQAILA
FT                   L"
FT   sig_peptide     complement(173581..173646)
FT                   /locus_tag="PputGB1_0168"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 22"
FT   gene            complement(173955..174170)
FT                   /locus_tag="PputGB1_0169"
FT   CDS_pept        complement(173955..174170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0169"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN0112 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96085"
FT                   /db_xref="InterPro:IPR009506"
FT                   /db_xref="UniProtKB/TrEMBL:B0KG34"
FT                   /protein_id="ABY96085.1"
FT                   /translation="MERTLSSGLVFESNAQQSNASMPLRALSTLLLWQRRMASRRQLAR
FT                   LDSRLLADAGISESQRYEELSKPFWR"
FT   gene            complement(174572..176065)
FT                   /locus_tag="PputGB1_0170"
FT   CDS_pept        complement(174572..176065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0170"
FT                   /product="succinate CoA transferase"
FT                   /EC_number="3.1.2.1"
FT                   /note="KEGG: pen:PSEEN0113 acetyl-CoA
FT                   hydrolase/transferase; TIGRFAM: succinate CoA transferase;
FT                   PFAM: acetyl-CoA hydrolase/transferase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96086"
FT                   /db_xref="GOA:B0KG35"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="InterPro:IPR017821"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR038460"
FT                   /db_xref="UniProtKB/TrEMBL:B0KG35"
FT                   /protein_id="ABY96086.1"
FT                   /translation="MYRDRIRLSSLHSKVMSAADAAGLIEDGMTVGMSGFTRAGEAKAV
FT                   PHALAERAKQSPLKISLMTGASLGNDLDKQLTEAGVLARRMPFQVDSTLRKAINDGQVM
FT                   FIDQHLSETVEQLRNQQLKLPDIAVIEAVAITEQGHIVPTTSVGNSASFAIFAKQVIVE
FT                   INLSHNTNLEGLHDIYIPTYRPTRTPIPLVKVDDRIGSTAIPIDPAKIVGIVISDQPDS
FT                   PSTVLPPDDETQGIADHLINFLKKEVDAGRMTNKLGPLQAGIGSIANAVMCGLIESPFE
FT                   DLTMYSEVLQDSTFDLIDAGKLSFASGSSITLSSRRNADVFGNLERYKDKLVLRPQEIS
FT                   NHPEVVRRLGIIGINTALEFDIYGNVNSTHVCGTRMMNGIGGSGDFARNAHLAVFVTKS
FT                   IAKGGAISSVVPMVSHVDHTEHDVDILVTEQGLADLRGLAPRERARAIIDNCVHPDYRA
FT                   ALNDYFDRACQRGGHTPHILREALSWHENLEETGRMLAS"
FT   gene            complement(176252..177688)
FT                   /locus_tag="PputGB1_0171"
FT   CDS_pept        complement(176252..177688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0171"
FT                   /product="NAD(P)(+) transhydrogenase (AB-specific)"
FT                   /EC_number="1.6.1.2"
FT                   /note="PFAM: NAD(P) transhydrogenase beta subunit; KEGG:
FT                   pen:PSEEN0114 pyridine nucleotide transhydrogenase, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96087"
FT                   /db_xref="GOA:B0KG36"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:B0KG36"
FT                   /protein_id="ABY96087.1"
FT                   /translation="MSMNLVTLLYLVASVCFIQALKGLSHPTTSRRGNLFGMIGMGLAI
FT                   LTTVGLIYKLGAELATAGIGYVIVGLLVGGTAGSIMAKRVEMTKMPELVAFMHSMIGLA
FT                   AVFIAIAAVLEPQSMGIVAAISDPIPTGNRLELFLGAAIGAITFSGSVIAFGKLSGKYK
FT                   FRLFQGAPVQFAGQHKLNLILGLTTIALGLLFTFTGHYSAFTLMLVLAFIMGVLIIIPI
FT                   GGADMPVVVSMLNSYSGWAAAGIGFSLNNSMLIIAGSLVGSSGAILSYIMCKAMNRSFF
FT                   NVILGGFGGDTDTGAAQGSQEQRPVKSGSADDATFLLSNADSVIIVPGYGLAVARAQHA
FT                   LKELTEKLTHNGVTVKYAIHPVAGRMPGHMNVLLAEAEVPYDQVFEMEDINAEFGQANV
FT                   VLVLGANDVVNPAAKNDPKSPIAGMPILEAFKAKTIIVNKRSMASGYAGLDNELFYLDK
FT                   TMMVFGDAKKVIEDMVKAVE"
FT   gene            complement(177691..178005)
FT                   /locus_tag="PputGB1_0172"
FT   CDS_pept        complement(177691..178005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0172"
FT                   /product="pyridine proton-translocating NAD(P)
FT                   transhydrogenase"
FT                   /note="KEGG: pen:PSEEN0115 pyridine proton-translocating
FT                   NAD(P) transhydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96088"
FT                   /db_xref="GOA:B0KG37"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="UniProtKB/TrEMBL:B0KG37"
FT                   /protein_id="ABY96088.1"
FT                   /translation="MEDMLISHGIYNLIIFVLAIYVGYHVVWNVTPALHTPLMAVTNAI
FT                   SAIVIVGAMLAAALTVTPAGKLMGTLAVALAAVNVFGGFLVTRRMLEMFKKKTKNEAQK
FT                   "
FT   gene            complement(178017..179138)
FT                   /locus_tag="PputGB1_0173"
FT   CDS_pept        complement(178017..179138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0173"
FT                   /product="NAD(P)(+) transhydrogenase (AB-specific)"
FT                   /EC_number="1.6.1.2"
FT                   /note="PFAM: alanine dehydrogenase/PNT domain protein;
FT                   KEGG: pen:PSEEN0116 proton-translocating NAD(P)
FT                   transhydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96089"
FT                   /db_xref="GOA:B0KG38"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0KG38"
FT                   /protein_id="ABY96089.1"
FT                   /translation="MHIGVPLETQTGETRVAATPETIKKLIGQGHQVTVQRGAGLNAAI
FT                   PDSAYEAVGASLGSAADAYGAQLVLKVVAPNDQELALINSGSLLVGMLNPFNSELIGKM
FT                   AERGITAFALEAAPRTSRAQSLDVLSSQANIAGYKAVLLAAHHYPRFMPMLMTAAGTVK
FT                   AARVLILGAGVAGLQAIATAKRLGAVIEASDVRPAVKEQIESLGAKFIDVPYETDEERE
FT                   CAEGVGGYARPMPASWMQRQAQAVHERAKQADIVITTALIPGRKAPTLLSAETVAQMKP
FT                   GSVVIDLAAAQGGNCPLTVADQVVQENGVTIVGPTNLPAQVGADASALYARNLLDFMKL
FT                   LFDKDGALVINLEDDIVAACLMCRDGQVVRKNG"
FT   gene            complement(179557..180474)
FT                   /locus_tag="PputGB1_0174"
FT   CDS_pept        complement(179557..180474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0174"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: pen:PSEEN0118 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96090"
FT                   /db_xref="GOA:B0KG39"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0KG39"
FT                   /protein_id="ABY96090.1"
FT                   /translation="MRRKIPSTAALVCFEAAARNESFTKAAQELALTQSAVCRQIGGLE
FT                   AFLNVELFRRSRRGVKLTEAGLSYSRQVATQLDAVERDTLSVMRLQGANVIELAVVPTF
FT                   GTQWLLPRLKDFQQRHPEVTVNLTNRTRPFLFADTTFDAAIYFGDADWSGTQSHRLMGE
FT                   NPVPVCSPVLLDGQGKLEARHIAQLPLLQQSTRPYAWRQWFGSVGMNVERDMTGPRYEL
FT                   FSMLAQAAMHEMGIALIPPFLIQRELEEGRLVVANRHALSSDKAYYLMIPERKVESASL
FT                   RAFRDWLVSQAQAYTGKTRTSATN"
FT   sig_peptide     complement(180418..180474)
FT                   /locus_tag="PputGB1_0174"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.763) with cleavage site probability 0.554 at
FT                   residue 19"
FT   gene            180636..181817
FT                   /locus_tag="PputGB1_0175"
FT   CDS_pept        180636..181817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0175"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: pen:PSEEN0120
FT                   glutaryl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96091"
FT                   /db_xref="GOA:B0KG40"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B0KG40"
FT                   /protein_id="ABY96091.1"
FT                   /translation="MAGKASFNWIDPLLLDQQLTEEERMVRDSAYQFAQDKLAPRVLEA
FT                   FRHEQTDPAIFREMGEIGLLGATIPEQYGGSGLNYVCYGLIAREVERIDSGYRSMMSVQ
FT                   SSLVMVPINEFGTEAQKQKYLPKLASGEWIGCFGLTEPNHGSDPGSMITRARKVDGGYR
FT                   LTGSKMWITNSPIADVFVVWAKDDEGDIRGFVLEKGWQGLSAPAIHGKVGLRASITGEI
FT                   VMDNVFVPDENIFPDVRGLKGPFTCLNSARYGISWGALGAAEACWHTARQYTLDRQQFG
FT                   RPLAANQLIQKKLADMQTEITLALQGCLRLGRMKDEGTAAVEITSIMKRNSCGKALDIA
FT                   RMARDMLGGNGISDEFGVARHLVNLEVVNTYEGTHDVHALILGRAQTGIQAFY"
FT   gene            181831..183051
FT                   /locus_tag="PputGB1_0176"
FT   CDS_pept        181831..183051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0176"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: pen:PSEEN0121 L-carnitine dehydratase/bile
FT                   acid-inducible protein F"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96092"
FT                   /db_xref="GOA:B0KG41"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:B0KG41"
FT                   /protein_id="ABY96092.1"
FT                   /translation="MGALSHLRVLDLSRVLAGPWSGQILADLGADVIKVERPGSGDDTR
FT                   SWGPPFLKDVEGENTGEAAYYLSANRNKRSVTIDFTQPEGQRLVRELAAKCDIVIENFK
FT                   VGGLAAYGLDYQSLKAVNPQLIYCSITGFGQTGPYAKRAGYDFMIQGLGGLMSLTGRPE
FT                   GEAGAGPVKVGVALTDILTGLYSTVAMLAALAHRDQTGVGQHVDMALLDVQVACLANQA
FT                   MNYLTTGTSPRRLGNAHPNIVPYQDFPTADGDFILTVGNDSQFRKFAEVAGQPQWADDP
FT                   RFVTNKLRVANRAELIPLIRQATVFKTTAEWVRQLEAAGVPCGPINDLAQMFQDPQVLA
FT                   RGLAVSMAHPLAGSVPQVASPIRLSETPVEYRRAPPLLGEHTDVVLGEVLGLGAGELQR
FT                   LRGAGVL"
FT   gene            complement(183248..183561)
FT                   /pseudo
FT                   /locus_tag="PputGB1_0177"
FT   gene            183627..185155
FT                   /locus_tag="PputGB1_R0001"
FT   rRNA            183627..185155
FT                   /locus_tag="PputGB1_R0001"
FT                   /product="16S ribosomal RNA"
FT   gene            185435..188328
FT                   /locus_tag="PputGB1_R0002"
FT   rRNA            185435..188328
FT                   /locus_tag="PputGB1_R0002"
FT                   /product="23S ribosomal RNA"
FT   gene            188466..188581
FT                   /locus_tag="PputGB1_R0003"
FT   rRNA            188466..188581
FT                   /locus_tag="PputGB1_R0003"
FT                   /product="5S ribosomal RNA"
FT   gene            189034..190562
FT                   /locus_tag="PputGB1_R0004"
FT   rRNA            189034..190562
FT                   /locus_tag="PputGB1_R0004"
FT                   /product="16S ribosomal RNA"
FT   gene            190651..190727
FT                   /locus_tag="PputGB1_R0005"
FT                   /note="tRNA-Ile1"
FT   tRNA            190651..190727
FT                   /locus_tag="PputGB1_R0005"
FT                   /product="tRNA-Ile"
FT   gene            190752..190827
FT                   /locus_tag="PputGB1_R0006"
FT                   /note="tRNA-Ala1"
FT   tRNA            190752..190827
FT                   /locus_tag="PputGB1_R0006"
FT                   /product="tRNA-Ala"
FT   gene            191072..193965
FT                   /locus_tag="PputGB1_R0007"
FT   rRNA            191072..193965
FT                   /locus_tag="PputGB1_R0007"
FT                   /product="23S ribosomal RNA"
FT   gene            194103..194218
FT                   /locus_tag="PputGB1_R0008"
FT   rRNA            194103..194218
FT                   /locus_tag="PputGB1_R0008"
FT                   /product="5S ribosomal RNA"
FT   gene            194328..194443
FT                   /locus_tag="PputGB1_R0009"
FT   rRNA            194328..194443
FT                   /locus_tag="PputGB1_R0009"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(194508..196994)
FT                   /locus_tag="PputGB1_0178"
FT   CDS_pept        complement(194508..196994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0178"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="TIGRFAM: TonB-dependent siderophore receptor; PFAM:
FT                   TonB-dependent receptor; Secretin/TonB short domain;
FT                   TonB-dependent receptor plug; KEGG: pfo:Pfl_0121
FT                   TonB-dependent siderophore receptor"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96093"
FT                   /db_xref="GOA:B0KGX4"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:B0KGX4"
FT                   /protein_id="ABY96093.1"
FT                   /translation="MFIKPVLNHTFSPNDFRPVLQSAYLRHAIRAALFGTAMGLAAVAQ
FT                   LSVAAETAQVSHHYAIPAGQLADVLNQFARQAGITLSSTPQLTDRLQSNGLQGQYAIDH
FT                   ALRQLLNGSGLEAVSQDGRNYVLQAQHQDAALALPDTDVRSFSLGNALGSMEGYNATHS
FT                   QVATKTSMPLVETSQSVSVVTRQQMDDQGSQTVAQAMRYTPGVLTNPYGATHRYDYVAM
FT                   RGFNDGSVDNIYVDGLKSMGDNGTYSTMQVDPYFLERIDILKGPSSVLYGRSSPGGLVA
FT                   LTTKKPLFTPYHQVQATVGTQGQRGMGFDFSGPVDDDKRIAYRLTGLADASDTQFDHNK
FT                   EERYTIAPAISVDFTEDTSLTLQAYLQHDPNGGYHGGNPADGMLHKRNGLRLSDHFFEG
FT                   EPGIDNYERTQQSFSYQFEHRFNDVFTARQNFRYQDSDVSMDQVYSAGWADADSNILNR
FT                   AYTGGDERLHSYIIDNMLQAEFFTGAAKHTLLLGADYQRRKADVAWRYGTVDPLDAGNP
FT                   QYGNGNLQVLGENRYQRRLQQTGVYLQDLVEVDQWRLSLGLRQDWVKVSEENRDSDTKV
FT                   SDQRSRFTTRAGVLYLFENGIAPYVSYSESFNPNTVSDQQGRPLAPTEGTQWEAGIKYQ
FT                   PPGSDNLFTASVFRIEQENLASKQPDENFYRPVGEVRSQGLELEAHVQLSDSLKLLGGY
FT                   TFTDIEYAKSMPSLVSASLDNEGNAPTQAPKQMFSLWADYNFHQGALDGLRLGGGVRYV
FT                   GYSWVDAENSMKVPSYTLFDASIGYDLGKVGLTGVDVRLNANNLTNESYITSCASLNYC
FT                   YMGEERNVSATVSYQF"
FT   sig_peptide     complement(196845..196994)
FT                   /locus_tag="PputGB1_0178"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.984) with cleavage site probability 0.922 at
FT                   residue 50"
FT   gene            complement(197089..198045)
FT                   /locus_tag="PputGB1_0179"
FT   CDS_pept        complement(197089..198045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0179"
FT                   /product="anti-FecI sigma factor, FecR"
FT                   /note="PFAM: FecR protein; KEGG: pfl:PFL_0126 sigma factor
FT                   regulatory protein, FecR/PupR family"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96094"
FT                   /db_xref="InterPro:IPR006860"
FT                   /db_xref="InterPro:IPR012373"
FT                   /db_xref="InterPro:IPR032623"
FT                   /db_xref="UniProtKB/TrEMBL:B0KGX5"
FT                   /protein_id="ABY96094.1"
FT                   /translation="MTAARPDTKAVKQAIQWMLRLRESGHDLAFQQQCAQWRSAHHEHE
FT                   HAWQRVTHLHQNLDLRAIPGAGLALQTLETSQQRLRRRQALKLLGGVVMAGSASWLAKD
FT                   LDAVSAWASDYATGTGERRVFTLPDGSLMQLNTRSAVDLAFIDRQRLVRLKHGELMITC
FT                   NPRHPVFVQTRDVLLEGFEGRFVAYQDSDCTRVSVSRGKVAIHRPGIAQLQWIESGQNW
FT                   RLDAHGAQRIAQMDMDAMAWTEGLIVTQNMRLADFLAQVSRYRHGYLGCSNEIADLRLS
FT                   GVFRLEDPEQLLRLLPQTLPVRVHQRTRWWVRVESTT"
FT   gene            complement(198050..198553)
FT                   /locus_tag="PputGB1_0180"
FT   CDS_pept        complement(198050..198553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0180"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; Sigma-70
FT                   region 4 type 2; KEGG: pfo:Pfl_0123 sigma-24 (FecI)"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96095"
FT                   /db_xref="GOA:B0KGX6"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:B0KGX6"
FT                   /protein_id="ABY96095.1"
FT                   /translation="MPSNDCVQTLYSDHHGWLHAWLRSKLGNAADAADLAQDTFVRLLQ
FT                   RREQLQLNAPRAFLRTVARGLVIDHWRREELHRAYLEALAHVPEALAPSAETRELLLEL
FT                   LERIARMLDGLKPKVRRAFLLAQCEGLKHQAIAEQLGISVRTVERYIADALYHCYVLHY
FT                   QDEC"
FT   gene            complement(198665..199354)
FT                   /locus_tag="PputGB1_0181"
FT   CDS_pept        complement(198665..199354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0181"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: pen:PSEEN0137 transcriptional regulator,
FT                   GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96096"
FT                   /db_xref="GOA:B0KGX7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0KGX7"
FT                   /protein_id="ABY96096.1"
FT                   /translation="MAEKIKLSNVLASEQLLPHQARGVIEERLRSAILDGRLPPGTAVR
FT                   QQELATLFGVSRMPVREALRQLEAQSLLKVEMHKGAVVAPLIGEDAVDTYALRVLLESE
FT                   ALRQSIPLLDASDIASARGYIQQLENETRHAEIGRLNRLFHMALYSRAPNKKLLRLIEN
FT                   ELNEEERFLRFHLSSMGLGKLTQDDHNALADAASDKLVDEAVAVLERHLNSGARVIRKY
FT                   LDTQLGH"
FT   gene            199628..200320
FT                   /locus_tag="PputGB1_0182"
FT   CDS_pept        199628..200320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0182"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN0138 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96097"
FT                   /db_xref="InterPro:IPR010319"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B0KGX8"
FT                   /protein_id="ABY96097.1"
FT                   /translation="MAISWLLKTVVRRVGFAALLGSLLLGGLHADWDFSQISRKSQALY
FT                   GPLGAGQGRIDAWQNLMATQKQGTELERLQVVNRFFNQQLRYVEDIDLWHEVDYWATPV
FT                   QALIKGAGDCEDYAIAKYFSLRRMGIPSEKLRITYVKALRQNRAHMVLTYYSSPQAQPL
FT                   VLDSLMDAIKPASQRTDLLPVYAFNGEGLWLTGAAGNKKVGDTKRLSRWQDLLKKMQAE
FT                   GFPAEPVY"
FT   sig_peptide     199628..199720
FT                   /locus_tag="PputGB1_0182"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.994 at
FT                   residue 31"
FT   gene            200331..202277
FT                   /locus_tag="PputGB1_0183"
FT   CDS_pept        200331..202277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0183"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; histidine kinase
FT                   HAMP region domain protein; KEGG: pen:PSEEN0139 signal
FT                   transduction protein; GGDEF/EAL domain"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96098"
FT                   /db_xref="GOA:B0KGX9"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR032244"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B0KGX9"
FT                   /protein_id="ABY96098.1"
FT                   /translation="MSLFKQLLLAICLFLVVAFSGSFMVSLESSRSQYVNQLRSHAQDA
FT                   ATALALSLTPNIDDPAMVELMVSSIFDSGYYASIKVVDLGSNAVLVERHAEPDPGGVPR
FT                   WFVHLIGLEAAGGDAIVSRGWQQAARVEVISHPMFAIAKLWQSALGSLGWLLLCGAASA
FT                   VLGALLLRRQLRPLDYMVEQSHAIARREFLSLPELPRTPELRRVVQAMNQMVEKLKALF
FT                   TEQAERSERLRAESYQDSLTGLSNRRYFEMQLNTRVSNLEEARAGYLLLLRVQGLAGLN
FT                   ARLGGQRTDQLLQAVGEQLRRTCASYPETNDLISRSRGGEFAVLAPGMVHEEAVQLAQA
FT                   LEATLQSLHETGASDIDPVACIGLAPFSPGDSPQALLKLADEALARAENQPTPGWVCLE
FT                   QGVAAVAGDSQHAWHERLDQAFGNGHFELFFQPVVDCASAQRVLHHKVISRLQDGQGEA
FT                   LPAGRFLPWLERFGWMPRLDVLVLEKVLAHLRGHDQVLALNLSAATLADPKALQRVFEL
FT                   LGQNAALGPRLVFEIGEEQLPEQAALEQLTRRLHGLGFGLALQRFGGRFSMIGNLAHLG
FT                   LAYLKIDGSYIRNIDHEQHKRLFIEAIQRAAHSIDLPLIAERVETEGERRVLQEMGVGG
FT                   IQGQLVGEPAPWR"
FT   sig_peptide     200331..200414
FT                   /locus_tag="PputGB1_0183"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.537 at
FT                   residue 28"
FT   gene            complement(202476..203852)
FT                   /locus_tag="PputGB1_0184"
FT   CDS_pept        complement(202476..203852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0184"
FT                   /product="type I secretion membrane fusion protein, HlyD
FT                   family"
FT                   /note="TIGRFAM: type I secretion membrane fusion protein,
FT                   HlyD family; PFAM: secretion protein HlyD family protein;
FT                   KEGG: pen:PSEEN0145 type I toxin efflux membrane fusion
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96099"
FT                   /db_xref="GOA:B0KGY0"
FT                   /db_xref="InterPro:IPR006144"
FT                   /db_xref="InterPro:IPR010129"
FT                   /db_xref="UniProtKB/TrEMBL:B0KGY0"
FT                   /protein_id="ABY96099.1"
FT                   /translation="MLHKLDMGQFKDGLRRYFKGSDSLGGQPLPEVNKALIEDAPRVVR
FT                   LTIWGVILFFVFLIVWASVAPIDEVTRGEGKAIPSSKVQKIQNLEGGIVAEIFAKEGEI
FT                   VEVGQPLLRLDETRFASNVGETEADRLAMALRVERLSAEVQDSPLKIDEELRKAAPSQA
FT                   ASEESLYQSRRQQLQDEIGGLQQQLVQRQQELREYSSKRAQYANSLELLRKEIGMSEPL
FT                   VATGAISQVEVLRLRRAEVENRGQLDSTALAIPRAEAAIREVQSKIEETRGKFRSEALT
FT                   QLNEARTELNKATATSKALDDRVHRTMVTSPVRGIVKQLLVNTIGGVIQPGSDIIEIVP
FT                   LDDTLVIEAKILPKDIAFLHPGQEATVKFTAYDYTIYGGLKAKLEQIGADTITDEDKKT
FT                   TYYLIKLRTDRSHLGTDEKPLLIIPGMVATVDIMTGKKTIMSYLLKPIMKARSEALRER
FT                   "
FT   gene            complement(203842..205998)
FT                   /locus_tag="PputGB1_0185"
FT   CDS_pept        complement(203842..205998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0185"
FT                   /product="type I secretion system ATPase"
FT                   /note="KEGG: pen:PSEEN0144 type I toxin efflux ATP-binding
FT                   protein; TIGRFAM: type I secretion system ATPase; PFAM: ABC
FT                   transporter transmembrane region; ABC transporter related;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96100"
FT                   /db_xref="GOA:B0KGY1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017750"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B0KGY1"
FT                   /protein_id="ABY96100.1"
FT                   /translation="MESEVSRVQLSHDPRSQHDDPLLDSLLSLCVLHQKPASRVMLTTG
FT                   LPLPAQRLSPELLPRAAARAGLQGRLLQRKLEQIPSIAMPAMLLLKEGRSAVLLGWENE
FT                   DTARLLLSESDGGEVHVSREALQSDYSGRVFFAQPQHKFDVNHGNLIPRAKSWFRDTLL
FT                   RSKWLYIDAIAASLVINLIALAAPLFVMNVYDRVVPNQATSTLWVLAIGIAGAYIFDLI
FT                   LKGLRGLCLDLAGKKTDLIISATLFERIVGMSMKYRPARVGSFAQNIHEFQGLRDFLAS
FT                   LTLTSLIDLPFTILILIVIAIIGGHLVWIPIIAFPLALGIGYALQRPLMATMERTMALA
FT                   SERQSSLIETLAGLDAVKVNNAESERQYMWEQTLGTLSRLELRVKVLSSLAMNITLLIQ
FT                   QLAGVAMICVGVYLIIDGNLSMGGLVACYMLSGRALGPLGQLNGLLARYQQAKVTMVST
FT                   DHMMELPQERNFEERPLSRKVLQGSVEFRGVDFTYPNQQNLALKNINLTIRPGEKVGII
FT                   GRSGSGKSSLAKLIVGLYEADGGSLLVDGVDIRQIDVSELRHNIGYVPQDIQLLAGTLR
FT                   DNLVSGARYIEDELILQAAELAGVHEFARLHPDGYELQVGERGQNLSGGQRQNVALGRA
FT                   LLLNPQILLLDEPTSAMDNTGEERLKQRLQAVVEGKTVLLVTHRASLLSLVDRLIVIDR
FT                   GQIVADGPKAAVMDALKKGQISVA"
FT   gene            207003..227264
FT                   /locus_tag="PputGB1_0186"
FT   CDS_pept        207003..227264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0186"
FT                   /product="conserved repeat domain protein"
FT                   /note="KEGG: pen:PSEEN0141 surface adhesion protein;
FT                   TIGRFAM: conserved repeat domain protein; PFAM:
FT                   Hemolysin-type calcium-binding region; von Willebrand
FT                   factor type A; SMART: Pyrrolo-quinoline quinone"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96101"
FT                   /db_xref="GOA:B0KGY2"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="InterPro:IPR019960"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR037524"
FT                   /db_xref="InterPro:IPR038081"
FT                   /db_xref="UniProtKB/TrEMBL:B0KGY2"
FT                   /protein_id="ABY96101.1"
FT                   /translation="MSSVVAIVKSIVGQVIAVSPEGIRRVLIEGDRLLTGEEVLTGPGG
FT                   AVTLELADGRLLDLGRDSQWSAEAPDSSTDLSQATAQAAPSVEELQQAIAAGVDPTTEL
FT                   EATAAGPSAAGGGGALGGGHSFVMLEETAGRVDPTVGFPTDGLGFAAALDSEEVGLLDT
FT                   NGNNLVIPPTTDTNVATDLILGATPSISEAGGVIVYTATVGQAPTTNLVVTLSNGAVIV
FT                   IPAGQTSGSVNVVVPANDTPYIDGGQISATVTGSTGGGGLTVTLPQTPAVTQVTDTIDT
FT                   TTATLTASPSVTEGGVITYTVTLSNPAQTPVTVTLSNGQTITVEAGKTQGSVDFQTPAN
FT                   DVYNNGSTVSVTIETATGGNFEQLTPNPTPAQTTINDSVDTTTATLTANPSVTEGGVIT
FT                   YTVTLSNPAQTPVTVTLSNGQTITVEAGKTQGSVDFQTPANDVYNNGSTVSVTIENATG
FT                   GNFEQLTPNPTPAQTTINDSVDTTTATLTANPSVTEGGVITYTVTLSNPAQTPVTVTLS
FT                   NGQTITVEAGKTQGSVDFQTPANDVYNNGSTVSVTIENATGGNFEQLTPNPTPAQTTIN
FT                   DSVDTTTATLTANPSVTEGGVITYTVTLSNPAQTPVTVTLSNGQTITVEAGKTQGSVDF
FT                   QTPANDVYNNGSTVSVTIENATGGNFEQLTPNPTPAQTTINDSVDTTTATLTANPSVTE
FT                   GGVITYTVTLSNPAQTPVTVTLSNGQTITVEAGKTQGSVDFQTPANDVYNNGSTVSVTI
FT                   ENATGGNFEQLTPNPTPAQTTINDSVDTTTATLTANPSVTEGGVITYTVTLSNPAQTPV
FT                   TVTLSNGQTITVEAGKTQGSVDFQTPANDVYNNGSTVSVTIENATGGNFEQLTPNPTPA
FT                   QTTINDSVDTTTATLTANPSVTEGGVITYTVTLSNPAQTPVTVTLSNGQTITVEAGKTQ
FT                   GSVDFQTPANDVYNNGSTVSVTIENATGGNFEQLTPNPTPASTVINDSIDTVTVSIVSN
FT                   GNVTEDQQPSFTVKVSQALDRPLTVTLSNGDTVTIEAGKTEVEYKTPAQGDDVYHDAGS
FT                   ITLSVTDATVPGATFEKLALGGPATVEISDTISEVVAKLTATPSVTEGGEITYTITLTN
FT                   KDGLPINNHGALTFTLSDGKTVITVPANSTTGSITVTAPDNVYVGSNPPVVQSIATVVG
FT                   ADVGKFEQLTLDKTPVSTTVTDEPGTPGNPGGSNEGDLVKVTITADQASVAENVKPTFT
FT                   VHINQPLDHDLVVTLSNNAQVTIKAGETSAPYTHDAQGDDVYKDSGEISLGIKSAVDVD
FT                   GRTFENLQLGGDASVQVTDTTDEVVAKLTATPSVTEGGEITYTITLTNKDGLPINNHGA
FT                   LTFTLSDGTTVITIPANGTTASVTVTAPDNVYVGANDPVVKSIATVEGADVDKFEQLTL
FT                   DKTQVSTTVTDEPGTPGNEGDLVKVTITADQASVAENVKPTFTVHINTALAHDLVVTLS
FT                   NNAQVTIKAGETSAPYEHAAQGDDVYLDSGEITLGIKSAVDVDGRTFENLQLGGDASVK
FT                   VTDTLDEVVAKLTATPSVTEGGEITYTITLTNKDGLPINNHSELYFKLTDGTTVVVAAN
FT                   STTGSATAIAPDNVYVGANQPVVNAIDAVSGADAWKFENLNLDKTPVSTQVTDEPGTPG
FT                   NEGDIVKVTITADQVSVAENVKPTFTVHVNQPLDHDLVVTLSNNAQVTIKAGETSAPYE
FT                   HAAQGDDVYQDAGEISLGIKSAVDATGATFENLQLGGDASVKVTDTIDEVVAKLTATPS
FT                   VTEGGEITYTITLTNKDGLPINNHSELYFKLTDGTTVVVAANSTTGSATAIAPDNVYVG
FT                   ANQPVVNAIDAVSGADAWKFENLNLDKTPVSTQVTDEPGTPGNEGDIVKVTITADQVSV
FT                   AENVKPTFTVHVNQPLDHDLVVTLSNNATVTIKAGETSAPYEHAAQGDDVYQDAGEISL
FT                   GIKSAVDATGATFENLQLGGDASVKVTDTIDEVVAKLTATPSVTEGGEITYTITLTNKD
FT                   GLPINNHSELYFKLTDGTTVVVAANSTTGSATAIAPDNVYVGANPPVVNAIDAVSGADA
FT                   WKFENLNLDKTPVSTQVTDEPGTPGNEGDIVKVTITADQVSVAENVKPTFTVHVNQPLD
FT                   HDLVVTLSNNATVTIKAGETSAPYEHAAQGDDVYQDAGEISLGIKSAVDATGATFENLQ
FT                   LGGDASVKVTDTIDEVVAKLTATPSVTEGGEITYTITLTNKDGLPINNHSELYFKLTDG
FT                   TTVVVAANSTTGSATVIAPDNVYVGANPPVVNAIDAVSGADAWKFENLNLDKTEVSTQV
FT                   TDEPGTPGNEGDLVKVTITADQTSVAENVKPTFTVHVNQPLDHDLVVTLSNNAQVTIKA
FT                   GDTSVKYEHAAQGDDVYLDSGEISLGIKSAVDIDGRTFENLELGGAAKVDVTDTTDEVI
FT                   AKLTATESVTEGGEITYTITLTNKDGLLINNHGALTFTLSDGKTVITVPANGTTGSVTV
FT                   AAPDNVYVGANDPIVKSIATVEGVDVDKFEKLTLDKTEVKTTVTDEPGTPGNPGGTNEG
FT                   DLVKVTITADQTSVAENVKPTFTVHVNQPLDHDLVVTLSNNAQVTIKAGDTSVKYEHAA
FT                   QGDDVYLDSGEISLGIKSAVDVDGRTFENLELGGAAKVDVTDTTDEVIAKLTATESVTE
FT                   GGEITYTITLTNKDGLLINNHGALTFTLSDGKTVITVPANGTTGSVTVAAPDNVYVGAN
FT                   DPIVKSIATVEGADVDKFEKLTLDKTEVKTTVTDEPGTPGNEGDLVKVTITADQTSVAE
FT                   NVKPTFTVHVNQPLDHDLVVTLSNNAQVTIKAGDTSVKYEHAAQGDDVYLDSGEISLGI
FT                   KSAVDVDGRTFENLELGGAAKVDVTDTTDEVIAKLTATESVTEGGEITYTITLTNKDGL
FT                   LINNHGALTFTLSDGKTVITVPANGTTGSVTVAAPDNVYVGANDPIVKSIATVEGADVD
FT                   KFEKLTLDKTEVKTTVTDEPGTPGNEGDLVKVTITADQTSVAENVKPTFTVHVNQPLDH
FT                   DLVVTLSNNAQVTIKAGDTSVKYEHAAQGDDVYLDSGEISLGIKSAVDIDGRTFENLEL
FT                   GGAAKVDVTDTTDEVVAKLTATPSVTEGGEITYTITLTNKDGLLINNHGALTFTLSDGK
FT                   TVITVPANGTTGSVTVIAPDNVYTGTNDPVVKSIATVEGVDVDKFEKLTLDKTEVKTTV
FT                   TDEPGTPGNPGGTNEGDLVKVTITADQASVAENVKPTFTVHVNQPLDHDLVVTLSNNAQ
FT                   VTIKAGDTSVKYEHAAQGDDVYLDSGEISLGIKSAVDIDGRTFENLELGGAAKVDVTDT
FT                   TDEVVAKLTATPSVTEGGEITYTITLTNKDGLLINNHGALTFTLSDGKTVITVPANGTT
FT                   GSVTVAAPDNVYVGANDPIVKSIATVEGVDVDKFEKLTLDKTEVKTTVTDEPGTPGNPG
FT                   GTNEGDLVKVTITADQTSVAENVKPTFTVHVNQPLDHDLVVTLSNNAQVTIKAGDTSVK
FT                   YEHAAQGDDVYLDSGEISLGIKSAVDIDGRTFENLELGGAAKVDVTDTTDEVIAKLTAT
FT                   PSVTEGGEITYTITLTNKDGLLINNHGALTFTLSDGKTVITVPANGTTGSVTVIAPDNV
FT                   YTGTNDPVIKSIATVEGADVDKFEKLTLDKTEVKTTVTDEPGTPGNEGDLVKVTITADQ
FT                   TSVAENVKPTFTVHVNQPLDHDLVVTLSNNAQVTIKAGDTSVKYEHAAQGDDVYLDSGE
FT                   ISLGIKSAVDVDGRTFENLELGGAAKVDVTDTTDEVIAKLTATESVTEGGEITYTITLT
FT                   NKDGLLINNHGALTFTLSDGKTVITVPANGTTGSVTVAAPDNVYVGANDPIVKSIATVE
FT                   GADVDKFEKLTLDKTEVKTTVTDEPGTPGNEGDLVKVTITADQTSVAENVKPTFTVHVN
FT                   QPLDHDLVVTLSNNAQVTIKAGDTSVKYEHAAQGDDVYLDSGEISLGIKSAVDVDGRTF
FT                   ENLELGGAAKVDVTDTTDEVIAKLTATESVTEGGEITYTITLTNKDGLLINNHGALTFT
FT                   LSDGKTVITVPANGTTGSVTVAAPDNVYVGANDPIVKSIATVEGADVDKFEKLTLDKTE
FT                   VKTTVTDEPGTPGNEGDLVKVTITADQTSVAENVKPTFTVHVNQPLDHDLVVTLSNNAQ
FT                   VTIKAGDTSVKYEHAAQGDDVYLDSGEISLGIKSAVDIDGRTFENLELGGAAKVDVTDT
FT                   TDEVVAKLTATPSVTEGGEITYTITLTNKDGLLINNHGALTFTLSDGKTVITVPANGTT
FT                   GSVTVIAPDNVYTGTNDPVVKSIATVEGVDVDKFEKLTLDKTEVKTTVTDEPGTPGNPG
FT                   GTNEGDLVKVTITADQASVAENVKPTFTVHVNQPLDHDLVVTLSNNAQVTIKAGDTSVK
FT                   YEHAAQGDDVYLDSGEISLGIKSAVDIDGRTFENLELGGAAKVDVTDTTDEVIAKLTAT
FT                   PSVTEGGVITYTVTLTNKDGLPIDKHAALTFTLDDGKTTITIPANGTSGTATVTAPDNV
FT                   YVGANDPIVKSIATVEGADVDKFEKLTLDKTEVKTTVTDEPGTPGNPGTPGGTNEGDLV
FT                   KVTITADQTSVAENVKPTFTVHVNQPLDHDLVVTLSNNATVTIKAGDTSVKYEHAAQGD
FT                   DVYLDSGEISLGIKSAVDIDGRTFENLELGGAAKVDVTDTTDEVVAKLTATPSVTEGGE
FT                   ITYTITLTNKDGLLINNHGALTFTLSDGKTVITVPANGTTGSVTVIAPDNVYTGTNDPV
FT                   IKSIATVEGVDVDKFEKLTLDKTEVKTTVTDEPGTPGNPGGTNEGDLVKVTITADQTSV
FT                   AENVKPTFTVHVNQPLDHDLVVTLSNNAQVTIKAGDTSVKYEHAAQGDDVYLDSGEISL
FT                   GIKSALDIDGRTFENLELGGAAKVDVTDTTDEVVAKLTATPSVTEGGEITYTITLTNKD
FT                   GLLINNHGALTFTLSDGKTVITVPANGTTGSVTVIAPDNVYTGTNDPVIKSIATVEGVD
FT                   VDKFEKLTLDKTEVKTTVTDEPGTPGNPGGTNEGDLVKVTITADQTSVAENVKPTFTVH
FT                   VNQPLDHDLVVTLSNNATVTIKAGDTSVKYEHAAQGDDVYLDSGEISLGIKSAVDIDGR
FT                   TFENLELGGAAKVDVTDTTDEVIAKLTATPSVTEGGEITYTITLTNKDGLLINNHGALT
FT                   FTLSDGKTVITVPANGTTGSVTVIAPDNVYTGTNDPVVKSIATVEGVDVDKFEKLTLDK
FT                   TEVKTTVTDEPGTPGNPGGTNEGDLVKVTITADQASVAENVKPTFTVHVNQPLDHDLVV
FT                   TLSNNATVTIKAGDTSVKYEHAAQGDDVYLDSGEISLGIKSAVDVDGRTFENLELGGAA
FT                   KVDVTDTTDEVIAKLTATPSVTEGGVITYTVTLTNKDGLPIDKHAALTFTLDDGKTTIT
FT                   IPANGTSGTATVTAPDNVYVGTNPAIVKAIATVSGVDVDKFEKLTLDKSSVSTSVTDEP
FT                   GSGVPGDNNQGDLVKVTITADQASVAENVKPTFTVHVNQPLDHDLVVTLSNNAQVTIKA
FT                   GDTSVKYEHAAQGDDVYKDAGEISLGIKSAADIGNRPFENLQLGDAAKVSVTDTTDEVI
FT                   AKLTATPSVTEGGVITYTVTLTNKDGLPINNHSALTFTLSDGKTTITVPANGTVGTATV
FT                   IAPDNVYVGANDPVIKSIATVSGADVDKFEKLTLDKTSVTTSVTDEPGSGTPGTGNQGD
FT                   VTTVGITGTSSLTEGETGQYTLTLSNASKAEVTITLSYSGTAKNGEDFSGVTTVKIPAN
FT                   STGTTFNIATIDDKLVEGTENFVVKIETATGGNFENLQVDSSKSSVTTTILDNDHLPVS
FT                   PGGAVFGVEDTDYVFAWSDFKVTDADGNTGLFVTITSLPAAGSLQFFNGTAWVNVAVNQ
FT                   VISQADITANNLKFVPALNQSGADNYGGNGVGNQQADYAQFKFKPNDGTNLGSEVTMKV
FT                   DISPVADKPTLSFGSADIDSKGLTKEVWTSLKGLGTGGNGITGEDLKAVFANSGNANSS
FT                   STTTNVQSDGSVTAGTGSKTSGLIYLEAGKTYTFSGTADDSFVVTIGGKTVVTATWGAG
FT                   GQVSGTFTPNTSGYYPIEVYHANQSGPGSYDLNIQVGSGAVTDLSSSNVKMYQNVTEMA
FT                   NAGLGVSDLHTVNGQSYYDGYKLNEGPEGGSVKLVGITTALTDTDGSETLNVTLSGIPK
FT                   GTVLSDGAGHTVTVGSTPVDVTGWKLSGLTLTPPAYYKGSFDITVTSTATESLGGSAIT
FT                   TGNIPVTVYAATYKASVGTTGNDTMIGSEGNDIIVADVSGLNVVQGKNYNIAFMVDSSG
FT                   SMSDKSIADAKTQLASVFNSLKASLGSDTSGTVNIFLVDFDTQVNKNVAVNLADPDALS
FT                   KLQAVLNSMVGGYYGGGTNYEDAFKTTSNFFNSTMATSNKGAENLTYFITDGKPTYYQS
FT                   GESTNPSLWKNGKNLDDVVNVNNYKMGDTFSAWADSTHKVEISSSGVVKVLTYTEKKGE
FT                   LVYDSTKTVGTLHAQGDGTYEFSSLGGTGYADYWNYVDSAAGSTASFAVLGGTNGLSKV
FT                   QAIGLNSDVTLNDLKPYDSAGKPQTNIDPSDLAKAILGHSEATVPGADTIDGGNGNDII
FT                   FGDLITLNGVVSEGYQALQTYVAQKSGVEVSSVTTSNVHQYITEHYTEFDISGAKDGND
FT                   ILSGGNGNDILFGQGGNDTLDGGRGNDILLGGSGNDTLIGGHGDDILIGGSGADTFVWK
FT                   AGDFGNDVIKDFKLSDKDKIDLSDLLQGEKGSTIDNYLKLTTVDGTTTLQVSSEGKLNA
FT                   AGGLANADVTIKLEGVNWSNTTINSLISGADPTIIIHNKDN"
FT   gene            227409..227750
FT                   /locus_tag="PputGB1_0187"
FT   CDS_pept        227409..227750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0187"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN0140 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96102"
FT                   /db_xref="UniProtKB/TrEMBL:B0KGY3"
FT                   /protein_id="ABY96102.1"
FT                   /translation="MFYVQRDAAGQLLRVEAAAFDQFTEMLPADHADIQEWFADDVVEN
FT                   SLNQLKQSDLDMIRVLEDLIDVLTAKGVFKITDLPAGAQAKLLNRSTARKALSSLNNLI
FT                   DEEEQGGLI"
FT   gene            227949..228848
FT                   /locus_tag="PputGB1_0188"
FT   CDS_pept        227949..228848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0188"
FT                   /product="Taurine dioxygenase"
FT                   /EC_number="1.14.11.17"
FT                   /note="PFAM: Taurine catabolism dioxygenase TauD/TfdA;
FT                   KEGG: pen:PSEEN0146 taurine catabolic dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96103"
FT                   /db_xref="GOA:B0KGY4"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:B0KGY4"
FT                   /protein_id="ABY96103.1"
FT                   /translation="MSAASNALSTIDSAQPQCFEIRPFSGAVGAEIIGLDLARPVNVED
FT                   FARIHRAHLDHHVLVFRDQRISPQQQITFSRRFGELQIHVLKQFLLTGHPEILIVSNIV
FT                   ENGQNIGLGDAGKFWHSDLSYKALPSLGSMLHAQELPSEGGDTLFADMHKAWDAVPDAL
FT                   RKVVEGRSAAHSYTARYAETKFEGNWRPTLTAEQLAQVQEVIHPVVRTHPENGRKALFV
FT                   SEGFTTRIVGLPDDESRDVLQQLYALSVLEKNIYRHQWQPHDLVFWDNRSLIHLATGCP
FT                   AHLRRKLYRTTIQGDAPF"
FT   gene            228867..229886
FT                   /locus_tag="PputGB1_0189"
FT   CDS_pept        228867..229886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0189"
FT                   /product="ABC transporter, periplasmic binding protein"
FT                   /note="KEGG: pen:PSEEN0147 ABC transporter, periplasmic
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96104"
FT                   /db_xref="UniProtKB/TrEMBL:B0KGY5"
FT                   /protein_id="ABY96104.1"
FT                   /translation="MRNSISRLAASIGLGASLVIGSLAAPAAAQAEGKIRIAEQFGIVY
FT                   LLLNVVRDQQLIEKHGKEQGIDIDVDWAQLSGGSAINDALLSGSVDIAGAGVGPLLTVW
FT                   DRTKGRQNVKAVASLGNFPYYLVSSNPNVKTIADISDKDRIAVPAVGVSVQSRFLQYAA
FT                   AQQWGDKEYNRLDKYTLAVPHPDATAALLAGGTELNGHFSNPPFQDQVLANKDVHVVLN
FT                   SYDLLGPNSPTLLFATEKFRKDNPKTYKAFVDALAEAADFAQKDKAAAADTYIRVTKAK
FT                   IDRDALIKLIDNPQYEFTVTPKNTYKLADFLYRVGAIKNKPASWKDYFFQDERPLQGS"
FT   sig_peptide     228867..228956
FT                   /locus_tag="PputGB1_0189"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.498 at
FT                   residue 30"
FT   gene            229893..230756
FT                   /locus_tag="PputGB1_0190"
FT   CDS_pept        229893..230756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0190"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pen:PSEEN0148 ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96105"
FT                   /db_xref="GOA:B0KGY6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0KGY6"
FT                   /protein_id="ABY96105.1"
FT                   /translation="MTAPLPGHTASNLSRVATPPLLKVDNLSLEYRTAQRVVRATHQVS
FT                   FEVDRADRFVLLGPSGCGKSTLLKAVAGFIQPQEGQILLQGQAVHGPGPDRIVVFQEFD
FT                   QLPPWKTVKQNVMFPLLVAGQLKRAEAEERALHYLEKVGLAAFADAYPHTLSGGMKARV
FT                   AIARALATQPKILLMDEPFAALDALTRRKMQEELLLLWEEVRFTLLFVTHSIEEALVVG
FT                   NRILLLSPHPGRVRAEVHSHQYDLGSLGGSDFQASARRIHRLLFDEADVPEQPDDLGFN
FT                   DIRIAY"
FT   gene            230771..231634
FT                   /locus_tag="PputGB1_0191"
FT   CDS_pept        230771..231634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0191"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: pen:PSEEN0149 ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96106"
FT                   /db_xref="GOA:B0KGY7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B0KGY7"
FT                   /protein_id="ABY96106.1"
FT                   /translation="MTTTPVRQEYEVQLEPLLSVPLERQLPLAQRLWQQGWLRKALILL
FT                   VIAVLWEAVARYQDNDLLLPSFLQTAAALWDGLVSGELPAKVGVSLVILLKGYVLGIVL
FT                   AFGLTSLAVSTQLGRDLLGTLTSMFNPLPAIALLPLALLWFGLGDNSLIFVLVHSVLWA
FT                   LALNTYAGFLGVSETLRMAGRNYGLKGLRLVLHILVPAALPSILSGLKIGWAFAWRTLI
FT                   AAELVFGASSGKGGLGWYIFQNRNELYTDKVFAGLAVVILIGLLVEGLVFNTLERLTVR
FT                   RWGMQR"
FT   gene            231845..232333
FT                   /locus_tag="PputGB1_0192"
FT   CDS_pept        231845..232333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0192"
FT                   /product="type VI secretion system effector, Hcp1 family"
FT                   /note="TIGRFAM: type VI secretion system effector, Hcp1
FT                   family; PFAM: protein of unknown function DUF796; KEGG:
FT                   psp:PSPPH_1885 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96107"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:B0KGY8"
FT                   /protein_id="ABY96107.1"
FT                   /translation="MAFDAYIQIAEIAGEAKDEQYSNWIEILGYTFGASQSTSVTASSA
FT                   GGATSGRTTLSNLTFTKYLDNASCKLLEASCAGQHLKEVKLVVCRAGSDKLKYYEVVLE
FT                   EVIIADYAQSAHAGVPTEIVQLNYGRIKTTYTRQQRVDGSAGGNVTGGWDRIANKKFA"
FT   gene            232343..233325
FT                   /pseudo
FT                   /locus_tag="PputGB1_0193"
FT                   /note="conserved hypothetical protein"
FT   gene            233336..233683
FT                   /locus_tag="PputGB1_0195"
FT   CDS_pept        233336..233683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96108"
FT                   /db_xref="GOA:B0KGY9"
FT                   /db_xref="UniProtKB/TrEMBL:B0KGY9"
FT                   /protein_id="ABY96108.1"
FT                   /translation="MALLVFSPGLIILILLIYIAHFYVERIESLLEKSSYIQGIRSTFL
FT                   RAGLPGKVLRTCCIACMMTMPAIYARRGLINMKEVNNFPLKMKRTLIGLWLALTIEILS
FT                   MLVFRAWLYLR"
FT   gene            233774..234397
FT                   /locus_tag="PputGB1_0196"
FT   CDS_pept        233774..234397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0196"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: psp:PSPPH_4491 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96109"
FT                   /db_xref="UniProtKB/TrEMBL:B0KGZ0"
FT                   /protein_id="ABY96109.1"
FT                   /translation="MNSRLPLEQIEQLHHVHMSGGAFRVREEFYAKRAALFRTLDEQLG
FT                   KTAAYGSGLRNQGSIKRMLQLSTKRYLSTGEISGYAEKVTGVAKAASLIKKGAYIGIAL
FT                   DVAATGLSIHKACTIGREEECRKAKYIEGSGLIGGLGGSAMLGALGGATASLICTVVFG
FT                   LPTGGPGALVCAVVGGVVGGEVGGDKGKEGGEWLGEIIYENKKS"
FT   gene            234409..234753
FT                   /locus_tag="PputGB1_0197"
FT   CDS_pept        234409..234753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0197"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96110"
FT                   /db_xref="GOA:B0KGZ1"
FT                   /db_xref="UniProtKB/TrEMBL:B0KGZ1"
FT                   /protein_id="ABY96110.1"
FT                   /translation="MNLVAVGFFFLGMAALLVLVFVAVRYLDEIEELLSKSVYVSGNKK
FT                   LYAPAGVIGKIMRICTISTVLTMPGVFARRRLVDVDQLRDFPNSIKRVLVGAWCTMFIS
FT                   SMVFLFLGSF"
FT   sig_peptide     234409..234477
FT                   /locus_tag="PputGB1_0197"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.739) with cleavage site probability 0.417 at
FT                   residue 23"
FT   gene            complement(235045..235608)
FT                   /locus_tag="PputGB1_0198"
FT   CDS_pept        complement(235045..235608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0198"
FT                   /product="transcriptional factor-related protein"
FT                   /note="KEGG: pen:PSEEN0150 transcriptional factor-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96111"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0KGZ2"
FT                   /protein_id="ABY96111.1"
FT                   /translation="MPFATTRATLSRQWALLRQLPSRSPGITSAELVWRLRDVGFTVSK
FT                   RTVERDLNELSLIFPLERNDKSIPFGWHWSASAVGELRGNFDLLTHLRGDALQPAQGEG
FT                   MELVARISDALARQLRVAPLSSDMQLTALEHGHRLRATVSDGWPLRWWLLSHGDGVVVE
FT                   QPADLREEIGKILSSAAAQYQSSL"
FT   gene            235815..236609
FT                   /locus_tag="PputGB1_0199"
FT   CDS_pept        235815..236609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0199"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="PFAM: Sel1 domain protein repeat-containing protein;
FT                   KEGG: pen:PSEEN0151 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96112"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B0KGZ3"
FT                   /protein_id="ABY96112.1"
FT                   /translation="MSAASNIHSLLARLLPERVIAPPAPVGRRQRLFAGVGLPSQRSLL
FT                   VNRLDEASDLQAVYVDLRRQALQGSVAALNDLGWIWLNGKYWRADTELAGHLLRMAALQ
FT                   GNAAAWFNLGQQHYFGKGIEPSYVQAAECYRQAFERGMLHAAAALGDLYEEEVCDGDLD
FT                   WQVDLVQAYQWFLRGAERGEARCRFEVGYRLMHGLYVEADLKAALYWLELAAAAGVVQA
FT                   AEELAVHFSSRDVVRYQEWRDRAVQMGSTLALTMKLEDQIQS"
FT   gene            236754..237206
FT                   /locus_tag="PputGB1_0200"
FT   CDS_pept        236754..237206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0200"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG: pen:PSEEN0152
FT                   transcriptional activator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96113"
FT                   /db_xref="GOA:B0KGZ4"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0KGZ4"
FT                   /protein_id="ABY96113.1"
FT                   /translation="MSLDLLRLQVSSGMVVAARHWRRICHTALTGYGISEACAAPLLMI
FT                   VRLGDGVHQVAVAQAAGLESPSLVRLLDQLCKAGLVCRSEDPLDRRAKALSLTAEGRAL
FT                   AEAIEAELVRLRRDVLHGIDQADLEAALRVLRAFEAAGLGNSGGAA"
FT   gene            237203..239290
FT                   /locus_tag="PputGB1_0201"
FT   CDS_pept        237203..239290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0201"
FT                   /product="Fusaric acid resistance protein conserved region"
FT                   /note="PFAM: Fusaric acid resistance protein conserved
FT                   region; KEGG: pen:PSEEN0153 efflux transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96114"
FT                   /db_xref="GOA:B0KGZ5"
FT                   /db_xref="InterPro:IPR006726"
FT                   /db_xref="UniProtKB/TrEMBL:B0KGZ5"
FT                   /protein_id="ABY96114.1"
FT                   /translation="MNGFFSSVPPARDWFYGVRTFAASMIALYIALLMQLPRPYWAMAT
FT                   VYIVSSPFVGPTSSKALYRAVGTLLGAGGAIFLVPPLVQSPLLLSIAIALWTGTLLFLS
FT                   LNLRTANNYVLMLAGYTLPMIALAVVDNPLAVFDVASSRAQEICLGIVCAAVVGAIFWP
FT                   RRLAPVVVGATSNWFTEAIRYSDIYLAREVSADKIGGMRGAMVATFNSLELMIGQLGHE
FT                   GAGPHTVKNARELRGRMIHLLPVIDALDDALVALEGRAPAQFAQLQPVLEAAREWLKGT
FT                   ADSPSVARWTTLHEQIDRLQPGAAALDQRAELLLSNALYRLTEWADLWQDCCTLQHALR
FT                   TDDAKPWRAVYRHWRLGRLTAFFDRGLMLYSVASTVLAIVVACGLWIGLGWNDGASAVI
FT                   LAAVSCSFFAAMDDPAPQIYRFFFWTLMSVIFSSLYLFLVLPNLHDFPMLVLAFAVPFI
FT                   CIGTLTVQPRFYLGTLLTIVNTSTFISIQGAYDADFFTFLNSNLAGPVGLLFAFIWTLV
FT                   MRPFGVELAAKRMTRFAWRDIVEMTEPATLAEHRQVGVQMLDRLMQHLPRLSQTGQDSG
FT                   VALRDLRVGLNLLDLLAYMPRAGQQARERLSTVVEEVGAHYAACLRAGERLHAPAALLR
FT                   NMERARLALNLDELYERGDARTHLLHALSGLRLALLPGVEVMLEPAEQPQLPPGLDGAP
FT                   L"
FT   gene            239287..239499
FT                   /locus_tag="PputGB1_0202"
FT   CDS_pept        239287..239499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0202"
FT                   /product="protein of unknown function DUF1656"
FT                   /note="PFAM: protein of unknown function DUF1656; KEGG:
FT                   pen:PSEEN0154 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96115"
FT                   /db_xref="GOA:B0KGZ6"
FT                   /db_xref="InterPro:IPR012451"
FT                   /db_xref="UniProtKB/TrEMBL:B0KGZ6"
FT                   /protein_id="ABY96115.1"
FT                   /translation="MIGELDISGVFLPTLLVMMFGTYLLFLGVHAVLVRLHFYRLVWHR
FT                   ALFNVALYAVLLGAVDHFCRNLMLP"
FT   gene            239496..240371
FT                   /locus_tag="PputGB1_0203"
FT   CDS_pept        239496..240371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0203"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   pen:PSEEN0155 efflux transporter, membrane fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96116"
FT                   /db_xref="GOA:B0KGZ7"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:B0KGZ7"
FT                   /protein_id="ABY96116.1"
FT                   /translation="MKKPLLTLGRVVLTLLVVTFAAVLVWQMVVYYMFAPWTRDGHIRA
FT                   DVIQIAPDVSGLIQKVEVRDNQTVKRGDVLFTIDQDRFSLALRQAKATLGERQETLAQA
FT                   SREAQRNRKLGNLVAAEQLEESQSREARARSAVSEAQVAVDTAQLNLDRSVVRSPVDGY
FT                   LNDRAPRNHEFVTAGRPVLSVVDSASYHVDGYFEETKLGGIQIGDAVDIRVMGDNTRLR
FT                   GHVQSFAAGIEDRDRSSGANLLPNVNPAFSWVRLAQRIPVRIAFDEVPQDFRMIAGRTA
FT                   TVSIIEGQRP"
FT   sig_peptide     239496..239561
FT                   /locus_tag="PputGB1_0203"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.972) with cleavage site probability 0.674 at
FT                   residue 22"
FT   gene            240368..241786
FT                   /locus_tag="PputGB1_0204"
FT   CDS_pept        240368..241786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0204"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: pen:PSEEN0156 efflux transporter, outer
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96117"
FT                   /db_xref="GOA:B0KGZ8"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:B0KGZ8"
FT                   /protein_id="ABY96117.1"
FT                   /translation="MKQLILAGLCLSLGACMMVGPDYEVPKDAAVQRSDLNGPLRQDAD
FT                   SVVSAPVPEDWWQLYQDQRLNELVRQALSANTELRVAAANIAKARAQVEVAESQGGFNG
FT                   GVKLGAQRLQESGEAFLLPEKVPVANIGEAIISASYQFDLWGTFKRGTEAAKANADAVQ
FT                   AAADTARITLVADVVKAYTQVCSANEEYHIARESLDLQEQSVTLNQRLRDAGRGDETQV
FT                   TRSQTQFKSLRAELPRFKAERETGMYTLAALLAKPVDQLPAGTADCAELPHLNQLVPVG
FT                   DGAALLKRRPDVRQAERQLAAATASIGVATGALYPDISIGAQVGTIGILENLGEPATNR
FT                   WGFGPQISWSIPTNGTRARIRMAEASTQAALANFDGVVLNAIRETQTRLAQYSALLDRR
FT                   DALAEAEKSAKEAADQTHRYYQAGRESFLADLQATRAYTDMRAQLAAANSQVAMGQIGV
FT                   FLALGGGWKDTAKH"
FT   sig_peptide     240368..240442
FT                   /locus_tag="PputGB1_0204"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.790) with cleavage site probability 0.785 at
FT                   residue 25"
FT   gene            241895..243838
FT                   /locus_tag="PputGB1_0205"
FT   CDS_pept        241895..243838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0205"
FT                   /product="cytochrome c class I"
FT                   /note="PFAM: cytochrome c class I; iron permease FTR1;
FT                   KEGG: pen:PSEEN5342 cytochrome c protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96118"
FT                   /db_xref="GOA:B0KGZ9"
FT                   /db_xref="InterPro:IPR004923"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B0KGZ9"
FT                   /protein_id="ABY96118.1"
FT                   /translation="MFSFAFPSRLAMNTRSRLLTWLPALLLGPVLALCSTLALAESPAE
FT                   AAKALHLLDYIGADYPPTVQEGKVIDEGEYREQQEFGAVLGDLVKGLPANAEQAALEQG
FT                   VQALRQAIDQRQEGTAVAKQARQLGARLAVAYEVSQAPVITPDPARGAALYAQNCAICH
FT                   GDTGAGDGPAGVGLEPAPANLRDAARLDQLSLFDLYNTLALGIDGTEMPSFADQLDDRQ
FT                   RWDVAAYIASFTAKPEAGKGDKTWNIADLARQTPAEVAANEGAAVLEAFRAQRAQPPQV
FT                   KRGPAQLLEYTASTLDKSLAAYRAGDHDQAYDLSVAAYLEGFELVESSLDNIDTQARKD
FT                   TEKSLMAYRQSLQDGLPVAQAEQRLAEAKRKLDQAAKLLGSDGLSWSLSYISGLLILLR
FT                   EGLEAILVLAAILAFLRNTGQQSAVRSVNIGWGLALVAGFATWALAAYVIDVGGAQREL
FT                   LEGCTALFAAVMVLWLGVWMHDRRHAAAWQNYIKSSLVSGGGRFGFALLAFFSVYRELF
FT                   EVILFYETLWLQAGPAGHQAVLAGGATALVLLVGLAWVILRGSAKLPLSLFFSINAALL
FT                   CALSVVFAGHGVKALQEAGVLGTRPVAFFEFDWLGIHADAYSLSAQAVALLAIVFLYGR
FT                   SRLAEKRRATAN"
FT   sig_peptide     241895..242017
FT                   /locus_tag="PputGB1_0205"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 41"
FT   gene            complement(243876..244121)
FT                   /locus_tag="PputGB1_0206"
FT   CDS_pept        complement(243876..244121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0206"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   pen:PSEEN5358 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96119"
FT                   /db_xref="InterPro:IPR013468"
FT                   /db_xref="InterPro:IPR020948"
FT                   /db_xref="UniProtKB/TrEMBL:B0KH00"
FT                   /protein_id="ABY96119.1"
FT                   /translation="MPFTPDLIDELEVLALFKHDSSQEGIKINSTAAPALIAAAQRLHE
FT                   KGLTDQPDGGYLTSLGHDAVESVQLLQNILKAPQPA"
FT   gene            complement(244191..244490)
FT                   /locus_tag="PputGB1_0207"
FT   CDS_pept        complement(244191..244490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0207"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN5357 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96120"
FT                   /db_xref="UniProtKB/TrEMBL:B0KH01"
FT                   /protein_id="ABY96120.1"
FT                   /translation="MSEPTDLDNDDEAFAEATLTQAIENQIESGEPPAAKATYNKLTLV
FT                   GYEREDILNLMAHVLAFEIDNMLVEDRAFNGEWYENALRALPELPPEMDQGEDE"
FT   gene            244639..245301
FT                   /locus_tag="PputGB1_0208"
FT   CDS_pept        244639..245301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0208"
FT                   /product="Glutathione S-transferase domain"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   pen:PSEEN5356 glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96121"
FT                   /db_xref="GOA:B0KH02"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:B0KH02"
FT                   /protein_id="ABY96121.1"
FT                   /translation="MLKLYGFSVSNYYNMVKLALLEKGLPFEEVTFYGGQAPQALKVSP
FT                   RGKVPVLETEHGFLSETSVILDYIEQTQGGKALLPADPFGQAKVRELRKEIELYIELPA
FT                   RTCYAEAFFGMSVEPLIKEKARADLLAGFATLKRNGRFAPYVAGEQLTLADLMFCFSVD
FT                   LAYAVGKKVLNIDFLADFPQAKALLQMMSENPHMARVVADKEAAMPAFMEMIRSGKR"
FT   gene            complement(245336..246730)
FT                   /locus_tag="PputGB1_0209"
FT   CDS_pept        complement(245336..246730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0209"
FT                   /product="argininosuccinate lyase"
FT                   /note="TIGRFAM: argininosuccinate lyase; PFAM: fumarate
FT                   lyase; KEGG: pen:PSEEN5355 argininosuccinate lyase
FT                   (arginosuccinase) (ASAL)"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96122"
FT                   /db_xref="GOA:B0KH03"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KH03"
FT                   /protein_id="ABY96122.1"
FT                   /translation="MSTDKTNQSWGGRFSEPVDAFVARFTASVDFDKRLYRHDIMGSIA
FT                   HATMLAQVGVLSDAERDTIIDGLKTIQGEIEAGNFDWRVDLEDVHMNIEARLTDRIGIT
FT                   GKKLHTGRSRNDQVATDIRLWLRDEIDLILAEITRLQQGLLEQAEREAETIMPGFTHLQ
FT                   TAQPVTFGHHLLAWFEMLSRDYERLVDCRKRANRMPLGSAALAGTTYPIDRELTCKLLG
FT                   FEAVAGNSLDGVSDRDFAIEFCAAASVAMMHLSRFSEELVLWTSAQFQFIDLPDRFCTG
FT                   SSIMPQKKNPDVPELVRGKTGRVFGALTGLLTLMKGQPLAYNKDNQEDKEPLFDAADTL
FT                   RDSLRAFADMIPAIKPKHAIMREAALRGFSTATDLADYLVRRGLPFRDCHEIVGHAVKY
FT                   GVDTGKDLAEMSLDELRQFSDQIEQDVFAVLTLEGSVNARNHIGGTAPAQVRAAVVRGK
FT                   ALLASR"
FT   gene            247027..247770
FT                   /locus_tag="PputGB1_0210"
FT   CDS_pept        247027..247770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0210"
FT                   /product="two component transcriptional regulator, LytTR
FT                   family"
FT                   /note="PFAM: response regulator receiver; LytTr DNA-binding
FT                   region; KEGG: pen:PSEEN5354 alginate biosynthesis
FT                   regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96123"
FT                   /db_xref="GOA:B0KH04"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B0KH04"
FT                   /protein_id="ABY96123.1"
FT                   /translation="MNVLIVDDEPQGRERLTRLLGELEGYTVLEPSATNGEEALALIES
FT                   LKPDVVLLDIGMPGLDGLQVAARLCEREAPPAVVFCTGDDEYGAEAFKDSTLSHVTKPF
FT                   QPQALRDALRKAEKPNRAQLAALTRPANEGGGPRSHISARTRKGIELIPIPQVIYFIAD
FT                   HKYVTLRHEAGEVLLDEPLKALEDEFGERFVRIHRNALVARERIERLQRTPLGHFQLYL
FT                   KGLDGDALTVSRRHVAGVRKMMQTL"
FT   gene            247946..248887
FT                   /locus_tag="PputGB1_0211"
FT   CDS_pept        247946..248887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0211"
FT                   /product="porphobilinogen deaminase"
FT                   /EC_number="2.5.1.61"
FT                   /note="KEGG: pen:PSEEN5353 porphobilinogen deaminase;
FT                   TIGRFAM: porphobilinogen deaminase; PFAM: Porphobilinogen
FT                   deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96124"
FT                   /db_xref="GOA:B0KH05"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KH05"
FT                   /protein_id="ABY96124.1"
FT                   /translation="MSTREIRIATRKSALALWQAEYVKARLEQAHPGLLVTLVPMVSRG
FT                   DKLLDAPLAKIGGKGLFVKELETALLDNEADIAVHSMKDVPMDFPEGLGLYCICEREDP
FT                   RDAFVSNTFDSLEALPAGSIVGTSSLRRQAQLLARRPDLQIRFLRGNVNTRLAKLDAGE
FT                   YDAIILAAAGLIRLGFEDRITSTISVDDSLPAGGQGAVGIECRSADVEIHALLAPLHHA
FT                   DTADRVVAERALNKHLNGGCQVPIACYAVLEGDQLWLRGLVGQPSGGTLLVADARAPRT
FT                   AAETLGVQVAEDLLSQGAEAILKEVYGEAGHP"
FT   gene            248884..249651
FT                   /locus_tag="PputGB1_0212"
FT   CDS_pept        248884..249651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0212"
FT                   /product="Uroporphyrinogen-III synthase"
FT                   /EC_number="4.2.1.75"
FT                   /note="PFAM: Uroporphyrinogen III synthase HEM4; KEGG:
FT                   pen:PSEEN5352 uroporphyrinogen III synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96125"
FT                   /db_xref="GOA:B0KH06"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:B0KH06"
FT                   /protein_id="ABY96125.1"
FT                   /translation="MSQWRLLLTRPAEDCAALAQSLAEEGVGSSCLPLLAIEPVTLETP
FT                   QRLLLEGLHGFQAIIVVSKPAARLLLEQLAKASLQPPRQGWFTVGEATAAVLQGAGLEV
FT                   SAPPRGDDSEALLALPALRQAVAAPAPRVLIVRGVGGRELLAERLAEQGASVEYLELYR
FT                   RCLPVYPAGTLMRRIEAERLNGLVVSSGQGFEHLQQLAGADWPQLARLPLFVPSPRVAE
FT                   QARAAGAQQVVDCRGASATALLAAVQRSAAPAS"
FT   gene            249697..250797
FT                   /locus_tag="PputGB1_0213"
FT   CDS_pept        249697..250797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0213"
FT                   /product="protein of unknown function DUF513 hemX"
FT                   /note="PFAM: protein of unknown function DUF513 hemX; KEGG:
FT                   pen:PSEEN5351 uroporphyrin-III C-methyltransferase HemX"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96126"
FT                   /db_xref="GOA:B0KH07"
FT                   /db_xref="InterPro:IPR007470"
FT                   /db_xref="UniProtKB/TrEMBL:B0KH07"
FT                   /protein_id="ABY96126.1"
FT                   /translation="MSETVLSNNDQPSAQTPAEPVTAPPAKRSGSGLAALALLLGAAGV
FT                   AVGGWGVWQVRQLQGSEFNQGQHIEALTQRAEALQQREQQISAQLASLPAASELEDRRR
FT                   LVAQLQGDQQRLSQRLETVLGESRKEWRLAEAEHLLRLATLRLSALQDITSAKALVEGA
FT                   DEILREQSDPGAFAAREQLARSLATLGSTQQPDRTGLFLKLAAQRELVQQLSAQSPEFD
FT                   TNADALGALTADGDGASRLSQWWAEISKYFQIDFNADENVRPLLAGQQLNQLRLALSLT
FT                   IEQAQWAALNGDAKVYTQALDDARSVLLANFNADNPQSKAMLDSLNALADQPVSVVTPD
FT                   LSESLAAVQAYIQRRHLPAEAEGGKP"
FT   gene            250794..252032
FT                   /locus_tag="PputGB1_0214"
FT   CDS_pept        250794..252032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0214"
FT                   /product="HemY domain protein"
FT                   /note="PFAM: HemY domain protein; KEGG: pen:PSEEN5350 HemY
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96127"
FT                   /db_xref="GOA:B0KH08"
FT                   /db_xref="InterPro:IPR005254"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:B0KH08"
FT                   /protein_id="ABY96127.1"
FT                   /translation="MKRVYLLAVLAIVVAAALGIAVAKHSGYVLISYGGFRYQSGLWAA
FT                   LAGLLAVVALLWLLRYLVGLVLTSSGVVNPWSRRNRSRRIRVAIEQGQLDLAEGRWASA
FT                   QRHLHRAAEAERQPLLYYLGAARAANEQGRTEDSDNLLERALERQPQAELAIALTHAQL
FT                   QMDRGETDGALETLLAMQERHPHNSQVLRLLQRLYLERGDWSALIRLLPDLRKGKVLPP
FT                   AELAALEQRAWGQNLSLATTRGEDAQTARQALERAWQQLTAAQRQEPQLVLAYAEQLRQ
FT                   VGAQSEAEHVLRTALKREYESHLARLYGLVRGDDPARQLQTAEGWLKAHPQDASLLLTL
FT                   GRLSLQNRLWGKARDYLESSLRMERNPEACAELARLLAGLGETERSNQLFQEGLGLLDE
