(data stored in ACNUC7421 zone)

EMBL: CP000929

ID   CP000929; SV 1; circular; genomic DNA; STD; PRO; 177878 BP.
XX
AC   CP000929; AATH01000000-AATH01000023;
XX
PR   Project:PRJNA16306;
XX
DT   13-FEB-2008 (Rel. 94, Created)
DT   01-MAY-2014 (Rel. 120, Last updated, Version 4)
XX
DE   Caulobacter sp. K31 plasmid pCAUL02, complete sequence.
XX
KW   .
XX
OS   Caulobacter sp. K31
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Caulobacterales;
OC   Caulobacteraceae; Caulobacter.
OG   Plasmid pCAUL02
XX
RN   [1]
RP   1-177878
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Glavina del Rio T., Dalin E.,
RA   Tice H., Pitluck S., Bruce D., Goodwin L., Thompson L.S., Brettin T.,
RA   Detter J.C., Han C., Schmutz J., Larimer F., Land M., Hauser L.,
RA   Kyrpides N., Kim E., Stephens C., Richardson P.;
RT   "Complete sequence of plasmid2 pCAUL02 of Caulobacter sp. K31";
RL   Unpublished.
XX
RN   [2]
RP   1-177878
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Glavina del Rio T., Dalin E.,
RA   Tice H., Pitluck S., Bruce D., Goodwin L., Thompson L.S., Brettin T.,
RA   Detter J.C., Han C., Schmutz J., Larimer F., Land M., Hauser L.,
RA   Kyrpides N., Kim E., Stephens C., Richardson P.;
RT   ;
RL   Submitted (24-JAN-2008) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 1229e34c7dd07b7b13a86addc835c2e8.
DR   BioSample; SAMN02598364.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4001606
CC   Source DNA and bacteria available from Craig Stephens
CC   (CStephens@scu.edu)
CC   Contacts: Craig Stephens (CStephens@scu.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..177878
FT                   /organism="Caulobacter sp. K31"
FT                   /plasmid="pCAUL02"
FT                   /strain="K31"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:366602"
FT   gene            complement(285..1859)
FT                   /locus_tag="Caul_5292"
FT   CDS_pept        complement(285..1859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5292"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: ccr:CC_2501 sensory box histidine
FT                   kinase/response regulator; TIGRFAM: PAS sensor protein;
FT                   PFAM: response regulator receiver; ATP-binding region
FT                   ATPase domain protein; histidine kinase A domain protein;
FT                   PAS fold-3 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5292"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74412"
FT                   /db_xref="GOA:B0T9L3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9L3"
FT                   /protein_id="ABZ74412.1"
FT                   /translation="MARTREAAEPDAEVAERLARIIELLPAGAVHVRAGVLSMNAAMEE
FT                   VTGYARAELPTLEAWFEKLYGDTSGKLIAHYLDQRAQGFPATVEGSIRRRDGEVRRIEF
FT                   RACNDSVGEIWIVNDITERDLIERDLIAAKDRAEAGARSKSEFLANMSHELRTPLTAII
FT                   GFAELLAREGSLAPQERHWLARIEDASKALHSIVNDVLDFSKLEEGAVELESEPFGLRK
FT                   LVEDTVALLADQAERKGVGLAIFVDDGLCDGLRGDTGRLRQILLNLICNAVKFTNHGGV
FT                   TIRVSEDVGAGGPPQVRFAISDTGIGIPDAALDQVFQRFVQADGSVSREFGGTGLGLAI
FT                   CRRLVELMGGEIGVESRVGSGSTFWFSVALAPAAHVEQPGAEDLAIDAGAVRLLLVEDT
FT                   EANQELVSTILRSVGVEVDIVSNGAEAVEAVQVCAYDLVLMDVHMPVMGGVQATQIIRS
FT                   LGGEFATLPIIALTANVLPAQVADYHRAGMNTHLAKPINPREMLAVIGRWAAADRAAEP
FT                   APQDLRA"
FT   gene            complement(2018..2218)
FT                   /locus_tag="Caul_5293"
FT   CDS_pept        complement(2018..2218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5293"
FT                   /product="transposase (class III)"
FT                   /note="KEGG: gox:GOX2480 transposase (class III)"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5293"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74413"
FT                   /db_xref="GOA:B0T9L4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9L4"
FT                   /protein_id="ABZ74413.1"
FT                   /translation="MRRGFLYLVAVMDWATRKVLSWRLSNSMDAEFCIQPLEEALARYG
FT                   PPQIFNTDQGSHLWTAPALQV"
FT   gene            2709..3515
FT                   /locus_tag="Caul_5294"
FT   CDS_pept        2709..3515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5294"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: nfa:nfa20070
FT                   putative recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5294"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74414"
FT                   /db_xref="GOA:B0T9L5"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9L5"
FT                   /protein_id="ABZ74414.1"
FT                   /translation="MTAITRAATAIAAVLVREGVDYAQSKAVFRAARKRAGLSAPPERR
FT                   GGVDRLTVEEELRFLDRAYAQGGRTGLMLQTLLETGARASELVQLRIEDVSLAERVVTI
FT                   REGKGGKRREIPIRRDLAQLLQLHIGARRAGPLFASRQQGSGPTPHVLTRQRIGQVVRE
FT                   VARDAGITKRVYPHLLRHTVATRLLALGMDITDLQRFLGHESITTTRLYAETTAATLQR
FT                   KFDALTDPAAHTLVAVIRQRQGDDAALLAAGLLAQRRAERVTTAGA"
FT   gene            complement(3496..3990)
FT                   /locus_tag="Caul_5295"
FT   CDS_pept        complement(3496..3990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5295"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hau:Haur_5189 plasmid pRiA4b ORF-3 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5295"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74415"
FT                   /db_xref="InterPro:IPR012912"
FT                   /db_xref="InterPro:IPR024047"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9L6"
FT                   /protein_id="ABZ74415.1"
FT                   /translation="MRRKRRSIARRPGHHCASLHLAALQLRKGARFSYEYDLNIPWAHE
FT                   VRIEGRLRPEPDAVYPTCTGGAGHCPPEDCGSPESFMAHRNDATSWEVLQEVRELADVL
FT                   GEFVLEPRPEEPDEETLWRLERAVERGKAREHAQGRPFVRRSVNARLWKGEHQVLMHQQ
FT                   W"
FT   gene            complement(4405..5673)
FT                   /locus_tag="Caul_5296"
FT   CDS_pept        complement(4405..5673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5296"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; KEGG: ccr:CC_0063 cytochrome
FT                   P450 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5296"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74416"
FT                   /db_xref="GOA:B0T9L7"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9L7"
FT                   /protein_id="ABZ74416.1"
FT                   /translation="MSDGAIDLRAEARAKAYAMPLEDINLADTELWRTDTVWPYLERLR
FT                   KEDPVHLHPAHHHPDGAFWSITKYADIMAVDINHEVFSSEPSITIFDPKEDFTLPMFIA
FT                   MDPPKHDVQRKTVSPIVSPANLHLMEPLIRSRITKTLDELPIGEPFDWVDRVSIELTTQ
FT                   MLATLFDFPWDERRKLTRWSDIATAVPESGLFVTDDYETERRMELFGCVDYFTRLWNER
FT                   VNAPPKGDLISMLAHGEATRNMDRMEYLGNLLLLIIGGNDTTRNTMTGSILAMNQNPDQ
FT                   LRKLRENPSLIPSMVSETIRWQTPLSNMRRTATQDFELGGKLIKKGDKVLIWYASGNRD
FT                   EEAIENPEAYIIDRERPRNHLSFGFGIHRCVGNRLAELQLRILWEEILPRFPEIQVLED
FT                   PQRVPSVLIRGYSSMPVMIPARS"
FT   gene            complement(5701..7359)
FT                   /locus_tag="Caul_5297"
FT   CDS_pept        complement(5701..7359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5297"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   pla:Plav_1781 cyclohexanone monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5297"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74417"
FT                   /db_xref="GOA:B0T9L8"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9L8"
FT                   /protein_id="ABZ74417.1"
FT                   /translation="MKTQPTVPPEIHAAEEVDVVVVGAGFTGLYQLHRLRQLGFSVRLL
FT                   EAGADLGGIWYWNCYPGARVDTHVPMYEFSSEDLWRDWTWTERFPAWDELRRYFHYVDQ
FT                   KLDLSRDIRFNTRVEGAEFDRDRNQWVVSILDGGAVRARFLVLCTGFAAKPYIPDIAGL
FT                   ERFEGVKHHTAWWPQDGLDMTDKRVGVIGTGASGVQVVQEAARVAAQLTVFQRTPILAL
FT                   AMQQCSLDEATQRDMKRDYPARFARRRESFGGFDFHASGKSALEVSPEERQDIYEASWA
FT                   AGGFSFWASTFYDVMMNLEANRTAYDFWREKVQKRIRDPKLAEKLAPKQPPHPFGVKRP
FT                   SLEQTYYDVFNQDNVELVDLKETPILEVTPGGVKTAEREYELDLLVLATGFDAVTGGLT
FT                   QIDIRGVEGLTLKEKWAKGARTHLGMASAGFPNLLFLYGPQSPSGFCNGPTCAELQGDW
FT                   VVEFLGRMRDAGVSRFEATTAAEQTWKDHVEAVGAMTLFPLADSWYMGANIPGKPRELL
FT                   NYPGGVPLYLQMCQASADKGYEGFVLGTRGARHLD"
FT   gene            complement(7364..8974)
FT                   /locus_tag="Caul_5298"
FT   CDS_pept        complement(7364..8974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5298"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   pla:Plav_1759 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5298"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74418"
FT                   /db_xref="GOA:B0T9L9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9L9"
FT                   /protein_id="ABZ74418.1"
FT                   /translation="MTWNFGDILDALPKALPADAPAFIHGDRTITWGETSRRSNNLARA
FT                   ILARGAKPGDKVAFYMRNRPEYGEALAACFKGRLTHVNVNYRYKPNEVFYIFDDSDAQT
FT                   VIYGSEFRDTILQLKDRLSKVATFIEIGDDDPPAPFSERYEDLAATGEGAPLGIERSPD
FT                   DLLFIYTGGTTGMPKGVMWRHEDMREAQLDAVRRLGPAPETLDAHLDFVRAAGPGSRTL
FT                   PACPMMHGTGLITAIGCMMNGGCVVTLQNASFEADELWSVVARHRVQSIALVGDAFAKP
FT                   MLKALDEQRGRYDTSSLVSIVSSGVMWSREVKSGLLGHIPQVVLMDSFGASEALGFGSS
FT                   AMTKDGEVKTATFQIGARCKVFDEEENLVEPGSGMAGIIAIGGPIPLGYYKDPEKTAKT
FT                   FRTIAGQRYSIPGDWCTVEADGAMTLLGRGSACINTAGEKVYPEEVEEALKTHPDIEDA
FT                   LVVGVPDDKWGQAVTGVVVLASGVTFDEDDVRRHVRASLAGYKTPKHILLTQVPLRASN
FT                   GKADYKTVTEFARRDLGLA"
FT   gene            complement(8986..10074)
FT                   /locus_tag="Caul_5299"
FT   CDS_pept        complement(8986..10074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5299"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: pla:Plav_1806
FT                   acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5299"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74419"
FT                   /db_xref="GOA:B0T9M0"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9M0"
FT                   /protein_id="ABZ74419.1"
FT                   /translation="MEFGLSSEQRMLQDAVARYLAEQSPLRHVRDIAAAAKPYSPDVAA