FT                   RLLALPLPEGVRA"
FT   sig_peptide     250794..250865
FT                   /locus_tag="PputGB1_0214"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.876 at
FT                   residue 24"
FT   gene            252254..252760
FT                   /locus_tag="PputGB1_0215"
FT   CDS_pept        252254..252760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0215"
FT                   /product="Disulphide bond formation protein DsbB"
FT                   /note="PFAM: Disulphide bond formation protein DsbB; KEGG:
FT                   pen:PSEEN0158 disulfide bond formation protein B1
FT                   (disulfide oxidoreductase 1)"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96128"
FT                   /db_xref="GOA:B0KH09"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR022920"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="UniProtKB/TrEMBL:B0KH09"
FT                   /protein_id="ABY96128.1"
FT                   /translation="MLPAHLRTLFLPACLAAMAVLVVSFHLENTLGLVPCPLCFSQRLL
FT                   LGLYALLCLAAVLQAPGTRGTLRYARVALGCSLAGAVLAARHVWLQGAHGVIHMCPAPI
FT                   GRVFEHSWAEAARQLLLGGPDCSSLTWSFLDLTLPEWSLLAFLLLAVLPLSCLLAYRFR
FT                   TLART"
FT   sig_peptide     252254..252322
FT                   /locus_tag="PputGB1_0215"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.874) with cleavage site probability 0.322 at
FT                   residue 23"
FT   gene            252992..253462
FT                   /locus_tag="PputGB1_0216"
FT   CDS_pept        252992..253462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0216"
FT                   /product="regulator of RpoD, Rsd/AlgQ"
FT                   /note="PFAM: regulator of RNA polymerase sigma(70) subunit
FT                   Rsd/AlgQ; KEGG: pen:PSEEN0159 transcriptional regulator
FT                   AlgQ"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96129"
FT                   /db_xref="GOA:B0KH10"
FT                   /db_xref="InterPro:IPR007448"
FT                   /db_xref="InterPro:IPR038309"
FT                   /db_xref="UniProtKB/TrEMBL:B0KH10"
FT                   /protein_id="ABY96129.1"
FT                   /translation="MLDSCQNAQERWGGVHKLIDRWLEERQELVQAFRALRDVKPAFAD
FT                   KDTNGDFCALLVDYVSAWHFEVCEQLASEAKAFGDEKALKLAEEINPRINDSTQIALAF
FT                   NDHCAKGECKDTERFAEKLAKLGGLLHERFELEDCLIEVLHNAHKEEGAVQA"
FT   gene            complement(253472..254110)
FT                   /locus_tag="PputGB1_0217"
FT   CDS_pept        complement(253472..254110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0217"
FT                   /product="peptidylprolyl isomerase FKBP-type"
FT                   /note="PFAM: peptidylprolyl isomerase FKBP-type; KEGG:
FT                   pen:PSEEN0160 peptidyl-prolyl cis-trans isomerase,
FT                   FKBP-type"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96130"
FT                   /db_xref="GOA:B0KH11"
FT                   /db_xref="InterPro:IPR000774"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR036944"
FT                   /db_xref="UniProtKB/TrEMBL:B0KH11"
FT                   /protein_id="ABY96130.1"
FT                   /translation="MPRYLVLGLCLLAPIALADSDDHDLAYSLGASLGERLRQEMPGLQ
FT                   LDALVEGLKQSYQGQPLKLDKARMQAVLQQHEAQEGDASVQKLQAAETRFMANERGRYG
FT                   VHELAEGVLYSELQAGTGAQPKAGGKVQVRYVGRLPDGSVFDQNQTPQWFNLDSVIEGW
FT                   QVALPKMHAGAKWRLVIPSAQAYGAEGAGDLIAPYTPLVFEIELLAVGD"
FT   sig_peptide     complement(254054..254110)
FT                   /locus_tag="PputGB1_0217"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.995 at
FT                   residue 19"
FT   gene            254289..255356
FT                   /locus_tag="PputGB1_0218"
FT   CDS_pept        254289..255356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0218"
FT                   /product="alginate regulatory protein AlgP"
FT                   /note="KEGG: pen:PSEEN0161 alginate regulatory protein
FT                   AlgP"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96131"
FT                   /db_xref="UniProtKB/TrEMBL:B0KH12"
FT                   /protein_id="ABY96131.1"
FT                   /translation="MSAKKKPVSTPLHLLQQLSGSLLEHLEEACSQALADAEKLLAKLE
FT                   KQRGKAQEKLHNGRLKLQDAAKAGKAKAQTKAQKAIGELEQLLDALKERQTQTRSYIQQ
FT                   LKRDAQDSLKLAQGVGKVREAAAKALDLRATKPAAKPAAKATTAAKPAAKPAVKATAAA
FT                   KPAAKPAAKATAAAKPAAKPAAKATAAAKPAAKPAAKATAAAKPAAKPAAKATAAAKPA
FT                   AKPAAKATAAAKPAAKPAAKATAAAKPAAKPAAKATAAAKPAAKPAAKATAAAKPAAKP
FT                   AAKAPAAKPATAKAPARTATKPAAKPVASKPAEAKPATPAASTPAVATNSATPATSAAA
FT                   STPASTPAQAPSSAS"
FT   gene            complement(255332..255814)
FT                   /locus_tag="PputGB1_0219"
FT   CDS_pept        complement(255332..255814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0219"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   pen:PSEEN0162 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96132"
FT                   /db_xref="InterPro:IPR012659"
FT                   /db_xref="UniProtKB/TrEMBL:B0KH13"
FT                   /protein_id="ABY96132.1"
FT                   /translation="MHNDLWSYALALYARPGVEAACLELQAQGGDVCLLLCATWLQARG
FT                   VVLLEERAQALQEVVEPWQREVVAPLRSLRQQWRAAASHDAQLAALREQVKGLELQAEK
FT                   TLLERLQERSRQWPGGSHEPSDDWLARLAPAPARHHDALDQLRVAAAALQDAEDGA"
FT   gene            255928..257775
FT                   /locus_tag="PputGB1_0220"
FT   CDS_pept        255928..257775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0220"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pen:PSEEN0163 ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96133"
FT                   /db_xref="GOA:B0KH14"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:B0KH14"
FT                   /protein_id="ABY96133.1"
FT                   /translation="MTLHAGHKAGLIGANGAGKSSLFALLRGELSPDAGDCQLPGDWRI
FT                   AHMRQEVDTLDRLAVDYVLDGDVRLRKVQAELAAAEQAHDGTALARLHSELESADGYTA
FT                   DARARKLLAGLGFTNEQMDRRVGDFSGGWRMRLNLAQALMCPSDLLLLDEPTNHLDLDA
FT                   ILWLEDWLKGYPGTLLLISHDRDFLDAVVDHVLHVEQRKLNLYKGGYTAFERTRAERLA
FT                   QQQQAYEKQQAQRAHMEKYIARFKAQATKARQAQSRIKALERMEELSAAHVDSPFDFVF
FT                   RESQKISSPLLSLSEGCLGYGDKAILEKVKLQLTPGARIGLLGPNGAGKSTLIKNLAGE
FT                   LEPLSGRLVRGENLAVGYFAQHQLDSLDDKASPLLHLQRIAPTEREQTLRDFLGGFDFH
FT                   GARCDEPVVNFSGGEKARLALALIAWERPNLLLLDEPTNHLDLEMRLALTMALQEFAGA
FT                   VVVVSHDRHLLKSTTDDFLLVADGKVDTFDGDLEDYSRWLVEYRQRSAPASTAPVNPDK
FT                   TDKKAQRQAAAALRQQLAPHKKAADKLETELNQVHVQLAEIETALGDGGLYEAARKDEL
FT                   RDLLARQTKLKQREGELEEAWMEALETLESMQAELEALS"
FT   gene            257775..258362
FT                   /locus_tag="PputGB1_0221"
FT   CDS_pept        257775..258362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0221"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN0164 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96134"
FT                   /db_xref="GOA:B0KH15"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:B0KH15"
FT                   /protein_id="ABY96134.1"
FT                   /translation="MEELRSLLPGQWMDTFWLGLQILLILVAAFLLQRIVARGLSRLGQ
FT                   RYPLPPELLVPVRGGLRWLIMGSALLFVLERLGVSATVLWTALSGFVAVAAVAFFAMWS
FT                   VLSNLLCAVLIFTVGPFRIGDVVELVDTLDKPGVKGRVIAINLLFTTLLEMPEAGGALV
FT                   QVPNSQFFQKSVRRWRGAEVQTMHKEPAGEAD"
FT   gene            258497..259129
FT                   /locus_tag="PputGB1_0222"
FT   CDS_pept        258497..259129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0222"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   pen:PSEEN0165 transporter, LysE family"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96135"
FT                   /db_xref="GOA:B0KH16"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:B0KH16"
FT                   /protein_id="ABY96135.1"
FT                   /translation="MSMEVWLGFFAACWVISLSPGAGAIASMSSGLQYGFWRGYWNALG
FT                   LQLGLILQIAIIAAGVGAILAASATAFQVIKWFGVAYLVYLAYKQWRALPMDMTDESGV
FT                   RPIGKPLSLVFRGFLVNVSNPKALVFMLAVLPQFLNPHAPLLPQYVAITVTMITVDMLV
FT                   MAGYTGLASRVLRLLRTPKQQKRLNRTFAGLFIGAATFLATLRRAPL"
FT   sig_peptide     258497..258571
FT                   /locus_tag="PputGB1_0222"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.839) with cleavage site probability 0.450 at
FT                   residue 25"
FT   gene            complement(259201..259956)
FT                   /locus_tag="PputGB1_0223"
FT   CDS_pept        complement(259201..259956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0223"
FT                   /product="band 7 protein"
FT                   /note="PFAM: band 7 protein; KEGG: pen:PSEEN0166
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96136"
FT                   /db_xref="GOA:B0KH17"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:B0KH17"
FT                   /protein_id="ABY96136.1"
FT                   /translation="MFMQMGFGAVLIVLVMLLLSAFRILREYERGVVFQLGRFWQVKGP
FT                   GLILLIPVIQQMVRVDLRTVVLDVPPQDVITRDNVSVKVNAVLYFRVLDPQKAIIQVED
FT                   FLVATSQLAQTTLRAVLGKHELDELLAEREQLNADIRQVLDAQTDAWGIKVANVEIKHV
FT                   DLNESMVRAIARQAEAERERRAKVIHAEGELQASEKLMQAAQMLGKEPGAMQLRYMQTL
FT                   GAIAGDRTSTIVFPMPVDLLTGLVDKQKQ"
FT   gene            complement(259959..261302)
FT                   /locus_tag="PputGB1_0224"
FT   CDS_pept        complement(259959..261302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0224"
FT                   /product="protein of unknown function DUF107"
FT                   /note="PFAM: protein of unknown function DUF107; KEGG:
FT                   pen:PSEEN0167 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96137"
FT                   /db_xref="GOA:B0KH18"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B0KH18"
FT                   /protein_id="ABY96137.1"
FT                   /translation="MIARSWCWVLLLLLLGITPGGQAAPGAVWVLGIDDAIGPASADYL
FT                   VRSLDQAQAQRAQLVVIRMDTPGGLDSAMRQMIKAILASPVPVATYVAPSGARAASAGT
FT                   YILYASHVAAMAPGTNLGAATPVQIGGPPGPGKDDKGKNGEEETLARKQVNDAAAYIRG
FT                   LAQLRGRNAEWAEKAVREAVSLSASEALRLNVIDQVADDLPDLLRKLDGKTFIVAGQPQ
FT                   QLHTTDASLVEHLPDWRTRVLAVITNPSVALILIMIGVYGLLFEFMNPGSAVGGVVGGV
FT                   CLLMALYALQLLPVSFAGVALILLGIAFMIAEAFLPSFGVVGFGGIVAFVVGALILIDT
FT                   DAPGFGIPLALIGTLALLSALLIGGVLGMALKARRRALVSGDAGLVGSLVTVTQVMPDN
FT                   PFCGLVLAQGEQWQAQCATVLQAGQNVRVTARHGVMLQVSAAAAAQGE"
FT   sig_peptide     complement(261231..261302)
FT                   /locus_tag="PputGB1_0224"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.998 at
FT                   residue 24"
FT   gene            261401..261859
FT                   /locus_tag="PputGB1_0225"
FT   CDS_pept        261401..261859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0225"
FT                   /product="YbaK/prolyl-tRNA synthetase associated region"
FT                   /note="PFAM: YbaK/prolyl-tRNA synthetase associated region;
FT                   KEGG: pen:PSEEN0168 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96138"
FT                   /db_xref="GOA:B0KH19"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:B0KH19"
FT                   /protein_id="ABY96138.1"
FT                   /translation="MRMAKTLQARLDKANCDYDIIPHPHSATSLESARTAGVPAERVAK
FT                   SVMLDDRHGNYIMAVLPANRHLDMSKVRMSGAWQLTRESGLPSLFNDCERGAVPALGDA
FT                   YQIKMLLDPSLTRQGDVYLEAGDHDHLIHMSMEQYMKLVPHAEVRELC"
FT   gene            261921..262163
FT                   /locus_tag="PputGB1_0226"
FT   CDS_pept        261921..262163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0226"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN0169 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96139"
FT                   /db_xref="InterPro:IPR021250"
FT                   /db_xref="InterPro:IPR038086"
FT                   /db_xref="UniProtKB/TrEMBL:B0KH20"
FT                   /protein_id="ABY96139.1"
FT                   /translation="MEAPTHPFADLFKQLGLPDDPKSIDQFITSHSPLKNETKLVDAPF
FT                   WTDSQRAFLKESIIEDADWAVPFDQLNEALRRPRK"
FT   gene            262233..262871
FT                   /locus_tag="PputGB1_0227"
FT   CDS_pept        262233..262871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0227"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN0170 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96140"
FT                   /db_xref="GOA:B0KH21"
FT                   /db_xref="UniProtKB/TrEMBL:B0KH21"
FT                   /protein_id="ABY96140.1"
FT                   /translation="MKDPYAPGFWCSVTILGTLTASYFYGIRQTQQMNQAVHFLYAAAA
FT                   VTVAVVLVALTWIAWQQLHLNKREVIQGRTLLTIWNTKVALRRVETVFDRYFWGSYWHS
FT                   GRTFEEVMGELKGTPLEQSLDALKRQCRVLDREIHDHHHHWLANARDLSSVAQAMARER
FT                   YQLDLGEPTHSGHGNTAVLNRDLEVLVYTWSARLRSFDHQLDELERAYH"
FT   gene            complement(262878..263315)
FT                   /locus_tag="PputGB1_0228"
FT   CDS_pept        complement(262878..263315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0228"
FT                   /product="CBS domain containing protein"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   pen:PSEEN0171 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96141"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:B0KH22"
FT                   /protein_id="ABY96141.1"
FT                   /translation="MKTVEQILKTKSQHQTVYTIGPDDSVLDALKMLAEKNVGALPVVE
FT                   GNQVVGIVSERDYARKLVLKGRSSAATPVREIMSAPVVTVEPKQKLDFCMNLMTDRHLR
FT                   HLPVVDNGKLLGLLSIGDLVKETIAEQASLIQQMEQYIRGE"
FT   gene            complement(263486..265216)
FT                   /locus_tag="PputGB1_0229"
FT   CDS_pept        complement(263486..265216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0229"
FT                   /product="dipeptidase"
FT                   /note="TIGRFAM: dipeptidase; PFAM: peptidase M20; KEGG:
FT                   pen:PSEEN0172 dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96142"
FT                   /db_xref="GOA:B0KH23"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010964"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B0KH23"
FT                   /protein_id="ABY96142.1"
FT                   /translation="MHLKKLTATTLLLASIGLFTQPAQANLTQQQSAAIVKAFDGSDPS
FT                   DFKQFLGKLKGSDLAKADNLEVTLDAYLANTPLAAEQQDEINRLLGLYTRIKYGKAATE
FT                   TLRELVAIPTFNVEGTPQYENPEFLKIADKIKALADSFGLAFRNIDNRVYEISLGSGKE
FT                   VIGIHAHADVVPVNPDNWKLADGTRLDPFKVTLVGDRMYGRGTEDDKNGIVVAMYALKV
FT                   AKDENLPLARQFKLLIDTTEETSGDAIPYYFERNPTPDYNLALDGGYPVVIAEKGYGTV
FT                   MASFSKRPATGKGAEIVNLTGGLATNQIPTTSVATLVSDNPAQLAKHLQQAGSKYVKQH
FT                   GSDFSIDAKADGKQVLLTVTGVSAHSSEPESGVNPVARMLDFINGLGQQVPLKHNQFTD
FT                   AARYAADNWGLDYLGNKLGVAFKDPFMGPLTASLTFVGVDDKGLKLAVNLRIPKGKPIA
FT                   TIKDELADKLGKWTRQSHTSVAFDYSLDEPMYRNPEGEWVKALLAVASENLGMKHEFGT
FT                   SAGATSVHDLPNGVQFGLAMPDVKYTGHNDNEFKTVDQFMLDLQVVSEMVARLGQMPKL
FT                   "
FT   sig_peptide     complement(265139..265216)
FT                   /locus_tag="PputGB1_0229"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 26"
FT   gene            complement(265377..265453)
FT                   /locus_tag="PputGB1_R0010"
FT                   /note="tRNA-Arg7"
FT   tRNA            complement(265377..265453)
FT                   /locus_tag="PputGB1_R0010"
FT                   /product="tRNA-Arg"
FT   gene            complement(265566..266429)
FT                   /locus_tag="PputGB1_0230"
FT   CDS_pept        complement(265566..266429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0230"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pen:PSEEN0180 alkyl sulfate ester ABC transporter
FT                   AstC, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96143"
FT                   /db_xref="GOA:B0KH24"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0KH24"
FT                   /protein_id="ABY96143.1"
FT                   /translation="MNAFNTSHLHAANQPDATPPLVSFEGVGKVFSVDGQPLEAIRNFN
FT                   LSINQGEFIAIVGASGCGKSTLLRLLVGLDTDYSGSIRIDGHAVSGIGGERGIVFQEHR
FT                   LFPWLNVEQNIALGLANESLTQGERARRVHEFVQLVGLVGFESAYPHQLSGGMAQRVAI
FT                   ARGLVASPRILLLDEPFGALDALTRQQLQDELLAIRERAGITTLLVTHDAEEATYLADR
FT                   VVVLEPRPGRIKSVVGIDLPHPRLRSGVALHGLREKVLHQITGDGGYLPPPSRRVEGLR
FT                   PELIAL"
FT   gene            complement(266426..268030)
FT                   /locus_tag="PputGB1_0231"
FT   CDS_pept        complement(266426..268030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0231"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: pen:PSEEN0181 alkyl sulfate
FT                   ester ABC transporter AstB, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96144"
FT                   /db_xref="GOA:B0KH25"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B0KH25"
FT                   /protein_id="ABY96144.1"
FT                   /translation="MNGVLSRNRGGPLRGPFAAQGRSHRDRILSVERVLPWLLPVLIAL
FT                   LWGVASRQHWMSEQILPAPALVWQSALEFGAGELWGHLWISLQRLFWGLAVGIGSGLLL
FT                   GVWLGASRQAQTLVLPTFVALAQIPTLAWIPLFMLFFGIGELLKLVVLVKAVVVPVTLH
FT                   TLVGVRDAQPKLREAAAALRLPRHLLFLRLLLPAALPAFLTGVRLALATGWTSLLAVEL
FT                   LASSEGIGYLMVWGRQLFMLDLVLLCILVIGLVGAVLERSFSALEHRLLYWPQPATGEH
FT                   QRGAVPRGWQSLLLPLAILALWQASSSFGWVDPNILTSPLEVLRTLLVGLADGSLPQAL
FT                   LLSLQRTLTGLLLGGGAGLLAGLVLGLSRNAERLFGPSLTALRQVALFAWVPLLTAWFG
FT                   LGEGAKHVFVGLAAFFPLLIATQRGIAGLSPQLGEAARTLRLGLWQRLRLLVLPGAAPG
FT                   IFAGLRLSLIYAWLGTIGAEYFMPSDGGIASLMIGAQQLFRMDQVMAAMLLIGLVGALL
FT                   GTLGQRLESRATRWRTA"
FT   gene            268328..269365
FT                   /locus_tag="PputGB1_0232"
FT   CDS_pept        268328..269365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0232"
FT                   /product="NMT1/THI5 like domain protein"
FT                   /note="PFAM: NMT1/THI5 like domain protein; KEGG:
FT                   pen:PSEEN0182 aryl sulfate ester ABC transporter AstR,
FT                   periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96145"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:B0KH26"
FT                   /protein_id="ABY96145.1"
FT                   /translation="MKTPLRHLITALGLAFTLSAHAAEPAKPASIRIAVPDLSAGSKAS
FT                   AGGVVDVLRDQQLLEKEFAKDGIRIDWRFFKGAGPVVNEALANGQADFAYLGDLAAIVG
FT                   KANGLDTRVLSAGVRGVKSYLGVVPGSGIKTLHDLKGKRVAVFRGTANQLSFASALASQ
FT                   GLSERELKVINLDFNAANAALAAKQIDATWGLSNLLSLRERGLVELPVNSRDLEGAGST
FT                   QAVLLGTGDFIRQYPELVQRLVNAQEQASAWLRDEHNRQAYIDLVASNANWPRSILSDD
FT                   LAKEDLAHYFDPRLDAGFVGQLQQGVDLAAKERLIRRGFQVADWIEPRFLDAALKQEQA
FT                   VQAAR"
FT   sig_peptide     268328..268396
FT                   /locus_tag="PputGB1_0232"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            269406..270311
FT                   /locus_tag="PputGB1_0233"
FT   CDS_pept        269406..270311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0233"
FT                   /product="Taurine dioxygenase"
FT                   /EC_number="1.14.11.17"
FT                   /note="PFAM: Taurine catabolism dioxygenase TauD/TfdA;
FT                   KEGG: pen:PSEEN0183 alkylsulfatase AtsK"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96146"
FT                   /db_xref="GOA:B0KH27"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:B0KH27"
FT                   /protein_id="ABY96146.1"
FT                   /translation="MSNAALATAPQALELDIHPVAGRIGAEIRGVRLSADLDAATVEAI
FT                   QAALVQHKVIFFREQTHLDDQSQEGFAKLLGEPVAHPTVPVVDGTSYLLQLDGAEGQRA
FT                   NSWHTDVTFVDAYPKASILRSVVAPTSGGDTVWANTAAAYQELPEPLRELADKLWAVHS
FT                   NEYDYASIKPDVDPAKLERYRKVFTSTVYETEHPVVRVHPISGERALQLGHFVKRIKGY
FT                   SLADSQHLFAVLQGHVTRLENTVRWRWQVGDVAIWDNRATQHYAVDDYGTQPRVVRRVT
FT                   LAGEVPVGVDGQLSRTTRKG"
FT   gene            complement(270430..271344)
FT                   /locus_tag="PputGB1_0234"
FT   CDS_pept        complement(270430..271344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0234"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: pen:PSEEN0184 transcritpional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96147"
FT                   /db_xref="GOA:B0KH28"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0KH28"
FT                   /protein_id="ABY96147.1"
FT                   /translation="MHIDLRQLRHYIALVEHRSFVAAAAAVNLSQSAFSRSIQTLEHNI
FT                   GCRLVDRASKELAPTRQGLLVLEHSRRLVHGAHNLVNEIHQFNGATTGVVRFGSGPAPA
FT                   GGLVPRAVARFVAEFPAARTCFQVDNWQALNRKLVAEEIEFFVADTRQFESDPDYQVHK
FT                   LTPQRWHFCCRAGHPLTKRQSVLARDLFDYPMATTFRPPNIRKILSDLSGRQDFLPAVE
FT                   CEHGYALLIVVMHSDTIGIACNANLRPYQRDGGLVKLQLADLTPEQEEACHTRYGVVSR
FT                   VGYGLSPLAQGLVRQLIACDSEM"
FT   gene            271537..273873
FT                   /locus_tag="PputGB1_0235"
FT   CDS_pept        271537..273873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0235"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: pen:PSEEN0186 TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96148"
FT                   /db_xref="GOA:B0KH29"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:B0KH29"
FT                   /protein_id="ABY96148.1"
FT                   /translation="MSGLSRWPARASRFTLQPLAAGVLLAASSGSFAEAPVSATPAVEQ
FT                   EAKLGTVTVNARRREETAQSVPTPISVLDSETLETQRIYRVQDLQQLVPSTNVAYVHAR
FT                   QSSISIRGLGNNPASDGLEGSVGIYLDNVYLGRPGMAVFDLLDVEQLEVLRGPQGTLFG
FT                   KNTTAGVLNITTRKPTFHREGSIQQSFGEDGYLQTQGSFSGPISETLAGRISAYRTEDD
FT                   GYVKNIHNGDDLNGGKRQGFRTQLLFKPSDTFNLRWIGEYNEEDSNNGILSLYSTGPTI
FT                   NGVNRYESLAAQAGATLVSGKDRKVNFDADQQVTVFQGGTSVEANWTLPNDFTLTSITA
FT                   YRWWDFTPRNDDGLNVPVFYSAGVSVRDKQYSQEIRLASPTGGAFDYVLGAYYFKQDLD
FT                   NKSFTYYGPQADIWNLTPAGALNNVNTIGDGHIDTDSYALFAQGTWHVTDRLDFTAGIR
FT                   GTYEEKSAWVTRDAPSGGAAVNGAAAAARQARIGAYDSGDLNQYSFSPSGLLGLSYRFS
FT                   EQLLGYATLTHGEKSGGVNLTVGAAPRLGTDSLLVGTERVNNAELGLKSTLFDGRLQLN
FT                   SNLFWAEVHGYQANVYDQINRVQYLANAGRVRSRGLEFEATALPIRGLTVNFNGSWNDV
FT                   RYTEYKDAPCPPEVSLANATATCDLSGHQVVGASKYIANLNTQYKWQATEHVEPYVTAS
FT                   YAFRSKAVGTIDDSDFGQIPSYALVNLSAGVRLDQGDGVVDLSLWVKNAGDKTYFTSLW
FT                   NSANGGYAGVLGTPRTFGATARYDF"
FT   sig_peptide     271537..271638
FT                   /locus_tag="PputGB1_0235"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 34"
FT   gene            273891..275567
FT                   /locus_tag="PputGB1_0236"
FT   CDS_pept        273891..275567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0236"
FT                   /product="Arylsulfotransferase"
FT                   /note="PFAM: Arylsulfotransferase; KEGG: pen:PSEEN0187
FT                   arylsulfotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96149"
FT                   /db_xref="GOA:B0KH30"
FT                   /db_xref="InterPro:IPR010262"
FT                   /db_xref="InterPro:IPR035391"
FT                   /db_xref="InterPro:IPR038477"
FT                   /db_xref="UniProtKB/TrEMBL:B0KH30"
FT                   /protein_id="ABY96149.1"
FT                   /translation="MNAKTQTPALPEGACLTAKVPERDEALLGDVVVNPYRLAPLTAII
FT                   RDGGRSLSDAHVRVLGRGERGVDIVYDVSDRSLWTYGGIPVFGLYPDHVNQVEVTYKLD
FT                   GERIREQYQIYAPAVRLPVVAKQTAALPEVEPVKVAPGFEKRLYLFNHLQGDIPGGRAF
FT                   KWNALGGAAEWDQVGNNWIADSNGDVRWYLDIEQIHDSNRRDGLGGTMGFQQTRDGKLI
FT                   WGQGQTYSKYDLLGRRIWQRSLPDKFADFSHEIRETSNGTYLLRVGTSDYRRPDGKRVR
FT                   SIRDHIIEVSEAGDVLDFWDLNQILDPYRGDLLETLGKAAIQLPPGVQKQDERLANELA
FT                   EGDLPFGDTPGVGTGRNWAHVNAIDYDADDDSIIVSARHQGVVKVGRDKQVKWILASPQ
FT                   GWPQHLREKVLKPVESEGFDWSWTQHTAWLTGKGTLTVFDNGWGRDFAPTKLAGNYSRA
FT                   VEYRIDEAEGTVEQVWEYGKARGDEWYSPVTSVVAYRPETDTQFIYSASVNFLTPEKLT
FT                   TTVLNEVRRGTQEVLVELKVHSRQPGSVGYRALVIDLAKAF"
FT   gene            275860..277302
FT                   /locus_tag="PputGB1_0237"
FT   CDS_pept        275860..277302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0237"
FT                   /product="succinic semialdehyde dehydrogenase"
FT                   /note="TIGRFAM: succinic semialdehyde dehydrogenase; PFAM:
FT                   Aldehyde Dehydrogenase; KEGG: pen:PSEEN0189
FT                   succinate-semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96150"
FT                   /db_xref="GOA:B0KH31"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B0KH31"
FT                   /protein_id="ABY96150.1"
FT                   /translation="MQLKDAQLFRQQAYINGEWLDADNGQTIKVTNPATGEVIGTVPKM
FT                   GTAETRRAIEAADKALPAWRALTAKERSAKLRRWFELMIENQDDLARLMTTEQGKPLAE
FT                   AKGEIAYAASFIEWFAEEAKRIYGDTIPGHQPDKRLIVIKQPIGVTAAITPWNFPAAMI
FT                   TRKAGPALAAGCTMVLKPASQTPYSALALVELAHRAGIPAGVLSVVTGSAGEVGGELTG
FT                   NSLVRKLSFTGSTEIGRQLMEECAKDIKKVSLELGGNAPFIVFDDADLDKAVEGAIISK
FT                   YRNNGQTCVCANRIYVQDGVYDAFAQKLAAAVAKLKIGNGLEEGTTTGPLIDGKAVAKV
FT                   QEHIEDAVGKGAKVLSGGKLIEGNFFEPTILVDVPKTAAVAKEETFGPLAPLFRFKDEA
FT                   EVIAMSNDTEFGLASYFYARDMSRVFRVAEALEYGMVGINTGLISNEVAPFGGIKASGL
FT                   GREGSKYGIEDYLEIKYLCISV"
FT   gene            277484..278761
FT                   /locus_tag="PputGB1_0238"
FT   CDS_pept        277484..278761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0238"
FT                   /product="4-aminobutyrate aminotransferase"
FT                   /note="TIGRFAM: 4-aminobutyrate aminotransferase; PFAM:
FT                   aminotransferase class I and II; aminotransferase
FT                   class-III; KEGG: pen:PSEEN0191 4-aminobutyrate
FT                   aminotransferase, PLP-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96151"
FT                   /db_xref="GOA:B0KH32"
FT                   /db_xref="InterPro:IPR004632"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B0KH32"
FT                   /protein_id="ABY96151.1"
FT                   /translation="MSKTNESLMQRRVAAVPRGVGQIHPIFVDTAKNSTVIDVEGRELI
FT                   DFAGGIAVLNTGHLHPKVVAAVQEQLTKVSHTCFQVLAYEPYVELCEKINKLVPGDFDK
FT                   KTLLVTTGSEAVENAVKIARAATGRAGVIAFTGGYHGRTMMTLGLTGKVVPYSAGMGLM
FT                   PGGIFRALFPSELHGISVDDAIASVERIFKNDAEPRDIAAIILEPVQGEGGFLPAPKEL
FT                   MKRLRALCDQHGILLIADEVQTGAGRTGTFFAMEQMGVAPDLTTFAKSIAGGFPLAGVC
FT                   GKAEYMDAIAPGGLGGTYAGSPIACAAALAVIEVFEEEKLLDRSKAVGERLTTGLREIQ
FT                   KKHPIIGDVRGLGSMIAVEVFEKGTHTPNAAAVGQVVAKAREKGLILLSCGTYGNVLRI
FT                   LVPLTAEDALLDKGLAIIEECFAELA"
FT   gene            278900..280138
FT                   /locus_tag="PputGB1_0239"
FT   CDS_pept        278900..280138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0239"
FT                   /product="putative signal transduction protein"
FT                   /note="PFAM: response regulator receiver; Metal-dependent
FT                   hydrolase HDOD; KEGG: pen:PSEEN0192 response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96152"
FT                   /db_xref="GOA:B0KH33"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:B0KH33"
FT                   /protein_id="ABY96152.1"
FT                   /translation="MSAANPTAPNVLIVEGDPWVRDMLSEMLLSVRCDARLQVCADGSQ
FT                   ALSALSSKPDLIIAARELAGVDGLDLLRKVRAKGPGLPFILMSNRSDSASVREALPLHP
FT                   TAYLSKPLNLDNLRKRLEELLVAVGEEIACPMPALQPGASLPAYLEQRRANADGGPLLA
FT                   DVQVAIKRALNPQGLNLKVLEEEVRNDPQVTAVLIAAANSAALHREAPVQTLLQALNKL
FT                   GSTQSMNLILGMTLKRSARLSDPLLAEHAARYWDLSLHTAEYGRTLARLLELDEGRCYC
FT                   AGLLHCLGDLAVLRCLQEWRLAGGELDERNVQQSLDEFGAAFGSALRTRWRLPLALREL
FT                   IAAIYQLGGGVYSREILAMSLAGQLSRLPAEQGLEKVASGKTARLLKLGLPELNRLRKV
FT                   ENPEVKPQEEPPV"
FT   gene            complement(280197..281225)
FT                   /locus_tag="PputGB1_0240"
FT   CDS_pept        complement(280197..281225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0240"
FT                   /product="diguanylate cyclase with PAS/PAC sensor"
FT                   /note="KEGG: pen:PSEEN0195 sensory box protein; TIGRFAM:
FT                   PAS sensor protein; diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; PAS fold-3 domain protein; SMART: PAS
FT                   domain containing protein; PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96153"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B0KH34"
FT                   /protein_id="ABY96153.1"
FT                   /translation="MLAARFHVETRFVHMAKNIPTTLPGTPPPEAAQTLLALLHAQGEV
FT                   ARLSERDQLFSSLLDSVNAVLWAFDWETRQVLYVSPAYERIFGRPVSLVLADYNEWRDS
FT                   IYPDDLEFAERSLAQVLLKGAVEDREYRILNADGQLRWLSDKCYINQQHDGDRVIIVGI
FT                   AEDITEKKQLEGELQRLATTDVLTQSSNRRHFFECAQQAFDSAREDGTPLAFLLLDIDD
FT                   FKRINDSYGHQEGDQVLQHIADSGKAVLRRGDLFGRIGGEEFAAVFPGCNAEVAEQIAE
FT                   RLQRQIQRLSFSHGQQTYGVTVSQGLTGLTEEDVTLDSLYARADAAMYQAKRQGKNQIV
FT                   RG"
FT   gene            complement(281325..282509)
FT                   /locus_tag="PputGB1_0241"
FT   CDS_pept        complement(281325..282509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0241"
FT                   /product="fatty acid desaturase"
FT                   /note="PFAM: fatty acid desaturase; KEGG: pen:PSEEN0196
FT                   fatty acid desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96154"
FT                   /db_xref="GOA:B0KH35"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR015876"
FT                   /db_xref="UniProtKB/TrEMBL:B0KH35"
FT                   /protein_id="ABY96154.1"
FT                   /translation="MWYNGLLDLSAWQLVGITLLMTHVTIVSVTVYLHRYSAHRALELN
FT                   GALKHFFRFWLWLTTAQNTREWTAVHRKHHAKCETPDDPHSPVHKGLSTVLRKGAELYR
FT                   EEARNPETLRIYGKNCPEDWIERNLYSRYKLGGIALMAVIDLLLFGTIGITIWAVQMMW
FT                   IPFWAAGVVNGLGHALGYRNFECRDAATNLVPWGIVIGGEELHNNHHTYPNSAKLSVKR
FT                   WEFDMGWAWIRLFCLLRLAKVQRVAPIAHRVAGKANLDMDTAMAILNNRFQIMAQYRKL
FT                   VIGPLVKQELARVDTSVRHRFRRAKRLLSRETSLLEDRHHVRIESMLAHSQALKTIYEK
FT                   RLALQQIWARTSANGHDMLAAMKDWVHEAESSGIHALRDFAAQLKTYSLRPTGA"
FT   gene            282750..284645
FT                   /locus_tag="PputGB1_0242"
FT   CDS_pept        282750..284645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0242"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="KEGG: pen:PSEEN0197 sensory box protein; TIGRFAM:
FT                   PAS sensor protein; diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; PAS fold-3 domain
FT                   protein; PAS fold-4 domain protein; PAS fold domain
FT                   protein; SMART: PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96155"
FT                   /db_xref="GOA:B0KH36"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B0KH36"
FT                   /protein_id="ABY96155.1"
FT                   /translation="MSVSVRDALRMAALYVVLSILWLALAEVMLHGMTDDPLALTVGRQ
FT                   INIVLWVLFSAVLIYVSRVRLLNFIGAGARLRCEDRERLRMAAAVFDSTLEGVLVTDRQ
FT                   GLIVHVNRAFMRITGYQQDEVMGQRPSKFKSGRHGLAFYQQIFATLAEQGEWSGEIWNR
FT                   RKSGEIYPQWQTICAIRDDDGELSHYVAVFSDISAIKHTEQELAYLAHHDPLTGLPNRL
FT                   LFTDRVEQALAAAQANKRGCALLLLDLDHFQSINDGLGHTIGDQLLKRVGERLGEVLGS
FT                   GVTLARLGGDEFAVLAENCQQVGQAGKLAQCIIERMREPFLCEENRLFISASVGISLFP
FT                   SDALGAEQLLRNADAALYKAKSNGRACYALYTEELTAHAQHRVETAGELRRALEQDELR
FT                   VYFQPVHDLATGRQVGVETLVRWQHPQRGLVPPGEFIPIAERTGLIAEIDTWVLRQACR
FT                   QMVQWQAEGRQLAFVAVNISSRLFGQHELYRQVAAVLHETGLPPALLELEVTESAVMED
FT                   PEVALEQLHRLRELGVTLAIDDFGTGYSSLLRLKRLPVQKLKIDQGFVAGLPLDEDDIA
FT                   IVRVIIALARSMGMQVHAEGIEQAEQASFLLQEQCQLGQGYWFGRPVPAGDLRWD"
FT   gene            complement(284762..285406)
FT                   /locus_tag="PputGB1_0243"
FT   CDS_pept        complement(284762..285406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0243"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: pen:PSEEN0198 D-methionine
FT                   ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96156"
FT                   /db_xref="GOA:B0KH37"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B0KH37"
FT                   /protein_id="ABY96156.1"
FT                   /translation="MWFDRLLEGLLDTLLMVGVSSLIALLVGVPMAVLLVTSDKGGIFE
FT                   APLLNRVLGAFVNLFRSIPFLILMVALIPFTRLVVGTTYGVWAAVVPLTIAATPFFARI
FT                   AEVSLREVDHGLVEAAQAMGCRRWHIVWHVLLPEALPGIVGGFTITLVTLINSSAMAGA
FT                   IGAGGLGDIAYRYGYQRFDSQIMLTVIALLVALVALIQLGGDRLAKGLNKR"
FT   gene            complement(285396..286505)
FT                   /locus_tag="PputGB1_0244"
FT   CDS_pept        complement(285396..286505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0244"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pen:PSEEN0199 D-methionine ABC transporter MetN,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96157"
FT                   /db_xref="GOA:B0KH38"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/TrEMBL:B0KH38"
FT                   /protein_id="ABY96157.1"
FT                   /translation="MSQASALRAPTPQPLPPTVKEQALRPEVNEAHVRFIGLGKTYPGQ
FT                   AQPALQGIDLNIRHGEIFGIIGRSGAGKSSLLRTINRLEQPSQGRILIDQVDIAPFDED
FT                   RLVALRRRIGMIFQHFNLMSAKTVWQNVELPLKVAGVAKAERQHKVRELLELVGLQEKH
FT                   HVYPAQLSGGQKQRVGIARALVHDPEILLCDEATSALDPETTASILELLRDINQRLGLT
FT                   IVLITHEMAVIRDICHRVVVLERGEVVEQGEVWRVFGSPRHEVTRTLLAPLQARLPAAL
FT                   QASLQASPASHDSAVVLKLTVLGEPELSALFQDLGGRVRLLQGGVETIGEHALGQLILS
FT                   VQHSPHDTHQLLERARRWAEDVEVLGHVV"
FT   gene            complement(286507..287307)
FT                   /locus_tag="PputGB1_0245"
FT   CDS_pept        complement(286507..287307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0245"
FT                   /product="NLPA lipoprotein"
FT                   /note="PFAM: NLPA lipoprotein; KEGG: pen:PSEEN0200
FT                   D-methionine-binding periplasmic lipoprotein MetQ"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96158"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:B0KH39"
FT                   /protein_id="ABY96158.1"
FT                   /translation="MLEKLFRPVAAIAFTLGLSASALAAEPLKIGTTSAFAIPLEAAVE
FT                   EAHKQGLEVKLIEFSDWIAPNVSLNSGDIDVNYFQHIPFLENAKAAAGFNLVPYASGII
FT                   NNVGLYSKTYKSFADLPEGASVAIANDPINSGRGLQLLAKAGLITLKPGVGYKATEDDI
FT                   VTNPKKLKILQVEAVQLVRAYDDADLVQGYPAYIRLANTFDATSALLFDGLENKEYVIQ
FT                   FVIRPQSKDDPRLAKFVDIYQHSPVVRAALDKAHGKLYQAGWEG"
FT   sig_peptide     complement(287233..287307)
FT                   /locus_tag="PputGB1_0245"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 25"
FT   gene            complement(287300..288691)
FT                   /locus_tag="PputGB1_0246"
FT   CDS_pept        complement(287300..288691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0246"
FT                   /product="monooxygenase"
FT                   /note="KEGG: pen:PSEEN0201 monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96159"
FT                   /db_xref="GOA:B0KH40"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B0KH40"
FT                   /protein_id="ABY96159.1"
FT                   /translation="MAKQILLNAFNMNCIGHINHGLWTHPRDTSTQYKTLDYWTHLARL
FT                   LERGLFDGLFIADIVGTYDIYGQSLDVPLKESIQLPVNDPLLLVSAMAAVTRHLGFGLT
FT                   ANLTYEAPYLFARRLSTLDHLSNGRIGWNIVTGYLDSAARAMGLEQQPEHDRRYDQADE
FT                   YLQVLYKLLEGSWADDAVVADRTQRVYAQPDKVRKVSHHGEFYNVEGYHLCEPSPQRTP
FT                   VLFQAGSSPRGLAFAGNHAECVFISGQDKAATRAQVDKVRAAAQAAGRDPQAVKVFMGI
FT                   TVIVAATEQAAQAKHAEYLRHASPEAGVAHFAASTGIDFAAYALDEPIAFNQGNAIQSA
FT                   TRQLQDNAWTRRRLLEQHALGGRYVTLVGAPEQVAEQLIAWVDETGLDGFNLTRTVTPE
FT                   SFEDFIDLVVPQLQQRGRYKTAYAEGTLREKLFQADHPHLPVSHPGSAYRFTPTPAPTG
FT                   ALHHA"
FT   gene            complement(288691..289872)
FT                   /locus_tag="PputGB1_0247"
FT   CDS_pept        complement(288691..289872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0247"
FT                   /product="Acyl-CoA dehydrogenase type 2 domain"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: pen:PSEEN0202
FT                   acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96160"
FT                   /db_xref="GOA:B0KH41"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR023922"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B0KH41"
FT                   /protein_id="ABY96160.1"
FT                   /translation="MTTNIITSDTEALNVAEDIAQQLRRDSALRDRERRLPHAELELFT
FT                   RSGLWAISVPKAFGGAGVSNVTLAKVIARIAQADGSLGQIPQNHFYGLEVLRVNGTPEQ
FT                   QQRLYAEVLAGRRFGNALAELGTKTANERTTRLSRDGDGFRINGRKFYSTGAIYAQRIP
FT                   TSVVDDQGVQQLAFVPADSQGLQVIDDWSGFGQRTTGSGSVVFDNVYVSAADVVPFQSA
FT                   FERPTPVGPLAQILHAAIDTGIARAAYEDALHFVRTRSRPWVDSGLDKATDDPLTLKSF
FT                   GHLAIRLHAAEALLERAGEYLDRARDDSTADNVAAASIAVAEARAISTEISLAAGTALF
FT                   ELGGSQATLAEHNLDRHWRNARVHTLHDPVRWKYHAIGNYYLNDANPPRRGTI"
FT   gene            complement(290026..291267)
FT                   /locus_tag="PputGB1_0248"
FT   CDS_pept        complement(290026..291267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0248"
FT                   /product="Acyl-CoA dehydrogenase type 2 domain"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: pen:PSEEN0203
FT                   acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96161"
FT                   /db_xref="GOA:B0KH42"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR023922"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B0KH42"
FT                   /protein_id="ABY96161.1"
FT                   /translation="MSSQPNTQFHSDLDSSPLLLPAKVLRNDAEALQAARELAEVAREQ
FT                   AARRDQQRKLPWAEIELFTRSGLGSISVPKAHGGPDVSFETVAEVFRVISAADPALGQI
FT                   PQNQFGMLQLIRLTATEAQQALIFRSVLDGWRIGNAGPERGTKDTLTLKARITRAGDSY
FT                   RISGEKFYSTGALFAHWVAVKALDDEGRQRLAFVRRGSPGLRIVDDWSGFGQRTTASGT
FT                   VLLDQVPVDAELVIDNWRQRDIPNIQGAASQLIQAAIDAGIAEAAIDDAITFVREKSRP
FT                   WIEANVDRASDDPYVIADIGRLKLELHAAEALLRKAARVLDEVNAAPVDAASAARASIA
FT                   VAEAKVLTTEVALQASEKLFELAGSRATLAEFNLDRHWRNARVHTLHDPVRWKYHAVGA
FT                   YHLNGTLPARHSWI"
FT   gene            complement(291532..292290)
FT                   /locus_tag="PputGB1_0249"
FT   CDS_pept        complement(291532..292290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0249"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pen:PSEEN0205 amino acid ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96162"
FT                   /db_xref="GOA:B0KH43"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:B0KH43"
FT                   /protein_id="ABY96162.1"
FT                   /translation="MIEVKGLTKRFKGQTVLNGIDLTVQPGEVVAIIGPSGSGKTTFLR
FT                   CLNLLETPDAGQIQIGAISIDANRPLGGQQGAIRRLRQQAGFVFQNFNLFPHRTALENV
FT                   IEGPVIVKKTPREQAIELGRRLLAKVGLAGKEDAYPRRLSGGQQQRVAIARALAMEPEV
FT                   ILFDEPTSALDPELVGEVLATIRGLAEEKRTMIIVTHEMSFARDVANRVIFFDKGVIVE
FT                   QGEAKALFAAPKEERTRQFLRKFLGTAASE"
FT   gene            complement(292293..292961)
FT                   /locus_tag="PputGB1_0250"
FT   CDS_pept        complement(292293..292961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0250"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: pen:PSEEN0206 amino
FT                   acid ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96163"
FT                   /db_xref="GOA:B0KH44"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B0KH44"
FT                   /protein_id="ABY96163.1"
FT                   /translation="MIAESLQLVVDSTPFLLKGAGYTVLLSVGGMFFGLLLGFALALMR
FT                   LSKILPLNWLARVYVSFFRGTPLLVQLFVIYFGMPQIGIELDPIPASLIGLSLNMAAYI
FT                   CEILRAAISSIDRGQWEAAASIGMTRVQAMRRAILPQALRTALPPLGNSFISLVKDTAL
FT                   AATIQVPELFRQAQLITARTFEVFTMYVAVAVIYWVLCSILAHFQNRMEARVNQHDQEQ
FT                   "
FT   gene            complement(292958..293752)
FT                   /locus_tag="PputGB1_0251"
FT   CDS_pept        complement(292958..293752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0251"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   SMART: ionotropic glutamate receptor; KEGG: pen:PSEEN0207
FT                   amino acid ABC transporter, periplasmic amino acid-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96164"
FT                   /db_xref="GOA:B0KH45"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:B0KH45"
FT                   /protein_id="ABY96164.1"
FT                   /translation="MSKFAKPLLNASLALLLGAGLLGQAFAGEQLKTIQEKGVINVGLE
FT                   GTYPPFSFQDENGKLAGFEVELSELLAKELGVKAKIQPTKWDGILAALESKRLDVVVNQ
FT                   VTISEERKKKYDFSEPYTVSGIQALILKKKAEQLNIKSAQDLAGKKVGVGLGTNYEQWV
FT                   KQDVPKAEVRTYEDDPSKFADLRNGRIDAILIDRLAALEYAQKAKDTELAGDAFSRLES
FT                   GVALRKGEPELLAAINKAIDKLKADGTLAKLSEKYFGADVTK"
FT   sig_peptide     complement(293669..293752)
FT                   /locus_tag="PputGB1_0251"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 28"
FT   gene            294061..294993
FT                   /locus_tag="PputGB1_0252"
FT   CDS_pept        294061..294993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0252"
FT                   /product="Serine O-acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /note="KEGG: pen:PSEEN0208 serine O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96165"
FT                   /db_xref="GOA:B0KH46"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:B0KH46"
FT                   /protein_id="ABY96165.1"
FT                   /translation="MSEQPSSAHWQLQNIVTGLRGAREQWRTRNGRSIGEQGGRELPSR
FT                   EAMRQILEQLCGALFPMRLGPVDLREESEDFYVGHTLDAALTALLAQARLELRYAARQS
FT                   KAELAGVDAHALSLIQGFAAALPELRVLLDTDVLAAYHGDPAARSVDEVLLCYPGILAI
FT                   IHHRLAHHLYQAGLPLLARISSELAHSATGIDIHPGAQIGPSFFIDHGTGVVIGETAII
FT                   GERVRIYQAVTLGAKRFPSDESGTLHKGLPRHPIVEDDVVIYAGATVLGRITIGKGSTI
FT                   GGNVWLTRSVPAESNITQANLQLDCQDKN"
FT   gene            295222..297225
FT                   /locus_tag="PputGB1_0253"
FT   CDS_pept        295222..297225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0253"
FT                   /product="choline/carnitine/betaine transporter"
FT                   /note="TIGRFAM: choline/carnitine/betaine transporter;
FT                   PFAM: BCCT transporter; KEGG: pen:PSEEN0209 choline/glycine
FT                   betaine transporter, BCCT family"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96166"
FT                   /db_xref="GOA:B0KH47"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="UniProtKB/TrEMBL:B0KH47"
FT                   /protein_id="ABY96166.1"
FT                   /translation="MSAPNPSLANGKIRMNPPVFYFAASFILIFGLVVISNPQAAGDWL
FT                   LAAQNWAANTVGWYYMLAMTLYLVFVVVTALSGYGKIKLGADHDEPEFSYLSWAGMLFA
FT                   AGISITLFFFCVSEPLTHMLQPPQGEAGTAEAGRQAMQILFLHWGLHGWGVFAFVGMAL
FT                   AYFAYRHNLPLALRSALYPLIGKRINGPIGYAVDGFGIIATVFGLGADMGFGVLHLNAG
FT                   LDYLFGISHSQWVQVILITLMMGAAVAVAVAGVEKGVRVMSDINLFLACALLLFVLFAG
FT                   PTQHLFNTLIQNLGDYLGALPRKSFDVYAYGENRDWLGGWTVFYWAWWIAWAPFVGLFI
FT                   ARISRGRTIREFVFGVLLIPLGFTLAWMSIFGNSALDQVINHGMTALGQSALDNPSMSL
FT                   YLLLETYPWSKAVIATTVFISFVFFVTSADSGTVVLSTLSAKGGEADEDGPNWLRIFWG
FT                   AMTALITSALLFAGSIDSLKSAVVLTSLPFSLILLCMMWGLHKAFYLESQRQIAQMHSL
FT                   APFAQSRRGRGGWRQRLSQAVHFPSRDEVYRFMDDVVRPAIADVREVFEQKGLVLITQD
FT                   DPSHDNVSLKIGHGEEQPFIYQVQMRGYFTPSFALGGLGTQELKNRRYYRAEVHLSEGS
FT                   QNYDLVGYSKEQIINDILDQYERHMQYLHLVR"
FT   sig_peptide     295222..295344
FT                   /locus_tag="PputGB1_0253"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.832) with cleavage site probability 0.640 at
FT                   residue 41"
FT   gene            complement(297352..298185)
FT                   /locus_tag="PputGB1_0254"
FT   CDS_pept        complement(297352..298185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0254"
FT                   /product="Taurine dioxygenase"
FT                   /EC_number="1.14.11.17"
FT                   /note="PFAM: Taurine catabolism dioxygenase TauD/TfdA;
FT                   KEGG: pen:PSEEN0210 taurine dioxygenase,
FT                   2-oxoglutarate-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96167"
FT                   /db_xref="GOA:B0KH48"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR006189"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:B0KH48"
FT                   /protein_id="ABY96167.1"
FT                   /translation="MSLTITPLSPALGAQISGVDISRDISAQARDAIEQALLQHQVLFF
FT                   RNQPINPEQQARFAARFGDLHIHPIYPNVPETPQVLVLDTAVTDVRDNAVWHTDVTFLP
FT                   TPALGAVLSAKQLPAYGGDTLWASGIAAFEALSVPLREMLDGLTATHDFTKSFPLERFG
FT                   TTPEDLARWEATRRNNPPLSHPVVRTHPVSGRKALFVNEGFTTRINELSELESDALLRL
FT                   LFAHATRPEFSIRWRWQENDVAFWDNRVTQHFAVDDYRPNRRVMHRATILGDAPF"
FT   gene            complement(298234..299073)
FT                   /locus_tag="PputGB1_0255"
FT   CDS_pept        complement(298234..299073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0255"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: pen:PSEEN0211 taurine ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96168"
FT                   /db_xref="GOA:B0KH49"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B0KH49"
FT                   /protein_id="ABY96168.1"
FT                   /translation="MSSLDLPVAGKHDTQARPAAKLRRPLSTRWISTLTLTSLLLAWWL
FT                   VTAAGWIEPLFLPSPGDILARAWTLLTQGYMDASLWQHLGASLGRIGLALLAATLTAIP
FT                   VGIAIGYNRVARGILDPLIEFYRPIPPLAYLPLIVIWCGIGELSKVLLIYLAIFAPIAI
FT                   ATATGVRTVDPAKLRAAQSLGATKAQLIRHVILPSALPDILTGIRIGLGVGWSTLVAAE
FT                   LIAATSGLGFMVQSAAQFLVTDVVVLGILLIALIAFALEMSLRALQRKLVPWHGQSH"
FT   gene            complement(299070..299858)
FT                   /locus_tag="PputGB1_0256"
FT   CDS_pept        complement(299070..299858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0256"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pen:PSEEN0212 taurine ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96169"
FT                   /db_xref="GOA:B0KH50"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015859"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0KH50"
FT                   /protein_id="ABY96169.1"
FT                   /translation="MALLELERISAQYPGASTPVLADINLSLGPRQLLVALGPSGSGKT
FT                   SLLNLIAGFVAPSGGRITLDGLPVQGPGAERGVVFQDDALLPWQNVLGNVAFGLELAGV
FT                   PRAQREAKAREMLALVDLAGFGERRIWQLSGGQKQRVGLARALAADPRVLLMDEPFGAL
FT                   DAFTREQMQELLLQVWQRTAKPVFLITHDIEEAVFLASELVLLAPNPGRVVERLQLDFG
FT                   QRYAAGESARAIKSDPAFIETREHVLARVFSQRQSLQEPA"
FT   gene            complement(299872..300843)
FT                   /locus_tag="PputGB1_0257"
FT   CDS_pept        complement(299872..300843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0257"
FT                   /product="taurine ABC transporter, periplasmic binding
FT                   protein"
FT                   /note="KEGG: pen:PSEEN0213 taurine ABC transporter,
FT                   periplasmic taurine-binding protein; TIGRFAM: taurine ABC
FT                   transporter, periplasmic binding protein; PFAM:
FT                   Substrate-binding region of ABC-type glycine betaine
FT                   transport system; NMT1/THI5 like domain protein; SMART:
FT                   extracellular solute-binding protein family 3"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96170"
FT                   /db_xref="GOA:B0KH51"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010068"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:B0KH51"
FT                   /protein_id="ABY96170.1"
FT                   /translation="MIPHAPLRLFAALTLASTSWLAQAADLTVAYQTTVDPAKVAQVDG
FT                   DYEKASKASIDWRKFDNGADVITAVASGDVQIGYLGSSPLAAAATRKLPVETFLIATQI
FT                   GAGEALVARDSIKTPQDLVGKKVAVPFVSTGHYSLLAALKSWNIDASKVQILNLAPPAI
FT                   IAAWKRGDIDATYVWDPALGVAKENGKVLITSGELAQKGAPTFDAWIVRKDFAEKHPDV
FT                   VKAFAKVTLDAYADYRKDPKAWLADKANVDKLVKLSGAKASDIPVLLEGNVYPLAADQA
FT                   NALGAPTTQALTDTANFLKQQGKVEAVLPDYSPYVSAKFLPN"
FT   sig_peptide     complement(300769..300843)
FT                   /locus_tag="PputGB1_0257"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            301352..302680
FT                   /locus_tag="PputGB1_0258"
FT   CDS_pept        301352..302680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0258"
FT                   /product="outer membrane porin"
FT                   /note="PFAM: outer membrane porin; KEGG: pen:PSEEN0214
FT                   outer membrane porin OprE"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96171"
FT                   /db_xref="GOA:B0KH52"
FT                   /db_xref="InterPro:IPR005318"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:B0KH52"
FT                   /protein_id="ABY96171.1"
FT                   /translation="MYKSSLALAVALGVLAQQAGAAGFVEDSKLSLSSRTMYFNNDNRD
FT                   GGADNRESGQGFKLDYISGFTEGTVGFGVDAQALWGIHLDGGRGKHPDNSSFFPSDTDG
FT                   SAVSQWARVGANAKARFSKTEVHFGSALAPNLPILVSNDGRLLPQTFEGGTIQSKEIDN
FT                   LTINAGQLTHAMGRASSNRTGLSVNGGTQDSNKFRYGGLDYKLTKDLTLQYYYSNLEDY
FT                   YKQHFLGLTHVFQIDQDQSFKTDLRYFDSSSDGKNGEAGYRFNNNGGYAKNTGEVDNKT
FT                   WSAMFTYTLGGHSLMLGHQRVNDDGGFVWLNQGSVVDGNGRNEGAGGSSFYLFTDSMIN
FT                   QFAKAGENTTFGQYAYDFARLGVPGLKASVAYLKGEDGKNAVGGGTFSEWERDARVDYV
FT                   IQEGTFKGLGASLRHGVYRGTGTSSLADQDQTRLIFNYTYNFL"
FT   sig_peptide     301352..301417
FT                   /locus_tag="PputGB1_0258"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.976 at
FT                   residue 22"
FT   gene            302846..303484
FT                   /locus_tag="PputGB1_0259"
FT   CDS_pept        302846..303484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0259"
FT                   /product="Peroxidase"
FT                   /EC_number="1.11.1.7"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   pen:PSEEN0215 thiol-specific antioxidant protein LsfA"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96172"
FT                   /db_xref="GOA:B0KH53"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B0KH53"
FT                   /protein_id="ABY96172.1"
FT                   /translation="MSLKLGDIAPDFEQDSSEGKIRFHEWLGNSWGVLFSHPADFTPVC
FT                   TTELGLTAKLKDDFAKRGVKAIALSVDPVDSHHRWIEDINETQNTVVNFPIIADADRKV
FT                   SDLYDLIHPNASDTLTVRSLFVIDPNKKVRLTITYPASTGRNFNEILRVIDSLQLTDNH
FT                   KVATPGNWQDGDEVVIVPSLKDEEEIKQRFPKGYRAVKPYLRLTPQPNR"
FT   gene            303793..304386
FT                   /locus_tag="PputGB1_0260"
FT   CDS_pept        303793..304386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0260"
FT                   /product="FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   pen:PSEEN0217 NAD(P)H-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96173"
FT                   /db_xref="GOA:B0KH54"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR020048"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B0KH54"
FT                   /protein_id="ABY96173.1"
FT                   /translation="MLVVSIGGSPSSRSRSGVLLERSRQWLQNRGVEVVTFQVRDFPAE
FT                   DLLHARFDSPQVQHFQQLVAQADGLIVSTPVYKASFAGALKTLLDLLPERALAHKIVLP
FT                   IATGGSIAHMLAVDYALKPVLSALKAQETLQGIFADDSQVAYAEGARPAQLVPALEERL
FT                   HDSLETFHVALARRPRPVAPGVLNERLISARWSI"
FT   gene            304472..305437
FT                   /locus_tag="PputGB1_0261"
FT   CDS_pept        304472..305437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0261"
FT                   /product="aliphatic sulfonates family ABC transporter,
FT                   periplsmic ligand-binding protein"
FT                   /note="KEGG: pen:PSEEN0218 sulfonate ABC transporter,
FT                   periplasmic sulfonate-binding protein SsuA; TIGRFAM:
FT                   aliphatic sulfonates family ABC transporter, periplsmic
FT                   ligand-binding protein; PFAM: Substrate-binding region of
FT                   ABC-type glycine betaine transport system; SMART:
FT                   extracellular solute-binding protein family 3"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96174"
FT                   /db_xref="GOA:B0KH55"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010067"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:B0KH55"
FT                   /protein_id="ABY96174.1"
FT                   /translation="MRTVFLRRGLVALFAAAVSFGAITQAQAESLRIGYQKYGTLVLLK
FT                   AKGTLEKRLAEQGVQVQWTEFPGGPQLLEGLNVGSIDFGVTGETPPVFAQAAGADLLYV
FT                   AYEPPAPHSEAILVPKGSPIQSVKDLKGKKVVLNKGSNVHYLLVRALEDAGLKYSDIQP
FT                   VYLPPADARAAFERGSVDAWVIWDPYQAAAEQQLQARTLRDGKGLVDNHQFYLATRNYA
FT                   TQHPAVINTVIEEVRAVGEWSQANPQEVTDQVAPLLGLPADITLTSVKRQGYGAAPLTP
FT                   EVVAAQQKIADTFQALKLIPKPLSIKDVIWTPPAKVASAP"
FT   sig_peptide     304472..304558
FT                   /locus_tag="PputGB1_0261"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.874 at
FT                   residue 29"
FT   gene            305498..306646
FT                   /locus_tag="PputGB1_0262"
FT   CDS_pept        305498..306646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0262"
FT                   /product="Alkanesulfonate monooxygenase"
FT                   /EC_number="1.14.14.5"
FT                   /note="PFAM: luciferase family protein; KEGG: pen:PSEEN0219
FT                   FMNH(2)-dependent alkanesulfonate monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96175"
FT                   /db_xref="GOA:B0KH56"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019911"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KH56"
FT                   /protein_id="ABY96175.1"
FT                   /translation="MSLNIFWFLPTHGDGKYLGTSDGARAVDHGYLQQIAQAADRLGFG
FT                   GVLIPTGRSCEDSWLVAASLIPVTQRLKFLVALRPGIISPTVAARQAATLDRLSNGRAL
FT                   FNLVTGGDPDELAGDGLHLNHQERYEASVEFTRIWRKVLEGENVDYDGKHIQVKGAKLL
FT                   YPPIQQPRPPLYFGGSSEAAQDLAAEQVELYLTWGEPPSAVAEKIAQVREKAAAQGREV
FT                   RFGIRLHVIVRETNEEAWAAADRLISHLDDDTISRAQASLARFDSVGQQRMAALHGGNR
FT                   DNLEVSPNLWAGVGLVRGGAGTALVGDGPTVAARVKEYAELGIDTFIFSGYPHLEESYR
FT                   VAELLFPHLDVQRPEQPKTGGYVSPFGEMVANDILPKSVSQS"
FT   gene            306657..307454
FT                   /locus_tag="PputGB1_0263"
FT   CDS_pept        306657..307454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0263"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: pen:PSEEN0220 sulfonate ABC
FT                   transporter, permease protein SsuC"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96176"
FT                   /db_xref="GOA:B0KHZ0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B0KHZ0"
FT                   /protein_id="ABY96176.1"
FT                   /translation="MSRATSSNLAQRLAPWALPVLLLAAWQLAVSAGWLSTRILPAPSA
FT                   VVSAGVELVRSGEIWTHLAISGWRAGLGFVIGGSIGLVLGFITGLSNWGERLLDSSVQM
FT                   IRNVPHLALIPLVILWFGIDESAKIFLVALGTLFPIYLNTYHGIRNVDPALVEMARSYG
FT                   LSGFGLFRQVILPGALPSILVGVRFALGFMWLTLIVAETISANAGIGYLAMNAREFLQT
FT                   DVVVLAIVLYAVLGKLADLAARGLERVWLRWHPAYQVAKKEGA"
FT   sig_peptide     306657..306755
FT                   /locus_tag="PputGB1_0263"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.974) with cleavage site probability 0.801 at
FT                   residue 33"
FT   gene            307451..308263
FT                   /locus_tag="PputGB1_0264"
FT   CDS_pept        307451..308263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0264"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pen:PSEEN0221 sulfonate ABC transporter, ATP-binding
FT                   subunit SsuB"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96177"
FT                   /db_xref="GOA:B0KHZ1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017875"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0KHZ1"
FT                   /protein_id="ABY96177.1"
FT                   /translation="MTVLKEQPPRLLRGIPLASNGLRKTFGQREVLKGIDLHIPAGQFV
FT                   AIVGRSGCGKSTLLRLLAGLDQPTAGQLLAGAAPLEEAREETRLMFQDARLLPWKKVID
FT                   NVGLGLSGDWRPRALDALEAVGLADRANEWPAALSGGQKQRVALARALIHQPRLLLLDE
FT                   PLGALDALTRIEMQQLIERLWRQHGFTVLLVTHDVSEAVAVADRVILIEDGEVGLDLTV
FT                   DLARPRARGSHRLAALESEVLNRVLSAPGTAPEPDPVAPLPTQLRWAH"
FT   gene            308308..308523
FT                   /locus_tag="PputGB1_0265"
FT   CDS_pept        308308..308523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0265"
FT                   /product="TOBE domain protein"
FT                   /note="PFAM: TOBE domain protein; KEGG: pen:PSEEN0222
FT                   organosulfonate utilization protein SsuF"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96178"
FT                   /db_xref="GOA:B0KHZ2"
FT                   /db_xref="InterPro:IPR004606"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="UniProtKB/TrEMBL:B0KHZ2"
FT                   /protein_id="ABY96178.1"
FT                   /translation="MTIKAINVRNQFKGTVKEILEGPVLSEIDVQTASGIVTSVITTRS