FT                   GLADLGVPGVIIPPEFGGMGLGLLEAALVAETLGFSVAPAHFAGAHVMAPLAILLGGSD
FT                   SQQQAWLPQLATGAARAAVAVSQAVEVRDGVGVVARDGWLDGTALFVLDAADADLFVVA
FT                   DTTGALHLVAADAPGLTQIPLTTIDKTRSVGELRMTGVKADPLPGGGGRTTRRIIDAGR
FT                   IMLAADILGAGTAMIEQAVAYAGTRVQFGRPIGSFQAVKHMCAEMAAALEPCRSLVWYA
FT                   AHAFDHAPDESTLMACHAKSHLSEVGRFVARTSTEVHGGMGFTDLAGLHYWFKRIGLDR
FT                   QLLGGPELVRNEAARVQGWIAA"
FT   gene            complement(10074..11282)
FT                   /locus_tag="Caul_5300"
FT   CDS_pept        complement(10074..11282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5300"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   pla:Plav_1805 acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5300"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74420"
FT                   /db_xref="GOA:B0T9M1"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9M1"
FT                   /protein_id="ABZ74420.1"
FT                   /translation="MDLTYSAEHQAFRREVLVFLEAHRHAAPKGGGAAQRPSAEAVAWQ
FT                   KLLIAHGYAARTIPKEYGGYGAAPDILKSRIIGEEFARTGVPPGLQSQGISMLVPTLLE
FT                   LGTEDQKRQWIGPTIHGEVIWCQGYSEPGSGSDLASLQTRATEDGDDFVINGQKIWTST
FT                   AREADMIFCLVRTEPDKGKHDGISYLIFSMKTPGIEVRPLVTMTGHAEFNETFFTDVRV
FT                   PKSQIVGKRGQGWFVANATLKHERGMLGDPGQLESRFLALAELMRTETAGDGRIMDNPI
FT                   LRDRLLRLQAELAAMKFNGLRVLSASANGGEAGLARLIVKLQSCELAHQISALAIDALG
FT                   ELGVLYDGSPHLRSHGSWQQAYMFQLGLIIGGGTAQIQKNIIAERGLGMPREPKPTTEG
FT                   SRS"
FT   gene            complement(11332..11763)
FT                   /locus_tag="Caul_5301"
FT   CDS_pept        complement(11332..11763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5301"
FT                   /product="protein of unknown function DUF35"
FT                   /note="PFAM: protein of unknown function DUF35; KEGG:
FT                   pla:Plav_1804 protein of unknown function DUF35"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5301"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74421"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9M2"
FT                   /protein_id="ABZ74421.1"
FT                   /translation="MQPPTIPAPLPRTQDPMDDAFWRQCQDGRLRFQRCSDCGAWRFLP
FT                   RYMCARCGSPDFAWAPVRGTGSLYSWTVTHQALHPAFAGEIPYVAALVELDEGVRMASR
FT                   LLNCDRNALQLGIRVELIFRELGDGFRLPCFQPSEQLAR"
FT   gene            complement(11769..12935)
FT                   /locus_tag="Caul_5302"
FT   CDS_pept        complement(11769..12935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5302"
FT                   /product="putative nonspecific lipid-transfer protein"
FT                   /note="KEGG: pla:Plav_1803 putative nonspecific
FT                   lipid-transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5302"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74422"
FT                   /db_xref="GOA:B0T9M3"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9M3"
FT                   /protein_id="ABZ74422.1"
FT                   /translation="MSFSDKAAIVGIGETEYVKGSERTAVDLMLEAARKAIADAGLKPS
FT                   QIDGMVPPPIYTSSEELAANLGVDVLRYASTVHMGGASPTTALQNAATAVAAGVADNVL
FT                   VVLGWNGYSALRPKPGRPPQRAMNMNTLTRTIQGFYMPYGVMMPAQMYSWIAMRHKHLY
FT                   GVPDEAMGEVALACRAHAQLNPRAVTYGQPLDMDAYLGARWISEPLRLYDCCLETDGAC
FT                   AVVVTSAERARDMPHRPVLIAGAAEGHPYPADDIPSRPDMLKIGLSYAAPRAFEMAGVT
FT                   ARDMDFLQVYDCFTYVVLLQLEALGFSAPGGIYDFVKDGQIQLGGRYPLNTHGGLLSEA
FT                   HVWGLNHVLEAVRQLRGDAGARQVPGARIGLVTGWGDLGDGSLAILRT"
FT   gene            complement(12992..14086)
FT                   /locus_tag="Caul_5303"
FT   CDS_pept        complement(12992..14086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5303"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   pla:Plav_1802 alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5303"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74423"
FT                   /db_xref="GOA:B0T9M4"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9M4"
FT                   /protein_id="ABZ74423.1"
FT                   /translation="MIPAKTFAMVQTAPRTLEMRDLPIPDIEADSAILRIEACGICGSD
FT                   YEQFEGVLKTPMPVIPGHEPVGIIEAIGDKAARRWGVDVGDRVAVETMLSCHSCDTCLG
FT                   GRYHLCADRQIYSYIPLSNMPGLWGAYAQYMYLAPNTIVHKMDKTLPPELAVMFNPLGA
FT                   GFRWAVEIPQTQVGDTIVILGPGQRGLASVIAARQAGAGKIIVTGMAADARKLDLARIF
FT                   GAHHTIDVQNENAIERIKELTGGRGADVVVEVTSYATDPVREALSYVRPGGTIVLAGVK
FT                   GFKPIPDFVSDLIVFKEITIKGAIGVTSSGYRKAIDLIEARSLPLELMHTHDFELKDAE
FT                   LAIRTLARQVTGDESIHSCLIPPT"
FT   gene            14233..14808
FT                   /locus_tag="Caul_5304"
FT   CDS_pept        14233..14808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5304"
FT                   /product="Carboxymuconolactone decarboxylase"
FT                   /note="PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   pla:Plav_1801 carboxymuconolactone decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5304"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74424"
FT                   /db_xref="GOA:B0T9M5"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9M5"
FT                   /protein_id="ABZ74424.1"
FT                   /translation="MTADAPRIDLLSLEEAANAAGSAGISEQMAPLSVFRVLLRHPAVA
FT                   GELASTLTTLLFRGNKLDARLRELIIMRIGWRTGSVYEWTQHWRVARGLDIPEADLAAS
FT                   RDWRGAANLSEADRAVLQATDDTLDQGMISDAAWEACCLHLATDAERIELVVAIGNWTM
FT                   FSQLLKSLRIPLEDGVEAWPPDGQAPRT"
FT   gene            14838..15689
FT                   /locus_tag="Caul_5305"
FT   CDS_pept        14838..15689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5305"
FT                   /product="3-alpha,7-alpha,
FT                   12-alpha-trihydroxy-5-beta-cholest-24-enoyl-CoAhydratase"
FT                   /EC_number="4.2.1.107"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   pla:Plav_1800 3-alpha,7-alpha,
FT                   12-alpha-trihydroxy-5-beta-cholest-24-enoyl-CoAhydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5305"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74425"
FT                   /db_xref="GOA:B0T9M6"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9M6"
FT                   /protein_id="ABZ74425.1"
FT                   /translation="MTRIPISSDLVGLELPATTQTWTSKDTMLYALGVGGRPAEDLDFI
FT                   YEGRGPKVLPTYAVIPGGGALGGLMRTVDMRLEMLLHGEQSIELFRPLPPEASVEVSGR
FT                   ITEVWDKGKAAVLGVEGVARDADGDLFRTHATLFVRGAGGFGGERGPSGGDSAAPDRAP
FT                   DITASFQTRPEQGAIYRLSGDRNPIHIDPAFARMGGFDAPFMHGLCTYGIVGRAILREL
FT                   CADDPGAFHSFQGRFADRVLYGDTIVTKIWRTGDGEAIVQGETADGRIVLSQARAKFAV
FT                   PA"
FT   gene            15698..17734
FT                   /locus_tag="Caul_5306"
FT   CDS_pept        15698..17734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5306"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase;
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; HI0933 family protein; KEGG: pla:Plav_1799
FT                   NADH:flavin oxidoreductase/NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5306"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74426"
FT                   /db_xref="GOA:B0T9M7"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9M7"
FT                   /protein_id="ABZ74426.1"
FT                   /translation="MSPYPHLLSPLNLGFVTLPNRTLMGSMHTGLEEAPDGYDRQARFF
FT                   ARRAQGGAGLIVTGGVSPNEAGRLGRNGAVMREAAVAGHGRITSAVHQSGGLIVLQLLH
FT                   AGRYARHEGLVAPSPIASRINPLTPRELTEEEILATIEDFANAAMLAKEAGYDGVEIMG
FT                   SEGYLLNQFLAPRTNQRTDRWGGSAANRQRLPTEIVRAVRARCGDEFILVYRQSLLDLV
FT                   EGGSTFDEVVDQAKTVAAAGANLVNTGIGWHEARIPTIAHMVPRGAFAWAAARLRSHLN
FT                   LPVVASNRINTPELADRLIGDGNADMVSMARPFLSDPDFVAKARAGRRAAINVCIGCNQ
FT                   ACLDNAFTGQLTTCMVNPAACREAEFGDVAGPIEPKRVAVVGAGPAGLAAAVTSAERGH
FT                   RVTLFEMSERIGGQFNLARRIPGKEDYAETIAYYGARLSELGVEVRLGTLARAQELLAA
FT                   AYDHVILATGVEPRALDSVGVDDPRVLTYAQAIEMPERAGDTVAILGAGGIGFDVAQLL
FT                   AHPTGAGDPTEPDIEGFSRDWGIDTAFTECGALQRPPTSWPAARRVTIFQRKPGSAFGA
FT                   GLSKTRGWANVQEVARRGVAMTGDVVYGHLSLEGLHITVGGIPRLVVADTFVLCIGQEP
FT                   QAGIAPALAAGRVPYSLVGGARDAAGLDAVRAIEEGTRAALTI"
FT   gene            17757..18524
FT                   /locus_tag="Caul_5307"
FT   CDS_pept        17757..18524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5307"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; KEGG: pla:Plav_1798
FT                   regulatory protein IclR"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5307"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74427"
FT                   /db_xref="GOA:B0T9M8"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9M8"
FT                   /protein_id="ABZ74427.1"
FT                   /translation="MPKPDQSVVKSAARTLEIFEYFDEVRRPAHIQDVALALGYPHSST
FT                   AALLRSLADLGYLEFSSDDKTFFPSIRVSLLGHWVGDEILPLRRIQQQMRDIAEQTQMT
FT                   VVLGAASGGYCQYVRVIEGATPIRYHVKAGTRRCLARSTLGRVLLAMAPPDRRARLIAE
FT                   GLAVWDGDEAPPPAEGVARDVAQVAARGHAFHAGLVNDNAAMLAIPLSVSPPAHPLALG
FT                   LAAPKDLFRGRRAELLKIIGDVLGSPGPAHKTA"
FT   gene            complement(18539..18982)
FT                   /locus_tag="Caul_5308"
FT   CDS_pept        complement(18539..18982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5308"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   pla:Plav_1780 thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5308"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74428"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9M9"
FT                   /protein_id="ABZ74428.1"
FT                   /translation="MIPRRMPEFHAEMVEAFMASSNRMTGLPEFLGLRIVAMEPGGLTA
FT                   EMAVDPKLLTGFGNMHGGVLSAACDHVLGCVCYPHMEKGQWAATTEFKINLLAPVSRGT
FT                   VTAHAEIISMSKQTAVVRIEMENEGRLCCSAQGTVLIQNPRPA"
FT   gene            complement(19001..20143)
FT                   /locus_tag="Caul_5309"
FT   CDS_pept        complement(19001..20143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5309"
FT                   /product="2-nitropropane dioxygenase NPD"