FT                   VKELELQVGSEVIAFVKSTEVSIAKL"
FT   gene            complement(308570..314062)
FT                   /locus_tag="PputGB1_0266"
FT   CDS_pept        complement(308570..314062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0266"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pfo:Pfl_4544 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96179"
FT                   /db_xref="UniProtKB/TrEMBL:B0KHZ3"
FT                   /protein_id="ABY96179.1"
FT                   /translation="MPTASSSQTDYVKALPLTDTDTFDRQLAGRGNMLEAARPAQRRAA
FT                   TALRNLLNGAPTVKQTLQATLHAHLGIDPYTCGLQDGDSQVTLMTFAARLLASPLFATA
FT                   YTTWTTWGLDDSQAQTKWAGSDWLSELGPVVNAAHFQATHDYWNGRMPGTTLSRQKHAS
FT                   NLLRQHFKSNLDMAFGTGKLDIDNWQQGHQPDLQYAQLDCQLPNGASLTSTAALLIAPQ
FT                   PKGSRWLMYRPGAQIPLLTFDNQQSLRNWVHQNHFWFWSDPRYSITTGSNENVIVSPIA
FT                   NDGFSVLLDEHLLRIQAISDHFLFKASKEPATQPLAWSDLQDWEAQRGSIISDSLDATT
FT                   DNTIDDLIAADAALANEELHFDSLEQYLPTSWRRQRIERQEALLEQYLGDDTEPSSVEV
FT                   TWLREQLEQLVKLQDSLNLFLLELPDQVAADDWQAPHEEQTRIARISHELSQGLLLEAR
FT                   LQHAMGELSATHLGWVEALVDRPRPSLQRPVQASTLMLGTGDRSWALSGYMTFRAAVGD
FT                   TDDTLDYSLLLYRPGQQGGLMAFEDEATLTRHLLATLCGAWPDAILDSVHAADAVQLLE
FT                   ALSNAPAVTLDQTPIPAHFMQHCVQTIVESLPANTSREQARQRLCMSENQARAIALERF
FT                   AELNRSSRVQTLLMPLQHLGADELTELIAQVSAYQDAVRAAGELLKVSLPSRQQFTWHM
FT                   LEHHVCNEFGLQTMPNITLNIANSVTVKKQVTGQSAAGGAGSRDVPVFSEARSDVSLES
FT                   FILVALDDERRLLLDNAIITLDPATHPTLQQALTPAYIAELITRLDAAGSYENRIVNAY
FT                   LGFEQETPWQVEWRHETLRAPYAYRLRLLALCKPASLDADGQRLLETFCREQVNAVSAR
FT                   TVQYLSLVLRPGTAADGSSDSVGLSAIHVITDANGPVLLYMPGAPNGSVVSQHASTSAA
FT                   CEALQRMALDPKMARYLATQAQSGNPDHHESYINTALQQGFRVFIEMGASRSETLPTHE
FT                   CRQDMGDLIRSHRATSRSQADMVLAAPDVFDRYFFLGLRLVLGLLPGAGTALALYDGWH
FT                   TANAAITAFAKGNLETGIQHLVSLLQSLTDAILTLAPLAASQRNPATAARLLTQRRQRL
FT                   DPLRPITSTRKAPPSPFTGYEAGLPAGPMVRSTLPQGAGVFEHVATGQRYISRNNAWYA
FT                   VTWDPAYFTWRLKPQGLRTYRQPVRLSEQGVWGTPGRLSGLLVDNGLAGGGGVLTTLYE
FT                   NGVAYWRVLLRRQPQQLTGMALAHDINDELKRIVIRMRAKQEAYHSAKRVVAEGGALSD
FT                   AQQAVIANARQQLSDELMQNIEFNARSLARLKEQRSTLSRSDYTRFTSLCEANISEMSV
FT                   LDMHLVADRFTLATQQSMRATSAIQALPLPSVPTHVVRRVTQDSLRANQEMIETLQEVE
FT                   RLAIGHHARCNQLQGKALTDYLAKVTGTGLTLDVANTRLVRASILSSTLFTANAVEHPQ
FT                   MAAFMAHFNEQGAALRSTLFSHLQLQRAGLSRAQERTFLASVQGRYTRFIGHVTAWQDT
FT                   FQDLLSTNETRSLRQLMRQLVSDIEDSLNSVTANRQRPAVQPARGPSRPRLFETAEGPL
FT                   IGNEYVERGQTRMRINHPNSDQPHTVYARNEAGEWLLSTPERAAPTETMSSLVETATAR
FT                   LDDIPRQQTRLRQYQTPQAVPVDLEDIAQGHAQQLRFIADRIRQKAGGTLNPEQTALTH
FT                   RLETTAQQVQAFGRQLRTAQTKATGKPTVGYLEDLLEQNEVEIVWSRTLKPKTDRKGNP
FT                   VEYLEEYRINDLGTQQPLWYAHFHFRQQPAQGFTRLEAGHLKLASERDIGEGAWRGSMS
FT                   EAQANRLFGNLRPAS"
FT   gene            complement(314148..314783)
FT                   /locus_tag="PputGB1_0267"
FT   CDS_pept        complement(314148..314783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0267"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: pen:PSEEN0223
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96180"
FT                   /db_xref="GOA:B0KHZ4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041674"
FT                   /db_xref="UniProtKB/TrEMBL:B0KHZ4"
FT                   /protein_id="ABY96180.1"
FT                   /translation="MNRTATPRKPRASSQARIEAILAAARELLAEQGVAALSIYSVAER
FT                   AQIPPSSVYHFFASVPALLEALTADVHRAFREALSAPIDSLAFTTWHQLSRLIEQRMLA
FT                   IYNEDAAARQLILAQHGLSEVVQADRQHDMELGELMHSLFDRHFQLPAMPGDVDVFALA
FT                   MELSDRVYARSMQLFEQITPRMAEEGMRVFEAYLSLYLPPFLPKRNSA"
FT   gene            complement(314783..316375)
FT                   /locus_tag="PputGB1_0268"
FT   CDS_pept        complement(314783..316375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0268"
FT                   /product="glutamate--cysteine ligase"
FT                   /EC_number="6.3.2.2"
FT                   /note="TIGRFAM: glutamate--cysteine ligase; KEGG:
FT                   pen:PSEEN0224 glutamate--cysteine ligase
FT                   (gamma-glutamylcysteine synthetase) (gamma-ECS) (GCS)"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96181"
FT                   /db_xref="GOA:B0KHZ5"
FT                   /db_xref="InterPro:IPR006334"
FT                   /db_xref="InterPro:IPR007370"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/TrEMBL:B0KHZ5"
FT                   /protein_id="ABY96181.1"
FT                   /translation="MKEYILSDLLNRRLSLLGANLPLLKQCLHGIERECLRVTDEGRLA
FT                   QTPHPDALGSALTNEQITTDYSESLLEFITPALPDPAKVLESLEETHRFVYSKLGDEYL
FT                   WSPSMPCTLPAEEDIPIAEYGTSNIGKLKHVYRKGLALRYGRTMQCIAGIHYNFSLPEA
FT                   LWPLLREAEGSTEDDRDYQSSAYIALIRNFRRYSWLLMYLFGASPALDKGFLRGRPHQL
FT                   EELDAETLFLPYATSLRMSDLGYQSNAQAGLTPCYNNLASYTDSLRKAVGTPYPPYVEV
FT                   GTHVDGEWVQLNTNILQIENEYYSNIRPKRVTYTGERPIQALTSRGVQYVEVRCLDINP
FT                   FLPVGIDLTEARFLDAFLLFCALEESPQLDNGECGQCTDNFLTVVKEGRRPGLELHRDG
FT                   QPIGLKDWASELIERIRQLADLLDQAQGGEAHAKALDAQQAKVDDTSLTPSAQVLARMT
FT                   EHDESFVQFSLRQSRIHAETFREQPLSSEKQQAFETLARESLARQSELEQDEVGDFDLF
FT                   VGAYQASILAISN"
FT   gene            complement(316514..316897)
FT                   /locus_tag="PputGB1_0269"
FT   CDS_pept        complement(316514..316897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0269"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   pen:PSEEN0225 thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96182"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B0KHZ6"
FT                   /protein_id="ABY96182.1"
FT                   /translation="MDVPREYVESAFSQLLGCRLQRLDTGVAEVALALEPHLRNRGQKL
FT                   HGGAIFSLVDIAMGLACSASHGFDQQSVTIECKINYMRAVSDGEVLCTARVLHAGRRTL
FT                   VVDADVVQGDKLVAKAQGTFAVL"
FT   gene            complement(316897..319221)
FT                   /locus_tag="PputGB1_0270"
FT   CDS_pept        complement(316897..319221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0270"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="PFAM: RNA binding S1 domain protein; SMART:
FT                   Resolvase RNase H domain protein fold; KEGG: pen:PSEEN0226
FT                   RNA-binding transcription accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96183"
FT                   /db_xref="GOA:B0KHZ7"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:B0KHZ7"
FT                   /protein_id="ABY96183.1"
FT                   /translation="MDSINSRIAEELGVRPQQVEAAVGLLDEGSTVPFIARYRKEVTGS
FT                   LDDTQLRHLEERLRYLRELDERRASILSSIEEQGKLTPELAREIKLADTKTRLEDLYLP
FT                   YKQKRRTKGQIALEAGLGELADGLFNDPTLAPESEAARFVDAEKGVADVKAALEGAKYI
FT                   LMERFAEDAALLDKLRSFLKQEAVLSARLVAGKEEEGAKFRDYFAHDELLRTAPSHRAL
FT                   AIFRGRNEGVLSASLKVGEELPGTLHPCELMIGSHVGIENRGRPADKWLGEVVRWTWKV
FT                   KLYTHLETDLFGELRDNAEGEAINVFAHNLHDLLLAAPAGPRATLGFDPGLRTGCKIAV
FT                   VDATGKLLDYTTVYPHAPKNDWDRTLSVMAALCAKHSVELIAIGNGTASRESDKLVAEL
FT                   VKKYPALKITKIMVSEAGASVYSASELAAREFPDLDVSIRGAVSIARRLQDPLAELVKI
FT                   DPKSIGVGQYQHDVSQLKLARGLDAVVEDCVNAVGVDVNTASVALLTRISGLNATLAQN
FT                   IVAHRDANGPFATRAALKKVSRLGEKTFEQAAGFLRVMNGDNPLDASAVHPEAYPLVQR
FT                   IAADTERDIRSLIGDSSFLKRLDPKKFTDESFGLPTVTDILQELDKPGRDPRPEFKTAT
FT                   FQDGVEDLKDLEPGMILEGVVTNVTNFGAFVDIGVHQDGLVHISALSEKFIKDPREAVK
FT                   AGDVVKVKVMEVDIPRKRVGLSMRMSDTPGEKVEGNRGGNRGNGGNRQQQAPRQRETTT
FT                   AAPANNAMASLFANAKQLKKK"
FT   gene            319439..320179
FT                   /locus_tag="PputGB1_0271"
FT   CDS_pept        319439..320179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0271"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: pen:PSEEN0227 two-component
FT                   response regulator OpmR"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96184"
FT                   /db_xref="GOA:B0KHZ8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B0KHZ8"
FT                   /protein_id="ABY96184.1"
FT                   /translation="MTGTPNTAEGDKILIVDDDPGLSSLLERFFTSKGYRARAVPNTEQ
FT                   MDRLLQREVFNLVVLDLMLPGEDGLSACKRLRQQNNQIPIIMLTAKGDELSRIKGLELG
FT                   ADDYLGKPFNPDELMARVKAVLRRQAPSVPGAPGSEDESVTFGDYELSLATRELKRGDE
FT                   VHMLTTGEFAVLKALVMHAREPLTRDKLMNLARGREWDALERSIDVQISRLRRMIEPDP
FT                   SKPRYIQTVWGVGYVFVPDGNAGK"
FT   gene            320193..321506
FT                   /locus_tag="PputGB1_0272"
FT   CDS_pept        320193..321506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0272"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: pen:PSEEN0228 osmolarity
FT                   sensor protein EnvZ"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96185"
FT                   /db_xref="GOA:B0KHZ9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B0KHZ9"
FT                   /protein_id="ABY96185.1"
FT                   /translation="MKTPVWFPQSFFARTLWLVLIVVLFSKALTLVYLLMNEDVLVDRQ
FT                   YSHGVALTLRAYWAADEENRDKIAEAAGLIRVTGSGVPEGEQHWPYSEIYQRQMQAELG
FT                   DDTEVRLRIHAPPALWVNAPSLGPGWLKVPLYPHPLRGQKIWNVLGWFLAIGLLSTASA
FT                   WIFVRQLNQPLKRLVFAARQLGQGRSVRLPISDTPSEMTEVYKAFNQMAEDVEQAGRER
FT                   ELMLAGVSHDLRTPLTRLRLSLSLLNSDSDLSDDMVRDIEDMDAILDQFLAFIRDGRDE
FT                   PVEEVDLADLVREVVAPYNQPQERVRLCLEPIPPFPLRRVSLKRMLGNLIGNALHHAGK
FT                   GVEVAAYVSGDESAPYVVLSVLDRGTGIDESELETIFNPFIRGDRARGGKGTGLGLAIV
FT                   KRIAAQHGGNVELRNRSGGGIEARVRLPLGLLLPRNAV"
FT   gene            complement(321538..322443)
FT                   /locus_tag="PputGB1_0273"
FT   CDS_pept        complement(321538..322443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0273"
FT                   /product="alpha-L-glutamate ligase, RimK family"
FT                   /note="TIGRFAM: alpha-L-glutamate ligase, RimK family;
FT                   PFAM: protein of unknown function DUF201; RimK domain
FT                   protein ATP-grasp; KEGG: pen:PSEEN0229 ribosomal protein S6
FT                   modification protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96186"
FT                   /db_xref="GOA:B0KI00"
FT                   /db_xref="InterPro:IPR004666"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR023533"
FT                   /db_xref="InterPro:IPR041107"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KI00"
FT                   /protein_id="ABY96186.1"
FT                   /translation="MKIAVLSRNPRLYSTRRLVEAGIQRGHEMVVIDTLRAYMNIASHK
FT                   PQIHYRGKPLEGFDAVIPRIGASVTFYGCAVLRQFEMMGVYPLNESVAIARSRDKLRSL
FT                   QLLSRRGIGLPITGFAHSPDDIPDLIQMVNGAPLVIKVLEGTQGIGVVLCETTQAAESV
FT                   IEAFMGLKQNIMVQEYIKEAGGADIRCFVVGDKVIASMKRQAKPGEFRSNLHRGGVASL
FT                   IKITPEERITAIRAAKVMGLSVAGVDILRSNHGPLVMEVNSSPGLEGIEVTTGKNVAGM
FT                   IIEHLEKNGGPNQTRTKGKG"
FT   gene            complement(322440..322979)
FT                   /locus_tag="PputGB1_0274"
FT   CDS_pept        complement(322440..322979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0274"
FT                   /product="protein of unknown function DUF785"
FT                   /note="PFAM: protein of unknown function DUF785; KEGG:
FT                   pen:PSEEN0230 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96187"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI01"
FT                   /protein_id="ABY96187.1"
FT                   /translation="MQKVPAVLTVHHLIRRVCFVKTFDHLTVIGLREWVALPDLGVAGL
FT                   RAKIDTGASTSSLHATEVEPFERDGQPWVRFTAHLGSVVQLRHRRCEAPLVTMKTIKSS
FT                   NGQAQTRYVIRTSLALGDGVWEVEFTLACRKNMRYRLLLGSKALIHGQLVVNPGLKYVQ
FT                   DKPAFPATLSPVTGAA"
FT   gene            323032..323433
FT                   /locus_tag="PputGB1_0275"
FT   CDS_pept        323032..323433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0275"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="PFAM: RNA-binding S4 domain protein; KEGG:
FT                   pen:PSEEN0231 heat shock protein 15, ribosome associated"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96188"
FT                   /db_xref="GOA:B0KI02"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025708"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI02"
FT                   /protein_id="ABY96188.1"
FT                   /translation="MAQKDEDDDKVRLDKWLWAARFYKTRALAKAAIESGKVHCRGERC
FT                   KPGKEPRVGDEFVLRTGFDERTVVVKALSVVRRGAPEAQTLYEETEESVRRREQAADLR
FT                   KAGAMGVTTDGRPTKKQRRQIHQLHGSFE"
FT   gene            complement(323536..324330)
FT                   /locus_tag="PputGB1_0276"
FT   CDS_pept        complement(323536..324330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0276"
FT                   /product="phosphoesterase PA-phosphatase related"
FT                   /note="PFAM: phosphoesterase PA-phosphatase related; KEGG:
FT                   pen:PSEEN0232 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96189"
FT                   /db_xref="GOA:B0KI03"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI03"
FT                   /protein_id="ABY96189.1"
FT                   /translation="MDNRPLFQARWSLGPLAACTLLPIALLCFWLWPIGQILCLTFDEW
FT                   LFHSLNAPLADNTTWRYIWIVGSLRPFDIVVGLILLTVLIRGDWVFKAAQVRQAFFGFL
FT                   VTLLLLVVIRALFSKWVDAAGWQHKSPSMIFDDVVHLSDYYPNLEKAWELKDRSSKSFP
FT                   GDHASVLLIWALFMSVFCRRLVQYLVVWGLALLFMLPRLVAGAHWGQDDYIGGLLMAVL
FT                   ALGWSYFTPLAAKGSEALMRWTAPLFTIAAKLPLVGKLAVVR"
FT   gene            324450..325349
FT                   /locus_tag="PputGB1_0277"
FT   CDS_pept        324450..325349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0277"
FT                   /product="Hsp33 protein"
FT                   /note="PFAM: Hsp33 protein; KEGG: pen:PSEEN0233 heat shock
FT                   protein 33, redox regulated chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96190"
FT                   /db_xref="GOA:B0KI04"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="InterPro:IPR023212"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KI04"
FT                   /protein_id="ABY96190.1"
FT                   /translation="MSDLPDTDFTQRFIFDERDVRGEWVSLDDSYAAVLARHEYPQPVK
FT                   ALLGELMAATALLVGAMKFDGLLILQARSAGPIPLLMVECSSDCEIRGMARYEAEQIPA
FT                   DASLSQLMPDGHLTLTIDPVKGQRYQGTVDLDGANLSECFTNYFIQSQQLNTRFWLNAE
FT                   GGKARGLLLQQLPRDRQPDDEEREDSWQHVVALAKTLKPEEWAEGNETLLHRLYHEDAV
FT                   RLFDIQPLRFNCSCSRERSGNALVSLGEHDAKALVEECGGTVEIDCQFCNERYFFDASD
FT                   VAQLFAGGGTDVASETRH"
FT   gene            325529..327070
FT                   /locus_tag="PputGB1_0278"
FT   CDS_pept        325529..327070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0278"
FT                   /product="Phosphoenolpyruvate carboxykinase (ATP)"
FT                   /EC_number="4.1.1.49"
FT                   /note="PFAM: phosphoenolpyruvate carboxykinase (ATP); KEGG:
FT                   pen:PSEEN0234 phosphoenolpyruvate carboxykinase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96191"
FT                   /db_xref="GOA:B0KI05"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR015994"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KI05"
FT                   /protein_id="ABY96191.1"
FT                   /translation="MTQANNTVYTDLSVDELVKEALQRGEGVLADTGALVVETGHRTGR
FT                   SPADRFIVEEPSTQDAISWGPINRKFPADKFDALWARVEAFNNAQDHFVSYVHVGAAAE
FT                   HYLPVKMTTQTAWQNLFGRCLFINPEQFNPAGRDQWQVLNVANFVCEPERDGTNSDGCV
FT                   IINFAQKKVLIAGMRYAGEMKKAMFSVQNFLLPAADVLPMHCAANIGEEGDVTLFFGLS
FT                   GTGKTTLSADESRYLIGDDEHGWGEGVVFNMEGGCYAKCIDLSEKNEPVIWKAIKHGAV
FT                   LENVVLDANKHADYTDVSLTQNSRAAYPLEHVAKRSEANLGGEPNAVIFLTCDLTGVLP
FT                   PVSILNNEQAAYHFLSGYTALVGSTEMGSGGGIKSTFSTCFGAPFFPRPAGEYAELLIK
FT                   RINGFNSKVYLVNTGWTGGGYGVGKRFSIPTTRAVIAAIQSGALVGAETEHLDIINLDV
FT                   PKAVPGVETELLNPRTNWADKAAYDEAAKGLAKLFIENFKKFEVSDAIKAAGPQL"
FT   gene            327224..327664
FT                   /locus_tag="PputGB1_0279"
FT   CDS_pept        327224..327664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0279"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   pen:PSEEN0236 thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96192"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI06"
FT                   /protein_id="ABY96192.1"
FT                   /translation="MTESPQRTAFSHFHTVLTRPSDNDINGHIAGATVHGFFETAIQAF
FT                   FVEQAELDLRDGELAAFVVSSAADFYALPGFPDVLEVGLGVTRLAGSTVEYRLALYRPG
FT                   ESEACAAGTVVQVFIERASGRPVALPEALQAILSGLVLEPQA"
FT   gene            complement(327720..328199)
FT                   /locus_tag="PputGB1_0280"
FT   CDS_pept        complement(327720..328199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0280"
FT                   /product="17 kDa surface antigen"
FT                   /note="PFAM: 17 kDa surface antigen; KEGG: pen:PSEEN0239
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96193"
FT                   /db_xref="InterPro:IPR039567"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI07"
FT                   /protein_id="ABY96193.1"
FT                   /translation="MKKYSSILLLSFSLLSGVAMAGGTTEAGIGGALGGVLGSVVGNSI
FT                   GGSTGGAIGAGLGGAAGGALGADKRQRGEAAIGGALGAAGGNVVGRSVGGTTGSYIGAA
FT                   AGGGAGGALGNYMGNKADEDERHDDRRYRRGYDDRRHYDRGHHYGHRKHKRHWRD"
FT   sig_peptide     complement(328134..328199)
FT                   /locus_tag="PputGB1_0280"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            complement(328396..330741)
FT                   /locus_tag="PputGB1_0281"
FT   CDS_pept        complement(328396..330741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0281"
FT                   /product="oxidoreductase alpha (molybdopterin) subunit"
FT                   /note="TIGRFAM: oxidoreductase alpha (molybdopterin)
FT                   subunit; PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; KEGG: pen:PSEEN0240
FT                   molybdopterin oxidoreductase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96194"
FT                   /db_xref="GOA:B0KI08"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010046"
FT                   /db_xref="InterPro:IPR037951"
FT                   /db_xref="InterPro:IPR041953"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI08"
FT                   /protein_id="ABY96194.1"
FT                   /translation="MTSYQHLPDNAPASTPRYKPYHGPAGGWGALRSVAKAWVGSDNAL
FT                   KNIRALLKTNQNGGFDCPGCAWGDSPENGMVKFCENGAKAVNWEATKRRVDAAFFARYS
FT                   VTSLLQQSDYWLEYQGRLSEPMVYDAPSDRYLPIRWEAAFALIARELNKLANPDQAEFY
FT                   TSGRASNEAAYLYQLFVRAYGTNNFPDCSNMCHEASGVALGQSVGVGKGTVTFDDFEHA
FT                   DAIFVWGQNPGTNHPRMLDPLRDAVKRGAQVVCVNPLKERGLERFQHPQNPLEMLTNSD
FT                   RPTNTAFFRPALGGDMAMLRGMAKFVLQWEREAQAKGEPAVFDHAFIAEHGHGVDEYLA
FT                   VVDATPWEHIQAQSGLTLADIELAARMYCRGKRVIMCWAMGITQHRHSVPTIQEIVNLQ
FT                   MLRGNIGAPGAGLCPVRGHSNVQGDRTMGINERPPVALLDALEKRFGFPVPRHNGHNTV
FT                   EAIHAMLDGRAKVFIGLGGNFAQATPDTERTAQALRNCELTVHISTKLNRSHLVHGKQA
FT                   LILPCLGRTDIDLQADGPQAVTVEDSFSMVHASNGQLKPLSTQMRSEPAVVAGIAAATL
FT                   GKQPVDWHWLVADYDRIRDLIGDTIAGFSGFNQRLQHPGGFYLGNSAASREWKTSTGRA
FT                   NFKANLLPDSLLDERVRASGQLPDLIMQSMRSHDQYNTTIYGLDDRYRGVRGQREVLFA
FT                   NEADIIRLGFQPGQKVDIVSLWGDEHVRRVQGFTLLPFDIPAGQAAAYYPEVNPLVPLE
FT                   SIGDGSHTPTSKFIAIKLERARDDGRIL"
FT   gene            complement(330747..331577)
FT                   /locus_tag="PputGB1_0282"
FT   CDS_pept        complement(330747..331577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0282"
FT                   /product="formate dehydrogenase family accessory protein
FT                   FdhD"
FT                   /note="TIGRFAM: formate dehydrogenase family accessory
FT                   protein FdhD; PFAM: formate dehydrogenase subunit FdhD;
FT                   KEGG: pen:PSEEN0241 formate dehydrogenase accessory protein
FT                   FdhD"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96195"
FT                   /db_xref="GOA:B0KI09"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI09"
FT                   /protein_id="ABY96195.1"
FT                   /translation="MNSKPPVCAASSPLSMPAASNRYDYVQLSDAKRDSTPLAEEVALA
FT                   IVYNGLNQAVMLVSPTDLEDFAVGFSVGSGIVEGTAEIYDLKLSGSGSAMYADLEISSR
FT                   AFWNLKNQRRQLAGTSGCGLCGVEALEQALPELAVLPGAPLPPAQWLAGLRERIDAFQP
FT                   LGQHCGAVHAALFMDRHGELLLGREDIGRHNALDKLIGALLRQGIDSQGGLAIVTSRCS
FT                   LELIQKVLRAGIQTLVSLSAPTGLALQWARKHNLNLIHLPKHSAPRVYSPAAES"
FT   sig_peptide     complement(331515..331577)
FT                   /locus_tag="PputGB1_0282"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.859) with cleavage site probability 0.800 at
FT                   residue 21"
FT   gene            331754..332194
FT                   /locus_tag="PputGB1_0283"
FT   CDS_pept        331754..332194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0283"
FT                   /product="transport-associated"
FT                   /note="PFAM: Peptidoglycan-binding LysM;
FT                   transport-associated; KEGG: pen:PSEEN0243 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96196"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI10"
FT                   /protein_id="ABY96196.1"
FT                   /translation="MSLFSFVKEAGEKLIDLLTPGNANAEEQLKKHVESVGLGNPNITA
FT                   TVEGDKIILKGEVASQEEKEKIILAAGNINGVASVDDQITVTGPVVAAARFVTVKKGDT
FT                   LSAISVVVYGNANQYNKIFEANKPMLTHPDKIYPGQVLRIPD"
FT   gene            complement(332245..332907)
FT                   /locus_tag="PputGB1_0284"
FT   CDS_pept        complement(332245..332907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0284"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: pen:PSEEN0244 hydrolase, haloacid
FT                   dehalogenase family, subfamily IA, variant 3"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96197"
FT                   /db_xref="GOA:B0KI11"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI11"
FT                   /protein_id="ABY96197.1"
FT                   /translation="MPVLPWSAIDTVLLDMDGTLLDLHYDNRFWLDHLPQRYAELHGVS
FT                   RAMAEMELQPLFERNAGTLNWYCLDFWSRELRLPIRELKREIADLIALRPDADTFLAAI
FT                   RQAGKRVVMITNAHRDSLSLKLERVELAPYFERLISSHDYGYPKESPQFWDALQADIGF
FT                   EPGRSLFIDDTLAILRSARRFGVGHLLAVRQPDSKAQPRDTEEFAAVEDYRELLVGL"
FT   gene            332972..333538
FT                   /locus_tag="PputGB1_0285"
FT   CDS_pept        332972..333538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0285"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: pen:PSEEN0245 ADP
FT                   compounds hydrolase NudE"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96198"
FT                   /db_xref="GOA:B0KI12"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI12"
FT                   /protein_id="ABY96198.1"
FT                   /translation="MRQKPTVLSREIVASSRLFRVEAVQLRFSNGNERTYERLVGRGNG
FT                   YGAVMIVAMLDAEHAVLVEEYCGGTDEYELSLPKGLIEPGEDVLAAADRELKEEAGFGA
FT                   RQLEHLTELSLSPGYMSQKIQVVLASELYEERLEGDEPEPMRVDKVNLRELSALAMHPQ
FT                   FTEGRALAALYLARDLLIQRGLLEL"
FT   gene            333535..334353
FT                   /locus_tag="PputGB1_0286"
FT   CDS_pept        333535..334353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0286"
FT                   /product="3'(2'),5'-bisphosphate nucleotidase"
FT                   /note="TIGRFAM: 3'(2'),5'-bisphosphate nucleotidase; PFAM:
FT                   inositol monophosphatase; KEGG: pen:PSEEN0246
FT                   3'(2'),5'-bisphosphate nucleotidase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96199"
FT                   /db_xref="GOA:B0KI13"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006240"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI13"
FT                   /protein_id="ABY96199.1"
FT                   /translation="MNDLQLMHEVVKLALTAGEAILPFWRADVAVTNKADDSPVTVADL
FT                   AAHRVIADGLLALAPHIPVLSEEDCNIPLAERQGWGRWWLVDPLDGTKEFIAGSEEFTV
FT                   NIALIENGQVVFGVVSMPTNGRCYFGGRGLGAWRADAGEAAKAIQVRNAPPAGECFTVV
FT                   ASRRHSSPEQEALLAGLGAAVGELELANVGSSLKFCLLAEGSADCYPRLAPTSQWDTAA
FT                   AQGVVEGAGGEVIGLDGLPFRYPPRESLLNPYFLALPANAAWRQAFLNLI"
FT   gene            complement(334401..334856)
FT                   /locus_tag="PputGB1_0287"
FT   CDS_pept        complement(334401..334856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0287"
FT                   /product="thioesterase domain protein"
FT                   /note="TIGRFAM: thioesterase domain protein; PFAM:
FT                   Thioesterase putative; KEGG: pen:PSEEN0247 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96200"
FT                   /db_xref="InterPro:IPR012660"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI14"
FT                   /protein_id="ABY96200.1"
FT                   /translation="MSTNSQYLQSVLHSDIPLTREMGLEVIDWQQHTLRLQLPLAANVN
FT                   HKSTMFGGSLYCAAVLVGWGWLHLRLRALGIDDGHIVIQEGQISYPLPVTGTAVARCAA
FT                   PDEKTWERFLNMYQRRGRARLTLETTVSNAGSDEPAVTFSGQYVLHR"
FT   gene            complement(334856..336262)
FT                   /locus_tag="PputGB1_0288"
FT   CDS_pept        complement(334856..336262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0288"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: response regulator receiver; sigma-54 factor
FT                   interaction domain-containing protein; helix-turn-helix
FT                   Fis-type; ATPase associated with various cellular
FT                   activities AAA_5; SMART: AAA ATPase; KEGG: pen:PSEEN0248
FT                   sigma-54 dependent response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96201"
FT                   /db_xref="GOA:B0KI15"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030828"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI15"
FT                   /protein_id="ABY96201.1"
FT                   /translation="MTTETLIDSRAQVILVDDAPHLRQALSQTLDLAGLKVVALADAQG
FT                   LAERIEADWPGVVVSDIRMPGIDGLQLLEQLHSRDSELPVLLITGHGDVPLAVQAMRAG
FT                   AYDFLEKPFATDALLDSVRRALALRRLVLDNRSLRLALSDRQQLATRLVGHSPAMQRLR
FT                   EQIGALAGTRADVLILGETGAGKEVVARALHDLSSRRDGPFVAINAGALAESVVESELF
FT                   GHEPGAFTGAQKRRIGKFEFANGGTLFLDEIESMSLDVQVKLLRMLQERVVERLGGNQL
FT                   IPLDIRIIAATKEDLRQAADQGRFRADLYYRLNVAPLRIPPLRERGDDILVLFQHFADA
FT                   ASQRHGLSPHALQPAQRALLLRHDWPGNVRELQNAAERFALGLELALDGQAPPAAAPAA
FT                   PLLSGNLSEQVEQFERSLIAAELAQPHSSMRSLAEALGIPRKTLHDKLRKHGLNFDGGS
FT                   GGHDEQEDNR"
FT   gene            complement(336259..338073)
FT                   /locus_tag="PputGB1_0289"
FT   CDS_pept        complement(336259..338073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0289"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: pen:PSEEN0249
FT                   sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96202"
FT                   /db_xref="GOA:B0KI16"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR017055"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI16"
FT                   /protein_id="ABY96202.1"
FT                   /translation="MIAKPTPPRRPRWRSLALLALCLAPLLWPLHHLAERYYQQELASQ
FT                   NRQTLDLYVANLLGTLHRYETLPQILGDLPALRGVLADPFRLEAVTNANRLLKDIVQQT
FT                   GAEVMYLMDVSGNTLAASNWDKHDSFVGRNFAFRPYFNEAMAGHLGRFFGQGTTSAKRG
FT                   YFFAAAVRDRERTVGVLVVKVDLDHTETLWGRTPEQLLLTDHNGVVILTSRPDWRFRAT
FT                   RVLSEAERQAIIAIQPYPTQAPQPLVLSPDAWISQTRDIKETGWQVSILAPRTLVDRSV
FT                   QTVMAIGAGTLLVVMLLAGLVMQRRRHYIDRIDFEARGRQELEKRVAERTADLEGLNTR
FT                   LKSAVLERENAQQEAVRAQDELVQAGKLSVLGTMSASISHELNQPLAAIRSYAENAEIL
FT                   LDHQRTEDARGNLKLIGELTGRMASIIAHLRAFARRDRHAPESVALQPALDDALALLAK
FT                   RRRAMAVELIRDLPEATLWVQAGETRLRQVLGNLLANALDALTEKANPRRLWLSAEQRD
FT                   GCVYLYIRDNGPGFSRQALEHAKEPFFTTKTRTQGLGLGLAICESLMRALGGELLLANH
FT                   PEGGALLTLQLRVAAPGATLPNSEDPSA"
FT   gene            complement(338116..338661)
FT                   /locus_tag="PputGB1_0290"
FT   CDS_pept        complement(338116..338661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0290"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /EC_number="5.1.3.13"
FT                   /note="KEGG: pen:PSEEN0251
FT                   dTDP-4-keto-6-deoxy-D-glucose-3,5-epimerase; TIGRFAM:
FT                   dTDP-4-dehydrorhamnose 3,5-epimerase; PFAM:
FT                   dTDP-4-dehydrorhamnose 35-epimerase related"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96203"
FT                   /db_xref="GOA:B0KI17"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI17"
FT                   /protein_id="ABY96203.1"
FT                   /translation="MNIIPTAIPEVLIIEPKVFGDSRGFFFEAFNAREFARQTGVNVEF
FT                   VQDNHSRSIKGVLRGLHYQVANTQGKLVRVVHGEIRDIAVDVRKSSPTFGQWVAVHLSA
FT                   DNHRQLWIPPGFAHGFAVMSESAEFLYKTTDYYNPGADRCIRWDDPQLGIDWGLRQPPV
FT                   LSDKDKVGLPLAEAELLP"
FT   gene            338940..340046
FT                   /locus_tag="PputGB1_0291"
FT   CDS_pept        338940..340046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0291"
FT                   /product="agmatine deiminase"
FT                   /EC_number="3.5.3.12"
FT                   /note="KEGG: pen:PSEEN0261 agmatine deiminase; TIGRFAM:
FT                   agmatine deiminase; PFAM: Porphyromonas-type
FT                   peptidyl-arginine deiminase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96204"
FT                   /db_xref="GOA:B0KI18"
FT                   /db_xref="InterPro:IPR007466"
FT                   /db_xref="InterPro:IPR017754"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KI18"
FT                   /protein_id="ABY96204.1"
FT                   /translation="MKTLNSTPRADGFHMPAEWAPQTQVWMVWPERPDNWRLGGKPAQA
FT                   AHVTLAKAIARFEPVTVAASAGQYENARRQLDQPNIRVVEISNDDAWVRDTGPTFVIND
FT                   HGEVRGVDWGFNAWGGFDGGLYAPWNRDEELAAKVLEMERCQRYQTEGFVLEGGSIHVD
FT                   GEGTVITTEECLLNRNRNPHMNREQIEAVLRDQLAVDTVVWLPDGLFNDETDGHVDNFC
FT                   CYVRPGEVLLAWTDDSNDPNYARCHAAMEVLKNTRDAKGREFIVHKMPIPGPLFATAEE
FT                   CAGVDQVAGSQERDPSVRLAGSYVNFLIVNGGIIAPSFDDPADAEARAILAKIFPDHEV
FT                   VMIPGRELLLGGGNIHCLTQQQPAPVKR"
FT   gene            340230..340427
FT                   /locus_tag="PputGB1_0292"
FT   CDS_pept        340230..340427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0292"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pfl:PFL_0309 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96205"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI19"
FT                   /protein_id="ABY96205.1"
FT                   /translation="MNVASESALRPSAVNHQSLRVVAKWLKHHGSIRVRTTDPRRLLAG
FT                   RYPQGLISEAEMQALMAVWH"
FT   gene            complement(340499..342595)
FT                   /locus_tag="PputGB1_0293"
FT   CDS_pept        complement(340499..342595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0293"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="TIGRFAM: TonB-dependent siderophore receptor; PFAM:
FT                   TonB-dependent receptor; TonB-dependent receptor plug;
FT                   KEGG: pen:PSEEN0263 TonB-dependent siderophore receptor"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96206"
FT                   /db_xref="GOA:B0KI20"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI20"
FT                   /protein_id="ABY96206.1"
FT                   /translation="MLVPCRLSPLTLGLSLLFSVDLASAATTTLPESSITADSEREKDN
FT                   PRVKEVSTATRTSTPVRYVPQAIDTVKTVNVLDYGSNTLGKALEGIPNVSSGADTRFDS
FT                   VRIRGFEASNDFYLDGIRDDSQYIRDLHNIERVEVLKGPAAVLYGRGSQGGIVNRVSKA
FT                   PEPGRRSTLEAQAGSEDLRSLYADLSADPSDTVSLRLNMGNQDNNSFRDGVHGSRQLFA
FT                   PSISWQINPDLNWLVQYEYSRYNRTPDRGIPGVNGRPADVSRGNTYGDPRDYIDDHAQS
FT                   LRSRLNYQLNETWQLRHTLGLFKLDSEFDNTYVVGYNAGTNTVTRQRWQQDLNTRNLFN
FT                   NLEAEGDFDTLGLEHKLLVGLEFGNQRRDPLLYTALPVAKGGQAVPGLDLNNPDRSQQH
FT                   NGPMTVSSDNHTVVDSRGLYLQDQIRLNDQWQILAGVRFDQFDVQTTNKDGVREPQDSN
FT                   STSPRLGVVYTPWRDHSFYASWSKTFSPVGGGLIGITPDAPGNGNDAKPEETRQKEIGV
FT                   KSDWLDQRLTTTLAIYELELYNRRTRDPLIPENILLSGLQRSRGIELTATGNIVGNWYV
FT                   RGGIGLQDAIIVKDNNGQEGNRINDVAKRNGSLFVTWKPELGWYAETGLTLVGERYADN
FT                   QNTTVLPGYGRWDALAGYRTHDWDVRAALSNIADKTYYSSATSAAQIQVGDPRSLVVTG
FT                   SYSF"
FT   sig_peptide     complement(342518..342595)
FT                   /locus_tag="PputGB1_0293"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.971) with cleavage site probability 0.721 at
FT                   residue 26"
FT   gene            343100..344419
FT                   /locus_tag="PputGB1_0294"
FT   CDS_pept        343100..344419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0294"
FT                   /product="outer membrane porin"
FT                   /note="PFAM: outer membrane porin; KEGG: pen:PSEEN0264
FT                   outer membrane protein OprE3"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96207"
FT                   /db_xref="GOA:B0KI21"
FT                   /db_xref="InterPro:IPR005318"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI21"
FT                   /protein_id="ABY96207.1"
FT                   /translation="MLKTRISLVALAMIAATQAQANEQADSKGFIEDSHANVLLRNAYI
FT                   NRDKKHGTDDQIEWGQAFIANFSSGFTQGTVGVGVDAFGLYAVRLDGGKGHNGGGGVDF
FT                   FKPHETTNAEGNASSPHNLARGGAAVKFRISNTVLKYGDQMPALPVLQYDDARLLPESF
FT                   TGTLITSKEIQGLELNAGRFTQEARKSAEGRDSGGLKSINVFGGSYKFTDNFTASLYTA
FT                   DNEDVMKKHYLGLNYVFPIASDQSLTLDFNGYKSDIDHKYVQAAGLNGDSNTIWSLAAT
FT                   YAYGAHSFTLAHQRSTGSTGYNYGFYQNAGGVGDGGSTIYLANSYWSDFNAEDERSWQL
FT                   GYGLDFGAYGIPGLTYKLAYVVGDNINTRNVANPQGFGEGKEREIFNQIRYVVQDGPAK
FT                   DLSIKLRSSFVRTNNAVQQNGYNDDGNEVRVFVEYPISIF"
FT   sig_peptide     343100..343165
FT                   /locus_tag="PputGB1_0294"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            complement(344450..346117)
FT                   /locus_tag="PputGB1_0295"
FT   CDS_pept        complement(344450..346117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0295"
FT                   /product="Glutamate synthase (NADPH)"
FT                   /EC_number="1.4.1.13"
FT                   /note="PFAM: ferredoxin-dependent glutamate synthase; KEGG:
FT                   pen:PSEEN0265 glutamate synthase, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96208"
FT                   /db_xref="GOA:B0KI22"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024188"
FT                   /db_xref="InterPro:IPR027283"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI22"
FT                   /protein_id="ABY96208.1"
FT                   /translation="MKHSLPSRYACLALCLVFSFASLPLLAQHAWLWPVTLITALLSLV
FT                   GLNDLRQSHHAVRRNYPILGNIRYLIETIRPEIRQYLIEGDDDKLPFSRSQRSLVYARA
FT                   KNESAEKAFGTLNDAYKPGFEFISHSMLPVATPDPASFRIAIGGPQCRLPYSASIFNIS
FT                   AMSFGALSANAIAALNRGARMGRFAHDTGEGSISPYHREHGGDLIWEIGSGYFGCRTED
FT                   GRFDPQRFAEQAKSPQVKMIEIKLSQGAKPGHGGILPGHKVSPEIAQTRGVRAGEDCIS
FT                   PAAHSAFRTPVELLQFVASLRKLSGGKPVGFKFCLGHPWEFMGIAKAMLATGITPDFIV
FT                   VDGKEGGTGAAPREFSDNMGVPMREGLMFVHNTLVGLNLRSSIRIGAAGKIVSAFDIAS
FT                   VLAIGADWVNSARGFMFAIGCIQSQSCHTNKCPTGVATQDPLRQRALVVPDKAERVASF
FT                   HRNTLHTLAEMLAAAGLEHPSELKPKHLARRISPSEIGLFSDLHTFLKPGELLSGSIES
FT                   EFYARMWRMARSDSFAPETADATPAPAVTLRRKETAPA"
FT   sig_peptide     complement(346034..346117)
FT                   /locus_tag="PputGB1_0295"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 28"
FT   gene            complement(346231..347598)
FT                   /locus_tag="PputGB1_0296"
FT   CDS_pept        complement(346231..347598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0296"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: bur:Bcep18194_C7107
FT                   periplasmic sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96209"
FT                   /db_xref="GOA:B0KI23"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI23"
FT                   /protein_id="ABY96209.1"
FT                   /translation="MRWLRRLWPRTLFGQLLLIMVSGTLVIQLMSSSIWFDVRFAQVLE
FT                   APVRLVAARSAPLIAQADCHGGMLQPPAHYQLRCAESLPTPEHDERRGRRRIELLLQQA
FT                   LKYELGHAQDVRLMKVQLTDELGQPIVWRSLFGLRTAQAHIQFAVPLADGHWLTVDGQE
FT                   LQGWSGESAWVLISDYLLRVYALRIVAVLLVCLIAVRLCLRPLRRLADAARGLGANLEQ
FT                   PPLALDGPEEVRQAAQAFNAMQQRLIAMVNDKAYFLAAVSHDLRTPLTRMRLRLERLPD
FT                   DEHRQRLRQNITQMDDMIGQVLDYLRAGEQQNLQQVDLDRLVARQCADLACAEEPLPVH
FT                   GQAGSLRVDALLLQRCLQNLLVNALRYAQDISVTLERASTGVFIHIDDRGPGIAPALLT
FT                   TITDPFVRGEGSRNQASGGYGLGLSIAQRIATSHGGELMLSNREGGGLRVSILLPI"
FT   sig_peptide     complement(347503..347598)
FT                   /locus_tag="PputGB1_0296"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.682) with cleavage site probability 0.413 at
FT                   residue 32"
FT   gene            complement(347600..348322)
FT                   /locus_tag="PputGB1_0297"
FT   CDS_pept        complement(347600..348322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0297"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: mfa:Mfla_2739 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96210"
FT                   /db_xref="GOA:B0KI24"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI24"
FT                   /protein_id="ABY96210.1"
FT                   /translation="MSTTLLVVDDDDEIRELLCDYLKDAGYNVLAAADGEQMREQLARQ
FT                   KVELVVLDLMLPGEDGLSLCRQLQATPGLAVIMLSAKGSTLDRIIGLEVGADDYLAKPF
FT                   EPRELIARIKAVLRRPQRLDAQAEEPAVMDAQLFAGFRLEHVKRLLTRPDGETLTLPRS
FT                   DYRVLRELLEANNRVVSRDQLTRSAFGRDHLPDDRSVDMCVSRLRQQLRRAPAGAAQIL
FT                   TIRNEGYLLSIASHEADA"
FT   gene            348463..350760
FT                   /locus_tag="PputGB1_0298"
FT   CDS_pept        348463..350760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0298"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="TIGRFAM: TonB-dependent siderophore receptor; PFAM:
FT                   TonB-dependent receptor; TonB-dependent receptor plug;
FT                   KEGG: bpt:Bpet3198 TonB-dependent outer membrane receptor"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96211"
FT                   /db_xref="GOA:B0KI25"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI25"
FT                   /protein_id="ABY96211.1"
FT                   /translation="MNPMSTPKVFTPSSPSGSRLKPLAFFVAVAISGGAMAADGKPLEL
FT                   DATQIEDSALLPADDAGQLGYTVERTRSSTGLDLTPRQTPQSVTTITRQQMDDRDIHTI
FT                   EQALQTTPGVTANKSEVGGRTDYRARGYSISNWKVDGLQTQGGSDFSGSGNALNMDLYE
FT                   RIDIVRGANGLLGGTGDPSATVNLIRKAPTKTFGGSAYATYGSWDKRRLGADLNLPLSE
FT                   DGRLRSRFVMTQQDANSFRDNQSERSRAALANFEFDLDEATTLGAGYQYEYNKVVGGGW
FT                   GANIPLWYRDGSKTDLPRSTNVVPSWSFGEYTTRTAFGSLEHRFDNDWTLDLKGAQATT
FT                   EALNHRGLAKVNSAGRGSYGGYWDQNGSGAVLNGLHSSSDTTQQSAQIDLSGPFQLFGR
FT                   THQAMVGYNDSRTVSWSPEYSCTMVGDGMASAPALGCQFRANNGFPLTDWRNGVDDDYD
FT                   ILASRTGRHSKTTTRLQGMYAATRLSITDPLSVIVGVRTSNYSSVTRSVAGVRSSQEEN
FT                   GIVTPYLGAVYDLNENYSVYASYTDIFTPQTSETSSGSKVEPIRGQSYETGIKGEWFDG
FT                   RLNASAAYFRTKQENKAVLDGDLTTPTGGNAYKAGSGQETDGIDLEVAGALSPNWNVYA
FT                   GYTYLHFRRVDSDGRSDPSHLFKASTTYRLSGPLDRLTLGAGVTAQTNIRAISSPAGQP
FT                   TNGVSNGATDVNWSGYAIWNAMAKYQLTDDTSVSLNANNLFDKHYYTQYGFYAGAIYGD
FT                   PRNLSLTVSTAF"
FT   sig_peptide     348463..348576
FT                   /locus_tag="PputGB1_0298"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 38"
FT   gene            complement(350822..351028)
FT                   /locus_tag="PputGB1_0299"
FT   CDS_pept        complement(350822..351028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0299"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN5227 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96212"
FT                   /db_xref="InterPro:IPR021430"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI26"
FT                   /protein_id="ABY96212.1"
FT                   /translation="MAKKFPTNPSHPERICWGCDLYCPAKALACGNGADRTMHPIELFG
FT                   EDWESLEGRLEKPVVRGQEAEPG"
FT   gene            complement(351243..351318)
FT                   /locus_tag="PputGB1_R0011"
FT                   /note="tRNA-Thr3"
FT   tRNA            complement(351243..351318)
FT                   /locus_tag="PputGB1_R0011"
FT                   /product="tRNA-Thr"
FT   gene            complement(351417..351665)
FT                   /locus_tag="PputGB1_0300"
FT   CDS_pept        complement(351417..351665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0300"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN5218 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96213"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI27"
FT                   /protein_id="ABY96213.1"
FT                   /translation="MTRATPLALLTFALALTGCTNGTAPHANSNLGWNHPGMQLGGDNG
FT                   LPLRTESPCRKRGCDNDKLFFNPGKSEPSVNTIHRGW"
FT   sig_peptide     complement(351582..351665)
FT                   /locus_tag="PputGB1_0300"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.638 at
FT                   residue 28"
FT   gene            complement(351815..352054)
FT                   /locus_tag="PputGB1_0301"
FT   CDS_pept        complement(351815..352054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0301"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96214"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI28"
FT                   /protein_id="ABY96214.1"
FT                   /translation="MNKLVITCWSQRYFKRLAYSSLRVKPNKNRRLRKDQRRSDPACLS
FT                   RKSAMPLVHKHFLWLMQALFARSFMGVRIPAKSA"
FT   gene            complement(352081..353286)
FT                   /locus_tag="PputGB1_0302"
FT   CDS_pept        complement(352081..353286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0302"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN5211 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96215"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI29"
FT                   /protein_id="ABY96215.1"
FT                   /translation="MPSHLHSHHLSTRFQALDQFLIEHQQLWKPRPFTTLHLGWETTHP
FT                   ELATHLRQCSLADAEADSTADHLPAPFPQLAQQAQQLSTLGSLPQSALPSAAHRLDVAV
FT                   PGRKWQQIEAFASHLAFREPPQHWLDWCSGKGHLGRRLLQPGQQLTCLEYDADLVAAGQ
FT                   ALSAHHHVPAQHVHQDVMASDSVRHLAGDKSVVALHACGDLHVRLMQLASRQGCRQLAV
FT                   APCCYNRTAVQQYQALSTAAQASNLQLSLDDLGLPLSETVTAGARVRRQRDTSMARRLG
FT                   FDLLQRQQRQSSEYLPTPSLPVAWLEKPFEHYCRDLADLKQLPLHGNPDWAALEAAGWQ
FT                   RLAEVRNLERVRNLFRRPLELWLVLDRALFLEEQGYEVRLGLFCDYPLTPRNLLILAER
FT                   DR"
FT   gene            complement(353351..354040)
FT                   /locus_tag="PputGB1_0303"
FT   CDS_pept        complement(353351..354040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0303"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: pen:PSEEN5210 amino
FT                   acid ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96216"
FT                   /db_xref="GOA:B0KI30"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI30"
FT                   /protein_id="ABY96216.1"
FT                   /translation="MNWEVIFKWLPRLAEGATLTLELVAIAVVAGLILAIPLGIARSSR
FT                   HWYVRAVPFSYIFFFRGTPLLVQLFLVYYGLAQFDAVRSSSLWPYLRDPFWCTVLTMTL
FT                   HTAAYIAEILRGALQSIPKGEIEAARALGMSRGKALFYIMLPRAARIGLPAYSNEVILM
FT                   LKASALASTVTLLELTGMARTIIARTYLPVEIFFAAGVFYLVISFLLVQGFKLLERWLR
FT                   VDACQGR"
FT   gene            complement(354040..354732)
FT                   /locus_tag="PputGB1_0304"
FT   CDS_pept        complement(354040..354732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0304"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: pen:PSEEN5209 amino
FT                   acid ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96217"
FT                   /db_xref="GOA:B0KI31"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI31"
FT                   /protein_id="ABY96217.1"
FT                   /translation="MNIDLHGFGPAMMAGTLMTVKLALCALLLGLVLGLLGALAKTSPL
FT                   KPLQWLGGFYSTLVRGVPELLWVLLIYFGTVGLMNSLGEALNMPGLELSAFAAGVIALG
FT                   LCFGAYATEVFRGAILAIPKGHREAGLALGLSKGRILSRIILPQMWRIALPGLGNLFMI
FT                   LMKDTALVSVIGLEEIMRHSQIGVTVTKEPFTFYMVAACIYLGLTVLAMTGMHFMEKRA
FT                   ARGFARAE"
FT   sig_peptide     complement(354610..354732)
FT                   /locus_tag="PputGB1_0304"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.978 at
FT                   residue 41"
FT   gene            complement(354787..355539)
FT                   /locus_tag="PputGB1_0305"
FT   CDS_pept        complement(354787..355539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0305"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   KEGG: pen:PSEEN5208 amino acid ABC transporter, periplasmic
FT                   amino acid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96218"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI32"
FT                   /protein_id="ABY96218.1"
FT                   /translation="MHTYKKFLLAAAATLVMSANAMAAEKLRMGIEAAYPPFNNKDASG
FT                   NVVGFDKDIGDALCAKMKVECSVVTSDWDGIIPALNAKKFDFLVSSLSITDERKQAVDF
FT                   TEPYYSNKLQFIAPKNVDFKTDAASLKGKSIGTQRATLAGTYLEDNFKGVDVKLYDTQE
FT                   NAYLDLVSGRIDGILADKYVQYEWLKSKDGSNFEFKGEPVMDSDKIGIAVRKGDTKLRD
FT                   DLNKALAEIKADGTYKKINDKYFPFSIE"
FT   sig_peptide     complement(355468..355539)
FT                   /locus_tag="PputGB1_0305"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 24"
FT   gene            complement(355551..356324)
FT                   /locus_tag="PputGB1_0306"
FT   CDS_pept        complement(355551..356324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0306"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pen:PSEEN5207 amino acid ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96219"
FT                   /db_xref="GOA:B0KI33"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI33"
FT                   /protein_id="ABY96219.1"
FT                   /translation="MAQATPALEIRNLHKRYGEQEILKGISLTARDGDVISILGSSGSG
FT                   KSTLLRCINLLENPHQGEILVAGEALKLKAAKNGDLVAADNRQINRLRSEIGFVFQNFN
FT                   LWPHMSILDNIIEAPRRVLGQSKAEAIEAAEALLNKVGIYDKRHSYPAQLSGGQQQRAA
FT                   IARTLAMKPKVILFDEPTSALDPEMVQEVLNVIRALAEEGRTMLLVTHEMSFARHVSSE
FT                   VVFLHQGLVEEQGSPQQVFENPTSARCKQFMSSHR"
FT   gene            356966..358351
FT                   /locus_tag="PputGB1_0307"
FT   CDS_pept        356966..358351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0307"
FT                   /product="GABA permease"
FT                   /note="TIGRFAM: GABA permease; PFAM: amino acid
FT                   permease-associated region; KEGG: pen:PSEEN5205
FT                   gamma-aminobutyrate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96220"
FT                   /db_xref="GOA:B0KI34"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="InterPro:IPR011265"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI34"
FT                   /protein_id="ABY96220.1"
FT                   /translation="MSGNNSNDLAQGLKQRHVTMLSIAGVIGAGLFVGSGHAIAAAGPA
FT                   VLLAYAAAGTLVVLVMRMLGEMAVASPDTGSFSTYADRAIGRWAGFTIGWLYWWFWVLV
FT                   IPLEANAAAAILHAWFPAVDLWAFSLIITLALTLTNLCSVKNYGEFEFWFALLKVLAII
FT                   GFIAVGCAALFGFVPNSQVSGASHLFDTQGFMPNGLGAVLAAMLTTMFSFMGTEIVTIA
FT                   AAESKDPGKQISRATNSVIWRICLFYLVSIFLVVALVPWNDPALAETGSYQTVLSRIGV
FT                   PNAKLIVDIVVLIAVTSCLNSALYTSSRMLFSLSKRGDAPAIAQRTTKAATPHVAVLLS
FT                   TAAAFLCVFANFVAPAQVFEFLLASSGAIALLVYLVIAVSQLRMRAQREARGEKITFKM
FT                   WLFPGLTWATIAFIVAILVVMALREDHRAEIIATALLSIGVVAAGLLVHRKREAAGRVA
FT                   LDN"
FT   sig_peptide     356966..357088
FT                   /locus_tag="PputGB1_0307"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.910) with cleavage site probability 0.792 at
FT                   residue 41"
FT   gene            complement(358428..358871)
FT                   /locus_tag="PputGB1_0308"
FT   CDS_pept        complement(358428..358871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0308"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN5204 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96221"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI35"
FT                   /protein_id="ABY96221.1"
FT                   /translation="MATPTKQQKRAKRAASKAKQNRMVRSGQAVKASAGDSASVEQVYN
FT                   KAMESGSYDAMFNKMKEAQEGGLVPMISVFLVDPLLALVLKGHKEEHATDYIVLVFNAY
FT                   RKWLDGADEEATMAWLESDEFQEAYIAASELVAKQQQQQKQFG"
FT   gene            complement(358932..359912)
FT                   /locus_tag="PputGB1_0309"
FT   CDS_pept        complement(358932..359912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0309"
FT                   /product="protein of unknown function DUF344"
FT                   /note="PFAM: protein of unknown function DUF344; KEGG:
FT                   pen:PSEEN5203 polyphosphate kinase 2"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96222"
FT                   /db_xref="GOA:B0KI36"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022486"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI36"
FT                   /protein_id="ABY96222.1"
FT                   /translation="MSEESPLLLPAPGEPAVTPVRTRRPRQRKPEPTITRISQQPAALE
FT                   VATAPKGSNEDSTSARLPASYPYRTRLRRQDYEKAKHALQIELLKVQSWVKDTGQRVVI
FT                   LFEGRDAAGKGGTIKRFMEHLNPRGARIVALEKPSEQEQGQWYFQRYIQHLPTAGEMVF
FT                   FDRSWYNRAGVEKVMEFCTPLQYLEFMRQAPDLERMLCNSGILLFKYWFSVNREEQLRR
FT                   FISRRDDPLKHWKLSPIDIKSLDKWEDYTAAKEAMFFHTDTADAPWTVIKSDDKKRARL
FT                   NCIRHFLHSLDYPGKDHSVAHAPDELLVGRASHGFEEDESAPLAS"
FT   gene            complement(360082..360157)
FT                   /locus_tag="PputGB1_R0012"
FT                   /note="tRNA-Phe1"
FT   tRNA            complement(360082..360157)
FT                   /locus_tag="PputGB1_R0012"
FT                   /product="tRNA-Phe"
FT   gene            complement(360248..360520)
FT                   /locus_tag="PputGB1_0310"
FT   CDS_pept        complement(360248..360520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0310"
FT                   /product="Fe(II) trafficking protein YggX"
FT                   /note="PFAM: Fe(II) trafficking protein YggX; KEGG:
FT                   pfl:PFL_0357 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96223"
FT                   /db_xref="GOA:B0KI37"
FT                   /db_xref="InterPro:IPR007457"
FT                   /db_xref="InterPro:IPR036766"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KI37"
FT                   /protein_id="ABY96223.1"
FT                   /translation="MTRTVMCRKYQEELPGLERPPYPGAKGQDIFEHISQKAWADWQKH
FT                   QTMLINEKRLNMMNAEDRKFLQAEMDKFFAGEEYAQAEGYVPPAE"
FT   gene            complement(360517..361584)
FT                   /locus_tag="PputGB1_0311"
FT   CDS_pept        complement(360517..361584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0311"
FT                   /product="A/G-specific adenine glycosylase"
FT                   /note="TIGRFAM: A/G-specific adenine glycosylase; PFAM:
FT                   helix-hairpin-helix motif; HhH-GPD family protein; KEGG:
FT                   pen:PSEEN5199 A/G specific adenine glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96224"
FT                   /db_xref="GOA:B0KI38"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI38"
FT                   /protein_id="ABY96224.1"
FT                   /translation="MSPEQFSSAVLDWYDEHGRHDLPWQQGITPYRVWVSEIMLQQTQV
FT                   STVLNYFDRFMQALPTVQALAEAPEDEVLHLWTGLGYYTRARNLQKAAKIVVEQHGGEF
FT                   PRSVEQLTELPGIGRSTAGAIASISMGIRAPILDGNVKRVLARYSAQAGYPGEPKVANQ
FT                   LWATAERFTPQLRANHYTQAMMDMGATLCTRSKPSCLICPLQRGCEAHLHGEETRYPEP
FT                   KPRKALPQRRTLMPLLTNPEGAILLYRRPSSGLWGGLWSMPELDDIAQLEDLAYQHGLR
FT                   LAGSHAMDGLTHTFSHFQLAIEPWLVRVDPVGEHMAEADWLWYNLATPPRLGLAAPVKK
FT                   LLERAADELIAGDAR"
FT   gene            complement(361581..363827)
FT                   /locus_tag="PputGB1_0312"
FT   CDS_pept        complement(361581..363827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0312"
FT                   /product="AsmA family protein"
FT                   /note="PFAM: AsmA family protein; KEGG: pen:PSEEN5198 AsmA
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96225"
FT                   /db_xref="InterPro:IPR007844"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI39"
FT                   /protein_id="ABY96225.1"
FT                   /translation="MKAFGKILGLGLLGLLLIIVALGFALTHLFDPNDYKDEIRQLARD
FT                   KAHVELTLNGDIGWSLFPWLGLELHEASIATLAKPKEPFADLQMLGLSVRVLPLLRREV
FT                   QMSDVRVEGLNLTLARDEQGHGNWEDIGKPLPAQNGTTAGAPAQPPAEQKPTTADNNDR
FT                   AVKLDIDSLTVNNARVQYTDAKTGQSYSAESIQLSTGPVHEGANIPLKASAFISASQPS
FT                   IKARTELAGELRFDRKLKRYNFEDMRLSGETSGEPTGGKTVTFAAQGQLLVDLAANVAS
FT                   WNGLKVSANQLRALGELNLRDLDKAPQLSGGLSIAQFNLRTFLDSIGRPLPATNDPAAF
FT                   AKLELVTRLQGTPNSLALEDLAVKLDDSTFSGRVAVEDFAKQALRLQLKGDTFDADRYL
FT                   PAKSEEAKGATAARQAEVKQQEASAVAGAGTTPLPNAPTQVAWSDDKLLPVDRLRALDL
FT                   QADLAFGSLTLDKLPIEDAQLKAIGQAGLLTLQTLRGELYNGTFEAKGTVDVRPAVPQL
FT                   GVNTNIQRVPVEHFIKTEGKEQTPPVKGLLTLTSDLTATGNSQKALVDTLNGSANFTIN
FT                   DGVLVNANLEQQLCQAIATLNRKTLSGEPRGKDTPFQELRGSLVVRNGVASNPDLKARI
FT                   PGLTVNGHGDLDLRVLGMDYNVGVIVEGDQRAMPDPACQVNERYVGVEVPLRCRGPLEL
FT                   GAKACRLDQNGLGKVAAKLAGNRLQDKIDEKLEEKLGDKVSPEVKDALKGLFKR"
FT   sig_peptide     complement(363744..363827)
FT                   /locus_tag="PputGB1_0312"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.532 at
FT                   residue 28"
FT   gene            364135..365796
FT                   /locus_tag="PputGB1_0313"
FT   CDS_pept        364135..365796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0313"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   pen:PSEEN5196 permease, MFS superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96226"
FT                   /db_xref="GOA:B0KI40"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI40"
FT                   /protein_id="ABY96226.1"
FT                   /translation="MTSTVATGSSASAPGFLSKERIIARPGFNRWLVPPAALAIHLCIG
FT                   MAYGFSVFWLPLSQALGITAPVACAADMSFMARMFSAECDWPISMLSWIYTLFFVFLGC
FT                   SAAVLGGWLEHAGPRKAGLVSALCWCGGMLLSAIGVKTHQLWLMWLGSGVIGGIGLGLG
FT                   YISPVSTLIKWFPDKRGMATGMAIMGFGGGAMVGAPLATALMGHFGNEHEVGVWQSFVA
FT                   MAAIYFVFMTAGALAYRVPPTGWKPEGWTAPVKKAGNAMVTDRHVHVSVAWKTPQFALI
FT                   WLVLCLNVSAGIGILGMASPLLQEVFAGKLLGNELTFSQLNTAQLAQIAAIAAGFTGLL
FT                   SLFNIGGRFFWASFSDYIGRKNTYFAFFALGVGLYSLVPNMGHLGNVALFVAAFCIILS
FT                   MYGGGFATVPAYLADLFGTQMVGAIHGRLLTAWAAAGVLGPVLITYLRESQLAAGVERA
FT                   AAYDMTLYILAGLLVLGFICNMLVRPVADKHFMSDAELAAERALSHDKGADSARSLEWK
FT                   AAPGSLPLVLLAWAVVVVPLAWGVWVTLQKTAVLFH"
FT   gene            365967..366560
FT                   /locus_tag="PputGB1_0314"
FT   CDS_pept        365967..366560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0314"
FT                   /product="Imidazoleglycerol-phosphate dehydratase"
FT                   /EC_number="4.2.1.19"
FT                   /note="PFAM: imidazoleglycerol-phosphate dehydratase; KEGG:
FT                   pen:PSEEN5195 imidazoleglycerol-phosphate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96227"
FT                   /db_xref="GOA:B0KI41"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KI41"
FT                   /protein_id="ABY96227.1"
FT                   /translation="MVERKASVERNTLETQVKCSINLDGSGKARFDIGVPFLEHMLDQI
FT                   ARHGLIDLDIECKGDTHIDDHHTVEDVGITLGMAFAQAIGDKKGIFRYGHAYVALDEAL
FT                   SRVVIDFSGRPGLQMHVPYTRASVGGFDVDLFQEFFQGFVNHALVTLHIDNLRGHNTHH
FT                   QIETVFKAFGRALRMAITLDERMAGQMPSTKGCL"
FT   gene            366561..367199
FT                   /locus_tag="PputGB1_0315"
FT   CDS_pept        366561..367199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0315"
FT                   /product="imidazole glycerol phosphate synthase, glutamine
FT                   amidotransferase subunit"
FT                   /note="TIGRFAM: imidazole glycerol phosphate synthase,
FT                   glutamine amidotransferase subunit; PFAM: glutamine
FT                   amidotransferase class-I; KEGG: pen:PSEEN5194 imidazole
FT                   glycerol phosphate synthetase, glutamine amidotransferase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96228"
FT                   /db_xref="GOA:B0KI42"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI42"
FT                   /protein_id="ABY96228.1"
FT                   /translation="MQTVAVIDYGMGNLHSVAKALEHVGAGKVLVTSDAAVIREADRVV