FT                   /note="PFAM: 2-nitropropane dioxygenase NPD; KEGG:
FT                   pla:Plav_1779 2-nitropropane dioxygenase NPD"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5309"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74429"
FT                   /db_xref="GOA:B0T9N0"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9N0"
FT                   /protein_id="ABZ74429.1"
FT                   /translation="MALHSRICEIFGIRYPIVLAGMGGASVPRLAAAVSNAGGLGILGA
FT                   AACSPEELRAWIREVRSLTDKPFGVDTLLPASVRREVVDAAAGSGEGGKPSPMDLLGDY
FT                   QAFAADFMRQEGLQKVVRPREDTNAEARGGPAFFSKEFFEAQMEVVIEEKVPVYAAGLG
FT                   NPGPWMERLRENGTKIMAVIGSVKHALQVAASGIDVVVAQGHDGGGHNSPIGTMALIPQ
FT                   VVDAMAGRIPVLGAGGIADGRGVAAAMMLGAEGAWVGTAFLATEEAGIQQFQKEVLVEY
FT                   GDGDTVVSKSVTGKPARIIRNKWAQAWVDAEKSPLPMPFQSIIAGPVLAAATLDQRKDI
FT                   APGFAGQGMGLIKAIRPARDVLEDLVSGAETALARADRFR"
FT   gene            complement(20193..21002)
FT                   /locus_tag="Caul_5310"
FT   CDS_pept        complement(20193..21002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5310"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   pla:Plav_1794 enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5310"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74430"
FT                   /db_xref="GOA:B0T9N1"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9N1"
FT                   /protein_id="ABZ74430.1"
FT                   /translation="MSDVVTFERKDHVALITLNRPEARNAISPEMLVRLADTWTAVRDD
FT                   PDIRVAVVTGAGDKAFCSGADLGRFIPLMSRARPPEDEWDRRLLADGEMLGRGLLRTFD
FT                   VVKPVIAAINGHAIAGGMELAQGTDLRVASESAKFGVQEVKWAIFPGGGSTVRLPRQIP
FT                   YARAMELLLTGDLITAAEALELGFLNRVVPQADVLPTALDLAERIAANGPIAVQAIRRS
FT                   ARACLGRPEAEAMQIESEMAAPVFRTEDAREGPLAFMQKRKPVFQGR"
FT   gene            21168..22025
FT                   /locus_tag="Caul_5311"
FT   CDS_pept        21168..22025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5311"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: pla:Plav_1777
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5311"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74431"
FT                   /db_xref="GOA:B0T9N2"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9N2"
FT                   /protein_id="ABZ74431.1"
FT                   /translation="MTEPHRTVFRTADGLDLVADRYGAPIRGGVLLAHGGGQTRHAWAK
FT                   TAAALADRGWEAVALDLRGHGDSGWSPTGDYQMERFAGDLATVANEMGGRPALIGASLG
FT                   GLAGLLAEAEIAPRSFSSITLVDIVPNMDMDGAAKVMGFMSAHIGEGFASLEEAADVIS
FT                   SYLPHRPRPSNLSGLAKNLRCGGDGRYRWHWDPSFVASANRERSRRDAQAFDAGLASLA
FT                   LPVHLIRGRLSELVTREAAEDFVATVKNAQFTDVAGASHMVAGDRNDAFLDAVVGFLDR
FT                   LEPV"
FT   gene            22446..22859
FT                   /locus_tag="Caul_5312"
FT   CDS_pept        22446..22859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5312"
FT                   /product="integrase/recombinase"
FT                   /note="KEGG: mlo:mlr5973 integrase/recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5312"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74432"
FT                   /db_xref="GOA:B0T9N3"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9N3"
FT                   /protein_id="ABZ74432.1"
FT                   /translation="MVSTGISWPALNQTVCARRFFYGVTLGHGEIPERIVYAREPRKLP
FT                   VVLGTDEVVHFLEAVPSLKTRVALTTAYAAGLRASEAGSLKVGDVDSGRMVIRVEHGKG
FT                   GKDQYVMLSTQILSILRAVPPLGSIFGQFLRSS"
FT   gene            complement(22877..23230)
FT                   /locus_tag="Caul_5313"
FT   CDS_pept        complement(22877..23230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5313"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG: ccr:CC_2576
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5313"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74433"
FT                   /db_xref="GOA:B0T9N4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9N4"
FT                   /protein_id="ABZ74433.1"
FT                   /translation="MSADSRHGLIIEDEMLIALEIEAHLRHLGFLSFDIADSPQEALIL
FT                   ARGHRPDLITADYRILEGTGPQAVEAILTEIGVLPVIYVTGNVDMVRGLGFPVVEKPIV
FT                   YAALEAAVDAATP"
FT   gene            complement(23376..23696)
FT                   /locus_tag="Caul_5314"
FT   CDS_pept        complement(23376..23696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5314"
FT                   /product="type IV pilus assembly PilZ"
FT                   /note="PFAM: type IV pilus assembly PilZ; KEGG:
FT                   bbt:BBta_7466 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5314"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74434"
FT                   /db_xref="GOA:B0T9N5"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9N5"
FT                   /protein_id="ABZ74434.1"
FT                   /translation="MERRRAPRQRTFLAGRLAYGDPAVTISCGIRNLSPAGARIELESP
FT                   VLLTLSVRLLVPRDGVAHDATVIWRRGAQVGLALTGAHDLRDSVDEQIRTLQAIWKEMA
FT                   LR"