FT                   FPGVGAIRDCMAEIRRLGFDSLVREVSQDRPFLGICVGMQALLEHSEENTGVDCIGLFP
FT                   GQVRFFGKDLQEDGEHLKVPHMGWNEVAQTIDHPLWHDIPDRARFYFVHSYYINAGKPG
FT                   QVVGRGHYGVDFAAALADGSRFAVQFHPEKSHTHGLQLLQNFVAWDGRW"
FT   gene            367200..367460
FT                   /locus_tag="PputGB1_0316"
FT   CDS_pept        367200..367460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0316"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN5193 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96229"
FT                   /db_xref="InterPro:IPR018680"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI43"
FT                   /protein_id="ABY96229.1"
FT                   /translation="MSRSKTKAPIMTLAPEQERDALDTLKRFLEDRFELQLGSFEVAEV
FT                   LELFTKEIAPHYYNRAIADVQLHLKERFESIESDLWALEKP"
FT   gene            367488..368225
FT                   /locus_tag="PputGB1_0317"
FT   CDS_pept        367488..368225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0317"
FT                   /product="phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase"
FT                   /note="TIGRFAM: phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase; PFAM: histidine
FT                   biosynthesis protein; KEGG: pen:PSEEN5192
FT                   phosphoribosylformimino-5-aminoimidazole carboxamide
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96230"
FT                   /db_xref="GOA:B0KI44"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KI44"
FT                   /protein_id="ABY96230.1"
FT                   /translation="MLIIPAIDLKDGACVRLRQGRMEDSTVFSDDPVSMAAKWVEGGCR
FT                   RLHLVDLNGAFEGQPVNGEVVTAIAKRYPTLPIQIGGGIRSLDTIEHYVKAGVSYVIIG
FT                   TKAVKQPEFVAEACKAFPGKVIVGLDAKDGFVATDGWAEVSSVQVIDLAKRFEADGVSA
FT                   IVYTDIAKDGMMQGCNVPFTKALAEATRIPVIASGGIHNLGDIKALLDAKAPGIVGAIT
FT                   GRAIYEGTLDVAEAQAFCDNYQG"
FT   gene            368236..369006
FT                   /locus_tag="PputGB1_0318"
FT   CDS_pept        368236..369006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0318"
FT                   /product="imidazoleglycerol phosphate synthase, cyclase
FT                   subunit"
FT                   /note="TIGRFAM: imidazoleglycerol phosphate synthase,
FT                   cyclase subunit; PFAM: histidine biosynthesis protein;
FT                   KEGG: pen:PSEEN5191 imidazole glycerol phosphate synthase,
FT                   cyclase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96231"
FT                   /db_xref="GOA:B0KI45"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KI45"
FT                   /protein_id="ABY96231.1"
FT                   /translation="MALAKRIIPCLDVDNGRVVKGVKFENIRDAGDPVEIARRYNEQGA
FT                   DEITFLDITASVDGRDTTLHTVERMASQVFIPLTVGGGVRTVQDIRNLLNAGADKVSIN
FT                   TAAVFNPEFVGEAADRFGSQCIVVAIDAKKVSGPGETPRWEIFTHGGRKPTGLDAVEWA
FT                   KKMEGLGAGEILLTSMDQDGMKNGFDLGVTRAISDALGIPVIASGGVGNLQHLADGILE
FT                   GHASAVLAASIFHFGEYTVPEAKAYMASRGIVVR"
FT   gene            complement(369126..370304)
FT                   /locus_tag="PputGB1_0319"
FT   CDS_pept        complement(369126..370304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0319"
FT                   /product="choline ABC transporter, ATP-binding protein"
FT                   /note="KEGG: pen:PSEEN5190 glycine betaine/L-proline ABC
FT                   transporter, ATP-binding subunit; TIGRFAM: glycine
FT                   betaine/L-proline ABC transporter, ATPase subunit; choline
FT                   ABC transporter, ATP-binding protein; PFAM: ABC transporter
FT                   related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96232"
FT                   /db_xref="GOA:B0KI46"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022473"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI46"
FT                   /protein_id="ABY96232.1"
FT                   /translation="MSIIRFEDVDVIFSNKPREALSLLDQGKTREQILKQTGLVVGVEK
FT                   ANLDINKGEICVLMGLSGSGKSSLLRCINGLNTVSRGKLFVEHEGKHIDIAHCSPAELK
FT                   MMRTKRIAMVFQKFALMPWLTVRENISFGLEMQGRPEKERRKLVDEKLELVGLTQWRNK
FT                   KPDELSGGMQQRVGLARALAMDADILLMDEPFSALDPLIRQGLQDELLGLQAKLSKTIV
FT                   FVSHDLDEALKLGTRIAIMKDGRIIQYSKPEEIVLNPADEYVRTFVAHTNPLNVLCGRS
FT                   LMRSLDNCKRVNGSVCLDPGIDSWLDLGEGGALKRARQGQNGLDMQNWAPGQDVELLER
FT                   RPTVVHADIGMREALQIRYQTGNKLVLQDNDRVVGILGDTELYHALLGKNHG"
FT   gene            complement(370301..371146)
FT                   /locus_tag="PputGB1_0320"
FT   CDS_pept        complement(370301..371146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0320"
FT                   /product="choline ABC transporter, permease protein"
FT                   /note="TIGRFAM: choline ABC transporter, permease protein;
FT                   PFAM: binding-protein-dependent transport systems inner
FT                   membrane component; KEGG: pen:PSEEN5189 glycine
FT                   betaine/L-proline ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96233"
FT                   /db_xref="GOA:B0KI47"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR017784"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI47"
FT                   /protein_id="ABY96233.1"
FT                   /translation="MLIDQKIPLGQYIASFVEWLTQNGANYFDAIAQGLEFMIHGVTNA
FT                   LTWFNPFVLIALFAALAHLIQRKWALTVFVALSFLLILNLGYWQETMETLAQVTFATVV
FT                   CVVIGVPLGILAAHKPMFYTAMRPVLDLMQTVPTFVYLIPTLTLFGLGVVPGLISTVVF
FT                   AIAAPIRLTYLGICDVPQELMDAGKAFGCSRRQLLTRIELPHAMPSIAAGVTQCIMLSL
FT                   SMVVIAALVGADGLGKPVVNALNTADISLGFEAGLAIVLLAIMLDRICKQPELPVRGEA
FT                   "
FT   gene            complement(371231..372178)
FT                   /locus_tag="PputGB1_0321"
FT   CDS_pept        complement(371231..372178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0321"
FT                   /product="choline ABC transporter, periplasmic binding
FT                   protein"
FT                   /note="TIGRFAM: choline ABC transporter, periplasmic
FT                   binding protein; PFAM: Substrate-binding region of ABC-type
FT                   glycine betaine transport system; KEGG: pen:PSEEN5188
FT                   glycine betaine/L-proline ABC transporter, periplasmic
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96234"
FT                   /db_xref="GOA:B0KI48"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR017783"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI48"
FT                   /protein_id="ABY96234.1"
FT                   /translation="MKGSPSLLLVALLSTPLLAQAAEPEQCQTVRFSDVGWTDITVTTA
FT                   TTSVVLEALGYKTHTTMISVPVTYKSLATGKDLDVFLGNWMPTMENDIKQYRDAGTVET
FT                   VRANLENAKYTLAVPQALYDKGLKDFSDIPKFKKELDSKIYGIEPGNDGNRTIQSMIDK
FT                   NAFGLKDAGFKIVQSSEAGMLSQVDRAQKRGEALVFLGWEPHPMNTRFKMQYLTGGDEF
FT                   FGPDFGKATVLTNTRKGYAQECSNVGQLLKNLSFELKDESTMMGYVLDDKMKPEAAAKK
FT                   WIKDNPGKLDAWLAGVTTVDGKPGLEAAKAKLTQ"
FT   sig_peptide     complement(372113..372178)
FT                   /locus_tag="PputGB1_0321"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.980 at
FT                   residue 22"
FT   gene            372621..373997
FT                   /locus_tag="PputGB1_0322"
FT   CDS_pept        372621..373997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0322"
FT                   /product="L-serine dehydratase 1"
FT                   /EC_number="4.3.1.17"
FT                   /note="KEGG: pen:PSEEN5187 L-serine deaminase I; TIGRFAM:
FT                   L-serine dehydratase 1; PFAM: serine dehydratase alpha
FT                   chain; serine dehydratase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96235"
FT                   /db_xref="GOA:B0KI49"
FT                   /db_xref="InterPro:IPR004644"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI49"
FT                   /protein_id="ABY96235.1"
FT                   /translation="MAISVFDLFKIGVGPSSSHTVGPMRAGALFVQGLRERGELERVKR
FT                   IEVRLYGSLSATGIGHGTDNATIMGLMGEWPDAIDPTQIVPRIADLRETDTLQLDGRLP
FT                   IEFVWARDMLLLDENLPYHPNAMTLIAEGEQGELHRDTYYSVGGGFVVDAAQAASGVLD
FT                   ADQTVLPYDFNSAAELLRLCKQNDLSVSQLMMANEKVWRSEQEIRAGLHKLWEAMQECV
FT                   NNGLKYEGTLPGGLNVRRRAAKLHRSLQEIGKPNVIGSTMSAMEWVNLFALAVNEENAA
FT                   GGRMVTAPTNGAAGIIPAVLHYYMRFSDEVDESSVVDFFLGAAAVGILCKKNASISGAE
FT                   VGCQGEVGSACAMAAAGLAEVLGATPPQVENAAEIALEHNLGLTCDPVGGLVQVPCIER
FT                   NAIAAVKAINAVQMALRGDGEHFISLDQVIRTMRDTGADMHDKYKETSRGGLAVSAIEC
FT                   "
FT   gene            374447..375553
FT                   /locus_tag="PputGB1_0323"
FT   CDS_pept        374447..375553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0323"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; ThiJ/PfpI domain protein; KEGG: pen:PSEEN5186
FT                   transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96236"
FT                   /db_xref="GOA:B0KI50"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI50"
FT                   /protein_id="ABY96236.1"
FT                   /translation="MTSYTSGNPTQNRTAPQSIGFLLLDNFTLISLASAVEPLRMANQL
FT                   SGRELYRWHTLTVDGGQVWASDGLQITPDAAISNAPPIDTVIVCGGVGIQRSVTREHVT
FT                   WLQAQARQSRRLGAVCTGSWALACAGLLDGFDCSVHWECLAAMQEAFPRVNMSTRLFTL
FT                   DRNRFTSSGGTAPLDMMLHLISRDHGRELSAAISEMFVYERIRNEQDHQRVPLKHMLGT
FT                   NQPKLQEIVALMEANLEEPIDLDELAVYVSVSRRQLERLFQKYLHCSPSRYYLKLRLIR
FT                   ARQLLKQTPMSIIEVASVCGFVSTPHFSKCYREYFGIPPRDERVGSNTAQQVAMMPIPQ
FT                   AMTLSPHSGPMAALSQARNESTFASVRL"
FT   gene            complement(375612..375869)
FT                   /locus_tag="PputGB1_0324"
FT   CDS_pept        complement(375612..375869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0324"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN5185 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96237"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI51"
FT                   /protein_id="ABY96237.1"
FT                   /translation="MMHADLIDQDDLAGHLRARGFEIPAGASAEQACEAVVRGLTEPNA
FT                   RALKGMVEQMYTGSATILPAVRQAIDKQLLPALAQFNKRA"
FT   gene            complement(376135..376611)
FT                   /locus_tag="PputGB1_0325"
FT   CDS_pept        complement(376135..376611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0325"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN5184 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96238"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI52"
FT                   /protein_id="ABY96238.1"
FT                   /translation="MPALITYRTPVQEDWVDYNGHLRDAFYLLIFSYATDALMERIGLD
FT                   ADSRGQSGNSLFTLEAHINYLHEVKLGTEVWVQTQIIGFDRKRLHVYHSLHRAGFDQVL
FT                   AASEQMLLHVDLAGPKAAPFSEQSAGLLQGLLEQQQDLPPAEFVGRVISLPAAR"
FT   gene            complement(376622..377587)
FT                   /locus_tag="PputGB1_0326"
FT   CDS_pept        complement(376622..377587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0326"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase NAD-binding"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase domain
FT                   protein; 3-hydroxyacyl-CoA dehydrogenase NAD-binding; KEGG:
FT                   pen:PSEEN5183 3-hydroxyacyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96239"
FT                   /db_xref="GOA:B0KI53"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR026578"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI53"
FT                   /protein_id="ABY96239.1"
FT                   /translation="MPFITEIKTFAALGSGVIGSGWVARALAHGLDVVAWDPAPGAEQA
FT                   LRKRIANAWPALEKQGLAPGASQDRLRFVATIDECVRNADFIQESAPERLDLKLDLHAK
FT                   ISAAAKPDAIIGSSTSGLLPSEFYESSTHPERCVVGHPFNPVYLLPLVEIVGGNRTSPE
FT                   AIEAAKTIYTTLGMRPLHVRKEVPGFIADRLLEALWREALHLVNDGVATTGEIDDAIRF
FT                   GAGLRWSFMGTFLTYTLAGGDAGMRHFMSQFGPALKLPWTYLPAPELTDQLIDDVVDGT
FT                   SEQLGERSIAALERYRDDTLLAVLEAVKTSKAKHGMAFGD"
FT   sig_peptide     complement(377501..377587)
FT                   /locus_tag="PputGB1_0326"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.977) with cleavage site probability 0.964 at
FT                   residue 29"
FT   gene            complement(377606..378490)
FT                   /locus_tag="PputGB1_0327"
FT   CDS_pept        complement(377606..378490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0327"
FT                   /product="protein of unknown function DUF849"
FT                   /note="PFAM: protein of unknown function DUF849; KEGG:
FT                   pen:PSEEN5182 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96240"
FT                   /db_xref="GOA:B0KI54"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI54"
FT                   /protein_id="ABY96240.1"
FT                   /translation="MNHDVIITCALTGAGDTASKSHLVPVTPKQIAESAVEAAKAGATV
FT                   VHCHVRDPQTGRFSRDVALYREVMERIREADVDIIVNLTAGMGGDLEIGPGETPLEFGP
FT                   GTDLIGPLERLAHVEALLPEICTLDCGTLNFGDGNSIYVSTPAQLRAGAKRITELGVKA
FT                   ELEIFDTGHLWFAKQMMKEGLLEDPLFQLCLGIPWGAPADTTTMKAMVDNLPANVTWAG
FT                   FGIGRMQMPMAAQAVLLGGNVRVGLEDNLYLDRGVLASNGQLVERAAEIITRMGGRVLS
FT                   PAEGREKMNLKRR"
FT   gene            complement(378616..379560)
FT                   /locus_tag="PputGB1_0328"
FT   CDS_pept        complement(378616..379560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0328"
FT                   /product="choline ABC transporter, periplasmic binding
FT                   protein"
FT                   /note="TIGRFAM: choline ABC transporter, periplasmic
FT                   binding protein; PFAM: Substrate-binding region of ABC-type
FT                   glycine betaine transport system; KEGG: pen:PSEEN5181
FT                   substrate-binding region of ABC-type glycine transport
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96241"
FT                   /db_xref="GOA:B0KI55"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR017783"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI55"
FT                   /protein_id="ABY96241.1"
FT                   /translation="MHSLIRRSLLTLALSSIATSPLFAAEPAACKNVRLGVVNWTDVIA
FT                   TSAMAQVLLDGLGYQTKQTSASQQIIFAGIRDKRLDMFLGYWNPIMTQTITPFVDANQV
FT                   KVLDKPSLEDARATLAVPKYLYDKGLKTFADIHKFEKELGGKIYGIEPGSGANTQIKAM
FT                   ITKNQFDLGQFQLVESSEAGMLAAVDRAVRRKEAVVFFGWAPHPMNVNIDMAYLGDSQD
FT                   ALGPDEGRATVWTVTAPDYAERCPNAHRLLANLNFSAEDESRMMQPLLDHKDALESARQ
FT                   WLKDHPDDKARWLEGVTTFDGKPAADNLKLTAN"
FT   sig_peptide     complement(379486..379560)
FT                   /locus_tag="PputGB1_0328"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            379707..380651
FT                   /locus_tag="PputGB1_0329"
FT   CDS_pept        379707..380651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0329"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; ThiJ/PfpI domain protein; KEGG: pen:PSEEN5180
FT                   transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96242"
FT                   /db_xref="GOA:B0KI56"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI56"
FT                   /protein_id="ABY96242.1"
FT                   /translation="MPQIIHFLLLPGFSAMGFISALEPLRVANRFKGPSYRWQVLSLDG
FT                   GAVQASNGMSVNADAALAAGEPGGILLIVAGFDPLACYGPPLQQALRRLDHDGVILGGI
FT                   DTGAVVLAEAGLLDGHRATVHWEALEAFKENYPSLQATQELFEIDRRRITCAGGTASID
FT                   LMLDLIAQAHGSELAVQVSEQFVLGRIRQRQDHQRMQIASRYGISNKKLVKVIGEMERN
FT                   TEQPLNTQVLAEAVQVTRRQLERLFRVHLDDTPSGFYLRLRLDKARQLLRQTDMSVLEV
FT                   GVACGFESASYFTRCYRARYQRCPREDRLARAL"
FT   sig_peptide     379707..379772
FT                   /locus_tag="PputGB1_0329"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.702) with cleavage site probability 0.669 at
FT                   residue 22"
FT   gene            complement(380733..381134)
FT                   /locus_tag="PputGB1_0330"
FT   CDS_pept        complement(380733..381134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0330"
FT                   /product="protein of unknown function DUF1311"
FT                   /note="PFAM: protein of unknown function DUF1311; KEGG:
FT                   pen:PSEEN5179 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96243"
FT                   /db_xref="InterPro:IPR009739"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI57"
FT                   /protein_id="ABY96243.1"
FT                   /translation="MKSLAWLVLLAVVSGAQAGEEESTPCDNVETDQQTYACAAFNKQT
FT                   AERELKAAYDDLIQRIRDQYAEEGDQATALIGRMDAAEKLWTQLRDADCKAETYAEKPG
FT                   SKAFQAAWDTCVAQRSDDRSEYLQSIGQQ"
FT   sig_peptide     complement(381078..381134)
FT                   /locus_tag="PputGB1_0330"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.978 at
FT                   residue 19"
FT   gene            381419..382396
FT                   /locus_tag="PputGB1_0331"
FT   CDS_pept        381419..382396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0331"
FT                   /product="Membrane dipeptidase"
FT                   /EC_number="3.4.13.19"
FT                   /note="PFAM: peptidase M19 renal dipeptidase; KEGG:
FT                   pen:PSEEN5178 dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96244"
FT                   /db_xref="GOA:B0KI58"
FT                   /db_xref="InterPro:IPR008257"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI58"
FT                   /protein_id="ABY96244.1"
FT                   /translation="MSPAELHADSIVIDGLIIAKWNRELFEDMRKGGLTAANCTVSVWE
FT                   GFKATVDNIAASQKLIRDNSDLVMPVRTTADIRKAKELGKTGILFGFQNAHAFEDQIAY
FT                   VDVFKQLGVGIVQMCYNTQNLVGTGCYERDGGLSGFGREIVAEMNRVGIMCDLSHVGSK
FT                   TSEEVILESKKPVCYSHCLPSGLKEHPRNKSDEELKFIADHGGFVGVTMFAPFLAKGID
FT                   STIDDYAEAIEYTMNIVGEDAIGIGTDFTQGHGQDFFEYLTHDKGYARRLTNFGKIINP
FT                   LGIRTVGEFPNLTETLLKRGHSERVVRKIMGENWVNVLKDVWGE"
FT   gene            382474..383004
FT                   /locus_tag="PputGB1_0332"
FT   CDS_pept        382474..383004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0332"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN5177 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96245"
FT                   /db_xref="InterPro:IPR004096"
FT                   /db_xref="InterPro:IPR024096"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI59"
FT                   /protein_id="ABY96245.1"
FT                   /translation="MAKIAPQLPIEVDSETGVWTSDALPMLYVPRHFFVNNHIGIEEVL
FT                   GADAYAEILYKAGYKSAWHWCEKEAECHGLEGVAVFEHYMKRLSQRGWGLFEIQDIDLD
FT                   KGTCSVKLKHSAFVYVYGKCGRKVDYMFTGWFAGAMDQILAARGSKIRTVAEQVYGGSE
FT                   EGHEDGLFVTKPL"
FT   gene            383020..385080
FT                   /locus_tag="PputGB1_0333"
FT   CDS_pept        383020..385080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0333"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase;
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; HI0933 family protein; KEGG: pen:PSEEN5176
FT                   oxidoreductase, FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96246"
FT                   /db_xref="GOA:B0KI60"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI60"
FT                   /protein_id="ABY96246.1"
FT                   /translation="MAFEAMFQPIQIGKLTIRNRVLSTAHAEVYATDGGMTTDRYVKYY
FT                   EEKAKGGIGLAICGGSSVVAIDSPQEWWASVNLSTDRIIPHFQNLADAMHKHGAKIMIQ
FT                   ITHMGRRSRWDGFNWPTLMSPSGIREPVHRATCKTIEVEEIWRVIGNYAQAARRAKEGG
FT                   LDGVELSAVHQHMIDQFWSPRVNKRTDEWGGTFEGRMKFGLEVLKAVRAEVGDDFCVGM
FT                   RICGDEFHPDGLSHEDMKQIAAYYDSTGMLDFIGVVGSGCDTHNTLANVIPNMSYPPEP
FT                   FLHLAAGIKEVVKVPVLHAQNIKDPNQATRILEGGYVDMVGMTRAHMADPHLIAKIKMG
FT                   QIDQIKQCVGANYCIDRQYQGLDVLCIQNAATSREYMGVPHIIEKTTGVKRKVVVVGAG
FT                   PAGMEAARVAAERGHDVTLFEKKDQIGGQITIAAKAPQRDQIAGITRWYQLELARLKVD
FT                   LRLGTAADVATIQDLRPDVIVLAVGGHSFLEQNEHWGAAEGLVVSSWDVLDGKVAPGKN
FT                   VLVYDTICEFTGMSVADFIADKGSQVEIVTDDIKPGVAMGGTTFPTYYRSMYPKEVIMT
FT                   GDMMLEKVYREGDKLVAVLENEYTGAKEERVVDQVVVENGVRPDEELYYALKDGSRNKG
FT                   QIDVEALFAIKPQPILSQPGEGYLLYRIGDCVAQRNVHAAIYDALRLCKDF"
FT   gene            385289..387241
FT                   /locus_tag="PputGB1_0334"
FT   CDS_pept        385289..387241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0334"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: protein of unknown function DUF224
FT                   cysteine-rich region domain protein; KEGG: pen:PSEEN5175
FT                   iron-sulfur cluster-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96247"
FT                   /db_xref="GOA:B0KI61"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR021872"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI61"
FT                   /protein_id="ABY96247.1"
FT                   /translation="MLNTLLPILLFAALGLAVLGALRRVRMWRRGRAAKVDLIGGLLAM
FT                   PRRYLVDLHHVVERDKYMSKTHVATAGGFVLSAALAILVHGFGLQSKILGYALLVATVI
FT                   MFSGAIFVFKRRLNPPSRLSKGPWMRLPKSLLAFAASFFIATLPVAGILPANTGGWVMV
FT                   VVLGLGVLWGVSELFFGMTWGGPMKHAFAGALHLAWHRRAERFGGGRSTGLKPLDLEDP
FT                   NAPLGVEKPVDFTWNQLLGFDACVQCGKCEAMCPAFAAGQPLNPKKLIQDMVIGLAGGT
FT                   DAQFAGSPYPGKPIGEHGGNPHQPIVNGLVDAETLWSCTTCRACVEECPMMIEHVDAIV
FT                   DMRRHLTLEKGATPNKGAEVLDNLIATDNPGGFAPGGRMNWAADLNLQLLSEVQSTEVL
FT                   FWVGDGAFDMRNQRTLRSFVKVLKASGVDFAVLGLEERDSGDVARRLGDEATFQQLAKR
FT                   NIQTLGKYKFQRIVTCDPHSFHVLKNEYGALGGDYQVQHHSTYIAELIAAKKLNLGQHK
FT                   GGSVTYHDPCYLGRYNGEYEAPREVLKALGIEVREMQRSGFRSRCCGGGGGAPITDIPG
FT                   KQRIPDMRMDDIRETEAELVAVGCPQCTAMLEGVVEPRPQIKDLAELVADVLIEEDAPT
FT                   GPKPQTAKREPAEVH"
FT   sig_peptide     385289..385351
FT                   /locus_tag="PputGB1_0334"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.976) with cleavage site probability 0.930 at
FT                   residue 21"
FT   gene            387241..388473
FT                   /locus_tag="PputGB1_0335"
FT   CDS_pept        387241..388473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0335"
FT                   /product="Electron transfer flavoprotein alpha subunit"
FT                   /note="PFAM: Electron transfer flavoprotein
FT                   alpha/beta-subunit; Electron transfer flavoprotein alpha
FT                   subunit; KEGG: pen:PSEEN5174 electron transfer
FT                   flavoprotein, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96248"
FT                   /db_xref="GOA:B0KI62"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI62"
FT                   /protein_id="ABY96248.1"
FT                   /translation="MSDIIRRDPRAEWIARNRLHPLHAAMQTQQTRWMGPNGILRKNPH
FT                   AIAAGFIGPAGIKRIDRSGAQQGTGVGGRRTAAAEVTLPLHQVPAPAFYIAVVPDMVGG
FT                   RLSSHDRDLLGLAHSLAGSDGAVLAVVFNEHKDSNFSTAGVDRLLVIEGEAFEGYAPEQ
FT                   LVQGLRAVDNQFTPRHWLLPDSRTGGGELGRRLGAALGERPATRVWQVKDGQCIGRAGA
FT                   GQQDLQRTVPRLILASAECAEPVSETRHEALPVELSTSVARSLSRIEDLGSVAVDPATI
FT                   AMAEAEFIVSGGNGVKDWDLYHQATAALGATEGASRVAVDDGFMPRNRQVGATGTWVTA
FT                   RVYVAVGISGAIQHLQGIGACDKVVAINMDPGCDMIKRADLSVIGDSSAILKALIEAVD
FT                   NFRSGGQRDAA"
FT   gene            388484..389254
FT                   /locus_tag="PputGB1_0336"
FT   CDS_pept        388484..389254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0336"
FT                   /product="Electron transfer flavoprotein
FT                   alpha/beta-subunit"
FT                   /note="PFAM: Electron transfer flavoprotein
FT                   alpha/beta-subunit; KEGG: pen:PSEEN5173 electron transfer
FT                   flavoprotein, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96249"
FT                   /db_xref="GOA:B0KI63"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI63"
FT                   /protein_id="ABY96249.1"
FT                   /translation="MSTKVISLVSIGAHPSSGRARRAEQDARAVELGLQLAGDNLQVVH
FT                   AGDPQEEALRAYLGMGLDHLDVLEQPAGADVLGVLGDYLRDAGAQLVLTGSQAETGEGS
FT                   GMLPFLLAEKLGWPLIVGLAEVESIDNGTAQVLQALPRGQRRRLKVRLPLLATVDNAAP
FT                   KPRQSAFGPARRGVLAARNVAIVDDELLAEAELQPARPRPKRLKVIKAKSGADRMKAAT
FT                   AKASGGGGKVLKDVSPQEGAEAILKLLVEEGVLR"
FT   gene            390130..390954
FT                   /locus_tag="PputGB1_0337"
FT   CDS_pept        390130..390954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0337"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: psb:Psyr_4720 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96250"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI64"
FT                   /protein_id="ABY96250.1"
FT                   /translation="MYLVHLLATDSLRSVMNDSTDVRRAYTAYGLVNIQGGPMSAFCGE
FT                   YRDPLAGYYHLGNGYRQFNPAIMRFHGPDGLSPFGEGGLNAYMYCEADPVNRIDPSGKV
FT                   PISLLQRLLTTTLHVVSPTALIFGPPPKGALAVNATRLALMGSTTTVAGAGLGFAGVAV
FT                   APYVSATGTGLLLAGGVTRIAKALWDNRSALWQNIKNNSRSNLRTIFTGRVEKKKNKTT
FT                   PLNSPKRVSVQAVFMVENELTRTGSTVSASIVTHTTENGANIRQAQRERPSL"
FT   gene            complement(390982..392274)
FT                   /locus_tag="PputGB1_0338"
FT   CDS_pept        complement(390982..392274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0338"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   pen:PSEEN5169 iron-sulfur cluster-binding protein, Rieske
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96251"
FT                   /db_xref="GOA:B0KI65"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI65"
FT                   /protein_id="ABY96251.1"
FT                   /translation="MDVTATLSLGDPLEPARKATAEMLQTRERTYSLPQPFYTDERLFQ
FT                   IDMQEIFQKEWLIAGMTCEIPAKGNYITLQIGNNPILVVRGAEGKVHAFHNVCRHRGSR
FT                   LCVSDKGKVAKLVCHYHQWTYELDGRLLFAGTEMGADFDMKQYGLKPVNVKVAGGYIFI
FT                   SLAENPPAIDEFLATLEHYMEPYDMENTKVAVQTTLMEKANWKLVLENNRECYHCSGSH
FT                   PELLQTLLEWDDTNDPRASQEFKDHVAASAAAWEAEKIPYLHKSHGLRNRIVRMPLLKG
FT                   TVSMTMDGKQACQKLMGRIKNPDLGSMRILHLPHSWNHCMGDHMIVFTVWPISAQETMV
FT                   TTKWLVHKDAVEGVDYDPERMRKVWDATNDQDRRLAEENQRGINSTAYQPGPYSKTYEF
FT                   GVVNFIDWYSGRMLNNLGAEPAAYLKEVQAQ"
FT   gene            392570..393670
FT                   /locus_tag="PputGB1_0339"
FT   CDS_pept        392570..393670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0339"
FT                   /product="Oxidoreductase FAD-binding domain protein"
FT                   /note="PFAM: ferredoxin; oxidoreductase FAD/NAD(P)-binding
FT                   domain protein; Oxidoreductase FAD-binding domain protein;
FT                   KEGG: pen:PSEEN5168 oxidoreductase, FAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96252"
FT                   /db_xref="GOA:B0KI66"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR001834"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI66"
FT                   /protein_id="ABY96252.1"
FT                   /translation="MSDTFLNPVTTQTWANGRHIVRCVKVIQETWDVRTFCFMADQPIM
FT                   FFFKPGQFVTLELEIEGKPVMRSYTISSSPSVPYSFSITVKRVPGGLVSNFLHDTMHEG
FT                   AELPVHGPVGLFNAIDFPAGKALYLSGGVGITPVMSMARWFYDTNANVDMVFVHSARSP
FT                   KDIIYHRELEQMASRIPNFSLHIICEKHGLGEPWAGYRGYLNQRLMELIAPDYMERVVF
FT                   CCGPTPYMTAVKRMLEAVGFDMKNYHEESFGATPAEAKADAVEHAEQAAEAPELDVSDL
FT                   NLVEFIGSEKSIRIAPGETVHAAAAKVGLMIPKACGMGICGTCKVLKLGGEVEMEHNGG
FT                   ITEEDEAEGYILSCCSVPKGDVRIDY"
FT   gene            complement(393815..395440)
FT                   /locus_tag="PputGB1_0340"
FT   CDS_pept        complement(393815..395440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0340"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: pen:PSEEN5167
FT                   methyl-accepting chemotaxis transducer"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96253"
FT                   /db_xref="GOA:B0KI67"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI67"
FT                   /protein_id="ABY96253.1"
FT                   /translation="MSLRNMNIAPRALLGFALIGLLMLGLGIFSLVQMGNIRQAGVAIE
FT                   QVSVPSIKILDELTALNLRMRTLSYRLLLNREPETQRDTLNLLDQRNSQIDRARQAYLP
FT                   MIGAADEQAAFDQYGLLLNQYRQLEARMRTLSQADRLDELRDLLNRDLLANSEQINKVM
FT                   DTLVRINTDQTRATNDKAASQYAAAFALVIGLLVAATVLTFACAFLLTRSIVKPIEDAL
FT                   KSAEQVADGDLTHIIRAEGTDEAARLLRAMARMQDKLRDTLQQIAGSATQLASAAEELN
FT                   AVTDESARGLQQQNNEIEQAATAVTEMTSAVEEVARNAVSTSEASSEASRSTGDGRDLV
FT                   METVGAIERMSGDVQATAKLITHLAEQSRDIGKVLDVIRGLADQTNLLALNAAIEAARA
FT                   GEAGRGFAVVADEVRALAHRTQQSTSEIERMIGSIQGGTEEAVESMRTSTERAESTLNI
FT                   ARGAGMALDTIAGAVAQINERNLVIASAAEEQAQVAREVDRNLVNINDLSVQSATGAHQ
FT                   TSAASAELSRLAVDLNGLVARFRT"
FT   sig_peptide     complement(395333..395440)
FT                   /locus_tag="PputGB1_0340"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.981) with cleavage site probability 0.624 at
FT                   residue 36"
FT   gene            395706..395936
FT                   /locus_tag="PputGB1_0341"
FT   CDS_pept        395706..395936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0341"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN5166 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96254"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI68"
FT                   /protein_id="ABY96254.1"
FT                   /translation="MLEASLNQIEQLVSDLMQKNAQLTEQNTALGQELAQAKEENETLQ
FT                   LSLMEQEEKNGATAARIQALVERASAGVVGA"
FT   gene            395933..396235
FT                   /locus_tag="PputGB1_0342"
FT   CDS_pept        395933..396235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0342"
FT                   /product="protein of unknown function DUF710"
FT                   /note="PFAM: protein of unknown function DUF710; KEGG:
FT                   pen:PSEEN5165 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96255"
FT                   /db_xref="InterPro:IPR007838"
FT                   /db_xref="InterPro:IPR036192"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI69"
FT                   /protein_id="ABY96255.1"
FT                   /translation="MRLQEQPINVVSILGIDYSIKAPEGQEETLAQAVRMLNTALNETK
FT                   RQYPTLIGDKLLVLAALNLCSKQVELQKEHQQTLARTQAQIDATVDAIVRTIAES"
FT   gene            396440..398377
FT                   /locus_tag="PputGB1_0343"
FT   CDS_pept        396440..398377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0343"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: pen:PSEEN5164
FT                   methyl-accepting chemotaxis transducer"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96256"
FT                   /db_xref="GOA:B0KI70"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI70"
FT                   /protein_id="ABY96256.1"
FT                   /translation="MRIWRKSIQWQLITSMGAALLASILVVVVIFTVALNRLTERYLVD
FT                   TALPASIEAIRNDIERMLGQPLVAAADIAGNTLLRDWLAAGEEPAQAAQFTEYLTAAKQ
FT                   RNQAFTALFAATETGHYYNENGLDRTLSRSNPKDKWFYGYIDSGAERLINIDIDGATGE
FT                   LALFIDYRVEKNGQLVGVAGMGLRMTELSKLIHDFSFGEHGKVFLVRNDGLIQVHPDAA
FT                   FSGKRQLTEQLGADAAKGVMTGGEGLRSRRFSRDGESYLALGLPLRDLNWTLVAEVPES
FT                   EIYAQMHQAVWLTSLIGGAVALLSLLLVVLLARGLVRPIRRVTGALVQIGSGAGDLSHR
FT                   LDDSRQDELGDLARGFNRFLDSQRSLIGEVLSTSERLHRAVEQVTQVVDNTAERSGRQQ
FT                   EMTEMVATAVHEMGLTVQDIARNAGDAAQASQSARDEALQAREVVQRSIRGIEGMSGDI
FT                   GKAADAVTQLADEVASIDEVLAVIRSISEQTNLLALNAAIEAARAGEMGRGFAVVADEV
FT                   RTLARRTQLSTDEVQQMIQRLKQGAGSAVSSMQAGQQATGSGVESSQRTGASLGAITDQ
FT                   VEHISDMNHQVATATEEQSAVTEEINRTVQGISDLARETAAEVQGCREECQALRGLADD
FT                   LARQMGGFRL"
FT   sig_peptide     396440..396550
FT                   /locus_tag="PputGB1_0343"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.967) with cleavage site probability 0.294 at
FT                   residue 37"
FT   gene            complement(398431..399471)
FT                   /locus_tag="PputGB1_0344"
FT   CDS_pept        complement(398431..399471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0344"
FT                   /product="Threonine aldolase"
FT                   /EC_number="4.1.2.5"
FT                   /note="PFAM: aromatic amino acid beta-eliminating
FT                   lyase/threonine aldolase; KEGG: pen:PSEEN5163
FT                   low-specificity L-threonine aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96257"
FT                   /db_xref="GOA:B0KI71"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR026273"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI71"
FT                   /protein_id="ABY96257.1"
FT                   /translation="MTDKSQQFASDNYSGICPEAWAAMEKANHGHDRAYGDDQWTERAS
FT                   EYFRNLFETDCEVFFAFNGTAANSLALASLCQSYHSVICSETAHVETDECGAPEFFSNG
FT                   SKLLTAASVNGKLTPQSIREVALKRQDIHYPKPRVVTITQATEVGTVYRPDELKAISAT
FT                   CKELGLNLHMDGARFTNACAFLGCSPAELTWKAGVDVLCFGGTKNGMAVGEAILFFNRQ
FT                   LAEDFDYRCKQAGQLASKMRFLSAPWVGLLEDGAWLRHGNHANHCAQLLASLVSDLPAV
FT                   ELMFPVEANGVFLQMPEHAIEALRGKGWRFYTFIGSGGARFMCSWDTEEARVRELAADI
FT                   RSIITA"
FT   gene            399811..401064
FT                   /locus_tag="PputGB1_0345"
FT   CDS_pept        399811..401064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0345"
FT                   /product="Glycine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /note="PFAM: glycine hydroxymethyltransferase; KEGG:
FT                   pen:PSEEN5162 serine hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96258"
FT                   /db_xref="GOA:B0KI72"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI72"
FT                   /protein_id="ABY96258.1"
FT                   /translation="MFSKQDQIQGYDDALLAAMNAEEQRQEDHIELIASENYTSKRVMQ
FT                   AQGSGLTNKYAEGYPGKRYYGGCEHVDKVEALAIERAKQLFGADYANVQPHSGSSANGA
FT                   VYLALLQAGDTILGMSLAHGGHLTHGAKVSSSGKLYNAVQYGIDTNTGLIDYDEVERLA
FT                   VEHKPKMIVAGFSAYSKTLDFPRFRAIADKVGALLFVDMAHVAGLVAAGLYPNPIPFAD
FT                   VVTTTTHKTLRGPRGGLILAKSNEEIEKKLNAAVFPGAQGGPLMHVIAAKAVCFKEALE
FT                   PGFKAYQQQVIENAQAMAQVFIDRGYDVVSGGTDNHLFLVSLIRQGLTGKDADAALGRA
FT                   HITVNKNAVPNDPQSPFVTSGLRIGTPAVTTRGFKVAQCVALAGWICDILDNLGDADVE
FT                   ADVAKNVAALCADFPVYR"
FT   gene            401080..402330
FT                   /locus_tag="PputGB1_0346"
FT   CDS_pept        401080..402330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0346"
FT                   /product="sarcosine oxidase, beta subunit family"
FT                   /note="TIGRFAM: sarcosine oxidase, beta subunit family;
FT                   PFAM: FAD dependent oxidoreductase; KEGG: pen:PSEEN5161
FT                   sarcosine oxidase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96259"
FT                   /db_xref="GOA:B0KI73"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006278"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI73"
FT                   /protein_id="ABY96259.1"
FT                   /translation="MQRYSGFGLFKHSLSHHENWQRMWRTPTPKKVYDVVIVGGGGHGL
FT                   ATAYYLAKEHGITNVAVIEKGYLGGGNTARNTTIVRSNYLWDESAHLYEHAMKLWEGLS
FT                   QDLNYNVMFSQRGVYNLCHTLQDMRDSERRVSANRLNGVDGELLNTAQVAAEIPYLDCS
FT                   KNTRYPILGATVQRRGGVARHDAVAWGFARAADALGVDLIQQTEVIGFRKENGAVIGVE
FT                   TNKGFIGAKRVGVVTAGNSGHMAKLAGFRLPLESHPLQALVSEPIKPIIDSVIMSNAVH
FT                   GYISQSDKGDLVIGAGIDGWVGYGQRGSYPVIEHTLQAIVEMFPNLSRVRMNRQWGGIV
FT                   DTSPDACPIITKTPVKNMFFNCGWGTGGFKATPGSGNVFAASLAKGEMHPLAAPFSMDR
FT                   FYNGALIDEHGAAAVAH"
FT   gene            402345..402680
FT                   /locus_tag="PputGB1_0347"
FT   CDS_pept        402345..402680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0347"
FT                   /product="sarcosine oxidase, delta subunit family"
FT                   /note="TIGRFAM: sarcosine oxidase, delta subunit family;
FT                   PFAM: Sarcosine oxidase delta subunit heterotetrameric;
FT                   KEGG: pen:PSEEN5160 sarcosine oxidase, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96260"
FT                   /db_xref="GOA:B0KI74"
FT                   /db_xref="InterPro:IPR006279"
FT                   /db_xref="InterPro:IPR038561"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI74"
FT                   /protein_id="ABY96260.1"
FT                   /translation="MLHIFCPHCGELRSEEEFHASGQAHIARPLDPNACSDEEWGTYMF
FT                   YRDNPRGIHHELWDHVAGCRQYFNVTRDTVTYEILETYKIGEKPQVTANGKAANAPSTV
FT                   KGQGEKV"
FT   gene            402677..405691
FT                   /locus_tag="PputGB1_0348"
FT   CDS_pept        402677..405691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0348"
FT                   /product="sarcosine oxidase, alpha subunit family"
FT                   /note="TIGRFAM: sarcosine oxidase, alpha subunit family;
FT                   PFAM: glycine cleavage T protein (aminomethyl transferase);
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: pen:PSEEN5159 sarcosine oxidase
FT                   (alpha subunit) oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96261"
FT                   /db_xref="GOA:B0KI75"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006277"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041117"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="InterPro:IPR042204"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI75"
FT                   /protein_id="ABY96261.1"
FT                   /translation="MSQTYRLASGGRIDRSKVLNFTFNGKTYQGYAGDSLAAALLANGV
FT                   DIVGRSFKYSRPRGIIAAGTEEPNAILQIGSSEATQIPNVRATQQALYAGLVATSTNGW
FT                   PNVNNDVMGILGKVGGSMMPPGFYYKTFMYPKSFWMTYEKYIRKAAGLGRAPLQNDPDS
FT                   YDYMNQHCDVLIVGAGPAGLAAALAAARSGARVILADEQEEFGGSLLDTRETLDGKPAA
FT                   DWVNAVVKELEGLPEVTLLPRATVNGYHDHNFLTIHERLTDHLGDRAPIGQVRHRVHRV
FT                   RAKRVVLAPGAHERPLVYGNNDVPGNMLAGAVSTYIRRYGVAPGRKLVLSTNNDHAYRA
FT                   ALDWHDAGLQVVAIADARHNPRGSLVEEARAKGIRILTSSAVVEAKGSKHVTGARVAAI
FT                   DVQAHKVTSPGETLECDLIASSGGYSPIVHLASHLGGRPVWRDDILGFVPGDAPQKREC
FT                   VGGINGVYALGDVIADGFEGGVRAATEAGFKATVGTLPKTVARKEEATVALFQVPHDKG
FT                   TKGPKQFVDQQNDVTAAGIELATREGFESVEHVKRYTALGFGTDQGKLGNINGLAIAAR
FT                   SIGITIPEMGTTMFRPNYTPVTFGAVAGRHCGHLFEPVRFTALHAWHVKNGAEFEDVGQ
FT                   WKRPWYFPKAGEDIHAAVARECKAVRDSVGLLDASTLGKIDIQGPDAREFLNRIYTNTW
FT                   TKLDVGKARYGLMCKEDGMVFDDGVTACVGDNHFIMTTTTGGAARVLQWMELYHQTEWP
FT                   ELKVYFTSVTDHWATMTLSGPNSRKLLSELTDIDMDKEAFPFMTWKEGNVGGVPARVFR
FT                   ISFTGELSYEVNVQANYAMGVLEQIIEAGKKYNLTPYGTETMHVLRAEKGFIIVGQDTD
FT                   GSMNPDDLNMSWCVGRNKPFSWIGLRGMNREDCVRENRKQLVGLKPVDPTKWLPEGAQL
FT                   VFDPKQPIPMDMVGHVTSSYASNSLGYSFAMGVVKGGLKRMGERVYSPQADGSVIEAEI
FT                   VSSVFFDPKGERQNV"
FT   gene            405866..406498
FT                   /locus_tag="PputGB1_0349"
FT   CDS_pept        405866..406498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0349"
FT                   /product="sarcosine oxidase, gamma subunit family"
FT                   /note="TIGRFAM: sarcosine oxidase, gamma subunit family;
FT                   PFAM: Sarcosine oxidase gamma subunit; KEGG: pen:PSEEN5158
FT                   sarcosine oxidase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96262"
FT                   /db_xref="GOA:B0KI76"
FT                   /db_xref="InterPro:IPR006280"
FT                   /db_xref="InterPro:IPR007375"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI76"
FT                   /protein_id="ABY96262.1"
FT                   /translation="MSAINVFQQNPGAEAKAQSPLHHADLASLVGKGRKNAGVTLRERK
FT                   FLGHLTLRGDGHNPEFAAGVHKALGLELPVALTVVANNDMSLQWVGPDEWLLIVPGGQE
FT                   LAVEQKLRAALDGQHIQVVNVSGGQSLLELRGPNVREVLMKSTSYDVHPNNFPVGKAVG
FT                   TVFAKSQLVIRRTAEDTWELVIRRSFADYWWLWLQDASAEYGLSIEA"
FT   gene            406511..407368
FT                   /locus_tag="PputGB1_0350"
FT   CDS_pept        406511..407368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0350"
FT                   /product="formyltetrahydrofolate deformylase"
FT                   /note="TIGRFAM: formyltetrahydrofolate deformylase; PFAM:
FT                   formyl transferase domain protein; KEGG: pen:PSEEN5157
FT                   formyltetrahydrofolate deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96263"
FT                   /db_xref="GOA:B0KI77"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004810"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR041729"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI77"
FT                   /protein_id="ABY96263.1"
FT                   /translation="MSRAPDTWILTADCPSMLGTVDVVTRYLFEQRCYVTEHHSFDDRQ
FT                   SGRFFIRVEFRAPDGFDEDGFRAGLAERSEAFGMAFELTAPNHRPKVVIMVSKADHCLN
FT                   DLLYRQRIGQLGMDVVAVVSNHPDLEPLAQWHKIPYYHFALDPKDKPGQERKVLQVIEE
FT                   TGAELVILARYMQVLSPELCRRLDGWAINIHHSLLPGFKGAKPYHQAYNKGVKMVGATA
FT                   HYINNDLDEGPIIAQGVEVVDHSHYPEDLIAKGRDIECLTLARAVGYHIERRVFLNANR
FT                   TVVL"
FT   gene            407643..408842
FT                   /locus_tag="PputGB1_0351"
FT   CDS_pept        407643..408842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0351"
FT                   /product="formaldehyde dehydrogenase,
FT                   glutathione-independent"
FT                   /note="TIGRFAM: formaldehyde dehydrogenase,
FT                   glutathione-independent; PFAM: Alcohol dehydrogenase
FT                   zinc-binding domain protein; Alcohol dehydrogenase GroES
FT                   domain protein; KEGG: pen:PSEEN5156 formaldehyde
FT                   dehydrogenase, glutathione-independent"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96264"
FT                   /db_xref="GOA:B0KI78"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014184"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI78"
FT                   /protein_id="ABY96264.1"
FT                   /translation="MSGNRGVVYLGAGKVEVQKIDYPKMQDPRGKKIEHGVILKVVSTN
FT                   ICGSDQHMVRGRTTAQVGLVLGHEITGEIVEKGSDVERMQIGDLVSVPFNVACGRCRSC
FT                   KEMHTGVCLTVNPARAGGAYGYVDMGDWTGGQAEYVLVPYADFNLLKLPERDKAMEKIR
FT                   DLTCLSDILPTGYHGAVTAGVGPGSTVYVAGAGPVGLAAAASARLLGAACVIVGDLNPA
FT                   RLAHAKSQGFEVVDLSKDTPLHEQIVDILGEPEVDCAVDAVGFEARGHGHEGAKHEAPA
FT                   TVLNSLMQVTRVAGSIGIPGLYVTEDPGAVDAAAKIGALSIRFGLGWAKSHSFHTGQTP
FT                   TMKYNRQLMQAIMWDRINIAEVVGVQVINLDQAPEGYGEFDAGVPKKFVIDPHKMWGAA
FT                   "
FT   gene            complement(408885..409829)
FT                   /locus_tag="PputGB1_0352"
FT   CDS_pept        complement(408885..409829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0352"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: psb:Psyr_0343 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96265"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI79"
FT                   /protein_id="ABY96265.1"
FT                   /translation="MSKASNCSLFFYQGDKLITVKQVDKHRAIFRNAEQPLAEQQTNGD
FT                   RSIALLATNDKGSVLSVESEGDKEDHPYSAYGHDPSLPSLRTTTGFNGEVFDIGSNCYL
FT                   LGLGYRAYSPRLGRFVAADNWSPFGQGGLNAYCYCEGDPVNSSDQSGHMRVYLANGQIM
FT                   RTSKNAAISAGSWLKPLDFNRTAHRKALIDTKLQMPRRVKADNSVTEGRTHIRVFELFQ
FT                   NPGSSTEVAHVRAMDMQTFKRNRAEIGVLTRLHDEGDRAPALNYLARAAALMNKNEKLS
FT                   QIGEALWRKGITPNWPTTTLPADARREIRKSNS"
FT   gene            complement(410342..411292)
FT                   /locus_tag="PputGB1_0355"
FT   CDS_pept        complement(410342..411292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0355"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: psb:Psyr_4870 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96266"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI80"
FT                   /protein_id="ABY96266.1"
FT                   /translation="MKRKPSTAAFFYRNHNTVTKVSSSSSTTIFGTDSRPLGQKTSETS
FT                   EAKLLLVDDKNSIYSASEVNNIATQYSPYGHATNLPFLLGYNGELAQNHASIYMLGNGY
FT                   RAYMPQLMRFISPDGKSPFGRGGVNAYAYCSNDPINYTDPSGQARNPLRTPVALTLTKS
FT                   RRVVNGKLYRVENIQGNKRFVSAPALSESEKIHLKGFIDEQTGEIDRTRARINQIKHSH
FT                   GRPIQEAENLEAIIDKGNASLKTYTDALNWTKDRRAVKNTIADIESRISEARAKLTDIT
FT                   TKHSAHLEKYRTYNEHHKQLTSDLENANAILRASS"
FT   gene            411493..412074
FT                   /locus_tag="PputGB1_0356"
FT   CDS_pept        411493..412074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0356"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN5155 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96267"
FT                   /db_xref="InterPro:IPR021302"
FT                   /db_xref="UniProtKB/TrEMBL:B0KI81"
FT                   /protein_id="ABY96267.1"
FT                   /translation="MKAFTLATLMTLAASPVFAFNLSDAANAVSAMQNQKQSQQAQVQA
FT                   PEAQANLLNTLGSELKITPEQAVGGAGAMLGLARNNLSSDDYGQLTKAVPGLDLLAGAN
FT                   ALGGLSGLGDLLGKNSESQSALSNALGNNVENRSDLDTAFKALGMDTGMIGQFAPLILQ
FT                   YLGQQGIAGSLLQNLGSLWTTPAPLTQPSV"
FT   sig_peptide     411493..411552
FT                   /locus_tag="PputGB1_0356"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.971 at
FT                   residue 20"
FT   gene            complement(412309..413658)
FT                   /locus_tag="PputGB1_0357"
FT   CDS_pept        complement(412309..413658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0357"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   pae:PA0322 probable transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96268"
FT                   /db_xref="GOA:B0KJ18"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ18"
FT                   /protein_id="ABY96268.1"
FT                   /translation="MANPPSSAPAQLRRVLGLPALVFFGLVYMVPLTIFTTYGIVTELT
FT                   GGRTAGAYLVTLVAMLFTAASYSFMVKRFPVAGSAYSYTNMAFGPNIGFLAGWSLLLDY
FT                   LFLPMINYLLIGLFLNIAFPAVPTWAFVLACIALVTVLNVVGINSVAKTSNLIVGAQIV
FT                   FIGVFVALSCQTLAGQPLDLLSPLLGDGSKPGFGHLMAGAAVLCLSFLGFDAVSTLAEE
FT                   CRDARRDVPRAIILTTLFAGLLFTVLAYVSQLVLPGSSFANADAAANEVMFKAGGQFLT
FT                   NFFTAAYVAGSLGSALASQAAVSRILFTMGRDNVLPRRSFGYLSPRFGTPVFAIALVSA
FT                   FSLLALVIDLSTLASLISFGALVAFSAVNLAVVKTHLMDDTSQRNAKNLLRYGVVPLVG
FT                   LGLTLWLWTSLSALTLVIGLCWFALGLVYLAVLTAGFRRPVHLVDFTEAA"
FT   gene            complement(413903..414790)
FT                   /locus_tag="PputGB1_0358"
FT   CDS_pept        complement(413903..414790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0358"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; KEGG:
FT                   pen:PSEEN5154 acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96269"
FT                   /db_xref="GOA:B0KJ19"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ19"
FT                   /protein_id="ABY96269.1"
FT                   /translation="MRRLLTGILTTTLLLLNTVVLICPLLVFALLKLVLPGRGRDYASW
FT                   AVMWVAETWSEIDKAIFALCIPTRWDIRGVENLRKDTSYLAVSNHQTWVDIPALIESLN
FT                   RRTPFFKFFLKKELIWVPLLGLAWWGLDYPFMKRYSKAFLEKHPELKGKDLEITKAACE
FT                   LFKRQPVTVVNYLEGTRFTEAKRQEQQSPYRYLLKPKAGGVAFVLAALGEQLDALLDVT
FT                   IVYPGNKAPGFWALLNGSISRVIIDIQVRELDPALWAGDYENDPEFRQTVQAWVNQLWV
FT                   EKDQRIEQLRQEMR"
FT   sig_peptide     complement(414701..414790)
FT                   /locus_tag="PputGB1_0358"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.951) with cleavage site probability 0.933 at
FT                   residue 30"
FT   gene            414973..415473
FT                   /locus_tag="PputGB1_0359"
FT   CDS_pept        414973..415473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0359"
FT                   /product="protein of unknown function DUF785"
FT                   /note="PFAM: protein of unknown function DUF785; KEGG:
FT                   pen:PSEEN5153 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96270"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ20"
FT                   /protein_id="ABY96270.1"
FT                   /translation="MKPLLALLSLLAMPVMAAEPTIYGRYENIALPELGETLKAKMDTG
FT                   AFTASLSAKDIELFNRDGEEWVRFRLATKDSDGKVYEHKVSRISKIKGRADEEEEGDAP
FT                   EISKRPVVDLELCLGDVKRTVEVNLVDRSSFNYPLLVGSKALREFKAAVNPAKKFTAGK
FT                   PDC"
FT   sig_peptide     414973..415026
FT                   /locus_tag="PputGB1_0359"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 18"
FT   gene            415654..416334
FT                   /locus_tag="PputGB1_0360"
FT   CDS_pept        415654..416334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0360"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: pen:PSEEN5152 two-component
FT                   response regulator CreB"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96271"
FT                   /db_xref="GOA:B0KJ21"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ21"
FT                   /protein_id="ABY96271.1"
FT                   /translation="MPHILIVEDEAAIADTLLYALQADGHSTEWVTLGSAALDQQRQRP
FT                   ADLIILDIGLPDISGFETCRQLRRFTEVPVMFLSARDGEIDRVVGLEIGADDYVVKPFS
FT                   PREVAARVRAILKRMAPRAEPATVAALFQLDTLRMQITYRSQPLTLTRHEFRLLQCLLE
FT                   QPQRVFSREQLLDALGVASDVGYERTIDSHIKSLRAKLRQVASGGEPIQTHRGLGYSYS
FT                   PEHA"
FT   gene            416334..417770
FT                   /locus_tag="PputGB1_0361"
FT   CDS_pept        416334..417770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0361"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: pen:PSEEN5151 two-component
FT                   sensor CreC"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96272"
FT                   /db_xref="GOA:B0KJ22"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ22"
FT                   /protein_id="ABY96272.1"
FT                   /translation="MRLGIRIFLVYFLFVGLAGYFLLNTVREQIRPVVRQSSEETLVDT
FT                   ANLLAEILRDDVKAGTLNQGRLPEVLKAYGSRSPGAQIWGLAKNQVSHRIYVTDAKGIV
FT                   LLDSSGEALGKDYSQWNDVLLTLRGQYGARSTRSDPSDESTSVMHVGAPIIDDGRIIGV
FT                   VTVAKPNSSLQPYIDRSERRLLTLGLGLIGLGLLIGAALSWWLARSLRRLARYAQAVSE
FT                   GERAALPHYKGGELAHLAQAVEHMRTQLEGKAYVERYVHTLTHELKSPLAAIRGASELL
FT                   QGDDMPAEQRARFAGNIERESERLQQMIERLLNLARVEQMQALEDEQQVALAALVDELL
FT                   LAHAARIEGANLHVRQRVPAGLRLLCDPFLMRQALANLLDNALDFTPEGGALLFDLERD
FT                   GERVALSLFNQGHAIPAYAIGRVSERFYSLPRPGSGRKSTGLGLNFVAEVMQLHGGALA
FT                   VDNVDGGVRVRLWLPVRRIS"
FT   gene            417936..419264
FT                   /locus_tag="PputGB1_0362"
FT   CDS_pept        417936..419264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0362"
FT                   /product="Inner membrane CreD family protein"
FT                   /note="PFAM: Inner membrane CreD family protein; KEGG:
FT                   pen:PSEEN5150 tolerance to colicin E2"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96273"
FT                   /db_xref="GOA:B0KJ23"
FT                   /db_xref="InterPro:IPR010364"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ23"
FT                   /protein_id="ABY96273.1"
FT                   /translation="MNKTLGYKLGMIAVLILLLLIPLLLINGLIDERQALRDNVLRDIA
FT                   QSASFDQQLSGPLLVVPYRKYQRRWIEKDGERTQETSTIAGHLYFLPETFDADLGVDTE
FT                   LRARGIYQARLFHAKGRISGRFKLPERWGIDKDFDDYRFDKPFLVVGISDIRGIENGLE
FT                   LSIDEQRLPFEAGTQLDWMRGGVHASLPMLDGLQAREFSYGFDLALQGTGQLHVVPVGR
FT                   TSSVAMRANWPHPSFVGSYLPNRRDIDAQGFSAHWQTSFFATNLEDALRQCATAGQCED
FT                   FNERSFGVSFIDPVDQYLKSERAIKYALLFIALTFAGFFLFEVLKNLSVHPVQYILVGV
FT                   ALAFFYLLLLSLSEHIGFGLAYGLSASACVLLIGFYLSHVLRSLGRGVGFAAGLAALYA
FT                   LLYGLLSAEDYALLMGSLLCFGLLGLFMVLTRRLDWARVGRAA"
FT   gene            complement(419431..420054)
FT                   /locus_tag="PputGB1_0363"
FT   CDS_pept        complement(419431..420054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0363"
FT                   /product="Glutathione S-transferase domain"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   pen:PSEEN5149 glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96274"
FT                   /db_xref="GOA:B0KJ24"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034343"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ24"
FT                   /protein_id="ABY96274.1"
FT                   /translation="MATMTLFHSPLSPFVRKVMVVLHETGQLERVQLQPVNISPVSGDP
FT                   QLNQDNPIGKIPALRLDDGTVLHDSRVICEYLDLQHVGLPLLPREGSARWRRMTLVSQA
FT                   DAIMDAAVSSRYESFLRPEEKRWDGWLQAQGDKIRRSLANLEQEHLPELMSGFDLAAIG
FT                   VACALGYLDLRQPEFGWRERQPGLAAWYAEVAKRPSMVATSPVA"
FT   gene            complement(420058..420726)
FT                   /locus_tag="PputGB1_0364"
FT   CDS_pept        complement(420058..420726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0364"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="TIGRFAM: peptide methionine sulfoxide reductase;
FT                   PFAM: Methionine sulfoxide reductase A; KEGG: pen:PSEEN5148
FT                   peptide methionine sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96275"
FT                   /db_xref="GOA:B0KJ25"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KJ25"
FT                   /protein_id="ABY96275.1"
FT                   /translation="MVLRSEILVNKNVMPTAEQALPGRETPMSLPEFHYVFEGTPLLGP
FT                   FFEGAIDFAIFGLGCFWGAERRFWQREGVVSTVVGYAGGFTPHPTYEEVCSGLTGHTEV
FT                   VLVVFDKDKVSYRELLAMFWELHNPTQGMRQGNDVGTQYRSAIYCTSPEQLEQAEASRD
FT                   AFQAELSKAGFGEITTEIDQAPTVYFAEAYHQQYLAKNPQGYCGIGGTGVCLPPSLQGN
FT                   "
FT   gene            complement(420892..423582)
FT                   /locus_tag="PputGB1_0365"
FT   CDS_pept        complement(420892..423582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0365"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC and GAF sensor(s)"
FT                   /note="KEGG: pen:PSEEN5147 sensory box protein; TIGRFAM:
FT                   PAS sensor protein; diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; GAF domain protein;
FT                   PAS fold-4 domain protein; PAS fold domain protein; SMART:
FT                   PAS domain containing protein; PAC repeat-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96276"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ26"
FT                   /protein_id="ABY96276.1"
FT                   /translation="MKSQPDAASRVAAEVVTQLPVPSRLGMLRFERLNEATWAMLYLDP
FT                   ACERQFGLQAGDLCALVDAPYASLMEPEARYRLHDEIQLQLAQRGYYRVRYTLHTPSAS
FT                   MRLLEAGEAYKQHNRQLLRGYLSVLDDQQDDTGEPGASDLESRNNRLQLALQLNQRAQQ
FT                   EQLEHLERVRGQQDLILRLARQRYSAGNSLLEAAQLITQSACEIYKVDSASIWHLEDQR
FT                   LEPIIAWYRDAQEHRQPEAIDASRFPDYLDALHASRAIDAHNAGHDPRTRALAQSMRPE
FT                   NKAMLDASIRVDGQVVGVLCLEQTGQARAWQSDEIAFAGELADQFAQVITNHNRRAATN
FT                   ALHLFQRAVEQSASAFLLVNRDGRVEYVNPSFTAITQYSTDEVQGRQLAELPALENLSE
FT                   LLFDSPSSLAMGNSWQGEFKSRRKNLEPYWGQLSISKVYGDNRELTHYIGIYEDVTQTK
FT                   LAQQRIERLAYTDNLTNLGNRPAFIRSLDERFARDGESAMCLLLVDIDNFKRINDSLGH
FT                   QTGDKLLISLARRLRNSLHAGGILARFASNEFAVLLDNTSLEDGQGVALQLLRTLDKPM
FT                   FVDNQLINVTASVGLACAPLHGVDPASLMKNAGLALHKAKANGKHQVQVFTEVLNAEAS
FT                   YKLFVENNLRRALTQNELEVFYQPKICLRSGRLLGLEALLRWNHPERGMIRPDQFISVA
FT                   EETGLIIPIGKWVVRQACRMSQQLREAGMGNLHVAINLSPKQFSDPDLVASISTILKDE
FT                   ALPPHLLELELTEGLLLEASEDTHRQLDELKALGLTLAMDDFGTGYSSLSYLKKFPIDI
FT                   LKIDRSFINEIPDNQDDMEITSAVVAMAHNLKLKVVAEGIETPEQLAFLRRHRCDVGQG
FT                   YLFDRPIPGRELAERLKRYPRGPVA"
FT   gene            complement(423855..425492)
FT                   /locus_tag="PputGB1_0366"
FT   CDS_pept        complement(423855..425492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0366"
FT                   /product="pyruvate dehydrogenase complex dihydrolipoamide
FT                   acetyltransferase"
FT                   /EC_number="2.3.1.61"
FT                   /note="KEGG: pen:PSEEN5146 dihydrolipoamide
FT                   S-acetyltransferase, E2 component of the pyruvate
FT                   dehydrogenase complex; TIGRFAM: pyruvate dehydrogenase
FT                   complex dihydrolipoamide acetyltransferase; PFAM:
FT                   biotin/lipoyl attachment domain-containing protein;
FT                   catalytic domain of components of various dehydrogenase
FT                   complexes; E3 binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96277"
FT                   /db_xref="GOA:B0KJ27"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006256"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ27"
FT                   /protein_id="ABY96277.1"
FT                   /translation="MSELIRVPDIGSGEGEIIELFVKVGDRIEADQSLLTLESDKASME
FT                   IPAPKAGVIKELKVKLGDRLKEGDELLVLEAEGAAAAAPEAPAAAAAPAAAPAPAAEAA
FT                   PAPAAAPAAASVQDIHVPDIGSSGKAKIIEVLVKVGDTVEADQSLITLESDKASMEIPS
FT                   PAAGVVEEVLCKLEDEVGTGDLIFKLKVAGAAPAAAPAPAAAAAPAKAEAAPAAAPAAA
FT                   APAAAPAPAATAPAAGSNAKVHAGPAVRQLAREFGVDLGAVAATGPHGRILKEDVQVYV
FT                   KAMMQKAKEAPAAAGATGGAGIPPIPAVDFSKFGEVEEVALTRLMQVGAANLHRSWLNV
FT                   PHVTQFDSADITELEAFRVAQKAVAEKAGVKLTVLPLLLKACAFLLKELPDFNSSLAPS
FT                   GKAIIRKKYVNIGFAVDTPDGLLVPVIKNVDQKSLLQLAAEAAALAEKARTKKLSADEM
FT                   QGACFTISSLGHIGGTGFTPIVNAPEVAILGVSKATMQPVWDGKAFQPKLMLPLSLSYD
FT                   HRVINGAAAARFTKRLGDVLGDIRTMLL"
FT   gene            complement(425506..428151)
FT                   /locus_tag="PputGB1_0367"
FT   CDS_pept        complement(425506..428151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0367"
FT                   /product="2-oxo-acid dehydrogenase E1 subunit, homodimeric
FT                   type"
FT                   /EC_number="1.2.4.1"
FT                   /note="TIGRFAM: 2-oxo-acid dehydrogenase E1 subunit,
FT                   homodimeric type; KEGG: pen:PSEEN5145 pyruvate
FT                   decarboxylase, E1 component of the pyruvate dehydrogenase
FT                   complex"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96278"
FT                   /db_xref="GOA:B0KJ28"
FT                   /db_xref="InterPro:IPR004660"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR035807"
FT                   /db_xref="InterPro:IPR041621"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ28"
FT                   /protein_id="ABY96278.1"
FT                   /translation="MQDLDPIETQEWLDALESVLDKEGEDRAHYLMTRMGELATRSGSQ
FT                   LPYAITTPYRNTIPVTHEARMPGDLFMERRIRSMVRWNALAMVMRTNLKDSDLGGHISS
FT                   FASSATLYDIGFNYFFQAPTEEHGGDLIFFQGHASPGVYARAFMEGRINEDQMNNFRQE
FT                   VDGNGLSSYPHPWLMPDFWQFPTVSMGLGPIQAIYQARFMKYLEARGFIPAGKQKVWCF
FT                   MGDGECDEPESLGAIALAGREKLDNLIFVINCNLQRLDGPVRGNGKIIQELEGVFRGGG
FT                   WNVNKVVWGRFWDPLLAKDTNGALQRRMDEVIDGEYQNYKAKDGAYVRENFFNTPELKA
FT                   MVEDLSDEEIWKLNRGGHDPYKVYAAYHQAVNHKEQPTVILAKTIKGYGTGAGEAKNTA
FT                   HNTKKVDVDSLRHFRDRFDIPVKDADLENLPFFKPEEGSAEAKYLAERRAALGGFVPQR
FT                   RAKSFSVPTPSLETLKAILDGSGDREISTTMAFVRILAQLVKDKEIGQRIVPIIPDEAR
FT                   TFGMEGMFRQLGIYSSVGQLYEPVDKDQVMFYREDKKGQILEEGINEAGAMSSFIAAGT
FT                   SYSCHNQPMLPFYIFYSMFGFQRIGDLAWAAGDSRTRGFLIGGTAGRTTLNGEGLQHED
FT                   GHSHMMAGTIPNCRTYDPTYGYELAVIIQDGMKKMTEEQQDIFYYITVMNESYQQPAMP
FT                   AGVEEGIIKGMYLLEEDTREAAHHVQLMGSGTILREVREAAKILREEFNVGADVWSVTS
FT                   FNELRRDGLAVERANRLKPGQKPQQTYVEECLNGRKGPVIASTDYMKLFAEQIRQWVPS
FT                   KEFKVLGTDGYGRSDSRKKLRHFFEVDRHFVVLAALEALADRGELEPKVVADAIVKFGI
FT                   DPDKRNPLDC"
FT   gene            428535..431468
FT                   /locus_tag="PputGB1_0368"
FT   CDS_pept        428535..431468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0368"
FT                   /product="(Glutamate--ammonia-ligase) adenylyltransferase"
FT                   /EC_number="2.7.7.42"
FT                   /note="PFAM: glutamate-ammonia ligase adenylyltransferase;
FT                   KEGG: pen:PSEEN5144 glutamine synthetase
FT                   adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96279"
FT                   /db_xref="GOA:B0KJ29"
FT                   /db_xref="InterPro:IPR005190"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="InterPro:IPR023057"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ29"
FT                   /protein_id="ABY96279.1"
FT                   /translation="MRLPLPSDLPVTLQPLVVRNRQFISDAVAAHPDLDLNGWSPAHRQ
FT                   QFDQVAAASDYVLGVAQRDPAMLFALLASGELERRYAPGELRGQIAEAAQAAQSEDELA
FT                   RNLRRARNRQQLRIIWRDITRQAELGETCRDLSDLADAAIDEAYQWLYPRHCQQFGTPI
FT                   GNRSGQPQHMVVLGMGKLGAVELNLSSDIDLIFGFPEGGETEGVKRSLDNQEFFTRLGQ
FT                   RLIKALDPVTVDGFVFRVDMRLRPYGSAGALVLSFNALEQYYQDQGRDWERYAMIKARV
FT                   VAGDQAAGAQLQEVLRPFVYRRYLDFSAIEALRTMKQLIQQEVRRKGMADNIKLGAGGI
FT                   REVEFIAQAFQLIHGGRDLSLQQRPLLKVLATLEGQGYLPPAVVAELREGYEFLRYTEH
FT                   AIQAIADRQTQMLPESETDQARVAYILGFADWQSFHDQLMYWRGRIDWHFRQVIADPDD
FT                   EDGEGELVVGGEWSPLWEQAQDEEAAGRQLQEAGFKQPVEALRRLAGLRSSPQLRSMQR
FT                   IGRERLDAFIPRLLAQAVEHDNPDLVLERVLPLVEAVARRSAYLVLLTENPGALRRLLT
FT                   LCAASPWIAEQIALYPLLLDELLNEGRLFSPPLAPELASELRERLTRIPEDDLEQQMEA
FT                   LRHFKLAHSLRVAASEISGNLPLMKVSDYLTWLAEAILDQVLALAWRQTVARHGQPKRS
FT                   DGSLCDPGFIIIGYGKVGGLELGHGSDLDLVFIHDGDPQAETDGAKPIDSAQFFTRLGQ
FT                   RIIHLLTTQTNSGQLYDVDMRLRPSGASGLLVSSLGAFERYQQNEAWTWEHQALVRARV
FT                   LVGCKQVGTAFEGVRAKVLGQARDLEKLRGEVSDMRAKMRDNLGTKATAAGTAANAFEA
FT                   GVPFDIKQDAGGIVDIEFMVQYAALAWSHDHPAILRWTDNIRILEELEQANLMPASDAV
FT                   LLREVYKAFRSASHRQALQKQAGVIDAAQFADERREVRRIWGELGLA"
FT   gene            431602..432651
FT                   /locus_tag="PputGB1_0369"
FT   CDS_pept        431602..432651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0369"
FT                   /product="lipopolysaccharide heptosyltransferase II"
FT                   /note="TIGRFAM: lipopolysaccharide heptosyltransferase II;
FT                   PFAM: glycosyl transferase family 9; KEGG: pen:PSEEN5143
FT                   ADP-heptose; LPS heptosyltransferase II"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96280"
FT                   /db_xref="GOA:B0KJ30"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011910"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ30"
FT                   /protein_id="ABY96280.1"
FT                   /translation="MRILIIGPSWVGDMVMAQTLFQCLKQQHPDCVIDVLAPEWSRPIL
FT                   ERMPEVRQALSFPLGHGALELATRRRIGKSLAGQYDQAILLPNSLKSALVPFFAGIPKR
FT                   TGWRGEMRFGLLNDVRKLDKARYPLMIERFMALAYAPGAELPQPYPRPSLQIEAQSRDA
FT                   ALAKFGLELDRPVLALCPGAEFGEAKRWPAEHYAAVADAMIRQGWQVWLFGSKNDHPVG
FT                   EQIRDRLIPGFREESSNLAGETSLAEAIDLMSCAHAVVSNDSGLMHVAAALNRPLVAVY
FT                   GSTSPGFTPPLAEQVEVVRTGIECSPCFDRTCRFGHYNCLRLLEPGKVIAALHSLSGPD
FT                   LIDTVAEVD"
FT   gene            432652..433710
FT                   /locus_tag="PputGB1_0370"
FT   CDS_pept        432652..433710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0370"
FT                   /product="lipopolysaccharide heptosyltransferase I"
FT                   /note="TIGRFAM: lipopolysaccharide heptosyltransferase I;
FT                   PFAM: glycosyl transferase family 9; KEGG: pen:PSEEN5142
FT                   ADP-heptose; LPS heptosyl transferase I"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96281"
FT                   /db_xref="GOA:B0KJ31"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011908"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ31"
FT                   /protein_id="ABY96281.1"
FT                   /translation="MRVLIIKTSSLGDVIHTLPALTDAAHAIPGIRFDWVVEEGFAEIP
FT                   SWHPAVDQVIPVAIRRWRKNVWQTIKSGEWKAFKQRVRERKYDLVIDAQGLVKSAWLTR
FT                   YVKATVAGLDRYSAREGWASRFYDRRLSVATGQHAVERVRQLFAMALAYDLPEGIGNYG
FT                   LDLDRLQLPPAAPYVVFLHGTTWATKHWPEAYWRELAERMGRRKLEVRLPWGNPAEKAR
FT                   AERIAQGLNNCQVLPKLNLAGVARVLAAAKACVAVDTGLGHLAAALDVPTISLFGPTNP
FT                   GLTGAYGRTQIHQASDWPCAPCLQKKCTYKPSADDLRRFDLKREWPLCFTRLNPEHVAG
FT                   RLSALLLAEDVR"
FT   gene            433710..434834
FT                   /locus_tag="PputGB1_0371"
FT   CDS_pept        433710..434834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0371"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   pen:PSEEN5141 glucosyltransferase I"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96282"
FT                   /db_xref="GOA:B0KJ32"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ32"
FT                   /protein_id="ABY96282.1"
FT                   /translation="MQLAFVLYKYFPFGGLQRDFMRIALECQKRGHQIRVYTLIWEGDI
FT                   PPGFEVLVAPVKAIFNHRRNEKLSAWMAADLAKRPVDRLIGFNKMPGLDVYYAADGCFE
FT                   DKAQTLRGGLYRRWGRYRHFAEYERAVFAKDAHTEVLMISEVQQPLFIKHYGTPVERFH
FT                   LLPPGISQDRRAPANAAEIRAEFRKEFNLGEDDLLLVQIGSGFKTKGVDRSLKALAALP
FT                   SALRKRTKLMVIGQDDPKVFQLQSATLGLGDQVQFLKGRSDIPRFLLGADLLIHPAYNE
FT                   NTGTVLLEALVAGLPVLVSKVCGYAHYIAEADSGLVLDEPFEQEQLNGYLQRMLEDPQA
FT                   RASWSRNGLAYAETADLYSMPQHAADVILGQKTA"
FT   gene            434831..435637
FT                   /locus_tag="PputGB1_0372"
FT   CDS_pept        434831..435637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0372"
FT                   /product="lipopolysaccharide kinase"
FT                   /note="PFAM: lipopolysaccharide kinase; KEGG: pen:PSEEN5140
FT                   lipopolysaccharide core biosynthesis; kinase for core
FT                   heptose of lipopolysaccharide"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96283"
FT                   /db_xref="GOA:B0KJ33"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017172"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ33"
FT                   /protein_id="ABY96283.1"
FT                   /translation="MKLIVAEPFKRLWAGRDAFDAVEALQGEVYRELEGRRTLRTEVEG
FT                   EGFFVKIHRGIGWGEIFKNLFTAKLPVLGAGQEWRAIQRLHEVGVPTMTAVAYGERGSN
FT                   PATQHSFIITEELAPTISLEDYSIDWVKQPPEPRLKRALIAEVAKMTGGIHRAGVNHRD
FT                   CYICHFLLHTDRPVTADDFKLSVIDLHRAQTRATISRRWRDKDLAALYFSALDIGLTQR
FT                   DKLRFLRGYFQRPLRQVLKDEAALLAWLERKAQKLYDRKQRYGDAL"
FT   gene            435637..436371
FT                   /locus_tag="PputGB1_0373"
FT   CDS_pept        435637..436371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0373"
FT                   /product="lipopolysaccharide kinase"
FT                   /note="PFAM: lipopolysaccharide kinase; KEGG: pen:PSEEN5139
FT                   heptose kinase WapP"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96284"
FT                   /db_xref="GOA:B0KJ34"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ34"
FT                   /protein_id="ABY96284.1"
FT                   /translation="MASWTLAPGYEHLATDFGSLDAVFAIQGERLTRDPLSEVVRIERS
FT                   GVNYYVKRYTGAGKHMRRYLGRPRIKAEWQNLKQFAKWGIPTAEVVAWGLERNGLAFGR
FT                   GAMITRELPRTEDLSALAERHDARLADRAWVDHVSRQLARHTRVMHEHRFAHNDLKWRN
FT                   LLVDDQGTLFFIDCPTGDFWRGFMWRHRMIKDLACLDKVAKYHLSATQRLRFYLQYRGR
FT                   DRLNVRDKKRIRQVLGFFEGRE"
FT   gene            436368..437120
FT                   /locus_tag="PputGB1_0374"
FT   CDS_pept        436368..437120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0374"
FT                   /product="lipopolysaccharide kinase"
FT                   /note="PFAM: lipopolysaccharide kinase; KEGG: pen:PSEEN5138
FT                   heptose kinase WapQ"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96285"
FT                   /db_xref="GOA:B0KJ35"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR027023"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ35"
FT                   /protein_id="ABY96285.1"
FT                   /translation="MTDYLASADLALLKRHGLDDFEALWALQLEAVDEPNTGRGGWSSV
FT                   FRLELEGKGYYLKRQSDYLTRTLHRPFGEPTFAREFRNISRYQKLHIPALQAVFYGERK
FT                   QGGKHRAILMTRALDEWADLDGLLAQWPQLGDAERNGILQACGQLARTLHSAGQVHGCF
FT                   YPKHIFLRQRRDGWDAQLIDLEKTRPLLFGMRDRLKDLEPLLRRAQAWSEQDVRTLLAT
FT                   YLAQPADGSLVNTWLQRLTQRRREKEAR"
FT   gene            437120..438562
FT                   /locus_tag="PputGB1_0375"
FT   CDS_pept        437120..438562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0375"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN5137 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96286"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ36"
FT                   /protein_id="ABY96286.1"
FT                   /translation="MRLSELKDAGRNPSLPLSITLADAAGSADLQLLSLLRVLPGQRYV
FT                   GAGVWRGTPVLAKLLVGGNAARHFQRELQGVKLLAEQGLTTPKLLADGLKEGEGGWLLF
FT                   EFLDGAESLADAWAAVENLPVLADEQHLVLGEALTAVAHMHAQGLWQEDLHLDNLLRHG
FT                   GKLYLIDGAGIKAETPGQQLSRPRVLENLGVFFAQLPKRLEPFIEELLVHYLLANAEHA
FT                   LPLEALQKQVDKVRNWRQKDYLEKAGRECSLFSVQRSLSGLQAIRRSEVSAMQPVLAQA
FT                   DTLIDKGHLYKTGGAASVARIEVNGRQLVLKRYNIKNTAHWFKRFWRPSRAWHSWIEGH
FT                   RLEFLDIATPKPLAVLEQRVMGLRSRAYLVTEYVDGPDLTACFAPFVENGDAPEEQVDA
FT                   LVHVMQQLIRERISHGDFKGHNLFWDNGRWSLIDLDAMCQHATQLSFAPAYARDRARLL
FT                   RNWPSGSALHQRLDRLLPKLAE"
FT   gene            complement(438607..438783)
FT                   /locus_tag="PputGB1_0376"
FT   CDS_pept        complement(438607..438783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0376"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN5136 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96287"
FT                   /db_xref="GOA:B0KJ37"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ37"
FT                   /protein_id="ABY96287.1"
FT                   /translation="MSHKSQTTARIFAWPALIALLGALGLFAALLGDGGWDGLSWLGLG
FT                   LPAWFSIRGLWRR"
FT   sig_peptide     complement(438697..438783)
FT                   /locus_tag="PputGB1_0376"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.859 at
FT                   residue 29"
FT   gene            complement(438780..439892)
FT                   /locus_tag="PputGB1_0377"
FT   CDS_pept        complement(438780..439892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0377"
FT                   /product="PepSY-associated TM helix domain protein"
FT                   /note="PFAM: PepSY-associated TM helix domain protein;
FT                   KEGG: pen:PSEEN5135 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96288"
FT                   /db_xref="GOA:B0KJ38"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ38"
FT                   /protein_id="ABY96288.1"
FT                   /translation="MKSPTIRRWSVIHTWSSLVCTLFLLLLAITGLPLIFHHELEHLLG
FT                   DAPELREMPAGTPHLDLQQLVLKAQQHRPGEVMQYFGYEEDEPNGVVAITAATAGTDPN
FT                   LSHTFMLDARTGEAVAMPAANGGFMMVMLRLHVDMFAGLPGKLLLAFMGVLFIVAIVSG
FT                   TVLYAPFMRRLDFGTVRHEKSRRLRWLDLHNLIGVVTLAWALTVGVTGVISALSDLVIA
FT                   AWRNDSLAAMVAPYRDAPPLTERAPATRLLEIAEQAAPGMRPDFIAFPGTRFSSEHHYA
FT                   VFMNGATHLSSHLFTPVLIDARTLEVTAVGERPWYMDAMGLSQPLHFGDYGGRPMQILW
FT                   AVLDVLTIIVLCSGLYLWWGKQRKPREARA"
FT   sig_peptide     complement(439806..439892)
FT                   /locus_tag="PputGB1_0377"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.708) with cleavage site probability 0.440 at
FT                   residue 29"
FT   gene            complement(439949..442381)
FT                   /locus_tag="PputGB1_0378"
FT   CDS_pept        complement(439949..442381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0378"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="TIGRFAM: TonB-dependent siderophore receptor; PFAM:
FT                   TonB-dependent receptor; Secretin/TonB short domain;
FT                   TonB-dependent receptor plug; KEGG: pen:PSEEN5134
FT                   TonB-dependent siderophore receptor"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96289"
FT                   /db_xref="GOA:B0KJ39"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ39"
FT                   /protein_id="ABY96289.1"
FT                   /translation="MSRAVDRILRPSLMALAIAVAAPLASTALFAAEQSAPRAYNLPSA
FT                   PLATTLNQIASQAGIALAIDPALVSGRSSAPVSGQYDGLGALQAALRGTGLQLQQSSAG
FT                   SYSLVAVPDGTLALPETTVDAASVSESAWGPVDGYLAKRTAAGTKTDTALVEVPRSISV
FT                   ATREQMKDRGVHSLDDAVRYMPGIVSASFGSDTRYDWMRVRGFEPTQFLDGLPLPRGVY
FT                   ANPKAETWNLDRLALLRGPASSLYGQTPPGGLLDMVSRRPQAESEHEIELQYGSDNHRQ
FT                   INFASTGKIDDDGRFLYGVSGVIRDGGTQIDHIDDKRYNIAPSLTWNIDEDTTLTLLTQ
FT                   FTRDDTGATSQFRPIQGTKIDMPFGKISHHKNLGDPDYEFYDRTYYALGYAFEHRINDV
FT                   WQFRQNLRYTKTDLSFQTITPGSYYEPGGPVKDDGTVSRMSTNTDEDISQFAVDNNFQA
FT                   DFTTGDISHTLLLGLDHQRINTNYLSIFGFNVPDSNVINPVYGVPITRPDRSTAFYDYN
FT                   QKSRQTGLYVQDQMALGNWRLTLGGREDWVHTGTKYFNQGDATNTQRDKKFSGNAAISY
FT                   VFDSGFVPYLSYAESFQPTSNASASATESLKPTEGQQWELGIKYQPPGSNTLLSAAVYD
FT                   LTQKNVSVTNNVGGVTVTSQTGEVKVHGLELEAVSDVTENLKVIAAYTLAKSEVQDGLY
FT                   KGNRLQLMPNQQASVWGDYTWHSGVLDGFGIGLGARYTGNTYGDQGNTYLGKAKAYTVF
FT                   DASVHYDLGRLDTSLKGASVAVTATNLLNKDYLSTCDSYYCYYGDERSVVASATYKF"
FT   sig_peptide     complement(442286..442381)
FT                   /locus_tag="PputGB1_0378"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 32"
FT   gene            complement(442600..443556)
FT                   /locus_tag="PputGB1_0379"
FT   CDS_pept        complement(442600..443556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0379"
FT                   /product="anti-FecI sigma factor, FecR"
FT                   /note="PFAM: FecR protein; KEGG: pen:PSEEN5132 FecR-like
FT                   transmembrane sensor"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96290"
FT                   /db_xref="GOA:B0KJ40"
FT                   /db_xref="InterPro:IPR006860"
FT                   /db_xref="InterPro:IPR012373"
FT                   /db_xref="InterPro:IPR032623"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ40"
FT                   /protein_id="ABY96290.1"
FT                   /translation="MSNAPVSSRVLEAAIAWKLSLDDASGTPDERNAFMRWHAASEEHA
FT                   RAWRQLGAMDQRVSAAAGPARQALLQSRVGLRRRIGKVGGGLAGMFLLGSLLAWVGAPS
FT                   LAPSYWLADQRTATGELRTLRLEDGTLLSLNTHTAVDIDYAGEQRVIVLHQGEISVETG
FT                   HQDPRPLLVRTDDGRLRPLGTRFLVRREAEGTRLEVLQASVAAMPHNSGDEHVLREGQQ
FT                   VLMNANGLGQVGTVPAGADAWTRGMLVVDNVRLGDLLAALGQYRSGYLGVDARVANLRV
FT                   TGSFPLTDTDLALASLVPALPVKIERHTQWWVNVVPK"
FT   gene            complement(443553..444071)
FT                   /locus_tag="PputGB1_0380"
FT   CDS_pept        complement(443553..444071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0380"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; sigma-70
FT                   region 4 domain protein; Sigma-70 region 4 type 2; KEGG:
FT                   pen:PSEEN5131 RNA polymerase sigma-70 factor, ECF
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96291"
FT                   /db_xref="GOA:B0KJ41"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ41"
FT                   /protein_id="ABY96291.1"
FT                   /translation="MSSAQSPHADLVDSLYRDHRGWLLAWLQRSMACRQRAEDLSQDTF
FT                   VRLLGRERLDTPREPRAFLAAVAKGLMFDHFRRAALEQAYLAELALIPEAEHPSPEVQH
FT                   LILEDLKAIDRLLGKLSSKARAAFLHNRLDGMGHAEIAERLGVSVSRVRQYIAQGMRQC
FT                   YVALYGEPT"
FT   gene            complement(444274..444984)
FT                   /locus_tag="PputGB1_0381"
FT   CDS_pept        complement(444274..444984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0381"
FT                   /product="DNA polymerase III, epsilon subunit"
FT                   /note="KEGG: pen:PSEEN5130 exonuclease; TIGRFAM: DNA
FT                   polymerase III, epsilon subunit; PFAM: Exonuclease RNase T
FT                   and DNA polymerase III; SMART: Exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96292"
FT                   /db_xref="GOA:B0KJ42"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ42"
FT                   /protein_id="ABY96292.1"
FT                   /translation="MSLFAWLRPSAPELDSITRQRLARHAKPAPLGVCSLREQRWVVLD
FT                   LETSGLNPNRDQVLSIGAVAIEDGAIDFAQQFERTLHRPLQKTNASVLIHGLGPSALAA
FT                   GCDPAEALLDLLDFMGDSPVLAFHAPFDQRMLARALKESLGHRLQSVFLDVAELAPMLN
FT                   PDTVLREAGLDDWVARFGLQVEERHHASADAQVTAELALILFSQARRQQLDSPLQLEQR
FT                   LRRWRRRNVQSHGL"
FT   gene            complement(444981..446918)
FT                   /locus_tag="PputGB1_0382"
FT   CDS_pept        complement(444981..446918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0382"
FT                   /product="putative CBS domain and cyclic
FT                   nucleotide-regulated nucleotidyltransferase"
FT                   /note="PFAM: cyclic nucleotide-binding; CBS domain
FT                   containing protein; protein of unknown function DUF294
FT                   nucleotidyltransferase putative; KEGG: pen:PSEEN5129
FT                   nucleotidyltransferase, CBS domain/cAMP binding"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96293"
FT                   /db_xref="GOA:B0KJ43"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005105"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR018821"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ43"
FT                   /protein_id="ABY96293.1"
FT                   /translation="MSKKDAYSQAGRTAVLQNIQGTLQFLQRFPPFNQMEHSHLAYLVE
FT                   QCQLRFYACGESIVKPADGPVEHFYIVKQGRVVGERQHLVKPGVETTFEITSGECFPLA
FT                   ALLGERATRTEHLAGEDTFCLQLNKAAFIRVFSMSEVFRDFALRGVSSLLDQVNQQVRQ
FT                   RAVETLGTQYSLNTPLGELAMRHPVVCSGDTSLREAVRLMHEQQVGSIVVVDPQRYPIG
FT                   IFTLRDLRQVVAAEDADLGAPIDRHMTAKPFYLSPQASAFDAAMAMTERHIAHVCLVEN
FT                   RRLCGVVSERDLFSLQRVDLVHLARTIRHAPRLDTLVSLRGEISQLVERMLAHGASSTQ
FT                   ITQIITLLNDHTVCRVIELALAERGDPGVPFSWLCFGSEGRREQTLHTDQDNGILFEAA
FT                   DNAEADAIRARLLPLAQYINQCLAQCGFTLCKGNVMAGNPDLCLSRNEWARRFAGFVRE
FT                   ASPENLLGSSIYFDLRVVWGDEQGCEQLRQGLLQQVADNRIFQRMLADNALRQRPPVGR
FT                   LREFVLTRQGNDKAATLDLKVQGLTPFVDGARLLALANGIGACNTLERLRQLVAKGVIE
FT                   PLDGAAYEEAYHFIQQTRMQQHQRQTRDNLPYSNRLDPDNLNHLDRRILRESLRQAQRL
FT                   QSSLALRYQL"
FT   gene            447035..447571
FT                   /locus_tag="PputGB1_0383"
FT   CDS_pept        447035..447571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0383"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   pen:PSEEN5128 response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96294"
FT                   /db_xref="GOA:B0KJ44"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ44"
FT                   /protein_id="ABY96294.1"
FT                   /translation="MSTPVRDPTKGETGYASNAVLMLKQNFFDEMAMPEQTDILSDAER
FT                   EALAVVSAPVAPRPLVLVVDDNAVNREALILYLKSRGIDAVGADGAEEARLYLYHQPRI
FT                   SLMITDLRMQPEDGLDLIRTIRESERAALSIIVVSGDTDVEEAVDVMHLGVVDFLLKPV
FT                   DLGKLLELVKKELKM"
FT   gene            complement(447609..449786)
FT                   /locus_tag="PputGB1_0384"
FT   CDS_pept        complement(447609..449786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0384"
FT                   /product="malate synthase G"
FT                   /EC_number="2.3.3.9"
FT                   /note="KEGG: pen:PSEEN5127 malate synthase G; TIGRFAM:
FT                   malate synthase G; PFAM: malate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96295"
FT                   /db_xref="GOA:B0KJ45"
FT                   /db_xref="InterPro:IPR001465"
FT                   /db_xref="InterPro:IPR006253"
FT                   /db_xref="InterPro:IPR011076"
FT                   /db_xref="InterPro:IPR023310"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ45"
FT                   /protein_id="ABY96295.1"
FT                   /translation="MTGYVQVGGLQVAKVLYDFVNNEAIPGTGIVAEQFWAGAEKIIND
FT                   LAPKNKALLAKRDELQAKIDAWHQARQGQAHDAVAYKAFLQEIGYLLPQADDFQATTQN
FT                   VDEEIAHMAGPQLVVPVMNARFALNAANARWGSLYDALYGTDAISDEGGAEKGQGYNKV
FT                   RGDKVIAFARAFLDEAAPLAAGSHVDSTGYRIEGGKLVVALKGGSNSGLRDDAQLIGFH
FT                   GDAAAPTAVLLKHNGLHFEIQVDANTPVGSTDAASVKDILMESALTTIMDCEDSVAAVD
FT                   ADDKVVVYRNWLGLMKGDLAETVSKGGKTFTRTMNPDREYAAPNGGSVTLHGRSLLFVR
FT                   NVGHLMTNPAVLDAQGNEIPEGIQDGLFTNLIALHNLNGNTSRKNTRSGSVYIVKPKMH
FT                   GPEEVAFAAEIFSQVEELLGMPRNTVKVGIMDEERRTTVNLKSCIKAAAERVAFINTGF
FT                   LDRTGDEIHTSMEAGAVVRKGAMKNEKWIGAYENNNVDVGLATGLQGRAQIGKGMWAMP
FT                   DLMAAMLEQKIAHPLAGANTAWVPSPTAATLHALHYHKVDVQARQRELASRTPASVDDI
FT                   LAIPLAADTNWSAEEIRNELDNNAQGILGYVVRWIDQGVGCSKVPDINNVGLMEDRATL
FT                   RISAQLLANWLRHGVVSQEQVLESLKRMAVVVDQQNAGDALYRPMAPNFDDNVAFQAAV
FT                   ELVVEGGKQPNGYTEPVLHRRRREFKARNGL"
FT   gene            450234..450752
FT                   /locus_tag="PputGB1_0385"
FT   CDS_pept        450234..450752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0385"
FT                   /product="amino acid-binding ACT domain protein"
FT                   /note="PFAM: amino acid-binding ACT domain protein; KEGG:
FT                   pen:PSEEN5126 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96296"
FT                   /db_xref="GOA:B0KJ46"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR016867"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ46"
FT                   /protein_id="ABY96296.1"
FT                   /translation="MDHLVLTVIAPDKAGQVERIAQCISDHSGNWLESRMSRMAGQFAG
FT                   ILRVAVPAENYAELVASLQGLARYDIRVLIAESGIEPSCTWKPIAMELVGNDRPGIVRD
FT                   ITRLLADLGVNLERFSTEVRPAPMSSEPLFHADALLALPLTLSLDELQQKLESLADDLM
FT                   VELQLRAED"
FT   gene            complement(451085..451972)
FT                   /locus_tag="PputGB1_0386"
FT   CDS_pept        complement(451085..451972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0386"
FT                   /product="RarD protein, DMT superfamily transporter"
FT                   /note="TIGRFAM: RarD protein, DMT superfamily transporter;
FT                   PFAM: protein of unknown function DUF6 transmembrane; KEGG:
FT                   pen:PSEEN5125 RarD protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96297"
FT                   /db_xref="GOA:B0KJ47"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004626"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ47"
FT                   /protein_id="ABY96297.1"
FT                   /translation="MHAANPRRGYTLGLSAYIIWGLFPIYFKAIQSVPAVEIIVHRVLW
FT                   SALFGSLLLLVWKHPGWWRELRDNPRRLGILALSGALIAGNWLTYVWSVNNGRMLEASL
FT                   GYYINPLINVLLGMLILGERLRRLQWLAVGMAAVGVAQQVWQVGSLPWVSLVLALSFGF
FT                   YGLIRKQAPVAALPGLVVETWMLVPLALGWLLLHPAAMSAQGAFYTSSEALWLMAAGPV
FT                   TLVPLVCFNAAARHLPYTTLGFLQYLAPTLVLLQAVLLFDEHLSSSTLVAFMFIWAGLA
FT                   IYSVDAWWNLRKRS"
FT   gene            complement(452157..453509)
FT                   /locus_tag="PputGB1_0387"
FT   CDS_pept        complement(452157..453509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0387"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: psb:Psyr_2041 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96298"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ48"
FT                   /protein_id="ABY96298.1"
FT                   /translation="MIVDWNDEHRAAGRAYTPRSGLDPIIEDGEFVNSWSIRLEYKFTI
FT                   ETIEGKHSLALEKTKQDYTYNLMATGDLGKHVHYGERVYRLCYERSEPKFKEFLDSIMS
FT                   GFTTLDVEIDTFILSSLLFRNSQVALDSVHWPNDLLTVGQLAPDRTKFSISTSDNTAID
FT                   QGETSVLTGGRIAFTTEPATPGVVWSVQHLPDYTGDDLKGEIDPGTGVYTAPAADTFDD
FT                   SFIKVIVTAKSGDNVAHALVSVLRTTVSVYPSVMTLNLGAYNDILAGEMNKGAINWAVE
FT                   GFGKLEDIDNGDPLAQASKRYLAPTVGEVPDWDDSMPLLDMYIRHSRIKVSSGATSKYV
FT                   DVLLPIAIQDNHWLEATRAGEGVRFEFWWKPKSRPAELVDPENTSWHVRVGSGTCIDGV
FT                   YTPDPSKAEEYAVIVATNDVTEDYASMILPLPFIDVEQFMALHAPDEAKAV"
FT   gene            complement(453527..454600)
FT                   /locus_tag="PputGB1_0388"
FT   CDS_pept        complement(453527..454600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0388"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: psb:Psyr_2041 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96299"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ49"
FT                   /protein_id="ABY96299.1"
FT                   /translation="MNNFVRQSLEDFLNEIAKARKNFGYPVIVAFDRKTANNVLKQEFI
FT                   ERYTGELFLDPMNSEVDIEQGVSYHQLSDFCLDQPRLTFENADLSDSKATLMMRTVRGK
FT                   QLQLSQAVGSTRRQVTRLAKASPINGPSLVFDIELKNTRNAVSENGRVYFSYAAGTNYA
FT                   FYGGTTQFELDKLGLHFKEYFEAYTVQPGQREIIEYTLGELANLADLILKPKDFKIRTH
FT                   GAPGTRLRNQASFGDGAVVLFVELEGFDSSNAIPPDRNDKLPYLLPDGYSANVLINSDF
FT                   ITKNLIIKQLKESASGISLLDWAPLLTGGLGYRATGELSIDGFEFYDNAGPNVTTFTKY
FT                   NATYTCPPNMTQPKILE"
FT   gene            complement(454873..455847)
FT                   /locus_tag="PputGB1_0389"
FT   CDS_pept        complement(454873..455847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0389"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; protein of
FT                   unknown function DUF227; KEGG: pen:PSEEN5124 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96300"
FT                   /db_xref="GOA:B0KJ50"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR032882"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ50"
FT                   /protein_id="ABY96300.1"
FT                   /translation="MSHPFDTLTPDLVLDAVESLGFLSDARVLALNSYENRVYQVGIED
FT                   AQPLIAKFYRPGRWSDAAILEEHSFTAELADCEVPVVAPMQHDGRTLFEHQGFRFTLFP
FT                   RRGGHAPEPGNLDQLYRLGQLLGRLHAVGASRPFEHREALAVDNFGHASLNTLLEGGFV
FT                   PRELLPAFESVARDLLKRVEDIYARTPHQLIRLHGDLHPGNLMHRDEVYHVVDLDDCRM
FT                   GPAVQDLWMMLAGNREERLGQLAELIDGYNEFHDFDPRELALIEPLRALRQLHYSAWLA
FT                   RRWDDPAFPPSFPWFGQPRYWGDQILALREQMAALDEPPLKLF"
FT   gene            complement(456005..456769)
FT                   /locus_tag="PputGB1_0390"
FT   CDS_pept        complement(456005..456769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0390"
FT                   /product="transcriptional regulator, ModE family"
FT                   /note="TIGRFAM: molybdate transport repressor, ModE; PFAM:
FT                   regulatory protein LysR; TOBE domain protein; KEGG:
FT                   pen:PSEEN5123 molybdate transport regulator ModE"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96301"
FT                   /db_xref="GOA:B0KJ51"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR003725"
FT                   /db_xref="InterPro:IPR004606"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR016462"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ51"
FT                   /protein_id="ABY96301.1"
FT                   /translation="MPLPTLLTQHIARRPQRIALLQHIAEQGSITRAAKAAGISYKAAW
FT                   DAIDELNNLASQPLVERSTGGRGGGGARLSPEGERVLRLYQRLQALQAQILEAAEESSD
FT                   LDLLGRLMLRTSARNQLQGQVSGLRREGRYDRVSLALGGGLEIDALITHDSTARLELTL
FT                   GTMVVALLKAGWVRLLAQGEQAEVGSNCLSATVEEVLAADDGPSEVRLALSNGQTLCAI
FT                   AEADWLAGLQVAAGSSVRVQFNPSVVLIGVPA"
FT   gene            complement(456828..457559)
FT                   /locus_tag="PputGB1_0391"
FT   CDS_pept        complement(456828..457559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0391"
FT                   /product="phosphoribosyltransferase"
FT                   /note="PFAM: phosphoribosyltransferase; KEGG: pen:PSEEN5122
FT                   competence protein ComF"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96302"
FT                   /db_xref="GOA:B0KJ52"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ52"
FT                   /protein_id="ABY96302.1"
FT                   /translation="MNCQPHWKRLVYKCSLINQTCLLCDEPAEQRYPLCTACEQELPWL
FT                   GDHCQHCALPLPMAGLTCAQCCRRLPAFDQVIALWHYGFPVDTLISRFKHNRQWPVGRL
FT                   MAELLGHGLLHRFAEGLPRPDLLLPVPLASRRLRERGFNQAGMLGRWLSSQLRLPCDER
FT                   LLMRTRETTAQQQLTAKARRRNLRQAFAVTGKLTGKHVAVVDDVLTTGATAQAIAQVLR
FT                   KAGARQVDVYCLARTPKPGYA"
FT   gene            457649..458707
FT                   /locus_tag="PputGB1_0392"
FT   CDS_pept        457649..458707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0392"
FT                   /product="biotin synthase"
FT                   /EC_number="2.8.1.6"
FT                   /note="KEGG: pen:PSEEN5121 biotin synthetase; TIGRFAM:
FT                   biotin synthase; PFAM: Radical SAM domain protein; biotin
FT                   and thiamin synthesis associated; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96303"
FT                   /db_xref="GOA:B0KJ53"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KJ53"
FT                   /protein_id="ABY96303.1"
FT                   /translation="MSASTTATTRHDWSLAEVKALFQQPFNDLLFQAQTVHRAHFDPNR
FT                   VQVSTLLSIKTGACPEDCKYCPQSGHYNTGLEKQKLMEVQKVLEEAARAKAIGSTRFCM
FT                   GAAWKHPSAKDMPYVLEMVKGVKAMGLETCMTLGKLDQDQTLALAQAGLDYYNHNLDTS
FT                   PEFYGSIITTRTYGERLQTLAYVRDAGMKICSGGILGMGESLDDRAGLLIQLANLPEHP
FT                   ESVPINMLVKVAGTPLAEEEDVDPFDFIRMLAVARILMPKSHVRLSAGREQMNEQMQAL
FT                   AFMAGANSIFYGEKLLTTANPQADKDMQLFARLGIKPEAREEHADEVHQAAIEQALVEQ
FT                   RSSEMFYNAASA"
FT   gene            458709..459881
FT                   /locus_tag="PputGB1_0393"
FT   CDS_pept        458709..459881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0393"
FT                   /product="8-amino-7-oxononanoate synthase"
FT                   /EC_number="2.3.1.47"
FT                   /note="KEGG: pen:PSEEN5120 8-amino-7-oxononanoate synthase;
FT                   TIGRFAM: 8-amino-7-oxononanoate synthase; PFAM:
FT                   aminotransferase class I and II; aminotransferase
FT                   class-III"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96304"
FT                   /db_xref="GOA:B0KJ54"
FT                   /db_xref="InterPro:IPR004723"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022834"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KJ54"
FT                   /protein_id="ABY96304.1"
FT                   /translation="MAFDLAARLAERRAADLYRQRPLLESPQGPEVVVDGQRLLAFCSN
FT                   DYLGLANHPEVISAWQAGAERWGVGGGASHLVVGHSTPHHQVEEALAELTGRPRALLFS
FT                   TGYMANLGAITALVGQGDTVLQDRLNHASLLDGGLLSGARFNRYLHNDSASLASRLDKA
FT                   VGNTLVVTDGVFSMDGDLADLPALADVARGRGAWLMVDDAHGLGTLGAQGGGIVEHFGL
FT                   GVADVPVLIGTLGKACGTAGAFVAGSEDLIEALVQFARPYIYTTSQPPALACATLKSLE
FT                   LLRRETWRREHLAALIRQFREGAQQIGLQLMDSPTPIQPIVIGDSAQALRLSRMLRERG
FT                   LLVTAIRPPTVPAGSARLRVTLSAAHSEAQVQLLLNALAECYPQLENADA"
FT   gene            459874..460605
FT                   /locus_tag="PputGB1_0394"
FT   CDS_pept        459874..460605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0394"
FT                   /product="Carboxylesterase"
FT                   /EC_number="3.1.1.1"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: pen:PSEEN5119
FT                   biotin biosynthesis BioH"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96305"
FT                   /db_xref="GOA:B0KJ55"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ55"
FT                   /protein_id="ABY96305.1"
FT                   /translation="MRNRLVLLPGWGLGIAALEPLAASLRAQDARLQVELMPLPELPHS
FT                   DVEGWLDHLDRKLPADVWLGGWSLGGMLASALAHKRGDHCCGLLTLASNPCFVARADWP
FT                   HGMAEDTFGTFLDGCRSHTQVTLKRFRTLCSDGALQPRTLLRQLGVGVPDTDPLYLATG
FT                   LEVLAKLDTREALQAYGGPQLHLFAGSDALVPAEAAKALSELLPDVEVGLVEDSSHAFL
FT                   LEYPQELAAGIKSFLHESGDD"
FT   sig_peptide     459874..459942
FT                   /locus_tag="PputGB1_0394"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.881) with cleavage site probability 0.510 at
FT                   residue 23"
FT   gene            460598..461416
FT                   /locus_tag="PputGB1_0395"
FT   CDS_pept        460598..461416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0395"
FT                   /product="biotin biosynthesis protein BioC"
FT                   /note="TIGRFAM: biotin biosynthesis protein BioC; PFAM:
FT                   UbiE/COQ5 methyltransferase; Methyltransferase type 11;
FT                   Methyltransferase type 12; KEGG: pen:PSEEN5118 biotin
FT                   biosynthesis protein BioC"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96306"
FT                   /db_xref="GOA:B0KJ56"
FT                   /db_xref="InterPro:IPR011814"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ56"
FT                   /protein_id="ABY96306.1"
FT                   /translation="MTDLSRPTLPGALPDKRQVAASFSRAAASYDSVAALQRAVGANLL
FT                   EQLPAGLQPLHWLDLGSGTGHFSRMLAERFAQASGVAVDIAEGMLRHARHEQGGAQYHV
FT                   AGDAERLPLRDGSVDLVFSSLAVQWCDQFASVLAEAQRVLRPGGVLAFSSLCVGTLDEL
FT                   RASWQAVDGLVHVNRFRRFEDYQRLCAASGFEQLELQRRPHVLHYPDVRSLTHELKALG
FT                   AHNLNPGRPSGLTGRARMQGLLQAYEAFRQPAGLPATYQVVYGVLRKPQA"
FT   gene            461427..462107
FT                   /locus_tag="PputGB1_0396"
FT   CDS_pept        461427..462107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0396"
FT                   /product="dethiobiotin synthase"
FT                   /EC_number="6.3.3.3"
FT                   /note="KEGG: pen:PSEEN5117 dethiobiotin synthetase;
FT                   TIGRFAM: dethiobiotin synthase; PFAM: Cobyrinic acid
FT                   ac-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96307"
FT                   /db_xref="GOA:B0KJ57"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ57"
FT                   /protein_id="ABY96307.1"
FT                   /translation="MSQAYFIAGTDTDVGKTTIAAGLLHAARLQGMSTLGAKPVASGCT
FT                   MTPKGLRNSDAQALIDESTIKLPYEQVNPFAFEPAIAPHVAAREAGVTLAVPELLAAMR
FT                   NVLQQHADFTLVEGAGGWRVPLSGLENLSDLAIALQLPVILVVGVRLGCISHALLSAEA
FT                   IERDGLQLAGWVANIIEPRTSRLEENLASLAERLPAPCLGRVPKLKQASADMVAEHLQL
FT                   DLLD"
FT   gene            462250..462546
FT                   /locus_tag="PputGB1_0397"
FT   CDS_pept        462250..462546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0397"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN5116 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96308"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ58"
FT                   /protein_id="ABY96308.1"
FT                   /translation="MEITGSSAYYAGLSAIQAGQSRVDQAAAQIANTTAERTATSQSSD
FT                   FQAERLRAVDRSQQMDMATSIVQQAVGKTEVELGAKVVKASDEMLGRIIDTYA"
FT   gene            462836..464641
FT                   /locus_tag="PputGB1_0398"
FT   CDS_pept        462836..464641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0398"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   pen:PSEEN5115 acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96309"
FT                   /db_xref="GOA:B0KJ59"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ59"
FT                   /protein_id="ABY96309.1"
FT                   /translation="MPDYKAPLRDIRFVRDELLGYEAHYQSLPGCQDATPDMVDAILEE
FT                   GAKFCEQVLSPLNRVGDQEGCTWSESGVKTPTGFKAAYEQFVEGGWPSLAHDVEHGGQG
FT                   LPESLGLALSEMVGGSNWSWGMYPGLSHGAMNTISAHGTHEQQETYLTKLVSGEWTGTM
FT                   CLTEPHCGTDLGMLRTKAEPQADGSYKVSGTKIFISAGEHDMADNIVHIVLARLPDAPA
FT                   GTKGISLFIVPKFLPNAEGGVGERNGVSCGSIEHKMGIHGNATCVMNFDAATGYLIGPA
FT                   NKGLNCMFTFMNTARLGTALQGLAHAEVAFQGGLKYARERLQMRSLTGPKAPDKAADPI
FT                   IVHPDVRRMLLTMKAFAEGNRAMVYFTAKQVDIVKYSQDEEERKKADALLAFLTPIAKA
FT                   FMTEVGFEAANHGVQIYGGHGFIAEWGMEQNVRDSRISMLYEGTTGIQALDLLGRKVLM
FT                   TQGEALKGFTKIVHKFCQAQEGNEAVKEFVEPLAAINKEWGELTMKVGMAAMKDREEVG
FT                   AASVDYLMYSGYACLAYFWADIARLAAEKLAAGTSEEAFYTAKLQTARFYFQRILPRTR
FT                   THVATMLSGANNLMAMDEEHFGLSY"
FT   gene            464825..466108
FT                   /locus_tag="PputGB1_0399"
FT   CDS_pept        464825..466108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0399"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: pen:PSEEN5114 diguanylate cyclase
FT                   (GGDEF domain)"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96310"
FT                   /db_xref="GOA:B0KJ60"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ60"
FT                   /protein_id="ABY96310.1"
FT                   /translation="MFRLNAVRASHFLPSLFLLLAGLAAAYVRDLSVFFTSLFNVLPTL
FT                   VLLLGGAYCAVYRRQRELFMMLTVYIAYFLLDTQTDFYRDHGRVREDAAVIFHLVCLLL
FT                   PALFGLYGAWQERTHLLQDLVARGAVLFAVGSVAVALEQSYPEALLTWLAEIRWPALHG
FT                   QWMSLIQMVYPLFIGVFILLVVQYLRAPRPLHAALITGLLGIFWMLPQTFILPFTLNIM
FT                   CSQVMLMIAAAVAHEAYQMAFRDELTGLPGRRALNERMQRLGRNYVIAMTDVDHFKKFN
FT                   DTHGHDVGDQVLRLVASRLSKVTGGGRAYRYGGEEFALVFAGKTAEECVPHVEAVREVI
FT                   ANYVMHLRDQHNRPQDDTAGRQRRAGSGGGTVSVTISIGVAERHADHRNPEAVLKSADQ
FT                   ALYSAKGAGRNCVMVHGQQSQRGAVRTA"
FT   sig_peptide     464825..464905
FT                   /locus_tag="PputGB1_0399"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.923 at
FT                   residue 27"
FT   gene            466233..468011
FT                   /locus_tag="PputGB1_0400"
FT   CDS_pept        466233..468011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0400"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: pen:PSEEN5113
FT                   acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96311"
FT                   /db_xref="GOA:B0KJ61"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ61"
FT                   /protein_id="ABY96311.1"
FT                   /translation="MADYKAPLRDMRFVLNEVFNVAEQWAQLPALAEVVDADTAMAVLE
FT                   EAGKVTAKTIAPLSRAADEEGCHWDNGAVRTPAGFIEAYNTYAEGGWVGVGGDPLFGGM
FT                   GMPKAISAQVEEMVNASSLAFGLYPMLTAGACLSINAHASEALKEKYLPNMYAGVWAGS
FT                   MCLTEPHAGTDLGIIRTKAEPQADGSYKVSGTKIFITGGEHDLTENIIHLVLAKLPDAP
FT                   AGPKGISLFLVPKFLVNEDGSLGARNPATCGSIEHKMGIQASATCVMNFDEAVGYIVGE
FT                   PNKGLAAMFTMMNYERLGVGIQGLASAERSYQNAVEYARDRLQSRAPTGPQAKDKAADP
FT                   IIVHPDVRRMLLTMKALIEGGRAFSTYVAMQLDSAKYSEDANVRKRSEELVALLTPVAK
FT                   AFLTDLGLECAVHGQQVFGGHGYIREWGQEQLVRDVRITQIYEGTNGIQALDLMGRKVV
FT                   ASGGAYYRLFSDEIRQFIASADGALDEFAKPLAVCLDQLDGLTEWVLEQAKGNPNEIGA
FT                   ASVEYLHAFGYVAYGYMWALMARAAKAGEGDEAFYSGKLGTARFYFARLLPRVDSLVAS
FT                   VKAGSESLYLLDAEQF"
FT   gene            complement(468380..469303)
FT                   /locus_tag="PputGB1_0401"
FT   CDS_pept        complement(468380..469303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0401"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: pen:PSEEN5111 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96312"
FT                   /db_xref="GOA:B0KJ62"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ62"
FT                   /protein_id="ABY96312.1"
FT                   /translation="MDFRQLRYFVAVYEEGHVGRAAERLSLSQPALSQQIRQLEHSLDL
FT                   SLFERSNKRLLPTLAAHTLYNHALPLLDGLQRAHEAMRNFKGQSLRTLAIGVLQTVRPS
FT                   LVPQLLERLRKAQPHLVVQIYELSGLEIERRLLNGSLDIGISYLPPRQPGLHGLLLYED
FT                   ELQLVIPDTHPLKDFKKVSIRQAAELPMLMLGEEFQIRQIWQAQLASQGRRPQVQAEMN
FT                   NMAGILDSLAHTALATILPGRAKEAAEDDQGLLWKPLSEPRVPLKVGLVFRDAQRQQAS
FT                   VELLRTLLEEETDARLLGASPLDVLA"
FT   gene            469513..470793
FT                   /locus_tag="PputGB1_0402"
FT   CDS_pept        469513..470793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0402"
FT                   /product="aminotransferase class-III"
FT                   /note="PFAM: aminotransferase class-III; KEGG:
FT                   pen:PSEEN5110 acetylornithine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96313"
FT                   /db_xref="GOA:B0KJ63"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ63"
FT                   /protein_id="ABY96313.1"
FT                   /translation="MNLFNLRRSAPAAVAEPKRAPVIVPQASELSRDRLMPSAERAAQV
FT                   FVRGQGSWLWDNEGHAYLDFTQGGAVNSLGHSPSVLVKALGNQAQALINPGSGFHSRGL
FT                   LDLVNRLCQSTGSDQAYLLNSGAEACEGAIKLARKWGQLHRNGAYHIITASQACHGRSL
FT                   GALSASDPLPCNRCEPGLPGFSKVPFNDLAALHAAVDSRTVAIMLEPIQGEAGVIPATQ
FT                   EYLKGVETLCRELGILLILDEVQTGIGRCGALLAEETYGVRADIITLGKGLGGGVPLAA
FT                   LLARGTACCAEPGELEGSHHGNALMCAAGLAVLGTVLEPGFFAQVQDNGRHLREGLSRL
FT                   AGRYGQGEVRGQGLLWALQLKENLARELVAAALYEGLLLNAPQADVVRFSPALTVSKGN
FT                   IDEMLLRLARAFARLHAQQQARREMPA"
FT   gene            470945..471103
FT                   /locus_tag="PputGB1_0403"
FT   CDS_pept        470945..471103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0403"
FT                   /product="protein of unknown function UPF0057"
FT                   /note="PFAM: protein of unknown function UPF0057; KEGG:
FT                   pen:PSEEN5109 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96314"
FT                   /db_xref="GOA:B0KJ64"
FT                   /db_xref="InterPro:IPR000612"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ64"
FT                   /protein_id="ABY96314.1"
FT                   /translation="MDFIRIIIAILLPPLGVFLQVGFGGAFWLNILLTLLGYIPGIVHA
FT                   VYIIAKR"
FT   gene            complement(471137..472960)
FT                   /locus_tag="PputGB1_0404"
FT   CDS_pept        complement(471137..472960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0404"
FT                   /product="peptidase S9 prolyl oligopeptidase active site
FT                   domain protein"
FT                   /note="PFAM: peptidase S9 prolyl oligopeptidase active site
FT                   domain protein; KEGG: pen:PSEEN0393 prolyl oligopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96315"
FT                   /db_xref="GOA:B0KJ65"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ65"
FT                   /protein_id="ABY96315.1"
FT                   /translation="MIETHVSSPAAEFSAAQAVAAGTDFAELKVSADGLFWIEFRPADG
FT                   ACRIWHWLHYQARCLTPDGFSVRSRAYEYGGGSFCLGGDGLVFVNEKDQQVYTQPLDDL
FT                   LPRALTRDASCRYGDVQWHDSQVLAVEERHAEQVEHRLVALGESRREVLAEGADFYAAP
FT                   TVSANGQRLAWIEWDRPAQPWTVTRLMSRTRDASGHWGPPQCVAAADESLQQPRFDAEG
FT                   RLYCLSDRNGFWQPWGEVEGHWQALPAKSADHAAAPWQLGTCTWLPLGPQSYLASWFQD
FT                   GFGQLGLRGEDGRMARFASAYTRFRNLAMDAEHLYAIAASPISPPAVIAIDRGNHEVRV
FT                   LAGGAEVLPAGRISLPQPIHYGSDGEQAHGFFYPPVQSQGAAPLVVFVHGGPTSACYPV
FT                   LDPRIQYWTQRGFAVADLNYRGSTGYGREYRQALHLRWGESDVADACAAVEYLAAQGWV
FT                   DKHKAFIRGGSAGGYTTLCALAFHDVFRAGASLYGVSDPVALGRATHKFEGDYLDWLIG
FT                   DPQQDAERYRQRTPLLHAGQIKVPVIFFQGELDAVVVPEQTRAMLAALQANGIEAEGHF
FT                   YAGERHGFRKAENLAHALEEEWKFYCRVLKH"
FT   gene            complement(472926..474086)
FT                   /locus_tag="PputGB1_0405"
FT   CDS_pept        complement(472926..474086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0405"
FT                   /product="coenzyme PQQ biosynthesis protein E"
FT                   /note="KEGG: pen:PSEEN0394 coenzyme PQQ synthesis protein E
FT                   (coenzyme PQQ synthesis protein III); TIGRFAM: coenzyme PQQ
FT                   biosynthesis protein E; PFAM: Radical SAM domain protein;
FT                   SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96316"
FT                   /db_xref="GOA:B0KJ66"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR011843"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017200"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ66"
FT                   /protein_id="ABY96316.1"
FT                   /translation="MPNTGSSSPELPPTPAVGLPLWLLAELTYRCPLQCPYCSNPLDFA
FT                   AQGQELSTEQWFKVMAEAREMGAAQIGFSGGEPLVRQDLAELIGEARRLGYYTNLITSG
FT                   IGLTEARIADFKKAGLDHIQISFQASDEQVNNLLAGSKKAFAQKLEMARAVKAHGYPMV
FT                   LNFVTHRHNIDKIDRIIELCIALEADFVELATCQFYGWAHLNRLGLLPTRAQLERAERI
FT                   TNEYRDKLKAEGNPCKLIFVTPDYYEERPKACMNGWGNLFLTITPDGTALPCHGARQLP
FT                   VQFPNVREHDLHHIWYESFGFNRFRGYEWMREPCRSCDEKEKDFGGCRCQAFMLTGDAS
FT                   NADPVCAKSADHGIILKAREEAETAQLAIEQMTFRNDRNSRVIARG"
FT   gene            complement(474058..474333)
FT                   /locus_tag="PputGB1_0406"
FT   CDS_pept        complement(474058..474333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0406"
FT                   /product="coenzyme PQQ synthesis D"
FT                   /note="PFAM: coenzyme PQQ synthesis D; KEGG: pen:PSEEN0395
FT                   coenzyme PQQ synthesis protein D (coenzyme PQQ synthesis
FT                   protein II)"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96317"
FT                   /db_xref="GOA:B0KJ67"
FT                   /db_xref="InterPro:IPR008792"
FT                   /db_xref="InterPro:IPR022479"
FT                   /db_xref="InterPro:IPR041881"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ67"
FT                   /protein_id="ABY96317.1"
FT                   /translation="MSLDRNQVPNWRPGYRFQYEPAQKGHVLLYPEGMIKLNESASLIG
FT                   GLIDGQRDVAAIISELEQQFPDVPEVADDIEQFMEVARAEHWIVLA"
FT   gene            complement(474330..475085)
FT                   /locus_tag="PputGB1_0407"
FT   CDS_pept        complement(474330..475085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0407"
FT                   /product="coenzyme PQQ biosynthesis protein C"
FT                   /EC_number="1.3.3.11"
FT                   /note="KEGG: pen:PSEEN0396 coenzyme PQQ synthesis protein C
FT                   (coenzyme PQQ synthesis protein I); TIGRFAM: coenzyme PQQ
FT                   biosynthesis protein C; PFAM: TENA/THI-4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96318"
FT                   /db_xref="GOA:B0KJ68"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR011845"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR039068"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KJ68"
FT                   /protein_id="ABY96318.1"
FT                   /translation="MSDALPMSPAEFEQALRAKGAYYHIHHPYHVAMYQGRATREQIQG
FT                   WVANRFYYQVNIPMKDAAILANCPDREVRREWIQRLLDHDGAPGEDGGIEAWLRLGQAV
FT                   GLDPDQLRSQELVLPGVRFAVDAYVNFARRASWQEAASSSLTELFAPQIHQSRLDSWPQ
FT                   HYPWIDPAGYEYFRTRLGQARRDVEHGLAITLQHYTTRAGQERMLEILQFKLDILWSML
FT                   DAMSMAYELNRPPYHSVTQDRVWHKGITL"
FT   gene            complement(475095..476006)
FT                   /locus_tag="PputGB1_0408"
FT   CDS_pept        complement(475095..476006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0408"
FT                   /product="coenzyme PQQ biosynthesis protein B"
FT                   /note="TIGRFAM: coenzyme PQQ biosynthesis protein B; KEGG:
FT                   pen:PSEEN0397 coenzyme PQQ synthesis protein B (coenzyme
FT                   PQQ synthesis protein V)"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96319"
FT                   /db_xref="GOA:B0KJ69"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011842"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KJ69"
FT                   /protein_id="ABY96319.1"
FT                   /translation="MYIQVLGSAAGGGFPQWNCNCVNCKGYRDGTLRATARTQSSIALS
FT                   DDGVHWVLCNASPDIRAQLQAFAPMQPARALRDTGINAIVLLDSQIDHTTGLLSLREGC
FT                   PHQVWCTDMVHQDLTTGFPLFNMLSHWNGGLQWNRIELEGSFVIEACPNLKFTPFPLRS
FT                   AAPPYSPHRFDPHPGDNLGLLVEDTRTGGKLFYAPGLGQVDGKLLAMMHDADCLLVDGT
FT                   LWEDDEMQRRGVGTRTGREMGHLAQNGPGGMLEVLDGFSRQRKVLIHINNTNPILDEDS
FT                   PERAEVLRRGVEVAFDGMSIEL"
FT   gene            complement(476317..478617)
FT                   /locus_tag="PputGB1_0409"
FT   CDS_pept        complement(476317..478617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0409"
FT                   /product="coenzyme PQQ biosynthesis protein PqqF"
FT                   /note="TIGRFAM: coenzyme PQQ biosynthesis protein PqqF;
FT                   PFAM: peptidase M16 domain protein; KEGG: pen:PSEEN0399
FT                   coenzyme PQQ synthesis protein F"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96320"
FT                   /db_xref="GOA:B0KJ70"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="InterPro:IPR011844"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ70"
FT                   /protein_id="ABY96320.1"
FT                   /translation="MPDATRHLTLANGLQLTLRHAPRLKRAAAALRVHAGSHDAPGKWP
FT                   GLAHFLEHLFFLGTPRFPLDDGLMRYVQALGGQVNASTRERTTDFFFEVPPNALAAGLE
FT                   RLCQMLAEPDLGIARQRREREVIHAEFIAWSRNPQAQQQFALLQTLSPAHPLSAFHAGN
FT                   RYTLALQDPAFQQALGGFHRRFYQGGQIVLSLCGPQPLDELEQLGRQHAQQFATGTRVP
FT                   HLQPPPLSAATMPLAFIHEHLPAGAEQALELLIACLNDSRPGTWLGTLRERGWLQGFKA
FT                   EKLYAFAGQLLWHLDLKLSANACPDEANDLLHGWFNFIRQADLAQLNRDFGLLQHSGER
FT                   SASALELARRDSTGLPFSQLDTQGLQALRALLDDLPCSNHGQWQIPTVEPLLMADLPTA
FT                   MAQPLPNALKISDQLPGTRQYAALYLRWHVPSPVRQRLQGVLEQALAPLQERCERASVQ
FT                   LQYTTAGEYWQLRCAGLPAAVLRAVPQALALMLTPPASCWLPSAAPPPALIPIRALLKQ
FT                   LPDTVLHTPPTAAPAGTLKQQQLDSLWQHANWHGLAAGFDDAALNALATALQHCPGQGA
FT                   RPGSLPTWANRRWQHAEVAGSEYALLLFCPLPPASEAAGRLLAQLLQGPVYQRLRVELQ
FT                   LGYAVFSAFRQVEGVGGLLFGVQSPHTGQAQVLDHLLALLRQGVTLDPAARQALAEQFD
FT                   EPAMANADVAEWAWQTHLATQPGRLDALRRTILNTRQTDLDHLLSNLLDTGSTWLCLAN
FT                   AAAPNPSWQGAAR"
FT   gene            complement(478680..479474)
FT                   /locus_tag="PputGB1_0410"
FT   CDS_pept        complement(478680..479474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0410"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: pen:PSEEN0400 amidohydrolase,
FT                   carbon-nitrogen family"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96321"
FT                   /db_xref="GOA:B0KJ71"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ71"
FT                   /protein_id="ABY96321.1"
FT                   /translation="MRIALFQGAPKPLDVPGNLQRLRHQAQLAAERGAQLLVCPEMFLT
FT                   GYNIGLAQVERLAEADDGPAAMAVVEIAQAQRIAIVYGYPERGDDGAIYNSVQLIDAHG
FT                   RSLSNYRKTHLFGDLDRSMFSPGADLSPVVEFDGWKVGLLICYDIEFPENARRLALDGA
FT                   ELILVPTANMTPYDFTCQVTVRARAQENQCYLVYANYCGAEDEIHYCGQSSLIGPDGSV
FT                   LAMAGQDECQLLAELEHDQVVQGRLAFPYLNDLRQELHLRKG"
FT   gene            complement(479489..481171)
FT                   /locus_tag="PputGB1_0411"
FT   CDS_pept        complement(479489..481171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0411"
FT                   /product="amine oxidase"
FT                   /note="PFAM: amine oxidase; KEGG: pen:PSEEN0401 amino
FT                   oxydase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96322"
FT                   /db_xref="GOA:B0KJ72"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ72"
FT                   /protein_id="ABY96322.1"
FT                   /translation="MNKKNRHPADGKKPITIFGPDFPFAFDDWLEHPAGLGSIPVDRQG
FT                   EEVAIIGAGIAGLVAAYELMKLGLKPVVYEASKLGGRLRSQAFNGTDGIIAELGGMRFP
FT                   VSSTAFYHYVDKLGLETKPFPNPLTPASGSTVIDLEGQTYYAEKTSDLPKLFHEVADAW
FT                   ADALESGAQFAEIQQAIRDRDVPRLKALWNKLVPLWDDRTFYDFVATSRSFAKLSFQHR
FT                   EVFGQVGFGTGGWDSDFPNSMLEIFRVVMTNCDDHQHLVVGGVEQVPQGIWRHVPERCV
FT                   HWPQGTSLSTLHGGAPRTGVKRIARASDGRLAVTDNWGDTRHYSAVLATCQTWLLTTQI
FT                   DCEESLFSQKMWMALDRTRYMQSSKTFVMVDRPFWKDKDPETGRDLMSMTLTDRLTRGT
FT                   YLFDNGDDKPGVICLSYAWMSDALKMLPHPVEKRVQLALDALKKIYPKTDIAGHIIGDP
FT                   ITISWEADPHFLGAFKGALPGHYRYNQRMYAHFMQQDMPAEQRGMFIAGDDVSWTPAWV
FT                   EGAVQTSLNAVWGIMNHFGGHTHPDNPGPGDVFDEIGPIALAD"
FT   gene            complement(481341..481802)
FT                   /locus_tag="PputGB1_0412"
FT   CDS_pept        complement(481341..481802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0412"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; KEGG:
FT                   pen:PSEEN0407 transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96323"
FT                   /db_xref="GOA:B0KJ73"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ73"
FT                   /protein_id="ABY96323.1"
FT                   /translation="MSDSRSITLDEIDRQLIALLQINARESVATLARQLGIARTTVNSR
FT                   LERLEKNKVISGYGVRLGQSVIGGGLQAYVGIKVQPRSGKEVVRRLSAMGQVQQLCAVS
FT                   GEFDYVAWLRTDSPEQLDQLLDQIGSVDGVEKTTTSIILSSKVDRGQPL"
FT   gene            481937..482491
FT                   /locus_tag="PputGB1_0413"
FT   CDS_pept        481937..482491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0413"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: plu:plu2021 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96324"
FT                   /db_xref="GOA:B0KJ74"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ74"
FT                   /protein_id="ABY96324.1"
FT                   /translation="MNLDHLLECWRLEVSNKKRPGRRISLLFNVLRRARKDNKLRFLFA
FT                   YRLAQYLDAHGGLARRHARRMQQRLNLKYAVDIDIGAHIAPGLRIAHLPGVVITRHVRI
FT                   GRNFFIRQNCSIGIKTLGLEEYALRIGDNVSMGANSCIVADRIDIGDDVVIGAMSLVTR
FT                   DIPAGMTFYNQRQVVMRPSAQ"
FT   gene            482671..483348
FT                   /locus_tag="PputGB1_0414"
FT   CDS_pept        482671..483348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0414"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: psa:PST_3443 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96325"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ75"
FT                   /protein_id="ABY96325.1"
FT                   /translation="MNKMMVSPWLMVSPDGPVTCAFDDDQQVHLRQGGLDGACGPYSVV
FT                   MALITLGVMRYDEATEMHQWHGNSREGRFRNEIRNLGALVSGGTDHKDMIRLVDCFSGL
FT                   GVGAEYVSGSKKEIVEQVEHAIDSQCAPIVGVRFSGGGGHWMMVVGYQGYEDEDGFQLT
FT                   HILCLDPASETPRTSLWNAVINVYEEDGSSVGSGPLPSTYWGYDGQRVSCRVEDALVIC
FT                   GAD"
FT   gene            complement(483639..484418)
FT                   /locus_tag="PputGB1_0415"
FT   CDS_pept        complement(483639..484418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0415"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96326"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ76"
FT                   /protein_id="ABY96326.1"
FT                   /translation="MVRENLIDAFVQELLAKKNMSPSERCSYEISQILNSAATEWVDIM
FT                   DFVWKSHYTITHEQAIEAEKVTHYFPDIEKHAEIIAARAAIHKRRWDNTYPYMISSGNL
FT                   FSTLSLFEAYILRLAIATEQASEIQLSSINGAGVEKIFNYFRKLGIPLETIAVHEPIKC
FT                   AQKIRNCLMHAGGLLQLSKDADTIRTIVERKSYLCSEDRGRYTKSSETELVSIRFYFVG
FT                   EKVSIEHDYPHLLCNYISRYIQILGEKILIWLEAQRA"
FT   gene            complement(484683..484979)