FT   gene            complement(23833..24267)
FT                   /locus_tag="Caul_5315"
FT   CDS_pept        complement(23833..24267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5315"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG: ccr:CC_0588
FT                   chemotaxis protein CheYI"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5315"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74435"
FT                   /db_xref="GOA:B0T9N6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9N6"
FT                   /protein_id="ABZ74435.1"
FT                   /translation="MTQPEARKGRVFVAEDDRGVLDLIVTRLTLAGYDTAYGRDGWEAV
FT                   QGIQQTRPAAVVLDINMPNLDGFGVLDALRKKPPLAPIPVMVLTARNAPGDVQRAMALG
FT                   ARDFLTKPFDDVQLLARIARLLRPRPRVAARTPSSPLLIL"
FT   gene            complement(24254..27463)
FT                   /locus_tag="Caul_5316"
FT   CDS_pept        complement(24254..27463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5316"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: ccr:CC_0652 sensory box histidine
FT                   kinase/response regulator; TIGRFAM: PAS sensor protein;
FT                   PFAM: response regulator receiver; GAF domain protein;
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; PAS fold-3 domain protein; PAS fold-4
FT                   domain protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein; PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5316"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74436"
FT                   /db_xref="GOA:B0T9N7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9N7"
FT                   /protein_id="ABZ74436.1"
FT                   /translation="MREAEARRLEALRIVEALNRPPQERFGLVTALAADLFKTPLALVS
FT                   LTEIEGSSPLSTPAVAANSPPQAWTLSAEALGMGPNALLVVEDAATDRRFATDPLVTGA
FT                   AHIRFYAGVVLTTRDGRTLGTLCVIDTKPRRRPTPAKLDRLKMLARIVVDELELARAHR
FT                   LASEKQRLLELTESVSGVGHWRIEVGAGDVGWSDMVYTIHGVSREDFEPDLRNSLALYH
FT                   PDDRAKLTACVREAVAAKGSFEAQLRINRPDGEIRDVISRGVCELDEHGEATAVFGVFQ
FT                   DITDQTRILNAIKRSERRYKLLADNMSDVVTRIRLDGGSGYISPTIERLLGYRPEEMTG
FT                   RSAQDFVHQDDRSQILAIFGQMAQGLEQKTLQHRAIHKDGRTVWVETSFRLVRDEQDQP
FT                   LEIVAVIRDATDRKALEDATIAARDEAREQAQRAATAERMAGLGHWRLEVATRSVTWSE
FT                   QMYQIYGLDPALPLDLDALLAMTHPDDQAESSQRLHRALTTGQPTMEAVFRLIRADGQL
FT                   RDITGNMLVQKDADGQVIAVVGTMSDVTEQQHAQAALAQSEARYRLLAENASDLIMHSD
FT                   VKGQVTYVSPSILPTTGYAPEALVGTNILDWIAPEDVPGVQAAVAKQFKSRGAEPPIAV
FT                   EYRVRHKDGRELWLEARPTLAFDPETGAITGITDVVRDISARRVLEAELRAARAEAEAA
FT                   AAVKSEFLANMSHELRTPLTAVLGFSRLAEEQPELSDTTRGYLKRACNAGQALLLTVND
FT                   ILDFSKLEAGQVEIAPRPMSPAKLATETLDLFATQAAEKGIALHLGGLETLPRTVRADP
FT                   DRVRQILLNLIGNAVKFTMVGSVRVDAIFEPLGGFLSFAVTDTGPGVPEDRADQLFQRF
FT                   SQVDASSTRKHGGTGLGLAICKGLAEAMGGDIGAQSKVGEGSCFWFTIPAPELDVAAPI
FT                   AAPPQGQIMLPAGCRILVADDNRINRDLVRAMLSPFDVELTEVVDGLGAVAAANAAPFD
FT                   VILMDLRMPGLDGAGAARCIRTEDGPNATIPILAFSADVDQAQATGLFDGMVGKPLTGV
FT                   NLLTAIAKAMAWPEDPLDDAA"
FT   gene            complement(27883..28803)
FT                   /locus_tag="Caul_5317"
FT   CDS_pept        complement(27883..28803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5317"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG: ccr:CC_2742
FT                   IS511, transposase OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5317"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74437"
FT                   /db_xref="GOA:B0T9N8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9N8"
FT                   /protein_id="ABZ74437.1"
FT                   /translation="MVGPAAVREGVAHLRTVFEISERRACSIVKADRKMVRYRSRRAPD
FT                   TELRERLRSLAAERRRFGYRRLFVLLRREGEPSGKNRIYRLYREEGLPVRKRRARRRPI
FT                   GTRAPILVEAKANARWSLDFVHDQFAGGRRFRVLNVVDDVTRECLAAIPDTSISGRRVA
FT                   RELSALIARHGRLGMIVSDNGTEFTSTAILAWAEDHRVAWHYIAPGKPTQNGFVESFNG
FT                   RMRDELLNETLFFSLARQKLAAWAEDYNTRRPHSSIGYQTPAAYAAHLNATGRPAAQCR
FT                   NSTARPVAPTAPSGVTNAETLVRAG"
FT   gene            28970..29395
FT                   /locus_tag="Caul_5318"
FT   CDS_pept        28970..29395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5318"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: acr:Acry_3499 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5318"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74438"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9N9"
FT                   /protein_id="ABZ74438.1"
FT                   /translation="MLAGQLARLRPSLVLPQDPDDLLFRKSRSLHVRPLKGRTLAPRGG
FT                   KNQGQVTSNVASLINYGERYRSGERISSAFVEATVNAVVSKRFAKKQQMQWSRCGAHLL
FT                   LQARTKTLDGTLRSTFERWYPGLANDNDQRLILAQTA"
FT   gene            complement(29529..29942)
FT                   /locus_tag="Caul_5319"
FT   CDS_pept        complement(29529..29942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5319"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   rrs:RoseRS_0761 two component transcriptional regulator,
FT                   winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5319"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74439"
FT                   /db_xref="GOA:B0T9P0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9P0"
FT                   /protein_id="ABZ74439.1"
FT                   /translation="MSVRSRILVAEDDLGVRDLIRTRLEMAGYDVHTARTGAEAVGRVR
FT                   ELRPDAMVLDINMPEMDGFGVLEALKAYSGAKRIPVLVLTARHTAEDVRRAVGLGAKDY
FT                   LTKPFSESQLLARVARLLRPPISTAPNESELLV"
FT   gene            complement(29932..32643)
FT                   /locus_tag="Caul_5320"
FT   CDS_pept        complement(29932..32643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5320"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: ccr:CC_0652 sensory box histidine
FT                   kinase/response regulator; TIGRFAM: PAS sensor protein;
FT                   PFAM: response regulator receiver; ATP-binding region
FT                   ATPase domain protein; histidine kinase A domain protein;
FT                   MHYT domain protein; PAS fold-3 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5320"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74440"
FT                   /db_xref="GOA:B0T9P1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005330"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9P1"
FT                   /protein_id="ABZ74440.1"
FT                   /translation="MFKILLCVATEHNWWLVVVAALVCVPATLATFFLYSKVPTFPVWR
FT                   RWTWLAMTGLVAGSGIWTTHFVAMLAFKTGLPTGYEALATMGSLAVAVISTTLGFAAGS
FT                   ATTADSRRRLTSIGGGLVVGLGITSMHYVGMSGYRTTGVFQWDVNYIVASVLIGALFAS
FT                   AALFVARPGAGLKQQAAGGGLLSLAIVGMHFTGMTAVTIVPDLSIAVPASLMSDPVMAA
FT                   VAVAVTALILITAIGGVALDAASRNGNLRRLREALDVMPEGLAFYDANDRLVAWNTQYD
FT                   DLCRTSGAILVAGMPFSDLLESSLVHGVYPEAVGRETEWLAERNAARRDEAPSLTQQTA
FT                   GGRWLRITERRTGDGGTVSVSVDITDLKRTEAAMAQARDKAEEQARRAEVAEGVAGLGN
FT                   WRVDARTRDVTWSTQMYHIFGLASDAPLDLEALIGMIHPDDAEAVAARLKRQLATGEVD
FT                   ENSISRIVRANGEVRYLARNSRAEHGPGGEVIAMIGTMVDVTDQKLLEARLRLARAEAE
FT                   AAAGVKAEFLANMSHELRTPLTSIIGFTSLAAEQSDLTDLTRTYVERVGDASRALLCTV
FT                   NDILDFSKLEAGQVSFQVQPASLAKLSRATLDLFTPQAGAKDLNLTLDGEAADDDLIIA
FT                   VDPDRIRQILLNLVGNAVKFTTGGSVTLRTRYDRAAEVLSVDVIDTGEGVAPDKQDRLF
FT                   KRFSQVDGSLTRVQGGTGLGLAICKGLVEAMGGEIGVESRMGEGSRFWFKVPAPLSSLS
FT                   QGNTDGLAMERLTFGGVRVLVVDDHPTNRELARLFLAGVGAEVSEAVDGEEAAQMAAEW
FT                   PYDVILMDLRMPRLDGLGALRRIRASQGPNDATPILAFTADADTNMADRLISAGFQDVV
FT                   AKPVGAGALIASIARATAFAEDPQPQEFADVG"
FT   gene            complement(32984..33238)
FT                   /locus_tag="Caul_5321"
FT   CDS_pept        complement(32984..33238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5321"
FT                   /product="putative sensory transduction regulatory protein"
FT                   /note="KEGG: sme:SMa0114 putative sensory transduction
FT                   regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5321"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74441"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9P2"
FT                   /protein_id="ABZ74441.1"
FT                   /translation="MAVDLVRTQRFDAALLDSNLDGHRSHPVAGALAARGVPFALATSH
FT                   GGHGLRDIDRDRPLLLKPFRYEVLEEILAGPLSPVGTKK"
FT   gene            33469..33762
FT                   /locus_tag="Caul_5322"
FT   CDS_pept        33469..33762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5322"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pde:Pden_0100 MobA/MobL protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5322"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74442"
FT                   /db_xref="InterPro:IPR005053"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9P3"
FT                   /protein_id="ABZ74442.1"
FT                   /translation="MLTTREVVPEGPGAPGAFGKKDREWNSTDLLTDWRERWAEHVTER
FT                   LAELNIDARIDHRTLEAQGIDLEGLPVNSAPKVTLRKSWNFNVLCDHGGIAH"
FT   gene            complement(34453..34803)
FT                   /pseudo
FT                   /locus_tag="Caul_5323"
FT   gene            complement(34800..35120)
FT                   /locus_tag="Caul_5324"
FT   CDS_pept        complement(34800..35120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5324"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mag:amb3304 transposase and inactivated
FT                   derivative"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5324"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74443"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9P4"
FT                   /protein_id="ABZ74443.1"
FT                   /translation="MIVDVETSAAARPAELTAVRTMIERVQERHDLHPDRLAADTGYSS
FT                   NETLEWLVNHHGIAPTSRPSTSLAGPAGPSPETTPPMIRRRPISLSGRQGPEAISASLP
FT                   RR"
FT   gene            35258..35851
FT                   /locus_tag="Caul_5325"