FT                   /locus_tag="PputGB1_0416"
FT   CDS_pept        complement(484683..484979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0416"
FT                   /product="site-specific recombinase, phage integrase
FT                   family"
FT                   /note="KEGG: pst:PSPTO_0535 site-specific recombinase,
FT                   phage integrase family"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96327"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ77"
FT                   /protein_id="ABY96327.1"
FT                   /translation="MATIVKNPAGTWKAVIRKTGWPTNAKTFRTKRDAEDWSRRTEDEM
FT                   VRGVYIQRSGSERLTLENALQRHLREVSPTKKPTAQKAEATRENIRSQLYHPR"
FT   gene            complement(485105..485181)
FT                   /locus_tag="PputGB1_R0013"
FT                   /note="tRNA-Met6"
FT   tRNA            complement(485105..485181)
FT                   /locus_tag="PputGB1_R0013"
FT                   /product="tRNA-Met"
FT   gene            complement(485198..488941)
FT                   /locus_tag="PputGB1_0417"
FT   CDS_pept        complement(485198..488941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0417"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="KEGG: pen:PSEEN0412 sensory box proten; GGDEF
FT                   domain/EAL domain protein; TIGRFAM: PAS sensor protein;
FT                   diguanylate cyclase; PFAM: GGDEF domain containing protein;
FT                   EAL domain protein; extracellular solute-binding protein
FT                   family 3; PAS fold-3 domain protein; PAS fold-4 domain
FT                   protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein; PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96328"
FT                   /db_xref="GOA:B0KJ78"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ78"
FT                   /protein_id="ABY96328.1"
FT                   /translation="MPLKPAILLLLLILWNTTAGALTLTDEEKAWLAAHPQLSLGVDAS
FT                   WPPFEFRDQEGRYQGLAADYIATIQQRLGVTLKPVEPSSWTEVLAQARESRIDLLPGIM
FT                   STPERQGYLAFTRPYLDFPIVILAHKGGAQPRKLDDLYGLKIAVVENYAPHELLRTHHP
FT                   DLNLVALPNVSSTLQALATDQVDAVVGDLASSIWSLRQLKLDGLYVSGETPYRYQLAMA
FT                   VPRDKAVLVGILDKVMADMSSSEISQIQQRWVGNVVDQRMFWSDLLVYGLPTVLLLMAV
FT                   LAVVIRINRRLSSEISRRIALEQELRSSEYHYRGLVESLSAIAWEADANDFTYSYVSPH
FT                   AEDLLGYPLSDWLRPGFWRSILHPEDALWAQAYCDSETAAGRDHSLDYRVIRADGQPLW
FT                   VRNIVSMIEHGHQPVMRGLMIDISETKHTEDALRLSEQKFASVFQQCPDILLIARHSDG
FT                   CLLEVNEAFEEQIGLTQSQVIGRTATDLNLWGVEGSGLRVLEHLHQGGIRNLEMSFRRS
FT                   NGQLFTGLTSAETFELDGTPALVVAVRDISQLKETQQQLQTSEEKFAKAFHASPDGLLL
FT                   SRQSDGLLLEVNEGFCRLTGYDLNPTIDQTSLDLGIWVDLNERKRLVEQLNRDGFVRDF
FT                   TCHIRRSDGQIRLCELSARPLPITGVDCMLTIARDITERHLMQEKLQLAATVFENTAEG
FT                   VLITDIDQHISAVNRAFSEITGYSEIEALGQTPRLLASGQHDSAFYAAMWHQLTDEGHW
FT                   QGEIYNKRKNGELYPSWLTISAVRNSEREITHFVAVFADISSIKHAQAKLDYQAHHDPL
FT                   TGLPNRALFENRLQAVLTCAQVSNRQGAVLFLDLDRFKHINDSLGHPVGDLLLKGIAQR
FT                   LKEQVRDVDTVARLGGDEFIILLPGLHKPSDASTIANKLLACFAAPFQAGEHEFFTSAS
FT                   IGISLYPQDGTDVATLIRNADAAMYRSKAKGRNRVEAYTRDLTAQASERIALEHELRRA
FT                   VERNEMSLCFQPKLSLKTQKLVGAEALIRWSHPTFGEVPPEHFIHLAEENGTILQLGDW
FT                   VLEQACRQMQAWKQHYQPFGPLSINLAGAQLRHPHLARRIEQLLKHYQLKAGDLQLEIT
FT                   ENFIMSQAEEALAVLYQLKKLGVQLAIDDFGTGYSSLSYLKRLPLDILKIDKSFIRGLP
FT                   DDPHDAAIARAIIALGRSMQLTIIAEGVENQAQQRFLAAEGCEQIQGYIVSLPLPPDEF
FT                   AAAFLRIALSDLSDGTGAKPSL"
FT   sig_peptide     complement(488876..488941)
FT                   /locus_tag="PputGB1_0417"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.963 at
FT                   residue 22"
FT   gene            complement(489069..490919)
FT                   /locus_tag="PputGB1_0418"
FT   CDS_pept        complement(489069..490919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0418"
FT                   /product="RNA polymerase, sigma 70 subunit, RpoD"
FT                   /note="TIGRFAM: RNA polymerase sigma factor RpoD; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   1.1 domain protein; sigma-70 region 3 domain protein;
FT                   sigma-70 region 2 domain protein; sigma-70 region 4 domain
FT                   protein; sigma-70 non-essential domain protein; sigma-70
FT                   region 1.2; KEGG: pen:PSEEN0413 sigma D (sigma 70) factor
FT                   of RNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96329"
FT                   /db_xref="GOA:B0KJ79"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007127"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR007631"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR042189"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ79"
FT                   /protein_id="ABY96329.1"
FT                   /translation="MSGKAQQQSRIKELITRGREQGYLTYAEVNDHLPEDISDPEQVED
FT                   IIRMINDMGINVFESAPDADALLLAEADTDEAAAEEAAAALAAVETDIGRTTDPVRMYM
FT                   REMGTVELLTREGEIEIAKRIEEGIREVMGAIAHFPGTVDYILGEYDRVTTEGGRLSDV
FT                   LSGYIDPDDNIAAPTEEVPIPGTKAAAAKEESDDEEEESESGDDEEEAESGPDPVVAAQ
FT                   RFGAVSDQLQATSKVLKKNGRGHKESIEALQALADLFMPIKLVPKQFEVLVERVRDALN
FT                   RLRQQERAIMQLCVRDARMPRADFLRMFPSNETDQTWSGDLAKRNTKWAAALGEKDAAI
FT                   VACQQKLIDLETETGLTVAEIKEINRRMSIGEAKARRAKKEMVEANLRLVISIAKKYTN
FT                   RGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVH
FT                   MIETINKLNRISRQMLQEMGREPTPEELGERMEMPEDKIRKVLKIAKEPISMETPIGDD
FT                   EDSHLGDFIEDSTMQSPIDVATVESLKEATRDVLSGLTAREAKVLRMRFGIDMNTDHTL
FT                   EEVGKQFDVTRERIRQIEAKALRKLRHPTRSEHLRSFLDE"
FT   gene            complement(490987..492969)
FT                   /locus_tag="PputGB1_0419"
FT   CDS_pept        complement(490987..492969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0419"
FT                   /product="DNA primase"
FT                   /note="KEGG: pfo:Pfl_5148 DNA primase; TIGRFAM: DNA
FT                   primase; PFAM: zinc finger CHC2-family protein; TOPRIM
FT                   domain protein; DNA primase DnaG DnaB-binding; DNA primase
FT                   catalytic core domain; SMART: Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96330"
FT                   /db_xref="GOA:B0KJ80"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013173"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR019475"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ80"
FT                   /protein_id="ABY96330.1"
FT                   /translation="MAGLIPQSFIDDLINRLDIVDVVSSRVQLKKTGKNYSACCPFHKE
FT                   KTPSFTVSPDKQFYYCFGCGAGGNALGFVMDHDNLDFPQAVEELARAAGMEVPREQGRR
FT                   DQKPRQPTDSPLYPLLDAASEFYRQALRNHPTRKAAVDYLKGRGLSGEIARDFGLGFAP
FT                   PGWDNLLKHLGADTLQQKVMIDAGLLIENAESGKRYDRFRDRVMFPIRDSRGRIIAFGG
FT                   RVLGDDKPKYLNSPETPVFHKGQELYGLYEARKHNRNLDEIIVVEGYMDVIALAQQGLR
FT                   NAVATLGTATSEEHLKRLFRVVPSVLFCFDGDQAGRKAAWRALESALPNLQDGRRARFL
FT                   FLPEGEDPDSLVRAEGTDAFMARINQHAQPLADYFFEQLSVEADPRSLEGKAHMATLAA
FT                   PLIEKIPGANLRQLMRNRLKEITGLDPQQVEQLAQQAPTVSSVPDYDPGYDYDAMASYT
FT                   PDYGDMPQHDFAPVHQEQAWKPNKSGGKKPWSDKPWDKNRKGGKPWQQRDEAPPRVPAP
FT                   VEPPTLAALRTLLHHPLLAGRVEDASHFADEEHLYSQLLVALIEAAQKNPGLSSMQLIA
FT                   RWHGTEQGRLLRALAEKEWLIVADNLEQQFFDTITSLSARQRERSLEQLLRKSRQSELT
FT                   SEEKTQLLALLSRNVPAQTPTSSGA"
FT   gene            complement(493273..493488)
FT                   /locus_tag="PputGB1_0420"
FT   CDS_pept        complement(493273..493488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0420"
FT                   /product="ribosomal protein S21"
FT                   /note="PFAM: ribosomal protein S21; KEGG: pen:PSEEN0416 30S
FT                   ribosomal protein S21"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96331"
FT                   /db_xref="GOA:B0KJ81"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KJ81"
FT                   /protein_id="ABY96331.1"
FT                   /translation="MPAVKVKENEPFDVALRRFKRSCEKAGVLAEVRSREFYEKPTAER
FT                   KRKAAAAVKRHAKKVQREQRRAVRLY"
FT   gene            493693..494718
FT                   /locus_tag="PputGB1_0421"
FT   CDS_pept        493693..494718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0421"
FT                   /product="metalloendopeptidase, glycoprotease family"
FT                   /EC_number="3.4.24.57"
FT                   /note="KEGG: pen:PSEEN0417 O-sialoglycoprotein
FT                   endopeptidase; TIGRFAM: metalloendopeptidase, glycoprotease
FT                   family; PFAM: peptidase M22 glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96332"
FT                   /db_xref="GOA:B0KJ82"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KJ82"
FT                   /protein_id="ABY96332.1"
FT                   /translation="MLVLGLETSCDETGVALYDSERGLLADALFSQIDLHRVFGGVVPE
FT                   LASRDHVKRMLPLIRQVLDEAGCVATEIDAIAYTAGPGLVGALLVGASCAQALAFAWDI
FT                   PAIGVHHMEGHLLAPMLEENPPEFPFVALLVSGGHTQLVRVDGIGQYELLGESLDDAAG
FT                   EAFDKTAKLIGLNYPGGPEIARLAEQGVPGRFVFPRPMTDRPGLEFSFSGLKTFALNTW
FT                   QQCKNAGDDGEQTRCDVSLAFQQAVVETLTIKCKRALKQTGLKRLVIAGGVSANKALRA
FT                   SLEEMLAGMKGNVYYARPQFCTDNGAMIAYAGCQRLLAGQQQDLAISVQARWPMEQLPP
FT                   L"
FT   gene            complement(494736..495305)
FT                   /locus_tag="PputGB1_0422"
FT   CDS_pept        complement(494736..495305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0422"
FT                   /product="protein of unknown function DUF205"
FT                   /note="PFAM: protein of unknown function DUF205; KEGG:
FT                   pen:PSEEN0418 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96333"
FT                   /db_xref="GOA:B0KJ83"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KJ83"
FT                   /protein_id="ABY96333.1"
FT                   /translation="MFWLLALLAYLLGSLSFAIVLSRLSGSPDPRSSGSGNAGATNMLR
FT                   LAGRKLAILTLLGDLCKGLLPVLLARAAGLDLHAQAWVGVCAVLGHLFPLYFRFQGGKG
FT                   VATAAGMLMGLYFPAALLAIGAWLLTFYLTRTSSLAALIATPLTLPLLAWREPEALLPI
FT                   TVLTAMIVWRHRKNLRDLFAGRERHF"
FT   sig_peptide     complement(495249..495305)
FT                   /locus_tag="PputGB1_0422"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.567 at
FT                   residue 19"
FT   gene            495380..495736
FT                   /locus_tag="PputGB1_0423"
FT   CDS_pept        495380..495736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0423"
FT                   /product="dihydroneopterin aldolase"
FT                   /note="TIGRFAM: dihydroneopterin aldolase; KEGG:
FT                   pen:PSEEN0419 dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96334"
FT                   /db_xref="GOA:B0KJ84"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ84"
FT                   /protein_id="ABY96334.1"
FT                   /translation="MDRVFIEGLEVDTVIGAYDWERDIRQCLRLDLSFAWDNRPAAAGD
FT                   DLNLALDYASVSARIQAFAEQARFELVETFAERLVATLMEEFHIPWVRLKLTKPGAVPA
FT                   ARGGVGVEIERGCL"
FT   gene            495727..496236
FT                   /locus_tag="PputGB1_0424"
FT   CDS_pept        495727..496236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0424"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /note="TIGRFAM:
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase; PFAM:
FT                   78-dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK;
FT                   KEGG: pen:PSEEN0420
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96335"
FT                   /db_xref="GOA:B0KJ85"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ85"
FT                   /protein_id="ABY96335.1"
FT                   /translation="MSLSTVYLGLGSNIDREAHLCAGLDALAGILTDMHCSPAFESQAV
FT                   GIKSGPFINFVVTGKTALPLIELDRRLKFIEADNGRYAPDRKGLPLDIDVLMYDDLHGT
FT                   FDGLVLPRAEILKNAFVLWPLSLLAPELVHPAAGKGMAQLWQEAQIDQVLAPVAFEWRG
FT                   LQLTPI"
FT   gene            complement(496355..497461)
FT                   /locus_tag="PputGB1_0425"
FT   CDS_pept        complement(496355..497461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0425"
FT                   /product="Polynucleotide adenylyltransferase region"
FT                   /note="PFAM: Polynucleotide adenylyltransferase region;
FT                   KEGG: pen:PSEEN0421 multifunctional CCA protein [includes:
FT                   CCA-adding enzyme (tRNA nucleotidyltransferase) (tRNA
FT                   adenylyl-/cytidylyl-transferase) (tRNA
FT                   CCA-pyrophosphorylase) (tRNA-NT); 2'-nucleotidase;
FT                   2',3'-cyclic phosphodiesterase; phosphatase]"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96336"
FT                   /db_xref="GOA:B0KJ86"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR012006"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KJ86"
FT                   /protein_id="ABY96336.1"
FT                   /translation="MHIYKVGGAVRDRLLGRPVSDIDWLVVGATVEEMLAKGYRPVGAD
FT                   FPVFLHPKTGEEYALARTERKSGRGYGGFTFHASPDVTLEEDLIRRDLTINAMAEDEAG
FT                   TVYDPYHGKDDLDQRLLRHVSPAFAEDPLRVLRVARFAARYAPLGFRVADETLELMRQI
FT                   SASGELQALTAERSWKEIERALMEARPQVFFQVLGACGALHELLPELVDDTQALAALEQ
FT                   AAAHEQPLHVRWACLLRGLAPAPIKTVNQRLKAPRECQELALLTGECLAQGNQAQELPA
FT                   TALLELLQKFDVYRRPQRFEDFIVVCEMAALGDGKSSYPQADYLRGAAAAARAVDVKPL
FT                   VQAGLTGQALGEALKRERLKAVEAYKRS"
FT   gene            complement(497517..499085)
FT                   /locus_tag="PputGB1_0426"
FT   CDS_pept        complement(497517..499085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0426"
FT                   /product="SpoVR family protein"
FT                   /note="PFAM: SpoVR family protein; KEGG: pen:PSEEN0422
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96337"
FT                   /db_xref="InterPro:IPR007390"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ87"
FT                   /protein_id="ABY96337.1"
FT                   /translation="MTARAQRRQPISTGSEWTFELIQTYDREISRLAERYALDTYPNQI
FT                   EVITAEQMMDAYASVGMPLGYHHWSYGKQFLSTEKSYSRGQMGLAYEIVINSDPCIAYL
FT                   MEENTMCMQALVIAHACYGHNSFFKGNYLFRTWTDASSIIDYLVFAKQYIAQCEERHGI
FT                   DAVEDLIDSCHALMNYGVDRYKRPYPISAEEERRRQQEREEHLQRQINDLWRTIPKSAE
FT                   KGNDRDDGRFPAEPQENILYFIEKNAPLLEPWQREVVRIVRKIAQYFYPQRQTQVMNEG
FT                   WATFWHYTLMNDLYDEGLITEGFMMEFLQSHTSVVFQPGFDSPYYSGINPYALGFAMYT
FT                   DIRRMCENPTEEDRHWFPDIAGSDWLSTIKFAMSSFKDESFILQYLSPKVMRDLKLFSI
FT                   LDDDQRDDLLVPAIHDEAGYRVIREQLAAQYNLGNREPNVQIWSVDRRGDRSLTLRHQQ
FT                   HNRKPLGDSTDEVLKHLHRLWGFDIHLETVQGEQVMKTHHMPPRGEHGESADYGRMDLA
FT                   VIHHL"
FT   gene            complement(499082..500356)
FT                   /locus_tag="PputGB1_0427"
FT   CDS_pept        complement(499082..500356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0427"
FT                   /product="protein of unknown function DUF444"
FT                   /note="PFAM: protein of unknown function DUF444; KEGG:
FT                   pen:PSEEN0423 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96338"
FT                   /db_xref="InterPro:IPR006698"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KJ88"
FT                   /protein_id="ABY96338.1"
FT                   /translation="MSYVIDRRLNGKNKSTVNRQRFLRRYREHIKKAVEEAVSRRSIMD
FT                   MEHGEQISIPGRDIDEPVLHHGRGGKQTIVHPGNKEFTAGEHIPRPQGGGGGGGGRGKA
FT                   GNSGEGMDEFVFQITQEEFLEFMFEDLELPNLVKRHLTGADTFKTVRAGIANEGNPSRI
FT                   NIVRTLRSAHARRIALTGSSRALLREAQKELDRLRVEEPDNFTDIQEVEQEIERLKARI
FT                   NRLPFLDTFDLKYNLLVKQPNPSSKAVMFCLMDVSGSMTQATKDIAKRFFILLYLFLKR
FT                   NYDRIEVVFIRHHTSAREVDEEEFFYSRETGGTIVSSALKLMQEIMAERYPASDWNIYA
FT                   AQASDGDNWNDDSPICRDILSKQIMPHVQYYTYVEITPREHQALWYEYERIGEAYPDTF
FT                   AQQQLVSAGDIYPVFRELFQRRLAT"
FT   gene            complement(500498..502420)
FT                   /locus_tag="PputGB1_0428"
FT   CDS_pept        complement(500498..502420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0428"
FT                   /product="putative serine protein kinase, PrkA"
FT                   /note="PFAM: PrkA serine kinase; PrkA AAA domain protein;
FT                   KEGG: pen:PSEEN0424 serine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96339"
FT                   /db_xref="GOA:B0KJ89"
FT                   /db_xref="InterPro:IPR010650"
FT                   /db_xref="InterPro:IPR013153"
FT                   /db_xref="InterPro:IPR016230"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ89"
FT                   /protein_id="ABY96339.1"
FT                   /translation="MSIFSHFQQRFESTRQEELSLQEYLELCKGDRSAYASAAERLLLA
FT                   IGEPELIDTSTNSRLSRIFSNKVIRRYPAFADFHGMEECIDQIVSYFRHAAQGLEEKKQ
FT                   ILYLLGPVGGGKSSLAEKLKQLMEKVPFYAIKGSPVFESPLGLFNATEDGAILEEEFGI
FT                   PRRYLNTIMSPWATKRLQEFGGDISKFKVVKLYPSILNQIAIAKTEPGDENNQDISALV
FT                   GKVDIRKLEEYPQNDADAYSYSGALCRANQGLMEFVEMFKAPIKVLHPLLTATQEGNYN
FT                   STEGLGAIPYTGILLAHSNESEWHTFRNNKNNEAFIDRIYIVKVPYCLRVSDEIKIYDK
FT                   LLVNSSLSKAHCAPDTLKMLAQFTVLSRLKEPENSNIYSKMRVYDGENLKDTDPKAKSI
FT                   QEYRDSAGVDEGMNGLSTRFAFKILSKVFNFDPHEIAANPVHLLYVLEQQIEQEQFPAE
FT                   VRERYLRYLKEYLAPRYIEFIGKEIQTAYLESYSEYGQNIFDRYVLYADFWIQDQEYRD
FT                   PETGEILNRIALNEELEKIEKPAGISNPKDFRNEIVNFVLRARANNNGKNPSWLSYEKL
FT                   RVVIEKKMFSNTEDLLPVISFNAKASKEDQKKHNDFVTRMVERGYTDKQVRLLSEWYLR
FT                   VRKSQ"
FT   gene            complement(502704..503036)
FT                   /locus_tag="PputGB1_0429"
FT   CDS_pept        complement(502704..503036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0429"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: pen:PSEEN0425
FT                   thiosulfate sulfurtransferase (rhodanese)"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96340"
FT                   /db_xref="GOA:B0KJ90"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR023695"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KJ90"
FT                   /protein_id="ABY96340.1"
FT                   /translation="MSEFKRIPPEQALELRKQEGAVVVDIRDAQAFAAGHITGARHLDN
FT                   HSVADFIRGANLDAPTLVVCYHGNSSQSAAAYLVGQGFSDVYSVDGGFELWRATYPAET
FT                   AQGAAE"
FT   gene            complement(503051..503917)
FT                   /locus_tag="PputGB1_0430"
FT   CDS_pept        complement(503051..503917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0430"
FT                   /product="bis(5'nucleosyl)-tetraphosphatase, ApaH"
FT                   /EC_number="3.6.1.41"
FT                   /note="KEGG: pen:PSEEN0426
FT                   bis(5'-nucleosyl)-tetraphosphatase, symmetrical
FT                   (diadenosine tetraphosphatase) (Ap4A hydrolase)
FT                   (diadenosine 5',5'''-P1,P4-tetraphosphate
FT                   pyrophosphohydrolase); TIGRFAM:
FT                   bis(5'-nucleosyl)-tetraphosphatase (symmetrical); PFAM:
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96341"
FT                   /db_xref="GOA:B0KJ91"
FT                   /db_xref="InterPro:IPR004617"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KJ91"
FT                   /protein_id="ABY96341.1"
FT                   /translation="MATYAVGDLQGCLQPLKCLLERVSFNPAVDRLWLVGDLVNRGPES
FT                   LETLRFLYSIRQSLVCVLGNHDLHLLAAWHNVERLKKSDTLREIIEAPDADPLFDWLRQ
FT                   QKLLHYDEARGIAMAHAGIPPQWTLGQALGYAAEVEEALRDDSRLKLYLDGMYGNEPNK
FT                   WSKNLTGVERLRVITNYLTRMRFCTAEGKLDLKSKEGLGTAPKGYKPWFAHKGRRSRHV
FT                   TIIFGHWAALEGRVDEPGIIALDTGCVWGGAMTLYNVDSGEYHRCDCADDGTLRQPAQP
FT                   TTLNDHT"
FT   gene            complement(503917..504297)
FT                   /locus_tag="PputGB1_0431"
FT   CDS_pept        complement(503917..504297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0431"
FT                   /product="ApaG domain protein"
FT                   /note="PFAM: ApaG domain protein; KEGG: pen:PSEEN0427
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96342"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR023065"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KJ92"
FT                   /protein_id="ABY96342.1"
FT                   /translation="MSDPRYQIDVSVVTRYLKEQSDPENSRFAFAYTITVQNNGSLKAK
FT                   LLSRHWLITNGDGEVEEVRGAGVVGQQPNIDPGQSHTYSSGAVISTRVGTMQGSYQMFA
FT                   EDGKRFDAEIAPFRLAVPGALH"
FT   gene            complement(504443..505243)
FT                   /locus_tag="PputGB1_0432"
FT   CDS_pept        complement(504443..505243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0432"
FT                   /product="dimethyladenosine transferase"
FT                   /note="KEGG: pen:PSEEN0428
FT                   S-adenosylmethionine-6-N',N'-adenosyl (rRNA)
FT                   dimethyltransferase, kasugamycin resistance; TIGRFAM:
FT                   dimethyladenosine transferase; PFAM: ribosomal RNA adenine
FT                   methylase transferase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96343"
FT                   /db_xref="GOA:B0KJ93"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ93"
FT                   /protein_id="ABY96343.1"
FT                   /translation="MNEQYQHRARKRFGQNFLHDAGVIDRILRAINAKAGEHLLEIGPG
FT                   QGALTEGLLGSGAQLDVVELDKDLVPILQHKFADRGNFRLHQGDALKFDFNQLGVPPRS
FT                   LKVVGNLPYNISTPLIFHLLSHAGLIRDMHFMLQKEVVERMAAGPGGGDWGRLSIMVQY
FT                   HCRVEHLFNVGPGAFNPPPKVDSAIVRLVPHEVLPHPAKDAKLLEQVVREAFNQRRKTL
FT                   RNTMKGLLDSAAIEAAGVDGSLRPEQLDLAAFVRLADQLADQQA"
FT   gene            complement(505240..506229)
FT                   /locus_tag="PputGB1_0433"
FT   CDS_pept        complement(505240..506229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0433"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /EC_number="1.1.1.262"
FT                   /note="KEGG: pen:PSEEN0429 4-hydroxythreonine-4-phosphate
FT                   dehydrogenase (4-(phosphohydroxy)-L-threonine
FT                   dehydrogenase); TIGRFAM: 4-hydroxythreonine-4-phosphate
FT                   dehydrogenase; PFAM: Pyridoxal phosphate biosynthetic
FT                   protein PdxA"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96344"
FT                   /db_xref="GOA:B0KJ94"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="InterPro:IPR037510"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ94"
FT                   /protein_id="ABY96344.1"
FT                   /translation="MKPLRFAVTPGEPAGIGPDLCLLLAADAQPHPLIAITSRDLLAER
FT                   ATQLGLAVNLLSVAPGQWPEQPAPAGSLYVWDTPLAAPVTSGHLDKANAAFVLETLTRA
FT                   GKGCLDGHFAGMITAPVHKGVINESGIAFSGHTEFLAELTHTAQVVMMLATRGLRVALV
FT                   TTHLPLRDIADAITAERIERVTRILHADMRDKFGIANPRILVCGLNPHAGEGGHLGREE
FT                   IDIIEPTLARLRTEGMDLRGPLPADTLFTPKYLEHCDAVLAMYHDQGLPVLKYKGFGAA
FT                   VNVTLGLPIIRTSVDHGTALDLAGTGKVDTGSLRVALETAYQMAENRP"
FT   gene            complement(506226..507551)
FT                   /locus_tag="PputGB1_0434"
FT   CDS_pept        complement(506226..507551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0434"
FT                   /product="SurA domain"
FT                   /note="PFAM: PpiC-type peptidyl-prolyl cis-trans isomerase;
FT                   SurA domain; KEGG: pen:PSEEN0430 peptidyl-prolyl cis-trans
FT                   isomerase A"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96345"
FT                   /db_xref="GOA:B0KJ95"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR015391"
FT                   /db_xref="InterPro:IPR023034"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ95"
FT                   /protein_id="ABY96345.1"
FT                   /translation="MNVKTKLIDRLRPVLLGAALLSGAVHAAVQPLDRVVAIVDNDVVM
FT                   QSQLDQRVHEVQQTIAKRGGGVPPTGALEQQVLERLIVENLQLQIGERSGIRITDEELN
FT                   QAIGTIAQRNGMSLDQFRAALAHDGLSFDDAREQVKREMIISRVRQRRVAERIQVSEQE
FT                   VKNFLNSDMGKMQMSEEYRLANILIPTPEAANSDDIQKAARKVGDVYQQLRQGADFGQM
FT                   AIANSASENALEGGEMGWRKAGQLPPDFAKMLSSMPVGEITQPIRIPNGFIILKLEEKR
FT                   GGSENVLRDEVHVRHILIKPSEIRSEAATEQLAERLYDRIKNGEDFGELAKSFSEDPGS
FT                   ALNGGDLNWVDPNSLVPEFREQMANAQQGVVTKPFKTQYGWHVLEVLGRRATDSTEQAR
FT                   EQQALSVLRNRKYDEELQTWLRQIRDEAYVEIKLPGADQAAQ"
FT   sig_peptide     complement(507468..507551)
FT                   /locus_tag="PputGB1_0434"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 28"
FT   gene            complement(507526..510324)
FT                   /locus_tag="PputGB1_0435"
FT   CDS_pept        complement(507526..510324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0435"
FT                   /product="Organic solvent tolerance protein"
FT                   /note="PFAM: OstA family protein; Organic solvent tolerance
FT                   protein; KEGG: pen:PSEEN0431 organic solvent tolerance
FT                   protein precursor OstA"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96346"
FT                   /db_xref="GOA:B0KJ96"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR007543"
FT                   /db_xref="InterPro:IPR020889"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KJ96"
FT                   /protein_id="ABY96346.1"
FT                   /translation="MALKSPAFRRKFPLLVTGGLLALQPLATSYAVAAEQFDCQVSAAG
FT                   GWDCKPKAPVNNLPPRPVHEGAAVSSGTEAASEGETADRPMLVTEAKGRALKSRSEDYS
FT                   HLDWVPREKLTAAQLAETGPYCGGAYVEPTRPGMADTTPKDESPTYINAKVSKYQQEQQ
FT                   IATLAGDVVMRQGSMQAEADEANLYQTENRGELKGNVKIRDNGSLVVGDEAQIQLDTGE
FT                   AQVDNAEYVMHKSHIRGSALYAKRGENAIIRLKDGTYTTCEPGSNAWQLKGNNITLNPA
FT                   TGFGTATNVTLRVKDFPVFYTPYIYFPIDDRRQSGFLPPSFSTSSDTGFMLVTPYYFNL
FT                   APNYDATLYPRYMAKRGLLMEGEFRYLTPSSEGQFGGAYLNDKDDDRKEQTDYKDQRWM
FT                   VNWQHKGGLDERLMTEVDYTDISDPFYFQDLESDQIGVESRDLLNQQGALTYRGDNYTA
FT                   RLNVHAYEMATISQITPYDRLPQITLNGVLPYNPGGLVMGYESEAVRFDRDLKDDFVRD
FT                   KDGNPDFSAGAAGRRLDQNVSGIARANGNRFNVAPSISLPMEASYGYLTPKLKYAYTHY
FT                   DLDLDSQGKAQAIAQSANPAYGSYNSSLNRDVPIFSVDSGLYFDRNTSLFGTNYKQTLE
FT                   PRLFYLNVPYKDQRDIPIFDSSETLFSYDSLFRDNRFSGTDRIGDENKLSLGVTTRWIE
FT                   DNGFERQNFSIGQAYYFKDRKVQLPGIYYKDRQSAQSDTSPYALVYNYYFNRDWRFNSD
FT                   FNWDPDSRSTRSGSAMFHYQPEDNPNKVVNLGYRYRNDTIIYDSTTGTWKEGGSYGNPG
FT                   DPNYIKDYYKIQQHDFSVIWPIVPQWSVIARWQHDYNRNRTLEAMGGFEYDNCCWKLRL
FT                   INRYWIDYDDFSQALPANEKGDHGVFLQIVLKGLGGVVGNKVESFLDQGIQGYREREDQ
FT                   AY"
FT   sig_peptide     complement(510223..510324)
FT                   /locus_tag="PputGB1_0435"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.982 at
FT                   residue 34"
FT   gene            510455..511474
FT                   /locus_tag="PputGB1_0436"
FT   CDS_pept        510455..511474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0436"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   pen:PSEEN0432 phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96347"
FT                   /db_xref="GOA:B0KJ97"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ97"
FT                   /protein_id="ABY96347.1"
FT                   /translation="MPEHDVRLQQLTVWLEEQLNELFRNNAWGEVPAGSLTSASSDASF
FT                   RRYFRWQGAGHSFVIMDAPPPQENCRPFVAIDHLLASADVHVPLIHAQDLERGFLLLGD
FT                   LGTQTYLDIINADNADGLFADAIDALLKFQRLPMDAPLPSYDDALLRREVELFPEWYVG
FT                   RELGLALSEAQKATWQRVSQLLIDSALAQPKVLVHRDYMPRNLMQSTPNPGVLDFQDAV
FT                   YGPVTYDITCLFKDAFVSWPQARVETWLRDYWQQAQVAGIPVHAEFEAFQRASDLMGVQ
FT                   RHLKVIGIFARICHRDGKPRYLGDVPRFFAYINEVIGRRPELAELGELIAQLQAGARA"
FT   gene            511471..512142
FT                   /locus_tag="PputGB1_0437"
FT   CDS_pept        511471..512142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0437"
FT                   /product="Nucleotidyl transferase"
FT                   /note="PFAM: Nucleotidyl transferase; KEGG: pen:PSEEN0433
FT                   nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96348"
FT                   /db_xref="GOA:B0KJ98"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ98"
FT                   /protein_id="ABY96348.1"
FT                   /translation="MKAMILAAGKGERMRPLTLHTPKPLVPVAGQPLIEYHLRALAAAG
FT                   VTDVVINHAWLGQQIEDHLGDGSRFGLSIRYSPEGEPLETGGGIFKALPLLGDAPFLLV
FT                   NGDVWTDYDFARLQAPLQGLAHLVLVDNPGHHGRGDFRLVGERVVDGDDAPGTLTFSGI
FT                   SLLHPALFDGCQAGAFKLAPLLRQAMTAGKVSGEHYRGHWVDVGTLERLAEVERLIGER
FT                   A"
FT   gene            512144..512911
FT                   /locus_tag="PputGB1_0438"
FT   CDS_pept        512144..512911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0438"
FT                   /product="heat shock protein DnaJ domain protein"
FT                   /note="PFAM: heat shock protein DnaJ domain protein; KEGG:
FT                   pen:PSEEN0434 DnaJ-like co-chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96349"
FT                   /db_xref="GOA:B0KJ99"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJ99"
FT                   /protein_id="ABY96349.1"
FT                   /translation="MWWPGTVIGVGAGFAVASIPGALLGALLGQAMDRRLRLQGWDDMR
FT                   ERLGGRSALRDDELLFVMLGRLAKCDGRVGELHIQQARQEMVRLDLAEAARLRAINAFN
FT                   RGKAGKDRLGGHLRRIRQQPHAAEGTLRACWRMVWADGKMGNKERELLLDWGQKLGMSR
FT                   RQVQAMSLEYEPRKATAAEGVPMTYAAALRLLAVEADTDSDKVKQAYRRLVSRHHPDKL
FT                   AGTGASDAQVREATERTRELHQAYAMIRKRRGL"
FT   sig_peptide     512144..512221
FT                   /locus_tag="PputGB1_0438"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.791) with cleavage site probability 0.548 at
FT                   residue 26"
FT   gene            complement(513013..514011)
FT                   /locus_tag="PputGB1_0439"
FT   CDS_pept        complement(513013..514011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0439"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN0435 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96350"
FT                   /db_xref="InterPro:IPR022529"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJA0"
FT                   /protein_id="ABY96350.1"
FT                   /translation="MSTLYRTGLAVCCLASLLPLGALAADAEKPPATTATPAVEPPRPP
FT                   LLERSQEDAQALERLVPKAEQQTLQAGADSFLALWKPANDSDPQGAVIIVPGAGETADW
FT                   PNAVGPLRQKFPDVGWHSLSVSLPDLLADSPQARVEAKPAAEPEKAKGESAPAKDVPAD
FT                   ANANIAQATAADADAAQNTDAEQASEQADPADAERIFARLDAAVAFAQQHNARSIVLIG
FT                   HGSGAYWAARYLSEKQPPQVQKLVMVAAQTPARVEHDLESLAPTLKVPTADIYYVTRSQ
FT                   DRNAAEQRLQASKRQKDSQYRQLSLIAMPGNKAAEQEQLFRRVRGWMSPQG"
FT   sig_peptide     complement(513937..514011)
FT                   /locus_tag="PputGB1_0439"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 25"
FT   gene            514107..516494
FT                   /locus_tag="PputGB1_0440"
FT   CDS_pept        514107..516494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0440"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: pen:PSEEN0436 sensory box histidine kinase;
FT                   TIGRFAM: PAS sensor protein; PFAM: ATP-binding region
FT                   ATPase domain protein; histidine kinase dimerisation and
FT                   phosphoacceptor region; PAS fold-3 domain protein; PAS
FT                   fold-4 domain protein; PAS fold domain protein; SMART: PAS
FT                   domain containing protein; extracellular solute-binding
FT                   protein family 3"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96351"
FT                   /db_xref="GOA:B0KJA1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJA1"
FT                   /protein_id="ABY96351.1"
FT                   /translation="MKRVRRLLVIGCLWLPLIALARPEAPPAVVLEPAQQQWLDTHRSL
FT                   RVGLVLQVPYAQFDRRLQQLYGANVELVSSLAQVLRLDLTWRNFSDQASLEHALQSGEI
FT                   DFAPGLTQTPASLRLWLFSDPYMRVPQLVVGPRTGAMAVELEKLEAEQRVAVRMPSQLA
FT                   DYLRANYSNLNLQGVPNEREALQLVVGGQAAFAVLDEAQLSRLSRESEFSELAVVGDIG
FT                   LPQLLRIGSRRDWPLLADVLERGLQALPAKELEQLHQRWLQPKYPRLSESPGFWQNLAL
FT                   LFGMLLLCALATLLWQRRQQRQLERSLLATRESLVERQVREEALRLSQFAIDQSTVGIL
FT                   WVNWDSHVRYANHAAERMLGYAEGELLERPLSTFEPSLNMDRWLELWKGARTGAGGTGQ
FT                   FEAQCRRADHSVLPVELSLSFLRFRDSEYLVVYLADVTERHRALAALRESEARLKGIAG
FT                   NVPGLVFRLERDPAEGDLEFPYISEGSEALVGYAPSEIQHPQMGLRNLVHPEDRADYHR
FT                   VQDLALASDQDWSWQGRILTRQGEQRWADIKASTRRLGNGQVVWDGVVWDITQGKRAEL
FT                   ALAKSQEQLRELSAHLESVREEEKARIAREVHDELGQMLTVLKLEVSMCELAFAELDPG
FT                   LNERLSSMKRLIAQLFQLVRDVATALRPPILDAGIASAIEWQARRFEARTQIPCLVQVP
FT                   DNLPALSDAKATGLFRILQEALTNVMRHAQAHSVEIELVRQDGQLRMTVSDDGQGFCRD
FT                   QPRPTSFGLVGVRERVLMLGGSMALDSQPGEGTSLSVAIPLE"
FT   sig_peptide     514107..514172
FT                   /locus_tag="PputGB1_0440"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            516505..517134
FT                   /locus_tag="PputGB1_0441"
FT   CDS_pept        516505..517134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0441"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; response regulator
FT                   receiver; KEGG: pen:PSEEN0437 DNA-binding response
FT                   regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96352"
FT                   /db_xref="GOA:B0KJA2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJA2"
FT                   /protein_id="ABY96352.1"
FT                   /translation="MIRVLVAEDHTIVREGIKQLIGLAKDMQVAGEAGNGEQLLETLRH
FT                   TPCEVVLLDISMPGVNGLEAIPRIRALHDAPAILMLSMHDEAQMAARALKAGAAGYATK
FT                   DSDPALLLTAIRRVAGGGRYIDPSLADRMVFEVGLTESRPLHTLLSEREFSVFERLAQG
FT                   ANVNDIAQQLALSSKTISTHKARLMQKLKVNSLAELVKYAMEHKLV"
FT   gene            517439..518563
FT                   /locus_tag="PputGB1_0442"
FT   CDS_pept        517439..518563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0442"
FT                   /product="spermidine/putrescine ABC transporter ATPase
FT                   subunit"
FT                   /note="KEGG: pen:PSEEN0438 polyamine ABC transporter,
FT                   ATP-binding protein; TIGRFAM: spermidine/putrescine ABC
FT                   transporter ATPase subunit; PFAM: ABC transporter related;
FT                   Transport-associated OB domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96353"
FT                   /db_xref="GOA:B0KJA3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJA3"
FT                   /protein_id="ABY96353.1"
FT                   /translation="MSEAKSNAATSETLVSFRGVQKSYDGESLIVKDLNLDIRKGEFLT
FT                   LLGPSGSGKTTSLMMLAGFETPTAGEIQLAGRSINNVPPHKRDIGMVFQNYALFPHMTV
FT                   AENLAFPLTVRNLSKTDISERVKRVLNMVQLDAFAKRYPGQLSGGQQQRVALARALVFE
FT                   PQLVLMDEPLGALDKQLREHMQMEIKHIHQRLGVTVVYVTHDQGEALTMSDRVAVFHQG
FT                   EIQQIADPRTLYEEPCNTFVANFIGENNRINGTLLASDGKRCQVQLPRGERVEALAVNV
FT                   GQAGEPVTLSIRPERVRLNGHSESCVNRFSGRVAEFIYLGDHVRVRLEVCGKGDFFVKQ
FT                   PIAELDPALAVGDVVPLGWEVEHARALDPIAEAH"
FT   gene            518604..519638
FT                   /locus_tag="PputGB1_0443"
FT   CDS_pept        518604..519638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0443"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: pen:PSEEN0439 polyamine ABC transporter, periplasmic
FT                   polyamine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96354"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJA4"
FT                   /protein_id="ABY96354.1"
FT                   /translation="MRKQLKLTALALGLFAAGQAMAADLTVISFGGANKAAQVKAFYEP
FT                   WEKAGNGKIVAGEYNGEMAKVKAMVDTKSVSWNLVEVESPELARGCDEGMFEELDPALF
FT                   GDDADYVPGAIQPCGVGFFVWSTVMAYNADKLKTAPTSWADFWDTKQFPGKRGLRKGAK
FT                   YTMEFALMADGVAPKDVYKVLATKEGQDRAFKKLDELKPNIQWWEAGAQPPQFLASGDV
FT                   VMSSAYNGRIAAVQKESNLKVVWNGGIYDFDAWAIPKGAKNAEEAKKFIAYSVKPEQQK
FT                   IYSENIAYGPANAKAVSLLSEDVKKDMPTTPENIANQVQIDVAFWADNSEQLEQRFNAW
FT                   AAKK"
FT   sig_peptide     518604..518672
FT                   /locus_tag="PputGB1_0443"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            519705..520952
FT                   /locus_tag="PputGB1_0444"
FT   CDS_pept        519705..520952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0444"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: pen:PSEEN0440 polyamine ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96355"
FT                   /db_xref="GOA:B0KJA5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJA5"
FT                   /protein_id="ABY96355.1"
FT                   /translation="MAIAVPLKEGAGPSLKQRLKHAERVNRWKAQALIAPLALFLLLVF
FT                   LVPIAALLYKSVGNPEVVGGLPRTVDIITQWDGKSLPGEDVYKALSQDLAESRKNQTLG
FT                   DLSKRLNMELAGYRSLLTKTARALPFKAEPASYKDALQAVDERWGDPAYWQAIRRNTSS
FT                   VTSFYLLASVDHRIDDLGELAKATPDQAIYLDIFARTLWMGVVITAICLVLAYPLAYLL
FT                   ANLPTRQSNLLMILVLLPFWTSILVRVAAWIVLLQSGGLINSALMAMGIIDQPLELVFN
FT                   RTGVYISMVHILLPFMILPLYSVMKGISPSYMRAAISLGCHPFASFWRVYFPQTYAGVG
FT                   AGCLLVFILAIGYYITPALLGSPNDQMVSYFVAFYTNTSINWGMATALGGLLLLATVLL
FT                   YLIYSWLVGASRLRLS"
FT   gene            520963..521790
FT                   /locus_tag="PputGB1_0445"
FT   CDS_pept        520963..521790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0445"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: pen:PSEEN0441 polyamine ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96356"
FT                   /db_xref="GOA:B0KJA6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJA6"
FT                   /protein_id="ABY96356.1"
FT                   /translation="MLSPYMSPVERVWFYSLRILCGLILLFLILPVLVIVPLSFNSGSF
FT                   LVYPLQGFSLQWYQDFFGSAEWMRALKNSIIVAPAATVLAMVFGTLAAIGLTRGDFPGK
FT                   SLVMALVISPMVVPVVIIGVASYLFFAPLGMGNSFTSLILVHAVLGVPFVIITVSATLQ
FT                   GFNYNLVRAAASLGASPLLTFRRVTLPLIAPGVISGALFAFATSFDEVVVTLFLAGPEQ
FT                   ATLPRQMFSGIRENLSPTIAAAATLLIAFSVVLLLTLEWLRGRSEKLRTQQPA"
FT   gene            521946..522620
FT                   /locus_tag="PputGB1_0446"
FT   CDS_pept        521946..522620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0446"
FT                   /product="Ribulose-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /note="PFAM: ribulose-phosphate 3-epimerase; KEGG:
FT                   pen:PSEEN0442 D-ribulose-5-phosphate 3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96357"
FT                   /db_xref="GOA:B0KJA7"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJA7"
FT                   /protein_id="ABY96357.1"
FT                   /translation="MQPYAIAPSILSADFARLGEDVDKVLAAGADIVHFDVMDNHYVPN
FT                   LTIGPMVCTALRKYGVTAPIDVHLMVSPVDRIIGDFIEAGATYITFHPEATQHIDRSLQ
FT                   LIKDGGCKAGLVFNPATSLDALKYVMDKIDMVLLMSVNPGFGGQKFIPGTLDKLREARA
FT                   LIDASGRDIRLEIDGGVNVNNIREIAAAGADTFVAGSAIFNAPDYQEVIAKMRAELALA
FT                   RP"
FT   gene            522617..523435
FT                   /locus_tag="PputGB1_0447"
FT   CDS_pept        522617..523435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0447"
FT                   /product="phosphoglycolate phosphatase"
FT                   /note="TIGRFAM: phosphoglycolate phosphatase;
FT                   HAD-superfamily hydrolase, subfamily IA, variant 3;
FT                   HAD-superfamily hydrolase, subfamily IA, variant 1; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; KEGG:
FT                   pen:PSEEN0443 phosphoglycolate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96358"
FT                   /db_xref="GOA:B0KJA8"
FT                   /db_xref="InterPro:IPR006346"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR037512"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJA8"
FT                   /protein_id="ABY96358.1"
FT                   /translation="MSGFEQLFPGTLPRLVMFDLDGTLIDSVPDLAAAVDRMLLELGRP
FT                   PAGLEAVRHWVGNGAQVLVRRALAGGIDHTTVDDALAEQALALFMDAYAESHELTVVYP
FT                   GVRDTLRWLRKQGVEMALITNKPERFVGPLLDQMKIGNYFRWIIGGDTLPQKKPDPAAL
FT                   LFVMQMAGVTPQQSLFVGDSRSDVLAAKAAGVQCVGLTYGYNHGRPINDESPNLVIDDL
FT                   RALLPGCADPATGITLANLQASQDREPTVVVTGKFWMKVIKALARWRWRA"
FT   gene            523505..524986
FT                   /locus_tag="PputGB1_0448"
FT   CDS_pept        523505..524986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0448"
FT                   /product="anthranilate synthase component I"
FT                   /EC_number="4.1.3.27"
FT                   /note="KEGG: pen:PSEEN0444 anthranilate synthase component
FT                   I; TIGRFAM: anthranilate synthase component I; PFAM:
FT                   Anthranilate synthase component I domain protein;
FT                   Chorismate binding-like"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96359"
FT                   /db_xref="GOA:B0KJA9"
FT                   /db_xref="InterPro:IPR005256"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJA9"
FT                   /protein_id="ABY96359.1"
FT                   /translation="MNREEFLRLAAAGYNRIPLACETLADFDTPLSIYLKLADQPNSYL
FT                   LESVQGGEKWGRYSMIGLPSRTVMRVHGYHVSILQDGVEVESHDVEDPLAFVETFKDRY
FT                   KVADIPGLPRFNGGLVGYFGYDCVRYVEKRLGASPNPDPLGVPDILLMVSDAVVVFDNL
FT                   AGKMHAIVLVDPAEEQAFEQGQARLQGLLETLRQPITPRRGLDLSGPQVDEPEFRSSYT
FT                   REDYENAVGRIKEYILAGDCMQVVPSQRMSIDFKAAPIDLYRALRCFNPTPYMYFFNFG
FT                   DFHVVGSSPEVLVRVEDNLVTVRPIAGTRPRGATEEADRALEDDLLSDDKEIAEHLMLI
FT                   DLGRNDVGRVSSTGSVRLTEKMVIERYSNVMHIVSNVTGQLREGLTAMDALRAILPAGT
FT                   LSGAPKIRAMEIIDELEPVKRGVYGGAVGYFAWNGNMDTAIAIRTAVIKDGELHVQAGG
FT                   GIVADSVPALEWEETINKRRAMFRAVALAEQTLTK"
FT   gene            complement(525019..526899)
FT                   /locus_tag="PputGB1_0449"
FT   CDS_pept        complement(525019..526899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0449"
FT                   /product="outer membrane autotransporter barrel domain
FT                   protein"
FT                   /EC_number="3.1.1.1"
FT                   /note="KEGG: pen:PSEEN0445 esterase EstA precursor;
FT                   TIGRFAM: outer membrane autotransporter barrel domain
FT                   protein; PFAM: lipolytic protein G-D-S-L family;
FT                   Autotransporter beta- domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96360"
FT                   /db_xref="GOA:B0KJB0"
FT                   /db_xref="InterPro:IPR001087"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR008265"
FT                   /db_xref="InterPro:IPR017186"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJB0"
FT                   /protein_id="ABY96360.1"
FT                   /translation="MRKAPLLRFTLASLALACSQAFAAPSPYSTLIVFGDSLSDAGQFG
FT                   GMRFTNRDADGNYAPVSPMILGGRLGVSPIELGPSTSPLNPALGLPDGNNWAVGGYTTQ
FT                   QILDSITSTSETVIPPGRTGAGQVLREKPGYLANGLRADPNALYYLTGGGNDFLQGLVN
FT                   SPADAIAAGARLAASAQALQQGGARYIMVWLLPDLGQTPNFSGTPQQNPLSLLSGAFNQ
FT                   SLLSRLGQIDAEIIPLNVPLLLSEALASPNQFGLASDQNLVGTCYSGEGCVANPVYGIT
FT                   GTTPDPTKLLFNDSVHPTIAGQQLIADYAYSIISAPWELTLLPEMAHASLRAHQDELRN
FT                   QWQTPWQAVGQWQAFVATGAQDLDFDGQHSAASGDGRGYNLTVGGSYRLNDAWRVGLAG
FT                   GAYRQKLEVGDQDSDYKLNSYLASAFAQYRQDRWWADAALTAGHLDYSDLKRTFALGVN
FT                   GRSEKGDTDGEAWAMSGRLGYNLAADSSDWQLAPFISADYARVKVDGYDEKSGRSTALG
FT                   FDDQERTSRRLGVGLLGSVQVMPSTRLFAEVAQEHEFEDDQQDVTMHLTRLPANDFTLT
FT                   GYTPHSDLTRASLGVSHELVAGVHVRGNYNWRKSDELTQQGVSLGVSVDF"
FT   sig_peptide     complement(526828..526899)
FT                   /locus_tag="PputGB1_0449"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            527267..527860
FT                   /locus_tag="PputGB1_0450"
FT   CDS_pept        527267..527860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0450"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /note="TIGRFAM: glutamine amidotransferase of anthranilate
FT                   synthase; PFAM: glutamine amidotransferase class-I; KEGG:
FT                   pen:PSEEN0447 anthranilate synthase component II (glutamine
FT                   amido-transferase)"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96361"
FT                   /db_xref="GOA:B0KJB1"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B0KJB1"
FT                   /protein_id="ABY96361.1"
FT                   /translation="MLLMIDNYDSFTYNVVQYLGELGAEVKVIRNDEMTIAQIEALNPE
FT                   RIVVSPGPCTPSEAGVSIEAILHFAGKLPILGVCLGHQSIGQAFGGDVVRARQVMHGKT
FT                   SPVHHRDLGVFAGLNNPLTVTRYHSLVVKRETLPDCLEVTAWTAHEDGSVDEIMGLRHK
FT                   TLNIEGVQFHPESILTEQGHELFANFLKQTGGRR"
FT   gene            527870..528919
FT                   /locus_tag="PputGB1_0451"
FT   CDS_pept        527870..528919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0451"
FT                   /product="anthranilate phosphoribosyltransferase"
FT                   /note="TIGRFAM: anthranilate phosphoribosyltransferase;
FT                   PFAM: glycosyl transferase family 3; KEGG: pen:PSEEN0448
FT                   anthranilate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96362"
FT                   /db_xref="GOA:B0KJB2"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR005940"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KJB2"
FT                   /protein_id="ABY96362.1"
FT                   /translation="MDIKSALARIVGHLDLSTEEMRDVMRQIMTGQCSEAQIGAFLMGM
FT                   RMKSESIDEIVGAVSVMRELADKVELKSLDGVVDIVGTGGDGANIFNVSTASAFVLAAA
FT                   GCTVAKHGNRAVSGKSGSADLLEAAGIYLNLTPTQVARCIDSLGIGFMFAQSHHSAMKH
FT                   AAGPRRELGLRTLFNMLGPLTNPAGVKHQVVGVFAQALCRPLAEVLQRLGSKHVLVVHS
FT                   KDGLDEFSLAAPTFVAELKNDEITEYWVEPEDLGMKSQSLHGLAVDNPQASLELIRDAL
FT                   GRRKTENGQKAAEMIVLNAGAALYAADHAMTLAQGVELAHDVLHTGLAWEKLQELGAFT
FT                   AVFKVENEA"
FT   gene            528916..529749
FT                   /locus_tag="PputGB1_0452"
FT   CDS_pept        528916..529749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0452"
FT                   /product="Indole-3-glycerol-phosphate synthase"
FT                   /EC_number="4.1.1.48"
FT                   /note="PFAM: Indole-3-glycerol phosphate synthase; KEGG:
FT                   pen:PSEEN0449 indole-3-glycerol phosphate synthase (IGPS)"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96363"
FT                   /db_xref="GOA:B0KK35"
FT                   /db_xref="InterPro:IPR001468"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KK35"
FT                   /protein_id="ABY96363.1"
FT                   /translation="MSVPTVLERIIARKFQEVAERSARVSLAELEALAKAADAPRGFAN
FT                   ALIEQAKRKQPAVIAEIKKASPSKGVIREHFVPAEIAVSYEKGGATCLSVLTDVDYFQG
FT                   ADVYLQQARAAVSLPVIRKDFMVDPYQIVEARALGADCVLLIVSALDDVKMAELAATAK
FT                   DVGLDVLVEVHDGDELERALKTLDTPLVGVNNRNLHTFEVSLETTLDLLPRIPRDRLAI
FT                   TESGILNRADVELMAINEVYSFLVGEAFMRAEQPGLELQRLFFPEQVKKTVQPLD"
FT   gene            529919..530623
FT                   /locus_tag="PputGB1_0453"
FT   CDS_pept        529919..530623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0453"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN0450 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96364"
FT                   /db_xref="GOA:B0KK36"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="UniProtKB/TrEMBL:B0KK36"
FT                   /protein_id="ABY96364.1"
FT                   /translation="MSDQPLALTVEQGLHAEQELLAAVCRGERESGVLFWRPTDHALVM
FT                   PRRMSRLDNFEAACAELAIAGWPVLLRETGGEPVPQSHSTVNVALVYAAPRSEGDHGRI
FT                   ENAYERLCLPLCDVLREWGGVASVGEIDGAFCDGRYNVNLNGRKLVGTAQRWRQGLGGK
FT                   RPVVLVHGALLLDNERESMVAAVNRFNECCELEQRCRADAHIALHEVAPAVPWFERLSQ
FT                   AYAKVLAELPKD"
FT   gene            complement(530620..531264)
FT                   /locus_tag="PputGB1_0454"
FT   CDS_pept        complement(530620..531264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0454"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="PFAM: cyclic nucleotide-binding; regulatory protein
FT                   Crp; KEGG: pen:PSEEN0451 cyclic nucleotide-binding
FT                   transcriptional regulator Vfr"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96365"
FT                   /db_xref="GOA:B0KK37"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018335"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0KK37"
FT                   /protein_id="ABY96365.1"
FT                   /translation="MVASALPAKIKNIDKLLVHCQRRRYTAKSNIICAGDRAETLSFII
FT                   KGSVTILIEDDDGHEMIIAYLNNGDFFGELGLFEPVEGEQQRSAWVRAKTECEVAEISY
FT                   EKFRELARQDPEILYALGSQMAQRLRNTTRKVGDLAFFDVTGRVARCLLELCKQPDAMT
FT                   HPDGMQIKITRQEIGRIVGCSREMVGRVLKDLEERSLVQVKGKTMVVYGTR"
FT   gene            531456..531878
FT                   /locus_tag="PputGB1_0455"
FT   CDS_pept        531456..531878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0455"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: pen:PSEEN0452
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96366"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:B0KK38"
FT                   /protein_id="ABY96366.1"
FT                   /translation="MKARIQWAGEAMFLGESGSGHVVVMDGPPEAGGRNLGVRPMEMLL
FT                   LGLGGCSSFDVVSILKKSRQAVESCEAFLEAERASEDPKVFTKIHMNFVVKGRGLKEAQ
FT                   VKRAVELSAEKYCSASIMLERAGVEITHGYEIVELG"
FT   gene            complement(531973..533013)
FT                   /locus_tag="PputGB1_0456"
FT   CDS_pept        complement(531973..533013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0456"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN0454 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96367"
FT                   /db_xref="GOA:B0KK39"
FT                   /db_xref="UniProtKB/TrEMBL:B0KK39"
FT                   /protein_id="ABY96367.1"
FT                   /translation="MTDRFDAKDLARAVHAGILQPGQDQTLLAFLRQQPAPRGSFQLAH
FT                   VAFYFGAMLIMAAMGWLLTEAWMSIGDGALLIIATLYILLITLFALNLQRRAQPVAAGV
FT                   LAAVAVSIVPLAVFAIERLAGWWPLDDAQANYHQYYTYVQGGWLAMEAATVLAGLLMLR
FT                   LIPYPFVVMPIAVALWFMSMDLSEWFFGSPFSWEQRREVSLWFGLALLVVFLVIDGRTR
FT                   EDYARWGYLSGLAAFWGGLTLVDSGSELGKALYCLINIVLMGMAVLLRRPVFMVFGALG
FT                   VAAYLGYLSYEVFAESLLFPVVVTLIGLGVIWLGLVYQKRRERLSQVMRRWLPGWVQAA
FT                   LPALRS"
FT   gene            complement(533024..533671)
FT                   /locus_tag="PputGB1_0457"
FT   CDS_pept        complement(533024..533671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0457"
FT                   /product="ubiquinone biosynthesis protein COQ7"
FT                   /note="KEGG: pen:PSEEN0455 ubiquinone biosynthesis protein
FT                   COQ7"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96368"
FT                   /db_xref="GOA:B0KK40"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011566"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KK40"
FT                   /protein_id="ABY96368.1"
FT                   /translation="MATERHYSPLDRLLLQADTAMRTLLPFSGQPARPSPAIIQPDADL
FT                   DEQQSRHIAGLMRINHTGEVCAQALYQGQALTAKLPEVRKAMEHAAEEEIDHLAWCEQR
FT                   IRQLNSHPSVLNPLFYGMSFGIGALAGLVSDKVSLGFVAATEHQVCKHLDEHLEQIPHE
FT                   DEKSRAILEQMRIDEEQHAESALEAGGYRFPAPVRFGMSLLAKVMTKSTYRI"
FT   gene            complement(533737..534075)
FT                   /locus_tag="PputGB1_0458"
FT   CDS_pept        complement(533737..534075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0458"
FT                   /product="histidine triad (HIT) protein"
FT                   /note="PFAM: histidine triad (HIT) protein; KEGG:
FT                   pen:PSEEN0456 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96369"
FT                   /db_xref="GOA:B0KK41"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:B0KK41"
FT                   /protein_id="ABY96369.1"
FT                   /translation="MDDLFLKIINREIPADIIYEDDQILAFKDIAPAAPVHFLVIPKKH
FT                   IRTLNDLTEEDKALAGHILFTAQRLAVEQGCEEGFRVVMNCNPKGGQTVYHIHMHVLGQ
FT                   RQMNWPPG"
FT   gene            complement(534139..534921)
FT                   /locus_tag="PputGB1_0459"
FT   CDS_pept        complement(534139..534921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0459"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: pen:PSEEN0457 oxidoreductase, short
FT                   chain dehydrogenase/reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96370"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0KK42"
FT                   /protein_id="ABY96370.1"
FT                   /translation="MTRYAMITGASSGLGLALAEALARRGRNLILVARQRETLEPVAIE
FT                   LTQRFGVEVLFRACDLSQPLRLSGFVLELEEGERRIDLLVNCAGLRTYGPFLAHEWADE
FT                   QDLLEVNVLALSRLCHAIGNLMAVQGGGQILNVAGLAGMAPGPWMAAYTASKAYVLSFS
FT                   QALREELKRTGIKVSVLCPGPVRSARRRIARLDGKPRCLSPEEVALYTVRALDKNRALI
FT                   MPGRRNRWLAFAPRLLPRWLVRKLAGAIHRRYCPVGME"
FT   sig_peptide     complement(534862..534921)
FT                   /locus_tag="PputGB1_0459"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.976 at
FT                   residue 20"
FT   gene            complement(534989..535945)
FT                   /locus_tag="PputGB1_0460"
FT   CDS_pept        complement(534989..535945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0460"
FT                   /product="2-nitropropane dioxygenase NPD"
FT                   /note="PFAM: 2-nitropropane dioxygenase NPD; KEGG:
FT                   pen:PSEEN0458 dioxygenases related to 2-nitropropane
FT                   dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96371"
FT                   /db_xref="GOA:B0KK43"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B0KK43"
FT                   /protein_id="ABY96371.1"
FT                   /translation="MSLPALLEQRLRLPVVAAPMFLISNPKLVLACCASGVVGSFPALN
FT                   QRDSAGFKAWLEEIEAGLTQLQAPAPYAVNLIVHPTNPRLQADLALCVEHRVPIVITSL
FT                   GAVKEVVDAVHGYGGLVFHDVTTRRHAEKAAEAGVDGLIAVAAGAGGHAGTWSPFALAA
FT                   EIRQFFDKTLLLAGCINHGHEILAAQLLGADLAYMGTRFIATAESHAQDAYKQMLLDAH
FT                   AADIIHTPAVSGIPASFLRSSLEQAGYDMNALKSGHEQGKLKPIDDEAKAWKTVWSAGQ
FT                   GVGEIHDLPSTTELIERLQKEYREALERCQVLRIRTL"
FT   gene            complement(535974..536399)
FT                   /locus_tag="PputGB1_0461"
FT   CDS_pept        complement(535974..536399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0461"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   pfo:Pfl_5103 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96372"
FT                   /db_xref="GOA:B0KK44"
FT                   /db_xref="InterPro:IPR005265"
FT                   /db_xref="UniProtKB/TrEMBL:B0KK44"
FT                   /protein_id="ABY96372.1"
FT                   /translation="MLYLWIKALHIVSVVCWFAGLFYLPRLFVYHAQSQDSISQERFIT
FT                   MERKLYRGIMNPAMIATYVFGAWMLYLTPGWLSQGWLHAKLTLVILLTGYHHVCGAQRK
FT                   RFASGTNTRSHVYYRWFNEVPVLFLLGIVILVVVKPF"
FT   gene            536542..537576
FT                   /locus_tag="PputGB1_0462"
FT   CDS_pept        536542..537576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0462"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="KEGG: pen:PSEEN0460
FT                   N-acetyl-gamma-glutamyl-phosphate reductase; TIGRFAM:
FT                   N-acetyl-gamma-glutamyl-phosphate reductase; PFAM:
FT                   Semialdehyde dehydrogenase NAD - binding; oxidoreductase
FT                   domain protein; NADP oxidoreductase coenzyme
FT                   F420-dependent; Semialdehyde dehydrogenase dimerisation
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96373"
FT                   /db_xref="GOA:B0KK45"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KK45"
FT                   /protein_id="ABY96373.1"
FT                   /translation="MIKVGIVGGTGYTGVELLRLLAQHPQAEVAVITSRSEAGVAVADM
FT                   YPNLRGHYDGLAFSVPDSKALAACDVVFFATPHGVAHALAGELLAAGTKVIDLSADFRL
FT                   QDAAEWGKWYGQPHGAPELLKDAVYGLPEVNREKIRQARLIAVPGCYPTATQLGFLPLL
FT                   EAGLADPSRLIADCKSGVSGAGRGAAVGSLFCEAGESMKAYAVKGHRHLPEISQGLRLA
FT                   AGKDIGLTFVPHLTPMIRGIHATLYANVVDTSVDLQALFEKRYADEPFVDVMPAGSHPE
FT                   TRSVRGANVCRIAVHRPQGGDLVVVLSVIDNLVKGASGQAVQNLNILFGLDERMGLSHA
FT                   GLLP"
FT   gene            537676..538074
FT                   /locus_tag="PputGB1_0463"
FT   CDS_pept        537676..538074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0463"
FT                   /product="iron-sulfur cluster assembly accessory protein"
FT                   /note="TIGRFAM: iron-sulfur cluster assembly accessory
FT                   protein; PFAM: HesB/YadR/YfhF-family protein; KEGG:
FT                   pfo:Pfl_5101 HesB/YadR/YfhF"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96374"
FT                   /db_xref="GOA:B0KK46"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR023063"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:B0KK46"
FT                   /protein_id="ABY96374.1"
FT                   /translation="MRVIEFYGGYRAGRINMSVETFTPTGLEFTHGAAQKVKNLVNEEG
FT                   NERLKLRVFVTGGGCSGFQYGFTFDEDVAEDDTIVEREGVSLVVDPMSFQYLAGAEVDY
FT                   QEGLEGSRFVIKNPNAATTCGCGSSFSI"
FT   gene            complement(538134..539225)
FT                   /locus_tag="PputGB1_0464"
FT   CDS_pept        complement(538134..539225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0464"
FT                   /product="protein of unknown function UPF0075"
FT                   /note="PFAM: protein of unknown function UPF0075; KEGG:
FT                   pen:PSEEN0462 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96375"
FT                   /db_xref="GOA:B0KK47"
FT                   /db_xref="InterPro:IPR005338"
FT                   /db_xref="UniProtKB/TrEMBL:B0KK47"
FT                   /protein_id="ABY96375.1"
FT                   /translation="MALYLGVMSGTSLDGLDIALIEQSEQLELLATLYLPMPSDLRQEL
FT                   LALCSSGPDEIARAALAENRWASLAGDGIRQLLARQGLQASAIRAIGSHGQTIRHEPAR
FT                   GFTVQIGNPALLAELTGISVVADFRRRDVAASGQGAPLVPAFHETLFGHLGQRLAILNV
FT                   GGFSNLSLIEQDKPVHGFDCGPGNVLLDAWIERKRGQAYDADGAWAASGVVQAGLLNAL
FT                   LADPFFAGSGPKSTGREVFNLLWLDGHLAHLPAYQDEDVQATLLELTARSIIDSLGSAQ
FT                   QGTEALLVCGGGARNGALMARLAQLLPRARVASTGAHGVDPDWVEAMAFAWLAHCCLEG
FT                   IAANRPSVTAAKGLRVLGAIYPA"
FT   gene            complement(539229..540650)
FT                   /locus_tag="PputGB1_0465"
FT   CDS_pept        complement(539229..540650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0465"
FT                   /product="peptidase M23B"
FT                   /note="PFAM: peptidase M23B; Opacity-associated protein A;
FT                   Opacity-associated protein A domain protein; KEGG:
FT                   pen:PSEEN0463 peptidase, M23/M37 family"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96376"
FT                   /db_xref="InterPro:IPR007340"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:B0KK48"
FT                   /protein_id="ABY96376.1"
FT                   /translation="MTNEPPKAPPLYPKSHLLAASGIAALLSLALLVFPSSEVEAKKTT
FT                   LNLELESPAEQLKDESRAAPLVQAEGEQGSPFAQIEDAAPETQKAEQQTPTAEPVAEAA
FT                   KEPGHREVTVARGDTLSTLFAKVGLPANAVHDVLASNKQAKQFSQLKHGQVLQFELDKD
FT                   GQLASLHSKVSNLETIRLTKTAKGYAFNREISKPVVRTAYAHGVIKSSLSASAQRAGLS
FT                   HSMTMDMARVLGYDIDFAQDIRPGDEFDVVYEQKVMDGKVVGTGNILSARFTNRGKTYT
FT                   AVRYTNKQGNSTYYTADGNSLRKAFIRTPVDFARISSRFSAGRKHPILNKIRAHKGVDY
FT                   AAPRGTPIKAAGDGRIELAGRRGGYGNTVIIQHGNRYKTLYGHMQGFAKGIKTGSSVKQ
FT                   GQIIGYIGTTGLSTGPHLHYEFQVNGVHVDPLSQKVPMADPIAKNERQRFLQQSQPLIA
FT                   RMDQEKATLLAANKR"
FT   sig_peptide     complement(540525..540650)
FT                   /locus_tag="PputGB1_0465"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.948) with cleavage site probability 0.468 at
FT                   residue 42"
FT   gene            540864..542063
FT                   /locus_tag="PputGB1_0466"
FT   CDS_pept        540864..542063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0466"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /note="KEGG: pen:PSEEN0464 tyrosyl-tRNA synthetase;
FT                   TIGRFAM: tyrosyl-tRNA synthetase; PFAM: aminoacyl-tRNA
FT                   synthetase class Ib; RNA-binding S4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96377"
FT                   /db_xref="GOA:B0KK49"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024108"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B0KK49"
FT                   /protein_id="ABY96377.1"
FT                   /translation="MKSVEEQLALIKRGAEEVLVESELVEKLKRGQPLRIKAGFDPTAP
FT                   DLHLGHTVLINKLRQFQELGHQVIFLIGDFTGMIGDPSGKSATRPPLTREQVLDNAETY
FT                   KQQVFKILDPAKTEVAFNSTWMDKLTPADFIRLASQYTVARMLERDDFDKRYTTNQPIA
FT                   IHEFLYPLVQGYDSVALKADVELGGTDQKFNLLMGRELQRAYGQEAQNIVTMPLLEGLD
FT                   GVKKMSKSLGNYVGIQEAPGVMYGKLVSIPDTLMWRYFELLSFRSMEEIEQFRADVAKG
FT                   ANPRDIKIKLAEEIVARFHGEEAAANAHRAAGNRMKEGELPEDLPEIEVAASEDLPIAA
FT                   VLNRAGLVKNSAQARDLLNGGAVKVDGAVVDKDFMFVLGATHVCQAGKKSFGRVTLKAE
FT                   "
FT   gene            542643..544171
FT                   /locus_tag="PputGB1_R0014"
FT   rRNA            542643..544171
FT                   /locus_tag="PputGB1_R0014"
FT                   /product="16S ribosomal RNA"
FT   gene            544451..547344
FT                   /locus_tag="PputGB1_R0015"
FT   rRNA            544451..547344
FT                   /locus_tag="PputGB1_R0015"
FT                   /product="23S ribosomal RNA"
FT   gene            547482..547597
FT                   /locus_tag="PputGB1_R0016"
FT   rRNA            547482..547597
FT                   /locus_tag="PputGB1_R0016"
FT                   /product="5S ribosomal RNA"
FT   gene            547808..548767
FT                   /locus_tag="PputGB1_0467"
FT   CDS_pept        547808..548767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0467"
FT                   /product="biotin--acetyl-CoA-carboxylase ligase"
FT                   /EC_number="6.3.4.15"
FT                   /note="KEGG: pen:PSEEN0471 biotin-[acetylCoA carboxylase]
FT                   holoenzyme synthetase; transcriptional repressor of biotin
FT                   synthesis BirA; TIGRFAM: biotin--acetyl-CoA-carboxylase
FT                   ligase; PFAM: biotin/lipoate A/B protein ligase;
FT                   Helix-turn-helix type 11 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96378"
FT                   /db_xref="GOA:B0KK50"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR030855"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0KK50"
FT                   /protein_id="ABY96378.1"
FT                   /translation="MLKLLNLLKDGRFHSGEALGEALGVSRSAVWKQLQHLEGELNLTI
FT                   HKVRGRGYQLATPLALLEAQAIAGFAESEQWPVFIHESVDSTNAEGLRLANQGQAAPFV
FT                   VLAERQSAGRGRRGRQWVSPFAENLYYSLVLRVDGGMRQLEGLSLVVGVAVMRTLQAFG
FT                   VKDVGLKWPNDVLVRGQKITGILLELVGDPADVCHVVLGIGINVNMQANDQVDQEWTSM
FT                   RREVGAAIDRNHLVASLNQQLQHELARHRRYGFAAFQEEWEQAHLWQGRNVSLVAGSTR
FT                   IDGVVLGVDGQGGLRLEVDGVEKSFSGGELSLRLRDDS"
FT   gene            548757..549506
FT                   /locus_tag="PputGB1_0468"
FT   CDS_pept        548757..549506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0468"
FT                   /product="putative transcriptional acitvator, Baf family"
FT                   /note="TIGRFAM: transcriptional activator, Baf family;
FT                   PFAM: Bvg accessory factor; KEGG: pen:PSEEN0472
FT                   transcriptional activator; Bvg accessory factor family"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96379"
FT                   /db_xref="GOA:B0KK51"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KK51"
FT                   /protein_id="ABY96379.1"
FT                   /translation="MILELDCGNSFIKWRVIHAADAVIEGGGIVDSDQALLAAVAALAS
FT                   VRLTGCRIVSVRSEEETDALCALIAQAFAVQARVAHPAQSMAGVRNGYDDYQRLGMDRW
FT                   LAALGAFHLAGGACLVIDLGTAAKADFVAADGEHLGGYICPGMPLMRSQLRTHTRRIRY
FT                   DDASAERALTSLSPGRSTVEAVERGCVLMLQGFARTQLEQARALWGEAFTVFLTGGDAP
FT                   LVREAVPQARVVPDLVFVGLAMACPLD"
FT   gene            549514..549939
FT                   /locus_tag="PputGB1_0469"
FT   CDS_pept        549514..549939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0469"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN0473 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96380"
FT                   /db_xref="UniProtKB/TrEMBL:B0KK52"
FT                   /protein_id="ABY96380.1"
FT                   /translation="MRWLFLLLLVLNVFYYVWHQQEAPLKVKEVAPLSLYKGNQQEIRL
FT                   LRETGVSAPAKRRDECLVVGGVEQQEQLEALRQRLLSLDIATLPVMGQLPGADGRWLKV
FT                   APESERLLDQTVLSALSNDFKDLKHKIIFCQGIATGE"
FT   gene            550093..550176
FT                   /locus_tag="PputGB1_R0017"
FT                   /note="tRNA-Tyr1"
FT   tRNA            550093..550176
FT                   /locus_tag="PputGB1_R0017"
FT                   /product="tRNA-Tyr"
FT   gene            550201..550274
FT                   /locus_tag="PputGB1_R0018"
FT                   /note="tRNA-Gly1"
FT   tRNA            550201..550274
FT                   /locus_tag="PputGB1_R0018"
FT                   /product="tRNA-Gly"
FT   gene            550304..550379
FT                   /locus_tag="PputGB1_R0019"
FT                   /note="tRNA-Thr1"
FT   tRNA            550304..550379
FT                   /locus_tag="PputGB1_R0019"
FT                   /product="tRNA-Thr"
FT   gene            550458..551651
FT                   /locus_tag="PputGB1_0470"
FT   CDS_pept        550458..551651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0470"
FT                   /product="translation elongation factor Tu"
FT                   /note="TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain protein;
FT                   elongation factor Tu domain 2 protein; KEGG: pen:PSEEN0487
FT                   protein chain elongation factor (EF-Tu-A)"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96381"
FT                   /db_xref="GOA:B0KK53"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KK53"
FT                   /protein_id="ABY96381.1"
FT                   /translation="MAKEKFDRSLPHVNVGTIGHVDHGKTTLTAALTRVCSEVFGSAIV
FT                   EFDKIDSAPEEKARGITINTAHVEYNSTIRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VCSAADGPMPQTREHILLSRQVGVPYIVVFLNKADLVDDAELLELVEMEVRDLLSTYDF
FT                   PGDDTPIIIGSARMALEGKDDNEMGTTAVKKLVETLDSYIPEPVRAIDQPFLMPIEDVF
FT                   SISGRGTVVTGRIERGIVRVQDPLEIVGLRDTTTTTCTGVEMFRKLLDEGRAGENCGVL
FT                   LRGTKRDDVERGQVLVKPGSVKPHTKFTAEVYVLSKEEGGRHTPFFKGYRPQFYFRTTD
FT                   VTGNCELPEGVEMVMPGDNIQMTVTLIKTIAMEDGLRFAIREGGRTVGAGVVAKIIE"
FT   gene            551706..551781
FT                   /locus_tag="PputGB1_R0020"
FT                   /note="tRNA-Trp1"
FT   tRNA            551706..551781
FT                   /locus_tag="PputGB1_R0020"
FT                   /product="tRNA-Trp"
FT   gene            551826..552194
FT                   /locus_tag="PputGB1_0471"
FT   CDS_pept        551826..552194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0471"
FT                   /product="preprotein translocase, SecE subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecE subunit; PFAM:
FT                   protein secE/sec61-gamma protein; KEGG: pen:PSEEN0476
FT                   preprotein translocase, membrane component, transport
FT                   across inner membrane (general secretory pathway)"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96382"
FT                   /db_xref="GOA:B0KK54"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:B0KK54"
FT                   /protein_id="ABY96382.1"
FT                   /translation="MTPKTEAQESRFDLFKWLAVVALVVVGVVGNQYYSASPILYRVLA
FT                   LLVLAAVAGFVALQTAKGKSFFSLAKEARTEIRKVVWPTRQETTQTTLIVVAVVLVMAL
FT                   LLWGLDSLLGWAVSLIVG"
FT   gene            552204..552737
FT                   /locus_tag="PputGB1_0472"
FT   CDS_pept        552204..552737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0472"
FT                   /product="NusG antitermination factor"
FT                   /note="TIGRFAM: transcription termination/antitermination
FT                   factor NusG; PFAM: KOW domain protein; NGN domain protein;
FT                   KEGG: pen:PSEEN0477 transcription antitermination protein
FT                   NusG"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96383"
FT                   /db_xref="GOA:B0KK55"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:B0KK55"
FT                   /protein_id="ABY96383.1"
FT                   /translation="MAKRWYVVHAYSGYEKHVMRSLIERVKLAGMEDGFGEILVPTEEV
FT                   VEMRNGQKRKSERKFFPGYVLVQMEMNEGTWHLVKDTPRVMGFIGGTADKPAPITDKEA
FT                   EAILRRVADGSDKPKPKTLFEPGEVVRVIDGPFADFNGSVEEVNYEKSRLQVAVLIFGR
FT                   STPVELEFSQVEKV"
FT   gene            552857..553288
FT                   /locus_tag="PputGB1_0473"
FT   CDS_pept        552857..553288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0473"
FT                   /product="ribosomal protein L11"
FT                   /note="PFAM: ribosomal protein L11; KEGG: pen:PSEEN0478 50S
FT                   ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96384"
FT                   /db_xref="GOA:B0KK56"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KK56"
FT                   /protein_id="ABY96384.1"
FT                   /translation="MAKKIQAYIKLQVKAGQANPSPPVGPALGQHGVNIMEFCKAFNAR
FT                   TQGQEAGLPTPVIITVYSDRSFTFETKSTPASVLLKKAAGLTSGSARPNTVKVGTVTRA
FT                   QLEDIAKAKQADLTAADLDAAVRTIAGSARSMGLNVEGV"
FT   gene            553288..553983
FT                   /locus_tag="PputGB1_0474"
FT   CDS_pept        553288..553983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0474"
FT                   /product="ribosomal protein L1"
FT                   /note="PFAM: ribosomal protein L1; KEGG: pen:PSEEN0479 50S
FT                   ribosomal subunit protein L1, regulates synthesis of L1 and
FT                   L11"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96385"
FT                   /db_xref="GOA:B0KK57"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KK57"
FT                   /protein_id="ABY96385.1"
FT                   /translation="MAKLTKRQKAIAEKIEAGKSYNFEEAATLLASLPAAKFVESYDIA
FT                   VNLGVDPRKSDQVVRSATVLPHGTGKTVRVAVFTQGPAAEAALAAGADRVGMDDLAAEM
FT                   KAGDLNYDVVIASPDAMRVVGQLGQVLGPRGLMPNPKVGTVSPDVATAVKNAKAGQVRY
FT                   RTDKNGIIHTSVGKVGFEAGKLKENVEALIADLKRIKPASSKGIYVKRVTLSTTMGPGL
FT                   VIDQSSLNV"
FT   gene            554181..554681
FT                   /locus_tag="PputGB1_0475"
FT   CDS_pept        554181..554681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0475"
FT                   /product="ribosomal protein L10"
FT                   /note="PFAM: ribosomal protein L10; KEGG: pen:PSEEN0480 50S
FT                   ribosomal subunit protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96386"
FT                   /db_xref="GOA:B0KK58"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KK58"
FT                   /protein_id="ABY96386.1"
FT                   /translation="MAIKLEDKKAIVAEVNEAAKVALSAVVADARGVTVSAMTGLRKEA
FT                   REAGVYVRVVRNTLLKRAVEGTEFSILNDAFKGPTLIAFSNEHPGAAARLFKEFAKGQD
FT                   KFEIKAAAFDGNFIAANQIDVLATLPTRDEAIARLMSVIQGATSKLARTLAAIRDQKEA
FT                   TAA"
FT   gene            554759..555124
FT                   /locus_tag="PputGB1_0476"
FT   CDS_pept        554759..555124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0476"
FT                   /product="ribosomal protein L7/L12"
FT                   /note="TIGRFAM: ribosomal protein L7/L12; PFAM: Ribosomal
FT                   protein L7/L12; KEGG: pfo:Pfl_5087 50S ribosomal protein
FT                   L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96387"
FT                   /db_xref="GOA:B0KK59"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KK59"
FT                   /protein_id="ABY96387.1"
FT                   /translation="MSLTNEQIIEAIGQKTVLEVVELIKAMEETFGVTAAVAAAGPAAA
FT                   AAVVEEQTEFNVVLVEAGDKKVNVIKAVRELTGLGLKEAKEKVDGAPQVVAEGVSKEAA
FT                   EDAKKKLEEAGAKVELK"
FT   gene            555344..559417
FT                   /locus_tag="PputGB1_0477"
FT   CDS_pept        555344..559417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0477"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, beta subunit;
FT                   PFAM: RNA polymerase Rpb2 domain 6; RNA polymerase Rpb2
FT                   domain 7; RNA polymerase Rpb2 domain 2; RNA polymerase beta
FT                   subunit; RNA polymerase Rpb2 domain 3; KEGG: pen:PSEEN0482
FT                   RNA polymerase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96388"
FT                   /db_xref="GOA:B0KK60"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KK60"
FT                   /protein_id="ABY96388.1"
FT                   /translation="MAYSYTEKKRIRKDFSKLPDVMDVPYLLAIQLDSYREFLQAGASK
FT                   DHFRDVGLHAAFKSVFPIISYSGNAALEYVGYRLGEPAFDVKECVLRGVTFAVPLRVKV
FT                   RLIIFDKESSNKAIKDIKEQEVYMGEIPLMTENGTFVINGTERVIVSQLHRSPGVFFDH
FT                   DRGKTHSSGKLLYSARIIPYRGSWLDFEFDPKDCVFVRIDRRRKLPASVLLRALGYSTE
FT                   EVLNTFYTTNVFHISGEKLSLELVPQRLRGEVAVMDIHDETGKVIVEQGRRITARHINQ
FT                   LEKAGVKQLDVPMEYVLGRTTAKAIVHPATGEILAECNTEMTTELLIKVAKAQVVRIET
FT                   LYTNDIDCGPFISDTLKIDTTSNQLEALVEIYRMMRPGEPPTKDAAETLFNNLFFSAER
FT                   YDLSAVGRMKFNRRIGRTEIEGSGVLSKEDIVEVLKTLVDIRNGKGIVDDIDHLGNRRV
FT                   RCVGEMAENQFRVGLVRVERAVKERLSMAESEGLMPQDLINAKPVAAAVKEFFGSSQLS
FT                   QFMDQNNPLSEITHKRRVSALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGL
FT                   INSLAAYARTNQYGFLESPYRVVKEGVVSDDIVFLSAIEEADHVIAQASAAMNEKKQLI
FT                   DELVAVRHLNEFTVKAPEDVTLMDVSPKQVVSVAASLIPFLEHDDANRALMGSNMQRQA
FT                   VPTLRADKPLVGTGMERNVARDSGVCVVARRGGVIDSVDASRIVVRVNDDEVETGEAGV
FT                   DIYNLTKYTRSNQNTCINQRPLVSKGDKVQRSDIMADGPSTDMGELALGQNMRIAFMAW
FT                   NGFNFEDSICLSERVVQEDRFTTIHIQELTCVARDTKLGPEEITADIPNVGEAALNKLD
FT                   EAGIVYVGAEVGAGDILVGKVTPKGETQLTPEEKLLRAIFGEKASDVKDTSLRVPTGTK
FT                   GTVIDVQVFTRDGVERDSRALAIEKMQLDEIRKDLNEEFRIVEGATFERLRSALNGQVV
FT                   DGGAGLKKGTVITDEVLDGLEHGQWFKLRMAEDALNEQLEKAQQYIVDRRRLLDDKFED
FT                   KKRKLQQGDDLAPGVLKIVKVYLAIRRRIQPGDKMAGRHGNKGVVSVIMPVEDMPHDAN
FT                   GTPVDVVLNPLGVPSRMNVGQILETHLGLAAKGLGEKIDRMLEEQRKAAELRVFLTEVY
FT                   NEIGGRQENLDEFTDEEILALANNLKKGVPMATPVFDGAKEREIKAMLKLADLPESGQM
FT                   VLFDGRTGNKFERPVTVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLGGKAQFGGQR
FT                   FGEMEVWALEAYGAAYTLQEMLTVKSDDVNGRTKMYKNIVDGDHRMEPGMPESFNVLIK
FT                   EIRSLGIDIDLETE"
FT   gene            559482..563681
FT                   /locus_tag="PputGB1_0478"
FT   CDS_pept        559482..563681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0478"
FT                   /product="DNA-directed RNA polymerase, beta' subunit"
FT                   /note="KEGG: pen:PSEEN0483 RNA polymerase, beta prime
FT                   subunit; TIGRFAM: DNA-directed RNA polymerase, beta'
FT                   subunit; PFAM: RNA polymerase alpha subunit; RNA polymerase
FT                   Rpb1 domain 3; RNA polymerase Rpb1 domain 1; RNA polymerase
FT                   Rpb1 domain 5; RNA polymerase Rpb1 domain 4; SMART: RNA
FT                   polymerase I subunit A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96389"
FT                   /db_xref="GOA:B0KK61"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KK61"
FT                   /protein_id="ABY96389.1"
FT                   /translation="MKDLLNLLKNQGQVEEFDAIRIGLASPEMIRSWSFGEVKKPETIN
FT                   YRTFKPERDGLFCAKIFGPVKDYECLCGKYKRLKHRGVICEKCGVEVALAKVRRERMAH
FT                   IELASPVAHIWFLKSLPSRIGLLMDMTLRDIERVLYFESYVVIDPGMTTLEKGQLLNDE
FT                   QYFEALEEFGDDFDARMGAEAVRELLHAIDLEHEIGRLREEIPQTNSETKIKKLSKRLK
FT                   LMEAFQGSGNLPEWMVLTVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKR
FT                   LLDLSAPDIIVRNEKRMLQEAVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQ
FT                   NLLGKRVDYSGRSVITVGPTLRLHQCGLPKKMALELFKPFIFGKLEMRGLATTIKAAKK
FT                   MVERELPEVWDVLAEVIREHPVLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAYN
FT                   ADFDGDQMAVHVPLTLEAQLEARALMMSTNNILSPANGEPIIVPSQDVVLGLYYMTREA
FT                   INAKGEGRVFADLQEVDRVFRAGEAALHAKIKVRINETVKDRDGSVTKNTRIVDTTVGR
FT                   ALLFQVVPAGLPYDVVNQPMKKKAISKLINQCYRVVGLKETVIFADQLMYTGFAYSTIS
FT                   GVSIGVNDFVIPDEKARIINSATDEVKEIESQYASGLVTQGEKYNKVIDLWSKANDEVS
FT                   KAMMANLSKEKVIDREGKEVEQESFNSMYMMADSGARGSAAQIRQLAGMRGLMAKPDGS
FT                   IIETPITANFREGLSVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVAQDLVVTEI
FT                   DCGTDHGLLMTPHIEGGDVVEPLGERVLGRVIARDVFKPGTEDVIVPAGTLVDEQWVEF
FT                   IELNSIDEVIVRSPINCETRYGICAKCYGRDLARGHQVNIGEAVGVIAAQSIGEPGTQL
FT                   TMRTFHIGGAASRTSAADSVQVKNGGMVRLHNLKQVERADGNLVAVSRSGELAIADEFG
FT                   RERERYKLPYGAVISVKEGEKVEAGAIVAKWDPHTHPIVTELKGTVTFVGMEENITIKR
FT                   QTDELTGLTNIEVLDVKDRPAAGKEIRPAIKMVDANGKDLYLPGTDVPAQYFLPANALV
FT                   GVADGAQIGVGDVIARIPQETSKTRDITGGLPRVADLFEARRPKEASILAEVSGTIAFG
FT                   KETKGKRRLVITPTDGSDPYEELIPKWRHLNVFEGEQVNRGEVISDGPSDPHDILRLLG
FT                   VSALAKYIVNEIQDVYRLQGVKINDKHIETILRQMLRKVEISESGDSSFIKGDQMELTH
FT                   VLVENERLAGEDKFISKFTRVLLGITKASLSTESFISAASFQETTRVLTEAAVTGKRDY
FT                   LRGLKENVVVGRLIPAGTGLAYHSERKRRRDADKPLRVSASEVEAALTEALNSSGN"
FT   gene            563893..564264
FT                   /locus_tag="PputGB1_0479"
FT   CDS_pept        563893..564264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0479"
FT                   /product="ribosomal protein S12"
FT                   /note="TIGRFAM: ribosomal protein S12; PFAM: ribosomal
FT                   protein S12/S23; KEGG: pen:PSEEN0484 30S ribosomal protein
FT                   S12"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96390"
FT                   /db_xref="GOA:B0KK62"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KK62"
FT                   /protein_id="ABY96390.1"
FT                   /translation="MATINQLVRQPRKRSVEKSDVPALQNCPQRRGVCTRVYTTTPRKP
FT                   NSALRKVCRVRLTNGFEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDT
FT                   SGVKGRNQGRSKYGTKRPK"
FT   gene            564371..564841
FT                   /locus_tag="PputGB1_0480"
FT   CDS_pept        564371..564841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0480"
FT                   /product="ribosomal protein S7"
FT                   /note="PFAM: ribosomal protein S7; KEGG: pmy:Pmen_3913
FT                   ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96391"
FT                   /db_xref="GOA:B0KK63"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KK63"
FT                   /protein_id="ABY96391.1"
FT                   /translation="MPRRRVAAKREILDDPKYGSQILAKFMNHVMESGKKAVAERIVYG
FT                   ALDTVKARKNSDPLEIFEKALDAIAPLVEVKSRRVGGATYQVPVEVRPSRRNALAMRWL
FT                   VDYARKRGEKSMALRLAGELLDAAEGKGAAVKKREDVHRMAEANKAFSHYRF"
FT   gene            564872..567016
FT                   /locus_tag="PputGB1_0481"
FT   CDS_pept        564872..567016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0481"
FT                   /product="translation elongation factor G"
FT                   /note="TIGRFAM: translation elongation factor G; small
FT                   GTP-binding protein; PFAM: elongation factor G domain
FT                   protein; protein synthesis factor GTP-binding; elongation
FT                   factor Tu domain 2 protein; elongation factor G domain IV;
FT                   KEGG: pen:PSEEN0486 protein chain elongation factor EF-G,
FT                   GTP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96392"
FT                   /db_xref="GOA:B0KK64"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:B0KK64"
FT                   /protein_id="ABY96392.1"
FT                   /translation="MARTTAINRYRNIGICAHVDAGKTTTTERILFYTGLSHKMGEVHD
FT                   GAATTDWMVQEQERGITITSAAVTTFWKGSVGQYDNYRVNVIDTPGHVDFTIEVERSLR
FT                   VLDGAVVVFCGTSGVEPQSETVWRQANKYGVPRVVYVNKMDRAGANFLRVVGQIKNRLG
FT                   HTPVPVQLAIGSEDNFQGQVDLIKMKAIYWNDDDKGTTYREEEIPADMLELAQEWRSNM
FT                   VEAAAESSEELMNKYLEGEELTVEEIKAGLRARTLASEIVPAVCGSSFKNKGVPLVLDA
FT                   VIDYLPAPTEIPAIQGINPDDKELDKEDPAVRKDVRHADDDEPFSALAFKIATDPFVGT
FT                   LTFVRVYSGVLTSGDSVINSVKGKKERVGRMVQMHANQREEIKEVRAGDIAALIGMKDV
FT                   TTGETLCNADKPIILERMDFPEPVISLSVEPKTKADQEKMGIALGKLAQEDPSFRVKTD
FT                   EETGQTIISGMGELHLDILVDRMKREFNVEANIGKPQVSYREKITKSNVEIEGKFVRQS
FT                   GGRGQFGHCWIRFSEPEVDEKGNITEGLVFSNEVVGGVIPKEFIAPIQKGIEEQMKNGV
FT                   VAGYPLIGLKAAVFDGSYHDVDSNEMAFKIAASMATKQLATKGGGVVLEPIMKVEVVTP
FT                   EDYLGDVMGDLNRRRGLVQGMDESVSGRVVRAEVPLGEMFGYATDVRSMSQGRASYSME
FT                   FSKYAEAPSNIVEALVKKQG"
FT   gene            567044..568237
FT                   /locus_tag="PputGB1_0482"
FT   CDS_pept        567044..568237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0482"
FT                   /product="translation elongation factor Tu"
FT                   /note="TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain protein;
FT                   elongation factor Tu domain 2 protein; KEGG: pen:PSEEN0487
FT                   protein chain elongation factor (EF-Tu-A)"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96393"
FT                   /db_xref="GOA:B0KK53"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KK53"
FT                   /protein_id="ABY96393.1"
FT                   /translation="MAKEKFDRSLPHVNVGTIGHVDHGKTTLTAALTRVCSEVFGSAIV
FT                   EFDKIDSAPEEKARGITINTAHVEYNSTIRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VCSAADGPMPQTREHILLSRQVGVPYIVVFLNKADLVDDAELLELVEMEVRDLLSTYDF
FT                   PGDDTPIIIGSARMALEGKDDNEMGTTAVKKLVETLDSYIPEPVRAIDQPFLMPIEDVF
FT                   SISGRGTVVTGRIERGIVRVQDPLEIVGLRDTTTTTCTGVEMFRKLLDEGRAGENCGVL
FT                   LRGTKRDDVERGQVLVKPGSVKPHTKFTAEVYVLSKEEGGRHTPFFKGYRPQFYFRTTD
FT                   VTGNCELPEGVEMVMPGDNIQMTVTLIKTIAMEDGLRFAIREGGRTVGAGVVAKIIE"
FT   gene            568379..568690
FT                   /locus_tag="PputGB1_0483"
FT   CDS_pept        568379..568690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0483"
FT                   /product="ribosomal protein S10"
FT                   /note="PFAM: ribosomal protein S10; KEGG: psa:PST_0783
FT                   ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96394"
FT                   /db_xref="GOA:B0KK66"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KK66"
FT                   /protein_id="ABY96394.1"
FT                   /translation="MQNQQIRIRLKAFDHRLIDQSTQEIVETAKRTGAQVRGPIPLPTR
FT                   KERFTVLVSPHVNKDARDQYEIRTHKRVLDIVQPTDKTVDALMKLDLAAGVEVQISLG"
FT   gene            568771..569406
FT                   /locus_tag="PputGB1_0484"
FT   CDS_pept        568771..569406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0484"
FT                   /product="ribosomal protein L3"
FT                   /note="PFAM: ribosomal protein L3; KEGG: pen:PSEEN0490 50S
FT                   ribosomal subunit protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96395"
FT                   /db_xref="GOA:B0KK67"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KK67"
FT                   /protein_id="ABY96395.1"
FT                   /translation="MTIGVIGRKCGMTRIFTEEGVSIPVTVIEIEPNRVTQFKTEETDG
FT                   YRAVQVTVGERRASRVTAAQAGHFAKANVAAGRGVWEFRLEEGDFQAGDLIKAELFTAG
FT                   QLVDVTGQSKGKGFAGTIKRWNFRGQDNTHGNSVSHRVPGSIGQCQTPGRVFKGKKMSG
FT                   HMGAERVTVQSLEVVRVDAERNLLLIKGAVPGATGGDVVVRPAVKARG"
FT   gene            569419..570021
FT                   /locus_tag="PputGB1_0485"
FT   CDS_pept        569419..570021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0485"
FT                   /product="ribosomal protein L4/L1e"
FT                   /note="PFAM: ribosomal protein L4/L1e; KEGG: pen:PSEEN0491
FT                   50S ribosomal subunit protein L4, regulates expression of
FT                   S10 operon"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96396"
FT                   /db_xref="GOA:B0KK68"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KK68"
FT                   /protein_id="ABY96396.1"
FT                   /translation="MQLNVNDAQAIEVSELTFGGEFNETLVHQAVVAYMAGGRQGTKQQ
FT                   KTRSDVAGGGKRPWRQKGTGRARAGTTRGPIWRGGGVTFAARPQDHSQKLNKKMYRAAL
FT                   RSILAELVRSDRLVVVQDFAVEAPKTKDLLNKLNGMGLSDVLIVSDAVDQNLYLAARNL
FT                   PHVDVRDVQGSDPVSLIAYEKVLITVSAVKKFEELLG"
FT   gene            570018..570317
FT                   /locus_tag="PputGB1_0486"
FT   CDS_pept        570018..570317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0486"
FT                   /product="Ribosomal protein L25/L23"
FT                   /note="PFAM: Ribosomal protein L25/L23; KEGG: pen:PSEEN0492
FT                   50S ribosomal subunit protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96397"
FT                   /db_xref="GOA:B0KK69"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KK69"
FT                   /protein_id="ABY96397.1"
FT                   /translation="MNQERVFKVLLGPHVSEKATVLAEKKGQFVFKVATDATKLEIKKA
FT                   VEGLFNVKVENVSTVNVLGKTKRTARGLGKRNDWKKAIVSLQPGQDLDFSSSAE"
FT   gene            570332..571156
FT                   /locus_tag="PputGB1_0487"
FT   CDS_pept        570332..571156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0487"
FT                   /product="ribosomal protein L2"
FT                   /note="PFAM: ribosomal protein L2; KEGG: pen:PSEEN0493 50S
FT                   ribosomal subunit protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96398"
FT                   /db_xref="GOA:B0KK70"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KK70"
FT                   /protein_id="ABY96398.1"
FT                   /translation="MAIVKCKPTSPGRRFVVKVVNKELHKGAPHAPLLEKKSKSGGRNN
FT                   NGRITTRHVGGGHKQHYRLVDFRRNDKDGIPATVERIEYDPNRTAHIALLCYADGERRY
FT                   IIAPKGVSAGDQLIAGALAPIKAGNSLQLRNIPVGSTIHGVELKPGKGAQIARSAGASA
FT                   QLIARDGVYVTLRLRSGEMRKVLAECRATLGEVSNSEHSLRSLGKAGAKRWRGVRPTVR
FT                   GVAMNPVDHPHGGGEGRTSGGRHPVSPWGFPTKGAKTRGNKRTDNMIVRRRK"
FT   gene            571173..571448
FT                   /locus_tag="PputGB1_0488"
FT   CDS_pept        571173..571448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0488"
FT                   /product="ribosomal protein S19"
FT                   /note="TIGRFAM: ribosomal protein S19; PFAM: ribosomal
FT                   protein S19/S15; KEGG: pen:PSEEN0494 30S ribosomal subunit
FT                   protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96399"
FT                   /db_xref="GOA:B0KK71"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KK71"
FT                   /protein_id="ABY96399.1"
FT                   /translation="MPRSLKKGPFIDLHLLKKVEVAVEKNDRKPVKTWSRRSMILPQMV
FT                   GLTIAVHNGRQHVPVLVNEDMVGHKLGEFAGTRTYRGHVADKKAKR"
FT   gene            571460..571792
FT                   /locus_tag="PputGB1_0489"
FT   CDS_pept        571460..571792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0489"
FT                   /product="ribosomal protein L22"
FT                   /note="TIGRFAM: ribosomal protein L22; PFAM: ribosomal
FT                   protein L22/L17; KEGG: pmy:Pmen_3904 ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96400"
FT                   /db_xref="GOA:B0KK72"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KK72"
FT                   /protein_id="ABY96400.1"
FT                   /translation="MEVAAKLSGARISAQKARLVADQIRGKKVGEALNLLAFSSKKAAE
FT                   IMKKVLESAVANAEHNEGADVDDLKVSTVFVNEGRSLKRIMPRAKGRADRIVKRSCHIT
FT                   VKVADK"
FT   gene            571806..572492
FT                   /locus_tag="PputGB1_0490"
FT   CDS_pept        571806..572492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0490"
FT                   /product="ribosomal protein S3"
FT                   /note="KEGG: pen:PSEEN0496 30S ribosomal subunit protein
FT                   S3; TIGRFAM: ribosomal protein S3; PFAM: ribosomal protein
FT                   S3- domain protein; KH type 2 domain protein; Ribosomal
FT                   protein S3 domain; SMART: KH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96401"
FT                   /db_xref="GOA:B0KK73"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/TrEMBL:B0KK73"
FT                   /protein_id="ABY96401.1"
FT                   /translation="MGQKVHPTGIRLGIVKEHTSVWYADGATYADYLLKDLKTREYLQD
FT                   KLKSASVSRIDIHRPAQTARITIHTARPGIVIGKKGEDVEKLRQDLTKQMGVPVHINIE
FT                   EIRKPELDAMLVAQSVAQQLERRVMFRRAMKRAVQNAMRIGAKGIKIQVSGRLGGAEIA
FT                   RTEWYREGRVPLHTLRADIDYNTYEAHTTYGVIGVKVWIFKGEVIGGRQEELKPQAPAP
FT                   RKKAAK"
FT   gene            572505..572918
FT                   /locus_tag="PputGB1_0491"
FT   CDS_pept        572505..572918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0491"
FT                   /product="ribosomal protein L16"
FT                   /note="PFAM: ribosomal protein L16; KEGG: pen:PSEEN0497 50S
FT                   ribosomal subunit protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96402"
FT                   /db_xref="GOA:B0KK74"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KK74"
FT                   /protein_id="ABY96402.1"
FT                   /translation="MLQPKRTKFRKQMTGHNRGLALRGSKVSFGEFALKAVARGRLTAR
FT                   QIESARRALTRHVKRGGKIWIRVFPDKPISKKPLEVRMGKGKGSVEYWVAQIQPGKVLY
FT                   EIEGVSEELAREAFALAAAKLPLATSFVKRTVM"
FT   gene            572915..573109
FT                   /locus_tag="PputGB1_0492"
FT   CDS_pept        572915..573109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0492"
FT                   /product="ribosomal protein L29"
FT                   /note="PFAM: ribosomal protein L29; KEGG: pen:PSEEN0498 50S
FT                   ribosomal subunit protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96403"
FT                   /db_xref="GOA:B0KK75"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KK75"
FT                   /protein_id="ABY96403.1"
FT                   /translation="MMKANELREKSAQQLNEQLLGLLRDQFNLRMQKATGQLGQSHLLS
FT                   QVKRDIARVKTVLNQQAGK"
FT   gene            573112..573378
FT                   /locus_tag="PputGB1_0493"
FT   CDS_pept        573112..573378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0493"
FT                   /product="ribosomal protein S17"
FT                   /note="PFAM: ribosomal protein S17; KEGG: pen:PSEEN0499 30S
FT                   ribosomal subunit protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96404"
FT                   /db_xref="GOA:B0KK76"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KK76"
FT                   /protein_id="ABY96404.1"
FT                   /translation="MAEAEKTVRTLTGRVVSDKMDKTITVLIERRVKHPIYGKYVKRST
FT                   KLHAHDESNQCKIGDKVSIRETRPLAKTKSWALVEVLERAVEV"
FT   gene            573402..573770
FT                   /locus_tag="PputGB1_0494"
FT   CDS_pept        573402..573770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0494"
FT                   /product="ribosomal protein L14"
FT                   /note="TIGRFAM: ribosomal protein L14; PFAM: ribosomal
FT                   protein L14b/L23e; KEGG: pfo:Pfl_5069 50S ribosomal protein
FT                   L14"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96405"
FT                   /db_xref="GOA:B0KK77"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KK77"
FT                   /protein_id="ABY96405.1"
FT                   /translation="MIQTQSMLDVADNSGARRVMCIKVLGGSHRRYAGIGDIIKVTVKE
FT                   AIPRGKVKKGQVMTAVVVRTRHGVRRADGSIIRFDGNAAVLLNNKQEPIGTRIFGPVTR
FT                   ELRTEKFMKIVSLAPEVL"
FT   gene            573782..574096
FT                   /locus_tag="PputGB1_0495"
FT   CDS_pept        573782..574096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0495"
FT                   /product="ribosomal protein L24"
FT                   /note="TIGRFAM: ribosomal protein L24; SMART: KOW domain
FT                   protein; KEGG: pen:PSEEN0501 50S ribosomal subunit protein
FT                   L24"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96406"
FT                   /db_xref="GOA:B0KK78"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KK78"
FT                   /protein_id="ABY96406.1"
FT                   /translation="MQKIRRDDEIIVIAGKDKGKRGKVLKVLADDRLVIGGVNLVKRHT
FT                   KPNPMAGVQGGIVEKEAPLHASNVAIFNGETNKADRVGFKVEDGKKIRVFKSTQKAVDA
FT                   "
FT   gene            574117..574656
FT                   /locus_tag="PputGB1_0496"
FT   CDS_pept        574117..574656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0496"
FT                   /product="ribosomal protein L5"
FT                   /note="PFAM: ribosomal protein L5; KEGG: pen:PSEEN0502 50S
FT                   ribosomal subunit protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96407"
FT                   /db_xref="GOA:B0KK79"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KK79"
FT                   /protein_id="ABY96407.1"
FT                   /translation="MARLKEIYRNEIAPKLKEELKLSNVMEVPRVTKITLNMGLGEAIG
FT                   DKKVIEHAVADLEKITGQKPVVTFARKSIAGFKVREGWPIGVKVTLRSDKMYEFLDRLL
FT                   AISLPRVRDFRGLNAKSFDGRGNYSMGVKEQIIFPEIDYDKIDALRGLDITLTTTARSD
FT                   DEGRALLRAFKFPFRN"
FT   gene            574670..574975
FT                   /locus_tag="PputGB1_0497"
FT   CDS_pept        574670..574975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0497"
FT                   /product="ribosomal protein S14"
FT                   /note="PFAM: ribosomal protein S14; KEGG: pen:PSEEN0503 30S
FT                   ribosomal subunit protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96408"
FT                   /db_xref="GOA:B0KK80"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KK80"
FT                   /protein_id="ABY96408.1"
FT                   /translation="MAKKSMKNRELKRQLTVAKFAKKRAELKATIVNVNASPEERFAAV
FT                   VALQKQPRDASAARLRNRCRLTGRPHGVYRKFGLGRNMLRQAAMRGDVPGLVKASW"
FT   gene            575185..575577
FT                   /locus_tag="PputGB1_0498"
FT   CDS_pept        575185..575577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0498"
FT                   /product="ribosomal protein S8"
FT                   /note="PFAM: ribosomal protein S8; KEGG: pen:PSEEN0504 30S
FT                   ribosomal subunit protein S8, and regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96409"
FT                   /db_xref="GOA:B0KK81"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KK81"
FT                   /protein_id="ABY96409.1"
FT                   /translation="MSMQDPLADMLTRIRNAQMAEKSVVSMPSSTLKVAVAKVLKDEGY
FT                   IAGYQVTGEAKPSLSIELKYFEGRPVIEELKRSSRPGLRQYKAVTDLPKVRGGLGVSIV
FT                   STNKGVMTDRAARAAGVGGEVLCTVF"
FT   gene            575590..576123
FT                   /locus_tag="PputGB1_0499"
FT   CDS_pept        575590..576123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0499"
FT                   /product="ribosomal protein L6"
FT                   /note="PFAM: ribosomal protein L6; KEGG: pen:PSEEN0505 50S
FT                   ribosomal subunit protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96410"
FT                   /db_xref="GOA:B0KK82"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KK82"
FT                   /protein_id="ABY96410.1"
FT                   /translation="MSRVAKNPVKLPSGVEVKFAGQQLSVKGAKGTLELNVHSSVEVTE
FT                   ESGELRFVARNGDQQARAMAGTTRALVNNMVQGVSQGFERKLQLVGVGYKAQAKGTVLN
FT                   LALGFSHPVDYELPAGITAETPSQTDILIKGIDKQLVGQVAAEIRDFRPPEPYKGKGVR
FT                   YADEVVRRKEAKKK"
FT   gene            576134..576484
FT                   /locus_tag="PputGB1_0500"
FT   CDS_pept        576134..576484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0500"
FT                   /product="ribosomal protein L18"
FT                   /note="TIGRFAM: ribosomal protein L18; PFAM: ribosomal
FT                   protein L18P/L5E; KEGG: pen:PSEEN0506 50S ribosomal subunit
FT                   protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96411"
FT                   /db_xref="GOA:B0KK83"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KK83"
FT                   /protein_id="ABY96411.1"
FT                   /translation="MTDKKVIRLRRARKARLKMHELEVVRLCVFRSSQHIYAQVISADG
FT                   SKVLASASTLDKDLRDGATGNIDAATKVGKLVAERAKAAGVSQVAFDRSGFKYHGRVKA
FT                   LADAAREGGLEF"
FT   gene            576488..576988
FT                   /locus_tag="PputGB1_0501"
FT   CDS_pept        576488..576988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0501"
FT                   /product="ribosomal protein S5"
FT                   /note="TIGRFAM: ribosomal protein S5; PFAM: ribosomal
FT                   protein S5 domain protein; Ribosomal protein S5; KEGG:
FT                   pen:PSEEN0507 30S ribosomal subunit protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96412"
FT                   /db_xref="GOA:B0KK84"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KK84"
FT                   /protein_id="ABY96412.1"
FT                   /translation="MANNDQKRDEGYIEKLVQVNRVAKTVKGGRIFTFTALTVVGDGKG
FT                   RVGFGRGKSREVPAAIQKAMEAARRNMIQVDLKGTTLQYATKAAHGASKVYMQPASEGT
FT                   GIIAGGAMRAVLEVAGVQNVLAKCYGSTNPVNVVYATFKGLKAMQSPESIAAKRGKSVE
FT                   EIF"
FT   gene            576991..577167
FT                   /locus_tag="PputGB1_0502"
FT   CDS_pept        576991..577167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0502"
FT                   /product="ribosomal protein L30"
FT                   /note="PFAM: ribosomal protein L30; KEGG: pen:PSEEN0508 50S
FT                   ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96413"
FT                   /db_xref="GOA:B0KK85"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KK85"
FT                   /protein_id="ABY96413.1"
FT                   /translation="MATVKVTLIKSVSGRLPNHKLCVKGLGLRRIGHTVEVQDTPENRG
FT                   MINKAYYMLKVEG"
FT   gene            577171..577605
FT                   /locus_tag="PputGB1_0503"
FT   CDS_pept        577171..577605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0503"
FT                   /product="ribosomal protein L15"
FT                   /note="PFAM: ribosomal protein L15; KEGG: pfl:PFL_5563 50S
FT                   ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96414"
FT                   /db_xref="GOA:B0KK86"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KK86"
FT                   /protein_id="ABY96414.1"
FT                   /translation="MKLNDLSPAPGSRREKHRPGRGIGSGLGKTGGRGHKGQTSRSGGS
FT                   IAPGFEGGQQPLHRRLPKFGFVSLKAMDRAEVRLSELAKVEGDVISVQSLKDANVINQH
FT                   IQRVKIMLSGEVTRAVTIKGIAATKGARAAIEAAGGKFEE"
FT   gene            577606..578937
FT                   /locus_tag="PputGB1_0504"
FT   CDS_pept        577606..578937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0504"
FT                   /product="preprotein translocase, SecY subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecY subunit; PFAM:
FT                   SecY protein; KEGG: pen:PSEEN0510 secretion protein SecY"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96415"
FT                   /db_xref="GOA:B0KK87"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:B0KK87"
FT                   /protein_id="ABY96415.1"
FT                   /translation="MAKQGALSSLGKGGMSELWARLRFLFMAIIVYRIGAHIPVPGINP
FT                   DRLADLFRQNEGTILSLFNMFSGGALERMSIFALGIMPYISASIIMQLMTAVSPQLEQL
FT                   KKEGEAGRRKISQYTRYGTVILALVQAIGMSIGLANQGVAFSVGLGFHVVAVSTFVAGA
FT                   MFMMWLGEQITERGVGNGISMLIFAGIVAGLPRAIGQSFESARTGDINIFALVAIGLLA
FT                   VAIIGFVVFIERGQRRIAVHYAKRQQGRKVFAAQTSHLPLKVNMAGVIPAIFASSILLF
FT                   PASLGAWFGQSEGMGWLQDISQSIAPGQPLNILLFSAGIIFFCFFYTALMFNPKDVAEN
FT                   LKKSGAFIPGIRPGEQSARYIDGVLTRLTMFGALYMMAVCLLPQFLVVAANVPFYLGGT
FT                   SLLIVVVVVMDFMSQVQSHLVSHQYESLMKKANLKGYGGSGLLR"
FT   gene            579214..579570
FT                   /locus_tag="PputGB1_0505"
FT   CDS_pept        579214..579570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0505"
FT                   /product="ribosomal protein S13"
FT                   /note="PFAM: ribosomal protein S13; KEGG: pen:PSEEN0511 30S
FT                   ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96416"
FT                   /db_xref="GOA:B0KK88"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KK88"
FT                   /protein_id="ABY96416.1"
FT                   /translation="MARIAGVNIPDNKHTVISLTYIYGVGRTTAQKICADAGVNPAAKI
FT                   KDLSDEQIETLRGEVAKFTTEGDLRRDINMKIKRLMDLGCYRGLRHRKGLPVRGQRTKT
FT                   NARTRKGPRKPIRK"
FT   gene            579589..579978
FT                   /locus_tag="PputGB1_0506"
FT   CDS_pept        579589..579978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0506"
FT                   /product="ribosomal protein S11"
FT                   /note="PFAM: ribosomal protein S11; KEGG: pen:PSEEN0512 30S
FT                   ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96417"
FT                   /db_xref="GOA:B0KK89"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KK89"
FT                   /protein_id="ABY96417.1"
FT                   /translation="MAKPAARPRKKIKKTVVDGIAHIHASFNNTIVTITDRQGNALSWA
FT                   TSGGSGFRGSRKSTPFAAQIAAERAGQAALEYGLKNLDVNVKGPGPGRESAVRALNSCG
FT                   YKIASITDVTPIPHNGCRPPKKRRV"
FT   gene            579994..580614
FT                   /locus_tag="PputGB1_0507"
FT   CDS_pept        579994..580614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0507"
FT                   /product="ribosomal protein S4"
FT                   /note="PFAM: ribosomal protein S4; RNA-binding S4 domain
FT                   protein; KEGG: pen:PSEEN0513 30S ribosomal protein S4"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96418"
FT                   /db_xref="GOA:B0KK90"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KK90"
FT                   /protein_id="ABY96418.1"
FT                   /translation="MARYIGPKCKLSRREGTDLFLKSGVRALESKCNIEAAPGIHGQRR
FT                   GRQSDYGTQLREKQKVRRIYGVLERQFRGYYQAAASKKGATGENLLQLLECRLDNVVYR
FT                   MGFGSTRSESRQLVSHKAISVNGKTVNIPSYQVRPGDVVAVREKSLAQLRIVQALELCA
FT                   QRGRVEWVDVDAAKKSGVFKNVPARSDLSADINENLIVELYSK"
FT   gene            580637..581638
FT                   /locus_tag="PputGB1_0508"
FT   CDS_pept        580637..581638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0508"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /note="KEGG: pen:PSEEN0514 RNA polymerase, alpha subunit;
FT                   TIGRFAM: DNA-directed RNA polymerase, alpha subunit; PFAM:
FT                   RNA polymerase alpha subunit domain protein; RNA polymerase
FT                   dimerisation; RNA polymerase insert; SMART: RNA polymerase
FT                   RpoA/D/Rpb3-type"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96419"
FT                   /db_xref="GOA:B0KK91"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:B0KK91"
FT                   /protein_id="ABY96419.1"
FT                   /translation="MQISVNEFLTPRHIDVQVVSPTRAKITLEPLERGFGHTLGNALRR
FT                   ILLSSMPGCAVVEAEIDGVLHEYSAIEGVQEDVIEILLNLKGLAIKLHGRDEVTLTLSK
FT                   KGSGVVTAADIQLDHDVEIVNPDHVIANLASNGALNMKLTVARGRGYEPADSRQTDEDE
FT                   SRSIGRLQLDASFSPVRRIAYVVENARVEQRTNLDKLVIDLETNGTLDPEEAIRRAATI
FT                   LQQQLAAFVDLKGDSEPVVVEQEDEIDPILLRPVDDLELTVRSANCLKAENIYYIGDLI
FT                   QRTEVELLKTPNLGKKSLTEIKDVLASRGLSLGMRLDNWPPASLKKDDKATA"
FT   gene            581681..582067
FT                   /locus_tag="PputGB1_0509"
FT   CDS_pept        581681..582067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0509"
FT                   /product="ribosomal protein L17"
FT                   /note="PFAM: ribosomal protein L17; KEGG: pen:PSEEN0515 50S
FT                   ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96420"
FT                   /db_xref="GOA:B0KK92"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KK92"
FT                   /protein_id="ABY96420.1"
FT                   /translation="MRHRKSGRHLSRTSSHRKAMFQNMAVSLIEHELIKTTLPKAKELR
FT                   RVAEPLITLAKEDSVANRRLAFDRTRSKSAVGKLFNDLGKRYATRQGGYLRILKCGFRA
FT                   GDNAPMAYVELVDRPVGGAVEAAE"
FT   gene            582239..583678
FT                   /locus_tag="PputGB1_0510"
FT   CDS_pept        582239..583678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0510"
FT                   /product="Catalase"
FT                   /EC_number="1.11.1.6"
FT                   /note="PFAM: Catalase domain protein; KEGG: pen:PSEEN0517
FT                   catalase (hydroperoxidase II)KatA"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96421"
FT                   /db_xref="GOA:B0KK93"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024708"
FT                   /db_xref="InterPro:IPR024711"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="InterPro:IPR040333"
FT                   /db_xref="UniProtKB/TrEMBL:B0KK93"
FT                   /protein_id="ABY96421.1"
FT                   /translation="MSKILTTASGAPVADNQNSRSAGPRGPLLLDDFHLIEKLAHFNRE
FT                   NIPERRVHAKGSGAYGTFTVTRDITGYTSAKLFEQIGKQTETFLRFSTVGGERGSADTE
FT                   RDPRGFAVKFYTEEGNWDIVGNNTPVFFIRDPLKFPDFIHTQKRHPQSNLKNAQMMWDF
FT                   WSHSPEALHQVTILFSDRGIPDGYRHMHGFGSHTYSLINAKGERTWVKWHFKTQQGIKN
FT                   LAPAEAARLAGTDPDYAQRDLFEAIERGDYPRWTVCIQVMSEAEAASRDENPFDVTKTW
FT                   SQRDYPLIEVGVLELNRNPLNYFAEVEQAAFGPSNMVPGVGLSPDRMLQGRVFAYADAH
FT                   RYRVGTNHQQLPVNAPRCPVNSYQRDGSMATGSYGSAPNYEPNSHVDAPKQSPRHAEPA
FT                   LALNGSADRYDHREDTDYFSHAGALFRLMNAEQKALLISNIAGTMVGVSEDVIQRQLQY
FT                   FFKADPAYGEGIAKALGVHLA"
FT   gene            583842..584306
FT                   /locus_tag="PputGB1_0511"
FT   CDS_pept        583842..584306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0511"
FT                   /product="bacterioferritin"
FT                   /note="TIGRFAM: bacterioferritin; PFAM: Ferritin Dps family
FT                   protein; KEGG: pen:PSEEN0518 bacterioferritin"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96422"
FT                   /db_xref="GOA:B0KK94"
FT                   /db_xref="InterPro:IPR002024"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:B0KK94"
FT                   /protein_id="ABY96422.1"
FT                   /translation="MQGHPDVINYLVTLLKGELAARDQYFIHSRMYEDWGLSKLYERIN
FT                   HEMEEETQHADALMRRILMLEGTPDMRADDLEVGSTVPEMIEADLKLEYKVRGALCKGI
FT                   ELCELHKDYISRDILRAQLADTEEDHTYWLEKQQGLIKAIGLENYLQSQM"
FT   gene            complement(584379..587213)
FT                   /locus_tag="PputGB1_0512"
FT   CDS_pept        complement(584379..587213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0512"
FT                   /product="excinuclease ABC, A subunit"
FT                   /note="TIGRFAM: excinuclease ABC, A subunit; PFAM: ABC
FT                   transporter related; KEGG: pen:PSEEN0519 DNA excision
FT                   repair enzyme subunit, with UvrBC"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96423"
FT                   /db_xref="GOA:B0KK95"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:B0KK95"
FT                   /protein_id="ABY96423.1"
FT                   /translation="MDKILIRGARTHNLKNIDLTLPRDKLIVITGLSGSGKSSLAFDTL
FT                   YAEGQRRYVESLSAYARQFLSMMEKPDVDTIEGLSPAISIEQKSTSHNPRSTVGTITEI
FT                   YDYLRLLYARVGTPRCPDHDIPLEAQTISQMVDLVLERPEGSKLMLLAPVVRERKGEHL
FT                   AVFDELRAQGFVRARVNGKLYELDELPKLDKQKKHSIDVVVDRFKVRADLQQRLAESFE
FT                   TALKLADGIALVAPMDDEQGEEMIFSARFACPVCGHAISELEPKLFSFNNPAGACPTCD
FT                   GLGVKQFFDTKRLVNAELTLAEGAIRGWDRRNVYYFQMLGSLAAHYGFSLEEPFGELSA
FT                   EHQKVILQGSGKQSVDFKYLNDRGDIVKRSHPFEGIVPNLERRYRETESATVREELAKF
FT                   LGTQPCPDCRGTRLRREARHVWVGEKTLPAVTNLPIGEASNYFGELTLTGRRGEIAAKI
FT                   LKEICERLQFLVNVGLDYLTLDRSADTLSGGEAQRIRLASQIGAGLVGVMYILDEPSIG
FT                   LHQRDNDRLLATLNHLRDLGNTVIVVEHDEDAIRLADYVVDIGPGAGVHGGQIVAEGSP
FT                   QEVMDHPDSLTGKYLSGRKKIAVPAKRTPRNKKLQLKLKGARGNNLQNVDLEIPVGLMT
FT                   CVTGVSGSGKSTLINNTLFPLAATALNGASSLEAAPHGSMDGLQHLDKVVDIDQSPIGR
FT                   TPRSNPATYTGIFTPIRELFSGVPESRSRGYGPGRFSFNVKGGRCEACQGDGLIKVEMH
FT                   FLPDIYVPCDVCKSKRYNRETLEIKYKGKNIHEVLEMTIEDAREFFDAVPALARKLQTL
FT                   MDVGLSYIKLGQSATTLSGGEAQRVKLSRELSKRDTGKTLYILDEPTTGLHFADIQQLL
FT                   DVLHRLRDHGNTVVVIEHNLDVIKTADWLVDLGPEGGSKGGQIIACGTPEELSEMKQSY
FT                   TGHYLKPLLERDRA"
FT   gene            587343..588737
FT                   /locus_tag="PputGB1_0513"
FT   CDS_pept        587343..588737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0513"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   pen:PSEEN0520 transporter, MFS superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96424"
FT                   /db_xref="GOA:B0KK96"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B0KK96"
FT                   /protein_id="ABY96424.1"
FT                   /translation="MHDTHNERMSGGETRAAGGLALVFAFRMLGMFMVLPVLATYGMDL
FT                   AGATPALIGLAIGAYGLTQAVLQIPFGMISDRIGRRPVIYLGLVIFALGSVLAAQADSI
FT                   WGVIAGRILQGAGAISAAVMALLSDLTREQHRTKAMAMIGMSIGLSFAVAMVVGPLLTS
FT                   AFGLSGLFFATAGLALVGIALIAFVVPNTHSILQHRESGVARKALGPTLRHPDLLRLDV
FT                   GIFILHAILMASFVALPLAFVERGGLPKEEHWWVYLTALFISFFAMVPFIIYGEKKRKM
FT                   KRVLAGAVSVLLLTEIYFWEWADGLRGLVIGTVVFFTAFNLLEASLPSLVSKVSPAGGK
FT                   GTAMGVYSTSQFLGAALGGILGGWLFQHGGLDTVFLGCAVLCAIWLIVALRMNEPPYVT
FT                   SLRMPLTPEAVREAGLTERLMAVPGVTDAVVVAEEAAIYIKLDTKILDRATLERLVNPA
FT                   SSACEA"
FT   gene            588747..589292
FT                   /locus_tag="PputGB1_0514"
FT   CDS_pept        588747..589292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0514"
FT                   /product="single-strand binding protein"
FT                   /note="TIGRFAM: single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n; KEGG: pen:PSEEN0521 ssDNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96425"
FT                   /db_xref="GOA:B0KK97"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:B0KK97"
FT                   /protein_id="ABY96425.1"
FT                   /translation="MARGVNKVILVGTCGQDPEVRYLPNGNAVTNLSLATSEQWTDKQS
FT                   GQKVERTEWHRVSLFGKVAEIAGEYLRKGSQCYIEGKLQTREWEKDGIKRYTTEIIVDI
FT                   NGTMQLLGGRPQGQQQGGDPYNQGGGNYGGGQQQQYNQAPPRQQAQRPQQAPQRPAPQQ
FT                   PAPQPAADFDSFDDDIPF"
FT   gene            589425..590711
FT                   /locus_tag="PputGB1_0515"
FT   CDS_pept        589425..590711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0515"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: tcx:Tcr_0328
FT                   phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96426"
FT                   /db_xref="GOA:B0KK98"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B0KK98"
FT                   /protein_id="ABY96426.1"
FT                   /translation="MTLNPYAVKTIVLSSGERLPVLIALATGDPLFEPSVYVLSEIRAT
FT                   NRASNTIDQVLRSIMVLQLFLDSNQIDIDQRIQEGSVFRLSELDELVRHCRRPVADQLK
FT                   CNSIPPSHTSVRRGAAESLRLVQRQFAPTEVAGHTAANRIRVIRGYLDWLVRYHMARHH
FT                   SGAAEGERLWNEWTSCKAALDARLPRHKGRNTIGLREGLQPEVAERLLSVTSPISPENP
FT                   WKGEGARIRNSLLVRWFYELGLRRGELLNVKIPDINFQSEELIVARRADDPEDPRKDQP
FT                   LVKTRDRKIPLSPGLCRLTHEYITNTRRNTEGARRHPFLFIAMGTGSPLSLSAVNAVFA
FT                   ELRNAFNGEFDAVTPHVLRHTWNDRFSDIMDNAKVSDAEEERMRSFLMGWAPTSKTAGQ
FT                   YTRRHVRLKAQQVSLGMQSKQTEGWGNND"
FT   gene            590704..592269
FT                   /locus_tag="PputGB1_0516"
FT   CDS_pept        590704..592269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0516"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG:
FT                   prw:PsycPRwf_1125 phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96427"
FT                   /db_xref="GOA:B0KK99"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B0KK99"
FT                   /protein_id="ABY96427.1"
FT                   /translation="MTEEAVLPSRLSGYQKLPPTVSTLSGAVFDPSGKRWAFHDGLSAI
FT                   CVNFNRLSEYATEEFVEAAKVPLIWYAENTEASTVAAIFDNLRVLLVSIATARERLVNE
FT                   IDAPLLITYRASLSSDKEWKLGGLRAFFKKWYRLGVPGVTGDAVRFLNSIRLKGVRKGT
FT                   AVLTMDPLKGPLTDVERSAVHAALNDAFAVGQIPLDDYLLAWLCLLLGQRNIQFAMLKV
FT                   CDISEIDKSDGRKEYVLRVPRVKQATAEARREQFKDRLITPSIGKLLVSHANSILERFK
FT                   DKREFLDAPSQAPLFPKKNSMSCARPNFHDHSSPEAIGHRVKSVFSALHVRSERTGEPI
FT                   KVTSKRLRHTVATSAAREGHGELIIAELLDHSDTQNVGVYVKATPEIVERIDHAIALHM
FT                   APLAHAFAGVIINDESLAIRGDDPRSRIVDPRFDASMKPMGNCSRCGSCGFMAPIACYT
FT                   CKSFQAWIDGPHEAVLEYLLSERDRLMSGVDTRIATINDRTILAVAEVIRQIRETRKEE
FT                   GDVC"
FT   gene            592259..594328
FT                   /locus_tag="PputGB1_0517"
FT   CDS_pept        592259..594328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0517"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: tcx:Tcr_0330
FT                   putative integrase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96428"
FT                   /db_xref="GOA:B0KKA0"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="UniProtKB/TrEMBL:B0KKA0"
FT                   /protein_id="ABY96428.1"
FT                   /translation="MSADIAVFTPKAEIDASANLAAFVTMCRSQLTIFGADLRFDDMAW
FT                   DVTDTTQLKGHGKKRVRVYFSTQETVDDILPTQMAEPFVSFAKAYVRYMQGMRPTKNPA
FT                   FRVTALRALDAALRQSGHLVPVMMDGDTFNRAARAIAERLSGSTAYRVGSQLELIAKFM
FT                   SENRLTAVPLSWRSAIKRPLDTVRVGQEFDKRRTEKMPSQAALEALPKTFQIATQPKDV
FT                   LFSSIAAILCSAPDRINEVLLLAESCEVHDKTSGGKDAYGLRWQPAKGADPMVKWIIPS
FT                   MAPVVAEAIAKIRRLTEDARRIAQWYEFNPERLYLPHDLEHLRRQELLTMDEVQQVILL
FT                   EKGSASFASQWCTANNVLLIKNDSGVCARFADVEKAAILQLPSGFPLLNTEMGLKYSEA
FT                   LIVVRRNELHSARGTFSCVIEPVSINQVNTALGTRSEHGFESIFERLGFTEPDGSRIRV
FT                   STHQFRHYLNTLAQAGGMSQLDIAKWSGRLDVRQNEVYDHVSADQMVAKIRESIGDESH
FT                   MFGPLAKLPKNIPISRDEFARLKIPTAHTTDFGFCVHDYTMMPCERHADCINCNEHVCV
FT                   KGDEGKAIMVKRRLQDAQELLVRAEAATVEGYYGADRWMEHHRKTVLRLIQLTEILDNP
FT                   AVPTGAVIQLADVPIISSTGVEQALEDRAALDGYSTLKRLAPTNASRMKRSKHG"
FT   gene            594321..594785
FT                   /locus_tag="PputGB1_0518"
FT   CDS_pept        594321..594785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0518"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: prw:PsycPRwf_1123 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96429"
FT                   /db_xref="UniProtKB/TrEMBL:B0KKA1"
FT                   /protein_id="ABY96429.1"
FT                   /translation="MAKRRAKNLDDHAIEHIVCVLDGWSGKLSWDLLIEAIEKHLGVRY
FT                   TRQALDKHARIKSTYQATKARLSKVPGSRLHQKLSTAEVGALTERLKRLEAENARLKVE
FT                   NESLLEQFVTWAYNAYLKGMTKESLSTPLPRVDRELTKLTRTKRFAGGKG"
FT   gene            complement(594787..595062)
FT                   /locus_tag="PputGB1_0519"
FT   CDS_pept        complement(594787..595062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0519"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   pst:PSPTO_4630 transcriptional regulator, PbsX family"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96430"
FT                   /db_xref="GOA:B0KKA2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B0KKA2"
FT                   /protein_id="ABY96430.1"
FT                   /translation="MELKQAFGQALKQLRMSQGLTQEDFSDVSSRTYLSTLERGLKSPT
FT                   LDKLDEIAYVMEVHPVSILVHSYLLRDRSMTIEQLFKRVQEELGNL"
FT   gene            595148..595480
FT                   /locus_tag="PputGB1_0520"
FT   CDS_pept        595148..595480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96431"
FT                   /db_xref="UniProtKB/TrEMBL:B0KKA3"
FT                   /protein_id="ABY96431.1"
FT                   /translation="MFRTHLKAEVKGAGAFGDGLRVWRYVEQAIQCPWLYVCCTEESGD
FT                   VTLSSMLMIADMSAFEDVLSQQTERLRVENVLLVSPRHLNRHTGWLMEGLVECKRSMNP
FT                   TFKALS"
FT   gene            595525..595884
FT                   /locus_tag="PputGB1_0521"
FT   CDS_pept        595525..595884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0521"
FT                   /product="IS66 Orf2 family protein"
FT                   /note="PFAM: IS66 Orf2 family protein; KEGG: pst:PSPTO_3221
FT                   ISPsy5, Orf1"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96432"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:B0KHB6"
FT                   /protein_id="ABY96432.1"
FT                   /translation="MMRPDAKVEKVYLYPKPVDFRKSIDGLAALVELDIKVAVFDPVLF
FT                   VFLNKSRNRVKILYWERNGFCLWLKRLESERFKTSPDATDEAIVLTVQELNWLLDGFDL
FT                   WRNRPHQVLTPRFVA"
FT   gene            595912..597432
FT                   /locus_tag="PputGB1_0522"
FT   CDS_pept        595912..597432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0522"
FT                   /product="transposase IS66"
FT                   /note="PFAM: transposase IS66; KEGG: pst:PSPTO_5591 ISPsy5,
FT                   transposase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96433"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:B0KHB7"
FT                   /protein_id="ABY96433.1"
FT                   /translation="MPEDLPDDPVLLKQMLAQLLMERTVDKGQIVDLKEQVKLLRDRLF
FT                   SRKSEQTVETNTPQLALFNEPESLSIPPVDDDEEVIAPTLRRGKRKPLSADLPRIEVIH
FT                   ELPEHEQACACGCRKHVIGEETSEQLDIVPMQIRVLKHIRKIYGCRGCEAAPVTADKPA
FT                   QLIEKSMASPSVLAMLLATKYVDGLPLHRFETVLSRHGIEIPRQTLARWVIQCGEHLQP
FT                   LLNLMRDRLLESPVIHCDETRVQVLKEPDRDPTSQSWMWVQASGPPDRKVVLFDYTSSR
FT                   AQEVPLRLLESYRGYVMTDDYAGYNALALQPGVERLACMAHARRKFVEAQKVQPKGKAG
FT                   RADMALSLINKLYGIERELKDASDEQRLTGRQEKSLPIMGQLKSWLDKTQPHVTSQSVL
FT                   GKAVNYLASNWSRLERYVEAGYLPIDNNPAERAIKPFVIGRKAWLFSDTPKGAAASAQL
FT                   YSLVETAKINGQEPYTWLRHVLERLPHAQSVADYEALLPWNCSPEMPR"
FT   gene            597636..598109
FT                   /locus_tag="PputGB1_0523"
FT   CDS_pept        597636..598109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0523"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pau:PA14_35850 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96434"
FT                   /db_xref="UniProtKB/TrEMBL:B0KKA6"
FT                   /protein_id="ABY96434.1"
FT                   /translation="MDLDQQGELFVLQLIDDISLPSPRQVAEESLADFAKQVWYGELDL
FT                   VHLLRKHLVRPDTADEQRRRLLYVIDRLIRYPCILRSKAAQLRTVLNEWDELKPPQPTL
FT                   EAAELAARHMLDKKAFEWGLEEDITPQMKAVLKYQTRHYAATLGRITGYTKLE"
FT   gene            complement(598260..599159)
FT                   /locus_tag="PputGB1_0524"
FT   CDS_pept        complement(598260..599159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0524"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmr:Mmar10_2162 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96435"
FT                   /db_xref="UniProtKB/TrEMBL:B0KKA7"
FT                   /protein_id="ABY96435.1"
FT                   /translation="MVDIFRRLTPFQPIEDYGYVGFGSVWFSDFILFHKSLGIKNMVSI
FT                   EASEGARERFEENRPFQISMKFSNSSEALPKLNWDQRTIAWLDYDDTLVTSMLHDVRSV
FT                   ASRAVSGSILAVSVQCMKAKALIEYHEENDPSKASAIERFRQTFGRERVPDEARDEDLA
FT                   GWPYGKLCRKILTTEIELALSDRNTNPETAMQFIPICEIEYQDDARMTTIVGIFVSPEE
FT                   IERYKSCSFNKLDFMPIDNKAIRIEMPKLTVRELRKIEQQLPNIEGVELSLGSIPRSDA
FT                   EKFCKMYRYFPNFAVMEV"
FT   gene            complement(599225..600571)
FT                   /locus_tag="PputGB1_0525"
FT   CDS_pept        complement(599225..600571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0525"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pmy:Pmen_4034 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96436"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B0KKA8"
FT                   /protein_id="ABY96436.1"
FT                   /translation="MAETDSEIRDSISAEPTKAFFVDMLVRDIPLEQAVLDLVDNCVDG
FT                   AKRLAKQAEQPYEGCSVKITLDQTHFRILDNCGGFDIETAREYAFRFGRPAGAKATSHS
FT                   IGQFGVGMKRALFKFGRHFNVQSATSNEAWAVDVNVDEWEAQSGWSFPWAKPQDNSVST
FT                   ASPGTDIKVTKLRPEVALKFGTAWFRNSIVGLIKSKHRQFISDGLQISVNDFRIDATNI
FT                   YLLVSNGFTPGTDILTFTSEGSAPVTAKIIVGVGTSSPKEAGWNVICNGRVILEADRRA
FT                   VTGWGLIEEEAGKTLIPSFHNQFARFRGIVSFDSEDSSQIPWNTTKTDVDQDSIIWRKA
FT                   FQRMLEMMRPVIDFLNELDADIDENTREKSALLDFVTKASPQRPESFSVKKDFTAPARG
FT                   SIVKGPKMVKIQYSRAVDDVTFLQDALGLGSAKAVGEACFDMILKRQRD"
FT   gene            600943..602076
FT                   /locus_tag="PputGB1_0526"
FT   CDS_pept        600943..602076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0526"
FT                   /product="DNA-cytosine methyltransferase"
FT                   /note="TIGRFAM: DNA-cytosine methyltransferase; PFAM: C-5
FT                   cytosine-specific DNA methylase; KEGG: mmr:Mmar10_2163 DNA
FT                   (cytosine-5-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96437"
FT                   /db_xref="GOA:B0KKA9"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031303"
FT                   /db_xref="UniProtKB/TrEMBL:B0KKA9"
FT                   /protein_id="ABY96437.1"
FT                   /translation="MDTSKPLVIDLFSGCGGLGLGAELAGFHSLAAVDVDKDLQSAYSL
FT                   NFPLTQTINTDLALVTPSMWKGILKGKRIDGIIGGPPCQGFSRIGLRKTDDPRNALLGQ
FT                   YFKQVRELKPRFFLMENVEGLLDEKNKLVLEAALNLIPANYHVVGPLKINALDCGAATS
FT                   RKRVVIIGVDSSSMDVITQQEVVASLVKSSVTVREAISDIPSPNDDELRTSELFTWAKY
FT                   RRVSLSEYALKMRAMPPKGLGSKLSLERLIHGEISGVINTKHTQPVIERFSETRPGETE
FT                   LVSRYPRLSWGGHCPTLRAGTGSDKGSFQAMRPIHPSEPRVITVREAARLQGFPDWFLF
FT                   HPTMWHSFRMIGNSVSPLMSHHLMSIIAEKLERRVAA"
FT   gene            602085..603806
FT                   /locus_tag="PputGB1_0527"
FT   CDS_pept        602085..603806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0527"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmr:Mmar10_2161 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96438"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B0KKB0"
FT                   /protein_id="ABY96438.1"
FT                   /translation="MAVVKDSIEVSFNSDADYLIQGLTSDVSTIECIYDLIDNSIDAAR
FT                   SKIIRASKRFKKDSYGLPASYKGFKIDLDVTSRKVAVSDNCAGIDESTLSDKVFTIGKR
FT                   SKHAFGIGHYGVGLNRAIFKLGSSVRLMTDNGVHAFSLGFSEMDVRSAVENKSTIQARR
FT                   LPTSKKSYYKLEIDSVKNDVLSDLGSDTWLDTLRDQIRIRYAIFCAKGLVISVNKKKVG
FT                   SFGPKIRNPDFLEKRAKNFVSQSGVSVYLEAGLHENYRIAKFEIDYEQFKPVIKGLTPE
FT                   YGWYVVCNDRIILVADKTKITGWTTTAWHNEYHGFLGWAHYVSEDPSLLPWDTKKTGIN
FT                   TNNQTHIEVLSSLKELADDYRSRNRNLRQPKSGGVASEPAKPRGTGAASGLGGKPLGGG
FT                   ADPKGKVVPGSAIHTKEMDMLIYNLSSISSSPRIASFLQEAREISIKEHPYTAMILLRV
FT                   LFEAALRDYLLRHKHYQKVKDSIFEEQAVQGRPFSQKQKRDFTPSLANMLSWAVKNTEI
FT                   FSSDLRRGTKTSIDNFIKDLSRLNGIVHEDGVLTDFSEAKQIRNNALKALETFLGS"
FT   gene            complement(603834..604250)
FT                   /locus_tag="PputGB1_0528"
FT   CDS_pept        complement(603834..604250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0528"
FT                   /product="DNA mismatch endonuclease Vsr"
FT                   /note="TIGRFAM: DNA mismatch endonuclease Vsr; PFAM: DNA
FT                   mismatch endonuclease vsr; KEGG: nha:Nham_2517 DNA mismatch
FT                   endonuclease vsr"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96439"
FT                   /db_xref="GOA:B0KKB1"
FT                   /db_xref="InterPro:IPR004603"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:B0KKB1"
FT                   /protein_id="ABY96439.1"
FT                   /translation="MDRLSVEQRSWLMSRIKGKNTTPELIVRKLVYGMGYRYRLHLKYL
FT                   QGRPDLTFLRRKKVIFVNGCFWHGHPNCRYGRLPKTRLEYWQEKIEKNKRRDTENIHAL
FT                   QADGWQVLTVWQCELRNLEQLREKLQNFIDGPIT"
FT   gene            complement(604310..605011)
FT                   /locus_tag="PputGB1_0529"
FT   CDS_pept        complement(604310..605011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0529"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_2206 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96440"
FT                   /db_xref="UniProtKB/TrEMBL:B0KKB2"
FT                   /protein_id="ABY96440.1"
FT                   /translation="MDPKHLFLDERLKGRCTYCGGPPETVDHVPSRVLLDNPLPANLPV
FT                   VEACQKCNGGFSLDEEYIACLLECTMSGTTEISELSREKIKHALARNPRLRNQLEQCRR
FT                   TDDCGHIWWQPDERRVRNVIMKLAQGHAAYELGESCNDQPDHYSVRAIPTMTTEEINDF
FT                   EILEDCVQPLWPEIGCRAFLRASGKPVPPIQIGAWLIIQSGRYRYLVDWQDGVDVRIII
FT                   GEYLACRIVWY"
FT   gene            complement(605099..606649)
FT                   /locus_tag="PputGB1_0530"
FT   CDS_pept        complement(605099..606649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0530"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_0335 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96441"
FT                   /db_xref="UniProtKB/TrEMBL:B0KKB3"
FT                   /protein_id="ABY96441.1"
FT                   /translation="MSSSERPGVFDISDAEGVNDSERLLMRLCRKSFLSLWAHANLHTD
FT                   QDMHNGKGSAKEFADVMVVFGDDIVIFSDKHITYQSETDTKVAWKRWYKRAVTSSAKQL
FT                   YGAKSWLERFPHRVFLDSKCTRPLPVQIPDITKIRFHLVAVTRGSAEACAKHFSGSVGS
FT                   HMIQTGVDHNAYAELPFTTGPLDSSKEFVHVFDEISLEVLMHEMSTIKDFVEYLGARRA
FT                   FLLNPNTMITSAGEEQLIASYLMHTNENEHAFHPSTESAPHHISFDETLYPELLSRPEY
FT                   REMHAQNEISEFWDALIEKFITVGDPTITDLGANQKNHETELALRLMASETRFMRRELS
FT                   RHFFEMMELAKAGQYVRRARTLTTQQAPDLLYIFLACPKFAEQSYVDYRQYRSRLLLSY
FT                   AQCAKLKFTGAKTIIALGFDHPLKDYQGGSEDVCVYIRDEYTEEERTEVERLRSALGIY
FT                   ADSSTPTESRSFQFPAADSLQLGTAVVVRQTASKRKQLKTKKSKNIQQKQARKANRKR"
FT   gene            607390..607980
FT                   /locus_tag="PputGB1_0531"
FT   CDS_pept        607390..607980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0531"
FT                   /product="molybdopterin oxidoreductase Fe4S4 region"
FT                   /note="PFAM: molybdopterin oxidoreductase Fe4S4 region;
FT                   KEGG: pen:PSEEN0563 formate dehydrogenase-O, major subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96442"
FT                   /db_xref="GOA:B0KKB4"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="UniProtKB/TrEMBL:B0KKB4"
FT                   /protein_id="ABY96442.1"
FT                   /translation="MDLNRRQFFKVAAVGLGGSSLAALGMAPTPAFAEQVRHFKLAHTK
FT                   EARNTCPYCSVGCGLILYSQGDAGKNVKQNIIHIEGDADHPVNRGTLCPKGAGLLDFIH
FT                   SPSRLQYPEVRKPGSREWVRVSWDEALDRVADLMKQDRDANFIERNAQGQTVNRWLTTG
FT                   FLAASAASSEAGYLTHKVVRATGMLGFDNQARV"
FT   sig_peptide     607390..607491
FT                   /locus_tag="PputGB1_0531"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 34"
FT   gene            608029..610458
FT                   /locus_tag="PputGB1_0532"
FT   CDS_pept        608029..610458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0532"
FT                   /product="formate dehydrogenase, alpha subunit"
FT                   /EC_number="1.17.1.9"
FT                   /note="KEGG: pen:PSEEN0564 formate dehydrogenase-N major
FT                   subunit, anaerobic; selenopeptide; TIGRFAM: formate
FT                   dehydrogenase, alpha subunit; PFAM: molybdopterin
FT                   oxidoreductase; molydopterin dinucleotide-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96443"
FT                   /db_xref="GOA:B0KKB5"
FT                   /db_xref="InterPro:IPR006443"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:B0KKB5"
FT                   /protein_id="ABY96443.1"
FT                   /translation="MTNHWSDIANANLVLVMGGNAAEAHPCGFKWVTEAKAHNKARLIV
FT                   VDPRFTRTASVADYYAPIRTGTDIAFMGGLINYLLSTDKIQHEYVRNYTDVSFIVKENY
FT                   GFEDGLFSGYDEAKRVYADKSGWGYELGEDSYAKVDPTLQHPRCVFQLMKQHYSRYTPE
FT                   LASMTCGMPQDAMMKVWEEIATCSAPGKTMTILYALGWTQHSIGAQIIRSAAMVQLLLG
FT                   NVGMPGGGVNALRGHSNIQGLTDLGLLSNSLPGYLTLAGDAEQDYATYIDKRASKPLRP
FT                   GQLSYWQNYGKFHVSLMKAWYGANATAENNWGYDWLPKLDVPAYDVLRMFEMMGQGKVN
FT                   GYMCQGFNPIAALPDKNRVTAALGKLKWLVIMDPLATETSEFWRNAGPFNDVDTANIQT
FT                   EVIRLPTTCFAEEDGSLVNSSRWLQWHWKGADGPGETRTDVQIMSELFLRLRQRYQAEG
FT                   GAYPDAMMNISWPYKIPDEPSPEELAKEMNGWAVTDLTDTTGATLKAGQQLSGFAQMKD
FT                   DGSTASGCWIFAGCWTEQGNQMARRDNSDPYGMHQVQNWAWAWPANRRILYNRASSDPQ
FT                   GKPWDPEKKRLVWWNGKAWTGTDVPDFKVDSPPEAGMNPFIMNPEGVARFFAIDKMAEG
FT                   PFPEHYEPFETPIGINPLHPQNKKATSNPAGRIFDSVWDTLGTHDEFPYAATTYRLTEH
FT                   FHFWSKHCRLNAIAQPEQFVEIGEVLANEKGIKAGDRVRVSSKRGHIDAVAVVTKRIRP
FT                   LQVNNQTVHQIGIPLHWGFTGATRHGYLTNTLVPFLGDGNTQTPESKSFLVKVEKL"
FT   gene            610458..611408
FT                   /locus_tag="PputGB1_0533"
FT   CDS_pept        610458..611408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0533"
FT                   /product="formate dehydrogenase, beta subunit"
FT                   /note="TIGRFAM: formate dehydrogenase, beta subunit; PFAM:
FT                   4Fe-4S ferredoxin iron-sulfur binding domain protein;
FT                   Formate dehydrogenase transmembrane domain protein; KEGG:
FT                   pen:PSEEN0565 formate dehydrogenase-O, Fe-S subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96444"
FT                   /db_xref="GOA:B0KKB6"
FT                   /db_xref="InterPro:IPR006470"
FT                   /db_xref="InterPro:IPR014603"
FT                   /db_xref="InterPro:IPR015246"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR038384"
FT                   /db_xref="UniProtKB/TrEMBL:B0KKB6"
FT                   /protein_id="ABY96444.1"
FT                   /translation="MASQDIIARSATTTVPSSVRQQQEVAKLIDTTKCIGCKACQVACS
FT                   EWNELRDEVGHNHGTYDNPQDLTAETWTLMRFTEHERDDGNLEWLIRKDGCMHCADPGC
FT                   LKACPSPGAIIKHANGIVDFNQDHCIGCGYCITGCPFNIPRISQKDHKAYKCTLCSDRV
FT                   TVGLEPACVKTCPTGAIVFGSKDEMKVHAAERIVDLKSRGYDKAGLYDPDGVGGTHVMY
FT                   VLHHADTPKLYAGLPDQPVISPLVGLWKGFTKPLALLAMGAAVLAGFFHYVRVGPQRVE
FT                   DDEHPTAPDDSVHQVDPAVHVYDPKQPGGQGEQRP"
FT   gene            611405..612061
FT                   /locus_tag="PputGB1_0534"
FT   CDS_pept        611405..612061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0534"
FT                   /product="formate dehydrogenase, gamma subunit"
FT                   /note="TIGRFAM: formate dehydrogenase, gamma subunit; KEGG:
FT                   pen:PSEEN0566 formate dehydrogenase-O, cytochrome b556
FT                   (FDO) subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96445"
FT                   /db_xref="GOA:B0KKB7"
FT                   /db_xref="InterPro:IPR006471"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:B0KKB7"
FT                   /protein_id="ABY96445.1"
FT                   /translation="MSDNKPILRYNANERTNHWIVAILFFMAGLSGLALFHPALFWLSH
FT                   LFGGGPWTRILHPFMGVAMFVFFLGLVIRFWRANFITANDRLWLRRIDRVMVNREDGVP
FT                   PIGKYNAGQKLLFWTLLVCMLVLLVSGVVIWRAYFSHWFGIDAIRLSALLHALAAFVLI
FT                   LSIIVHIYAGIWIKGSIGAMLHGWVSRAWARKHHELWYRDVTGDKTPGNHGRKEG"
FT   gene            612066..612986
FT                   /locus_tag="PputGB1_0535"
FT   CDS_pept        612066..612986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0535"
FT                   /product="formate dehydrogenase accessory protein FdhE"
FT                   /note="TIGRFAM: formate dehydrogenase accessory protein
FT                   FdhE; PFAM: formate dehydrogenase accessory protein; KEGG:
FT                   pen:PSEEN0567 formate dehydrogenase formation protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96446"
FT                   /db_xref="GOA:B0KKB8"
FT                   /db_xref="InterPro:IPR006452"
FT                   /db_xref="InterPro:IPR024064"
FT                   /db_xref="UniProtKB/TrEMBL:B0KKB8"
FT                   /protein_id="ABY96446.1"
FT                   /translation="MSTILEPGQIEASAVTPPFLHLPPVNLFELRALRLEHLVEGNALG
FT                   DYLKLVARLCRIQQQLVDNPPGGMPVAEERQRLCISHGLPPLAADSLVREGPWLVWLQA
FT                   LLQQLSGETSGPLGEALQVLRGSDDEQRKGWGIALLAGQYDAVPAALVPFLGAALQAAW
FT                   SSWLLALPAPELKPAGSLAQCPACGSPAMAGVVRNRGKHNGLRYLACSLCACEWHVVRV
FT                   KCVYCESSKDLRYTSLEDDRHAPGKAPLRAECCPGCESYLKQNYLENDAAAEPLADDLA
FT                   SLALDMRLDEEGFHRLAPNLMLAPG"
FT   gene            613083..614510
FT                   /locus_tag="PputGB1_0536"
FT   CDS_pept        613083..614510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0536"
FT                   /product="L-seryl-tRNA(Sec) selenium transferase"
FT                   /EC_number="2.9.1.1"
FT                   /note="PFAM: L-seryl-tRNA selenium transferase; KEGG:
FT                   pen:PSEEN0568 selenocysteine synthase (with SelD)"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96447"
FT                   /db_xref="GOA:B0KKB9"
FT                   /db_xref="InterPro:IPR004534"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR018319"
FT                   /db_xref="InterPro:IPR025862"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KKB9"
FT                   /protein_id="ABY96447.1"
FT                   /translation="MSSSLASDTPRLPSIDTLLRHQACLPLIDRHGREGVLATLRQLLD
FT                   DLRNLVRNGELTPAELAPEILLGRTGERLAAQQRSQVRRVFNLTGTVLHTNLGRALLPE
FT                   AAIEAMQTAARYPLNLEFDLATGKRGDRDDLIEGLIRELTGAEAVTVVNNNAAAVLLAL
FT                   NSLGARKEGIISRGELIEIGGAFRIPDIMARAGVKLHEIGTTNRTHARDYEAAIGPRTG
FT                   LLMRVHCSNYSIQGFTTQVPTAELASIAHQRDLPLLEDLGSGSLLDLTRWGLPAEPTVR
FT                   QALADGADIVTFSGDKLLGGPQAGIIVGRKDLIARIKKNPLKRALRVDKITLAALEAVL
FT                   ALYRNPDRLAERLPTLRLLTRSQAEIQAQAERLAPEVKAHLGEQWAVSVAPALGMIGSG
FT                   SQPVARLPSAALCLRPQVSKKLRGRSLHVLERALRDLPVPVLGRLDDDALWLDLRQLDD
FT                   EAQWLAQLPALQLGPVQ"
FT   gene            614507..616429
FT                   /locus_tag="PputGB1_0537"
FT   CDS_pept        614507..616429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0537"
FT                   /product="selenocysteine-specific translation elongation
FT                   factor"
FT                   /note="TIGRFAM: selenocysteine-specific translation
FT                   elongation factor; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain 2 protein;
FT                   Elongation factor SelB winged helix 2; Elongation factor
FT                   SelB winged helix 3; KEGG: pen:PSEEN0569
FT                   selenocysteinyl-tRNA-specific translation factor"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96448"
FT                   /db_xref="GOA:B0KKC0"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004535"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR015190"
FT                   /db_xref="InterPro:IPR015191"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0KKC0"
FT                   /protein_id="ABY96448.1"
FT                   /translation="MIVGTAGHIDHGKTALLQALTGQAGDQRQEERARGMTIDLGYRYA
FT                   ALSEGAPLTGFIDVPGHERFIHNMLVGAHGIDLVLLVVAADDGVMPQTREHLAIIELLG
FT                   ISQALVAISKCDRVEPSRLAEVQIQVSELLAPGPYAGARQFPLSSISGEGIEALRQALL
FT                   EAEAGVRQRSARGGFRLAVDRAFAVTGAGVVVTGTALAGRVSAGDTLLLGKAGKPVRVR
FT                   GLHAQNQAALVAEAGQRVALNIAAERLTVEQVHRGDWLVPEWLHAPSVRVDIELNLLPG
FT                   ETHTFEHFSAVHVHLGTQDVTARVALLEGQSLAAGQRMFAQLLLNAPLQAVHGDRLVLR
FT                   DQRAQRTLGGGKVLDPFAPSRQRRTDERLRQLQVLRDAVDLEQALPALLASAPAGIDPQ
FT                   RLERQFNRLRETWHLPKDVLVVATRQGQLLFANAQWQALKQQVLAQLARFHEQEPDQLG
FT                   PDRDRLRRFVALPLERPAFVSLLDELLENGALASSGPWLHLPDHKVQLSEADSALWARL
FT                   QPRLLAGQYDPPWVRTLASEESCAEADVRLLLRKLARLGLVHQVVRDLFYPEATLQRMA
FT                   ELLLGQARETPIVQVAAFRDMLGIGRKRSVQILEYFDRIGLTRRVADQRHIRADSALAQ
FT                   QQARH"
FT   gene            complement(616556..617554)
FT                   /locus_tag="PputGB1_0538"
FT   CDS_pept        complement(616556..617554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0538"
FT                   /product="Asparaginase"
FT                   /EC_number="3.5.1.1"
FT                   /note="PFAM: Asparaginase/glutaminase; KEGG: pen:PSEEN0570
FT                   L-asparaginase, type I"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96449"
FT                   /db_xref="GOA:B0KKC1"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR020827"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="InterPro:IPR041725"
FT                   /db_xref="UniProtKB/TrEMBL:B0KKC1"
FT                   /protein_id="ABY96449.1"
FT                   /translation="MLAMRAVKNLLVLYTGGTIGMLETPEGLAPAGGFEARMREHFAQM
FT                   ADAPKLQWALQELNPLLDSANMQQHNWLAMRDAIVEAVDVAGHDGVLVLHGTDSMAYSA
FT                   AALSFLLLGLPVPVLLTGSMLPAGAPGSDAWANLCGALRQFEQGLEGGVHLYFHGQLLH
FT                   GCRASKLRSEAFDAFAALPRHRGGERASAIPAELGYMHPRQPVNLAVVPVFPGLQAEHL
FT                   QGLIDSGVQGVLLECYGSGTGPSDDQALLAVLSAARQRGVMLAAISQCPEGSVVFDTYA
FT                   AGNRLRGAGLISGGGMTREAALGKMVALLGAGLDVEAAEQWFALDLCGERA"
FT   gene            complement(617617..619059)
FT                   /locus_tag="PputGB1_0539"
FT   CDS_pept        complement(617617..619059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0539"
FT                   /product="amino acid carrier protein"
FT                   /note="TIGRFAM: amino acid carrier protein; PFAM:
FT                   sodium:alanine symporter; KEGG: pen:PSEEN0571
FT                   sodium/alanine symporter"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96450"
FT                   /db_xref="GOA:B0KKC2"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:B0KKC2"
FT                   /protein_id="ABY96450.1"
FT                   /translation="MLEVINDFLSGKLLIVLIVGLGSYFTLRSRFVQFRHFAHMFSVFK
FT                   ESLRGQAGQLSSFQALMLSLAGRVGAGNIAGVGIAVTLGGPGAVFWMWVTALVGMSSSF
FT                   FECTLAQVYKRADGDGLYRGGPAYYIQHGLKLKSMAIVFSILLLVTYGFAFIGLQSYTV
FT                   THSLQNAFAFDPKHTGIVLAVLLAVTFIGGIKRIAAVSDLLVPVKTLAYIGVTLYVIGT
FT                   QIEHVPAMLETIFKSAFGLDPAFGGLLGSAIVMGVKRGVFANEAGLGSAPNVAAVAAVK
FT                   HPGAQGVVQAFSVFLDTFVICTCTALLILLSGFYTPGFEGDGIVLTQNSLAAVVGDWGR
FT                   VFVSVALSLFVFTCILYNYYLGENSLQFLSRNRVVLMVFRGLVLALVVWGSMQDLSTVF
FT                   AFADITMTCLAFVNLVALALLFKVGLRVMRDYDDQRKAGVQQPVFDSSKFADLDLDRNA
FT                   WPANPQVETAADKAAGQAQPQR"
FT   gene            619237..620046
FT                   /locus_tag="PputGB1_0540"
FT   CDS_pept        619237..620046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0540"
FT                   /product="transcriptional regulator, Cro/CI family"
FT                   /note="KEGG: pen:PSEEN0572 transcriptional regulator,
FT                   Cro/CI family"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96451"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="UniProtKB/TrEMBL:B0KKC3"
FT                   /protein_id="ABY96451.1"
FT                   /translation="MSDHFATNLKLACSHYRSISEVCRQLSINRAQFNKYLSGQSRPTA
FT                   FNLKRIGDFFGVEDYELNLPAEQFARLIGARVSTLAEQPSDPISELFRPLHDHAGNLSR
FT                   YCGYYFEYSNCMSVPGTILVSLVHLWEERGRFLFERQERQERSSATDQHAEVRCRYLGA
FT                   AFQLQDRLFLIDYESLTFNEMSQTILIPSFKSRITRLNGLKAGVSSGDRRNPACTRVVW
FT                   EYLGEEINRINAYRQVKLYRPDDPRIDDDVRERLSVRPLSNGLFEIE"
FT   gene            complement(620057..620902)
FT                   /locus_tag="PputGB1_0541"
FT   CDS_pept        complement(620057..620902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0541"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN0573 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96452"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B0KKC4"
FT                   /protein_id="ABY96452.1"
FT                   /translation="MHLQTGSSQRLKWQFDEPAPGKELFIDEVFGTYQQQARLLVPDIE
FT                   RAAPAFVLGGARSDFTRLNPLLYRLQAAGIGSLTANLSGHSLASEPGAASPSLATNLDE
FT                   ARRFHAHIAPQCRTIIGHSLGAAIALKLAAQLPQVNSIVLVCPAVYPDHAHQAPFGPAF
FT                   TAAIRKPYGFLDCDSYAFLKQFQGRVLMVIGEYDGLNSQRFGKGPGTSAGSLWLTGAER
FT                   YSPIPEEVTQALMQSVAAARLQCVFLTDCDHGIAAHLRSTPAIADQVASAVETFILEDA
FT                   "
FT   gene            complement(620911..621702)
FT                   /locus_tag="PputGB1_0542"
FT   CDS_pept        complement(620911..621702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0542"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   nme:NMB0432 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96453"
FT                   /db_xref="GOA:B0KKC5"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:B0KKC5"
FT                   /protein_id="ABY96453.1"
FT                   /translation="MIEIDLTLVLILALVALTAGFFDAIAGGGGLITLPVLFIAGIEPL
FT                   AAIATNKFQAASATVSATCAFARKGMIDWRRGSSMAVMSFIGGALGALSITYVPKSLLQ
FT                   ACVPPLLILIAAYFAFSPSPNEQARKAKMSTSLFCVAVTPFIGFYDGVFGPGVGSFFML
FT                   ACVILLGQHLIQAVCTSKLLNAACNLGALSVFSLSGAIIWSLALAMALAAFLGAQLGAR
FT                   CAVRFGTRLIRLLLVSVCILMALKLLLDTSNPLGEWLNLLL"
FT   sig_peptide     complement(621622..621702)
FT                   /locus_tag="PputGB1_0542"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.858) with cleavage site probability 0.807 at
FT                   residue 27"
FT   gene            complement(621720..621911)
FT                   /locus_tag="PputGB1_0543"
FT   CDS_pept        complement(621720..621911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0543"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96454"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:B0KKC6"
FT                   /protein_id="ABY96454.1"
FT                   /translation="MLSSVQPLVFVLQPDRALLINNSRALHGRQTVEDNRRLLIRQFGY
FT                   SPFAAPLVLVEDPLLVRG"
FT   gene            complement(621962..622759)
FT                   /locus_tag="PputGB1_0544"
FT   CDS_pept        complement(621962..622759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0544"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96455"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:B0KKC7"
FT                   /protein_id="ABY96455.1"
FT                   /translation="MPHSQAAYLDFSPEQSRAIAFASQTLADSGGPEAKGAAIQARILA
FT                   DQIQKSLTDEQRSLLQRFGEGRLSTLMYRHMPYADEPIPENLPDITALAQNPRCTYLAS
FT                   RNQLLLELARHRNFAFDIDNEGKQVRLVGNFKGGGRIPRVGEHPRLEVETSSHAGLCLG
FT                   PHTEAPYNCSTVSSDGHSPAPSALILTARWNPANDPTHVFPLQEIIERLSSLGALALTS
FT                   KSFDFTRSECLLTEKAKQVKQFQCFSSSLTVASLYASTVTASV"
FT   gene            622975..623901
FT                   /locus_tag="PputGB1_0545"
FT   CDS_pept        622975..623901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0545"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /note="PFAM: dTDP-4-dehydrorhamnose reductase; KEGG:
FT                   pen:PSEEN0574 dTDP-4-rhamnose reductase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96456"
FT                   /db_xref="GOA:B0KKC8"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0KKC8"
FT                   /protein_id="ABY96456.1"
FT                   /translation="MPLSFINLSGSADSMRMRLMLLGGGNALGQALIRLGAEEDIAFLA
FT                   PRPPENGWTPASLTQLLDDHRPDALVNLAYYFDWFQAESVSEQRLAQQERAVERLAELC
FT                   QHHQITLVQPSSYRVFDGSRATAYSEKDEPVPLGLRGQALWRIEQSVRAACPQHVLLRF
FT                   GWLLDESIDGSLGRFLTRAEQPQELLLADDRRGNPTPVDDAARVILSVLKQLDCNAPLW
FT                   GTYHYAGNEATTPLALGQAILTEAGQHRQLAVQAPTPQAHAARPDASEEPQHAVLACKK
FT                   ILHTFGIKPRAWRAGLPPLLDRFYRHG"
FT   gene            623894..624826
FT                   /locus_tag="PputGB1_0546"
FT   CDS_pept        623894..624826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0546"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; dTDP-4-dehydrorhamnose
FT                   reductase; Male sterility domain; KR domain protein; KEGG:
FT                   pen:PSEEN0575 NAD-dependent epimerase/dehydratase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96457"
FT                   /db_xref="GOA:B0KKC9"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0KKC9"
FT                   /protein_id="ABY96457.1"
FT                   /translation="MADAPILITGGAGFIGSHLCDALLDKGYAVRILDDFSTGRRSNLQ
FT                   VDHPRLELIEGDVADAGLVTQTAAGCRAVVHLAAVASVQASVEDPVRTHQSNFIGTLNV
FT                   CEAMRVHGVRRVLFASSAAVYGNNGEGESIAEETPKAPLTPYAVDKLASEQYLDFYRRQ
FT                   HGLEPVVFRFFNIFGPRQDPSSPYSGVISIFCERAVQGLPITVFGDGEQTRDFLYVGDL
FT                   VQVMVQALEQPQVEEGAVNIGLNQATSLNQLLAALEKVVGSLPAISYVAARSGDIRHSR
FT                   ADNQRLLARFKFAQATPMVEGLARLLGKA"
FT   gene            complement(624855..625298)
FT                   /locus_tag="PputGB1_0547"
FT   CDS_pept        complement(624855..625298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0547"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG:
FT                   pen:PSEEN0576 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96458"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0KKD0"
FT                   /protein_id="ABY96458.1"
FT                   /translation="MLDEHNAQCPVARALEVLGDRWALMILRDAFDGLHRFSEFHKNLG
FT                   LAKNILASRLKLLVESELLALQPASDGSAYKEYVLTAKGRSVFPVVVGLRQWGERFLFE
FT                   AGEARSELVEGATGQALETLQVRAQDGRVLHAEDCLRRMVRHE"
FT   gene            625400..626605
FT                   /locus_tag="PputGB1_0548"
FT   CDS_pept        625400..626605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0548"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   pen:PSEEN0577 transport protein, MFS superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96459"
FT                   /db_xref="GOA:B0KL55"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B0KL55"
FT                   /protein_id="ABY96459.1"
FT                   /translation="MAPSLTRWTTLLLAITSAMAVATVYFAQPLLESMAAELGVGQQQI
FT                   GWVVGATQAGYALGLLLIVPLGDLVDRKRLLLGQLLFSALALIGVGMSQSWAMLLVALA
FT                   VTGLMAVMVQVMVAHAASLASPGQQGQAVGAVTSGVVLGILLARLVSGGLADLAGWRSV
FT                   YWMAAGVLIVLALVIWRSLPSVQPVMHRSGYRALIVSQFNLYRHDRLLRQRGMFGVLIF
FT                   ASFSVLWSAMVMPLSAAPLALSHTEIGLFGLAGVAGTLAASRAGRLADQGQGERTTGLA
FT                   LALLTLSWLPTAFVGASLMAFVLGVLMLDFAVQAVHVTNQSLLLAGRGAMASRLIGAYM
FT                   CCYSLGSGLGAVLAAWVFAHWGWVAVCGLGMAISAVALGYWLWLQRARAAEAALPCSGQ
FT                   NL"
FT   sig_peptide     625400..625483
FT                   /locus_tag="PputGB1_0548"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.780 at
FT                   residue 28"
FT   gene            complement(626593..627276)
FT                   /locus_tag="PputGB1_0549"
FT   CDS_pept        complement(626593..627276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0549"
FT                   /product="OmpW family protein"
FT                   /note="PFAM: OmpW family protein; KEGG: pen:PSEEN0578 outer
FT                   membrane protein OprG"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96460"
FT                   /db_xref="GOA:B0KL56"
FT                   /db_xref="InterPro:IPR000758"
FT                   /db_xref="InterPro:IPR005618"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:B0KL56"
FT                   /protein_id="ABY96460.1"
FT                   /translation="MNKSLLGASLVALALAAPVAHAHQAGDVIVRAGAITTAPNESSGD
FT                   LKFDGNKVSGTKATLDSDTQLGLTFAYMLTDHIGLELLAATPFKHTVGVKGLGGGLDGK
FT                   LADIKQLPPTLSLQYYPMEPNSKFQPYAGVGINYTLFFDEDLSSARKQQGFSNLKLQDS
FT                   IGIAGQLGMDYMITDNLLVNASVWYVDIDTKASVNGPTALGYSKTKVDVDVDPWVYMVG
FT                   LGYKF"
FT   sig_peptide     complement(627208..627276)
FT                   /locus_tag="PputGB1_0549"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            complement(627386..627958)
FT                   /locus_tag="PputGB1_0550"
FT   CDS_pept        complement(627386..627958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0550"
FT                   /product="lipoprotein"
FT                   /note="KEGG: pen:PSEEN0579 lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96461"
FT                   /db_xref="InterPro:IPR021727"
FT                   /db_xref="UniProtKB/TrEMBL:B0KL57"
FT                   /protein_id="ABY96461.1"
FT                   /translation="MIKHLIALFAGSPAKRPVKATQFLLVILLSLTLPAWASEPRELDW
FT                   PALIPEGAPVIPPQLAPLHDMSQLSNALSAESAPPARQQAPDAPVVKGLDGQQVKLPGY
FT                   IVPLEVSEEGRTTEFLLVPYYGACIHVPPPPSNQIVHIFSEMGVRVEDLYQPYWIEGKM
FT                   QVRASSSELADAGYQMEAEKIYAYELR"
FT   sig_peptide     complement(627845..627958)
FT                   /locus_tag="PputGB1_0550"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.999 at
FT                   residue 38"
FT   gene            complement(627968..629233)
FT                   /locus_tag="PputGB1_0551"
FT   CDS_pept        complement(627968..629233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0551"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   pen:PSEEN0580 ABC efflux transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96462"
FT                   /db_xref="GOA:B0KL58"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:B0KL58"
FT                   /protein_id="ABY96462.1"
FT                   /translation="MYLLRLALASLANRRFTAFLTAFAIALSVCLLLAVERVRTEARAS
FT                   FASTISGTDLIVGARSGSVNLLLYSVFRIGNATNNIRWDSFQHYAQDPRVKWAIPISLG
FT                   DSHRGYRVMGTTADYFSHYQYGRRQHLELSQGREFASDPFEVVLGAEVAEALHYKLGDK
FT                   LVLAHGVAAISLVKHDDKPFTVVGVLKRTGTPVDRTLHISLGGMEAIHIDWHNGVPARG
FT                   AGRISAEQARAMDLQPAAITAFMLGLNSKIATFSLQREINEYRSEPLLAILPGVALQEL
FT                   WSLMGTAEQALFVVSLFVVLTGLIGMLTAILTSLNERRREMAILRSVGARPWHIAGLLV
FT                   LEALSLAAVGIVAGLGLLYAGIALAQGYVQANYGLYLPLALPSAHEWTLLAIILGAALL
FT                   MGSVPAWRAYRQSLADGLSIHL"
FT   sig_peptide     complement(629129..629233)
FT                   /locus_tag="PputGB1_0551"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.915 at
FT                   residue 35"
FT   gene            complement(629233..629943)
FT                   /locus_tag="PputGB1_0552"
FT   CDS_pept        complement(629233..629943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0552"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pen:PSEEN0581 ABC transporter, ATP binding component"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96463"
FT                   /db_xref="GOA:B0KL59"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0KL59"
FT                   /protein_id="ABY96463.1"
FT                   /translation="MSQPLIELRDLVFAWPGQPPLLDIPALRLNAGEALFLKGPSGSGK
FT                   TTLLGLLGGVSVPAQGRIELLGQDLGGLSQGARDRFRVDHTGYIFQQFNLLPFLSVREN
FT                   VELPCRFSRSRKARAEQRHGGVDQAASTLLAHLGLDDPALLARRADSLSIGQQQRVAAA
FT                   RALIGQPELVIADEPTSALDTDTREAFIRLLFDECRAAGASLLFVSHDQSLAPLFDRHL
FT                   SLADLNRAAKPREA"
FT   gene            complement(629944..630519)
FT                   /locus_tag="PputGB1_0553"
FT   CDS_pept        complement(629944..630519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0553"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN0582 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96464"
FT                   /db_xref="InterPro:IPR021253"
FT                   /db_xref="UniProtKB/TrEMBL:B0KL60"
FT                   /protein_id="ABY96464.1"
FT                   /translation="MRRLLLALPFALLPLAVAHAHDDHDHDHAHGTLGAHEHGVAKLNV
FT                   VLDGNTLELELDSPAMNLVGFEHAASSDADKAKVAAVRQQLEQPLTLVGLAAAAGCKEE
FT                   QQALESPLFGDAPKADEDGDDHEHGHQHSDIGAHYQLTCANPEKLTQVDLAPLFKAFPA
FT                   TQKINLQLIGPNGQKGVETTPAQATVAF"
FT   sig_peptide     complement(630457..630519)
FT                   /locus_tag="PputGB1_0553"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 21"
FT   gene            630650..631009
FT                   /locus_tag="PputGB1_0554"
FT   CDS_pept        630650..631009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0554"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN0583 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96465"
FT                   /db_xref="UniProtKB/TrEMBL:B0KL61"
FT                   /protein_id="ABY96465.1"
FT                   /translation="MRIRGQIGEWPVDLTIELAPEEWAQLGQRVTGREASVDATAVVHA
FT                   PPSQDDGQWATARELLQRAGHVAGPQLLEQLEALVGSVAAGKRLLVRLRHSPDVRVENV
FT                   GDAPVYHWVGPRKAE"
FT   gene            631087..632571
FT                   /locus_tag="PputGB1_0555"
FT   CDS_pept        631087..632571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0555"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96466"
FT                   /db_xref="UniProtKB/TrEMBL:B0KL62"
FT                   /protein_id="ABY96466.1"
FT                   /translation="MDISNGANDEVRSGEDSLYGWPFMVFFDWRKLNEYWKAHALEPQG
FT                   DGFCAQDIEFEIDTTMESAQFFRCSLGPLKLQVTGGDGSPLRLVVRRRILSCVVIHLVR
FT                   SLGGRTRTITQVRHVIEEQGVELCLEIDLEANAGRYDSEQRVSLGWAKYPVFYLSNAYQ
FT                   TSTRDELGALPYALFFRGHADSSKFIQLGKIQPLSTRVLKPMHFWLRSISAVENQSSFL
FT                   ALYPVIGEHGIAFFPNLYPPIPVSTAGVSMVLDATRYPGAALAQQDIQDCPSLLMPPGL
FT                   VRSGVLETDGSIVRSRFELQSSEPPLAHVQVEGQSFGLEPRVRVINGAQTVTLSLLPSN
FT                   AGEHPRSWSQYGGRIEPKGWGCTFLPDEREASSIETLCEYCVIQAAVENSTFTSTVMVL
FT                   RGVPTGYIRLTPSLHGHVKLCYRKGGQEVVIPYEDTYWSGFNCFIASNGAIERFDNEPF
FT                   CIIRAYSDLGEAFIWAVLILPVPLIDLQTALSLDIG"
FT   gene            complement(632633..633505)
FT                   /locus_tag="PputGB1_0556"
FT   CDS_pept        complement(632633..633505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0556"
FT                   /product="thioredoxin"
FT                   /note="TIGRFAM: thioredoxin; PFAM: Thioredoxin domain;
FT                   KEGG: pen:PSEEN0584 thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96467"
FT                   /db_xref="GOA:B0KL63"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B0KL63"
FT                   /protein_id="ABY96467.1"
FT                   /translation="MSQDTPYIFDATDATFQQLVIENSFHKPVLVDFWAEWCAPCKALM
FT                   PLLAKIAEGYQGELLLAKINCDVEQQVVAQFGIRSLPTVVLFKDGQPVDGFAGAQPESA
FT                   IRAMLEPHVQMPAAPAASPLEQAKALFAESRFAEAEALLQVLLGEDNSNAEALILYARC
FT                   LAERGELGEAQVVLDAVKTDEHKAALAGAKAQLTFLRQAASLPEVADLKSRLAQNPQDD
FT                   EAAYQLSIQQLARQQYEAALEGLLKLFQRNRAYENGLPHKALLQVFELLGNDHPLVNVY
FT                   RRKLFAAMY"
FT   gene            complement(633537..634196)
FT                   /locus_tag="PputGB1_0557"
FT   CDS_pept        complement(633537..634196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0557"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: methyltransferase small; Methyltransferase
FT                   type 12; KEGG: pen:PSEEN0585 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96468"
FT                   /db_xref="GOA:B0KL64"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B0KL64"
FT                   /protein_id="ABY96468.1"
FT                   /translation="MAPLALQQALSGLIGEARLVVSELPGCDLKLWLIDDQNMDRAFSS
FT                   EETRRILEEPPYWSFCWASGLAMARYLAERPEWVAGKRVLDFGAGSGIAGIAAARAGAL
FT                   EVVACDLDPLALDACRANAALNGVELNYSSDFFAEGDRFDLILVADVLYDRANLPLLDA
FT                   FLGRGRQALVADSRVRDFSHPLYRQLGVLEALTLPDLAEPHEFRRVSLYHASRDAL"
FT   gene            complement(634197..634649)
FT                   /locus_tag="PputGB1_0558"
FT   CDS_pept        complement(634197..634649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0558"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN0586 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96469"
FT                   /db_xref="InterPro:IPR039366"
FT                   /db_xref="UniProtKB/TrEMBL:B0KL65"
FT                   /protein_id="ABY96469.1"
FT                   /translation="MHYRALVVLCCAALLAACGSDRPKTDNLPAPTPARSAKQAEVLGP
FT                   LPAYQRELSGTLLEIPAGANVELALLVIDERDRPQGLLASSTLTGTGQALPYHLRFNPE
FT                   AFPAGARVELRGRASSSGQLIMHLPPVRITQAQTQATGPLRFEKAP"
FT   sig_peptide     complement(634590..634649)
FT                   /locus_tag="PputGB1_0558"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.911 at
FT                   residue 20"
FT   gene            634756..635220
FT                   /locus_tag="PputGB1_0559"
FT   CDS_pept        634756..635220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0559"
FT                   /product="ATP-cone domain protein"
FT                   /note="PFAM: ATP-cone domain protein; KEGG: pen:PSEEN0587
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96470"
FT                   /db_xref="GOA:B0KL66"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KL66"
FT                   /protein_id="ABY96470.1"
FT                   /translation="MHCPFCGANDTKVIDSRLVAEGEQVRRRRECVACGERFTTFETAE
FT                   LVLPRLIKQDGTRQPFDEEKLRAGMQRALEKRPVSVERLEAALAHIKSRLRATGEREVK
FT                   SLVVGEMVMAELRKLDEVAYIRFASVYRRFQDLDEFREEIDRLAREPARE"
FT   gene            635223..636353
FT                   /locus_tag="PputGB1_0560"
FT   CDS_pept        635223..636353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0560"
FT                   /product="riboflavin biosynthesis protein RibD"
FT                   /EC_number="3.5.4.26"
FT                   /EC_number="1.1.1.193"
FT                   /note="KEGG: pen:PSEEN0588 riboflavin biosynthesis protein
FT                   RibD; TIGRFAM: riboflavin biosynthesis protein RibD; PFAM:
FT                   CMP/dCMP deaminase zinc-binding; bifunctional
FT                   deaminase-reductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96471"
FT                   /db_xref="GOA:B0KL67"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR011549"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:B0KL67"
FT                   /protein_id="ABY96471.1"
FT                   /translation="MPSQAAVLDAHYMARALELARKGLYTTHPNPRVGCVIVRDGEVVG
FT                   EGWHVRAGEPHAEVHALRQAGERAIGACAYVTLEPCSHHGRTPPCAEALVKAGVARVVA
FT                   AMQDPNPQVAGQGLQRLAEAGIEVASGVLETEARALNPGFLKRMEHGLPFVRAKLAMSL
FT                   DGRTAMASGESQWITGPAARSAVQRLRARSSVVLTSAASVLADNARMTVRGTELGLDAE
FT                   TTALALSRTPLRVLVDSRLRLPLDAAFFQAGPALVVAAVADDPRYAAAGHELLSLPGDN
FT                   GQVDLPALLQALAARGVNEILLEAGAGLVGAFAQQGLVDEYQLFVAGTFLGSQARPLLD
FT                   WPLGKMSEAPRLKITEMRAVGDDWRVTAIPLPAPGV"
FT   gene            636397..637062
FT                   /locus_tag="PputGB1_0561"
FT   CDS_pept        636397..637062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0561"
FT                   /product="riboflavin synthase, alpha subunit"
FT                   /note="TIGRFAM: riboflavin synthase, alpha subunit; PFAM:
FT                   Lumazine-binding protein; KEGG: pen:PSEEN0589 riboflavin
FT                   synthase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96472"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:B0KL68"
FT                   /protein_id="ABY96472.1"
FT                   /translation="MFTGIIESIGTIRSLTPKGGDVRVYVETGKLDLGDVKLGDSIAVN
FT                   GVCLTAVELPGDGFWADVSVETLKRTAFIDLKSGSKVNLEKALTPTTRLGGHLVSGHVD
FT                   GVGEIISRSDNARAIQFRVRAPKELAKYIAHKGSITVDGTSLTVNEVNGAEFELTIVPH
FT                   TLSETIMADYRAGRRVNLEVDLLARYLERLLLGDKAAEPSKGSGITESFLAANGFLKS"
FT   gene            637081..638172
FT                   /locus_tag="PputGB1_0562"
FT   CDS_pept        637081..638172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0562"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /note="TIGRFAM: 3,4-dihydroxy-2-butanone 4-phosphate
FT                   synthase; PFAM: 34-dihydroxy-2-butanone 4-phosphate
FT                   synthase; GTP cyclohydrolase II; KEGG: pen:PSEEN0590
FT                   3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP
FT                   cyclohydrolase II"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96473"
FT                   /db_xref="GOA:B0KL69"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:B0KL69"
FT                   /protein_id="ABY96473.1"
FT                   /translation="MALNSIEELVEDIRQGKMVILMDDEDRENEGDIIMAAECCLPEHI
FT                   NFMAKHARGLICMPMTRERCETLKLPLMAPRNGSGFGTKFTVSIEAAEGVTTGISAADR
FT                   ARTVQAAAAKDAKAEDIVSPGHIFPLMAQPGGTLARAGHTEAACDLARMAGFEPSGVIC
FT                   EVMNDDGTMSRRAELEVFAAEHGLKIGTIADLIHYRMIHERTVQRVSEQPVESELGEFN
FT                   LVTYRDAVEGDVHMALTLGKICAEEPTLVRVHNMDPLRDLLLVKQPGRWSLRAAMAAVA
FT                   EAGSGVVLLLGHPLDGDVLLAHIRESAGDAPTKAPTTYSTVGAGSQILRDLGVRKMRLM
FT                   SSPMKFNAISGFDLEVVEYVPSE"
FT   gene            638264..638740
FT                   /locus_tag="PputGB1_0563"
FT   CDS_pept        638264..638740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0563"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase"
FT                   /EC_number="2.5.1.9"
FT                   /note="KEGG: pen:PSEEN0591 6,7-dimethyl-8-ribityllumazine
FT                   synthase (lumazine synthase)(riboflavin synthase beta
FT                   chain); TIGRFAM: 6,7-dimethyl-8-ribityllumazine synthase;
FT                   PFAM: 67-dimethyl-8-ribityllumazine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96474"
FT                   /db_xref="GOA:B0KL70"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KL70"
FT                   /protein_id="ABY96474.1"
FT                   /translation="MTLKTIEGTFIAPKGRYALVVGRFNSFVVESLVSGAVDALVRHGV
FT                   SESDITIIRAPGAFEIPLVAQKVAQQGAYDAIIALGAVIRGGTPHFEYVAGECTKGLAQ
FT                   VSMEFGVPVAFGVLTVDSIEQAIERSGTKAGNKGAEAALSALEMVSLLAQLEAK"
FT   gene            638737..639237
FT                   /locus_tag="PputGB1_0564"
FT   CDS_pept        638737..639237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0564"
FT                   /product="NusB antitermination factor"
FT                   /note="TIGRFAM: transcription antitermination factor NusB;
FT                   PFAM: NusB/RsmB/TIM44; KEGG: pfl:PFL_5518 transcription
FT                   antitermination protein NusB"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96475"
FT                   /db_xref="GOA:B0KL71"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KL71"
FT                   /protein_id="ABY96475.1"
FT                   /translation="MISDESDRFNPRDPKPADAGKPSKSAKRREARKLATQALYQWHMA
FT                   QHSLNEIEAQFRVDNDFTDVDGAYFREILHGVPAIKGEIDKALVPCMTIALEELDPVEL
FT                   AVLRLSTWELIKRVDVPYRVVINEGVELAKVFGATDGHKFVNGVLDKLAPALREAEVKA
FT                   NKR"
FT   gene            639256..640224
FT                   /locus_tag="PputGB1_0565"
FT   CDS_pept        639256..640224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0565"
FT                   /product="thiamine-monophosphate kinase"
FT                   /EC_number="2.7.4.16"
FT                   /note="KEGG: pen:PSEEN0593 thiamin-monophosphate kinase;
FT                   TIGRFAM: thiamine-monophosphate kinase; PFAM: AIR synthase
FT                   related protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96476"
FT                   /db_xref="GOA:B0KL72"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:B0KL72"
FT                   /protein_id="ABY96476.1"
FT                   /translation="MGEFELINHYFAAAPCAQGGEGVALGIGDDCALLDLPPGEQLAVS
FT                   TDTLVAGVHFPVACDPLLLGQRSLAVAASDLAAMGATAIGFTLALTLPDVGPGWLSAYA
FT                   DGLSRMAQRCRMSLIGGDTTRGPLSITVTVFGRVPVGQALRRSGARPGDLLCVGGSLGK
FT                   AAGALPLVLGEREAPAAQAEPLLAHYWSPMPQLTLGALLRGRATAALDISDGLLADCGH
FT                   IAKASGVALEVNLAQVPVSPALEAFLGREAAVRAALTGGDDYVLAFTLPPEALAPLAAF
FT                   DTIEVHTIGRVLEGQGVTLRDAQGQDITPVQRGYQHFRETP"
FT   gene            640221..640724
FT                   /locus_tag="PputGB1_0566"
FT   CDS_pept        640221..640724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0566"
FT                   /product="phosphatidylglycerophosphatase A"
FT                   /note="PFAM: phosphatidylglycerophosphatase A; KEGG:
FT                   pen:PSEEN0594 phosphatidylglycerophosphatase A"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96477"
FT                   /db_xref="GOA:B0KL73"
FT                   /db_xref="InterPro:IPR007686"
FT                   /db_xref="InterPro:IPR026037"
FT                   /db_xref="InterPro:IPR036681"
FT                   /db_xref="UniProtKB/TrEMBL:B0KL73"
FT                   /protein_id="ABY96477.1"
FT                   /translation="MTDHPNQVPAEFVPPSVWRNPWHFIAFGFGSGTLPKAPGTWGSLV
FT                   AIPFIPLWQMLPDWGYWLLLGVSMLFGFWLCGKVANDLRVHDHEGIVWDEIVGMWITLW
FT                   LVPEGWQWLLAGFLMFRFFDILKPWPIRWIDRHVHGGVGIMLDDILAGVFAWLGMQVLV
FT                   WAVA"
FT   gene            640741..641484
FT                   /locus_tag="PputGB1_0567"
FT   CDS_pept        640741..641484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0567"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN0595 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96478"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:B0KL74"
FT                   /protein_id="ABY96478.1"
FT                   /translation="MAIRTVLLAMLLSVAPWVSAAEGVPKQIHLVSEEWLDYTNADGTG
FT                   VAWDVLRKVFEPAGVKVVTQSAPYSRAVGLVKRGEADAWVGSYKEENDDNLYPRWHFDM
FT                   DHIYALGLASKPVPTPQNVGKYRLAWVRGYDYGSYLPDVHEFREIQRREGILPMLEHDR
FT                   VDFYIDAQTEVDYVLSQSSQPERFRRTHVAELPLYLAFARNDQAKALCDLFDKRMAELV
FT                   RSGELKPIFERWKQPYPFSADSKPH"
FT   sig_peptide     640741..640806
FT                   /locus_tag="PputGB1_0567"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.555 at
FT                   residue 22"
FT   gene            641614..642231
FT                   /locus_tag="PputGB1_0568"
FT   CDS_pept        641614..642231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0568"
FT                   /product="GTP cyclohydrolase II"
FT                   /EC_number="3.5.4.25"
FT                   /note="PFAM: GTP cyclohydrolase II; KEGG: pen:PSEEN0596 GTP
FT                   cyclohydrolase II"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96479"
FT                   /db_xref="GOA:B0KL75"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KL75"
FT                   /protein_id="ABY96479.1"
FT                   /translation="MPVVFVAASKLPTPFATFTMHGFLDEATGREHVVLSLGDIADGQP
FT                   VLGRLHSECLTGDALFSQRCDCGSQLEAALQAIAREGRGVLLYLRQEGRGIGLLNKIRA
FT                   YELQDGGADTVEANERLGFAADQRDYAMCLPMLEHLGVKSLRLMTNNPRKVKALTDMNI
FT                   VVAERVPLHTGHNPHNRYYLATKAGKLGHMLGNEHQGEAPQA"
FT   gene            642228..642647
FT                   /locus_tag="PputGB1_0569"
FT   CDS_pept        642228..642647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0569"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN0597 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96480"
FT                   /db_xref="GOA:B0KL76"
FT                   /db_xref="UniProtKB/TrEMBL:B0KL76"
FT                   /protein_id="ABY96480.1"
FT                   /translation="MTRAEVKRRLALAWWQYLAVGLVPLPVMAWAFGGGDALIPVLAMP
FT                   LFIAGAATMFLSLPRFGAYKRALIATSKVLGTGEEPGAWIELARVRRVAMLYACFPAWV
FT                   AALTVLVGLEAVPQILLALSTVVVLYLYRIPRQLG"
FT   sig_peptide     642228..642317
FT                   /locus_tag="PputGB1_0569"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.722) with cleavage site probability 0.427 at
FT                   residue 30"
FT   gene            642647..643459
FT                   /locus_tag="PputGB1_0570"
FT   CDS_pept        642647..643459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0570"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   pen:PSEEN0598 periplasmic cobalamin-binding protein HutB"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96481"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:B0KL77"
FT                   /protein_id="ABY96481.1"
FT                   /translation="MRLLPGLLALLACTALAADPLRVVSLAPSMTEIMLELQADDLLVG
FT                   VLDGGERPAALGDLPSVGRQGQLDMERLLSLRPDLLLLWPGSVSPAQRDQLKRLGIATF
FT                   SAEPHDIDQLIEQIEAIAGRIGRAEQGHAYAQALRKRLQQLRQQYGRDEPLQVFYQVWD
FT                   RPLYTLGGRQVVSDALAVCGARNVFADLSQPAPQVSVESVLLRDPQVILAGDQAQLASW
FT                   KAWPQLRAVADGRLLVVPDKGLERPSGQMIEATARLCALLAAKAPVSR"
FT   sig_peptide     642647..642700
FT                   /locus_tag="PputGB1_0570"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.967 at
FT                   residue 18"
FT   gene            complement(643437..645323)
FT                   /locus_tag="PputGB1_0571"
FT   CDS_pept        complement(643437..645323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0571"
FT                   /product="TonB-dependent receptor plug"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: pen:PSEEN0599 cobalamine
FT                   TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96482"
FT                   /db_xref="GOA:B0KL78"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:B0KL78"
FT                   /protein_id="ABY96482.1"
FT                   /translation="MVLPMKTPTFATLLCLPLPLLATERDDALKLPDVLISASRQVESR
FT                   TATSAANTVFTRTDIDRLQPTSVTDLLTRVPGVQVAPTGGRGSLPGIFIRGTKAAQSLV
FT                   LVDGVRIANATSGDSGLQFLDVDQIERIEVLRGSRSAVYGSDAIGGVIQIFTRRSNGPG
FT                   LQPRLRMAAGSNQTFQRSLGLSGGNDATRFNLGASLDETAGIDSTGPSFDSDGDHDAYR
FT                   NRSLNLSLSHTFNERFEAGVNLLDSRGRSEYDNPYGRLDEDTWLSYPQQPYTDFSVSSL
FT                   GGWFDAQLNDAWHSRLELGHSENRDDKRDKLSDQRFIYNTYRDQVTWQNDLAFDDQNQL
FT                   MLGGDWYEERFHGTANFSEDSRWNRAAFAQYRFTGEHFSSELGVRHDRNQQYGDQTTWN
FT                   ASLTLPLNSRNDLLASYSEGFRAPTFNDLYDVQYGNPDLRPEHSKSYELQWRSQLASHT
FT                   RLEASLYRTDLRDAINYDPTLRRPGNVDNARINGFELSLLQEWAGWTSQLGVSMIDPRD
FT                   RESGHTLQRRARRTLNLDLDRQFERFSVGASWQAVSGSYDDPSNNEHIGGYGLVGLRGG
FT                   MRLTTDVELELKLDNLLDKQYSRAMYSFDGSQYGYREEGRTLLFSVTWTPVL"
FT   sig_peptide     complement(645255..645323)
FT                   /locus_tag="PputGB1_0571"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.981 at
FT                   residue 23"
FT   gene            complement(645434..647329)
FT                   /locus_tag="PputGB1_0572"
FT   CDS_pept        complement(645434..647329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputGB1_0572"
FT                   /product="deoxyxylulose-5-phosphate synthase"
FT                   /note="TIGRFAM: deoxyxylulose-5-phosphate synthase; PFAM:
FT                   Transketolase central region; Transketolase domain protein;
FT                   KEGG: pen:PSEEN0600 1-deoxyxylulose-5-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PputGB1_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABY96483"
FT                   /db_xref="GOA:B0KL79"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0KL79"
FT                   /protein_id="ABY96483.1"
FT                   /translation="MPTTFQEIPRERPVTPLLDRADTPAGLRRLAEADLETLADELRQE
FT                   LLYTVGQTGGHFGAGLGVIELTIALHYVFDTPDDRLVWDVGHQAYPHKILTGRRNRMLS
FT                   LRQKDGIAAFPRRSESEYDTFGVGHSSTSISAALGMAIAARLQNSARKSIAVIGDGALT
FT                   AGMAFEALNHAQEVNADMLVILNDNDMSISRNVGGLSNYLAKILSSRTYASMREGSKKV
FT                   LSRLPGAWEIARRTEEYAKGMLVPGTLFEELGWNYIGPIDGHDLPTMIATLRNMRDLKG
FT                   PQFLHVVTKKGKGFAPAEVDPIGYHAITKLEPADKPAAPKKVSGPKYSAVFGQWLCDMA
FT                   AADNRLVGITPAMKEGSDLVDFSERYPQRYFDVAIAEQHAVTLAAGMACEGSKPVVAIY
FT                   STFLQRAYDQLIHDVAVQNLDVLFAIDRAGLVGEDGPTHAGSYDLSYLRCIPGMLVMTP
FT                   SDENELRKMLSTGHLYNGPAAVRYPRGTGPNAPISGDLQPLEIGKGVVRRQGEKIALLV
FT