FT   CDS_pept        35258..35851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5325"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gox:GOX1322 transposase (class I)"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5325"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74444"
FT                   /db_xref="GOA:B0T9P5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9P5"
FT                   /protein_id="ABZ74444.1"
FT                   /translation="MSRRCGAIDQDKQNAILEAALDVAGSARPSLAAIASTAPVSRQTA
FT                   HKQFGGAPGLKRAVLNWCRAALRDPLVAAFALMRLPPGRLLLPDFRQGRVPFDLAQLSC
FT                   RHHGQVERMNLTIKEATVKRFRYDSHDQLRMHLADFMAAYNFARRLKTLNGLTPYEYIA
FT                   KKLGFRARAIHPRSDPQDAGTERWNKANELFAAA"
FT   gene            35963..36910
FT                   /locus_tag="Caul_5326"
FT   CDS_pept        35963..36910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5326"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   bra:BRADO4092 conserved hypothetical protein; putative
FT                   metallo-beta-lactamase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5326"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74445"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9P6"
FT                   /protein_id="ABZ74445.1"
FT                   /translation="MIPHFKIAAAGMVLSAVLASGAWSKTGEAKAPAVPASATPAVSED
FT                   VARFKIGSLEAISLRDGGLTVPNDNKVLGVGRTPEEVAAVLTGAGAPGETISLSIQPLL
FT                   VRTGERLVLIDTGVGSGMGGAGGKLHSSLTAAGVDPADITEILISHSHGDHVGGLVGAD
FT                   GKLLFPNAVIRIEANEWDFMQANAELKSVVDAILPKIQVFRYGSEVAPGITAVEIAGHT
FT                   PGHSGFEIVSGAEKLLYIGDAMHSSIISVQKPDWQIQFDNDAPVATASRIALDERAAAN
FT                   NLRLYGYHFAYPGVGRIEKTGDTYRWVPEAAPAN"
FT   sig_peptide     35963..36037
FT                   /locus_tag="Caul_5326"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.935 at
FT                   residue 25"
FT   gene            37119..37520
FT                   /locus_tag="Caul_5327"
FT   CDS_pept        37119..37520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5327"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vei:Veis_2691 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5327"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74446"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9P7"
FT                   /protein_id="ABZ74446.1"
FT                   /translation="MGENLWGRAKSPFLLASPNAYNALGVGTTQLHNKTVVYNHKRHGK
FT                   FALGGRTYDFRMKPAFPKKLSREFLLVDLVNNLDQLGEDPREVLERVKDRLSSSDTARL
FT                   KKAAQTYGSERAKKFFARALAEVGVQDAA"
FT   gene            37510..37761
FT                   /locus_tag="Caul_5328"
FT   CDS_pept        37510..37761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5328"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vei:Veis_2690 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5328"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74447"
FT                   /db_xref="InterPro:IPR014942"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9P8"
FT                   /protein_id="ABZ74447.1"
FT                   /translation="MPPDFLHNHRQFGDLIRIVGANEKIEPALIEKDYWIMQSLYGLQQ
FT                   MGLTFELKGGTSLSKGYCFINRFSADIDNPAQVKSLEQ"
FT   gene            37901..39124
FT                   /locus_tag="Caul_5329"
FT   CDS_pept        37901..39124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5329"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_PF00561 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5329"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74448"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9P9"
FT                   /protein_id="ABZ74448.1"
FT                   /translation="MYPRHAIDRIREALSDTRVVLLAGPRQAGKTTLARSLAEAGRTYL
FT                   TLDDATTLSAAKADPAGLVRGLDKAVIDEVQRAPDLLLAIKDSVDRDTRPGRFLLTGSA
FT                   NLMTLPRVADSLAGRMETIRLMPLAQSEILGQPASRFLASLFAGQAPPPGPPRLGADLI
FT                   DLVLAGGYPEALARKTWARRQDWYANYIEAVVGRDVRDIANIDQLDRMPRLLRALAEHS
FT                   GQLINHAGVGASLDLNHVTTQKYTGVFEQLFLVRTLPPWHNNALKRLTKKPKLHFLDSG
FT                   LLAALRGLTPERVAADRSNFGAVLETFVFAEVLKLTGWSDERFSLSHFRDKEQDEVDIV
FT                   LEDRQGKIVGLEVKGSATVRSEDFAGLRKLAQAVGDRFAFGAVLYDYEQVVPFGERLAA
FT                   APLSSLWG"
FT   gene            complement(39121..40083)
FT                   /locus_tag="Caul_5330"
FT   CDS_pept        complement(39121..40083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5330"
FT                   /product="P-type conjugative transfer ATPase TrbB"
FT                   /note="TIGRFAM: P-type conjugative transfer ATPase TrbB;
FT                   PFAM: type II secretion system protein E; KEGG: rso:RSc2584
FT                   probable conjugal transfer protein TrbB"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5330"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74449"
FT                   /db_xref="GOA:B0T9Q0"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR014149"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9Q0"
FT                   /protein_id="ABZ74449.1"
FT                   /translation="MPQHHPVVTDRKVAALKQAMGPVIASALADRMVVEVMVNPDGKIW
FT                   VDRIGEGRSFTGQSLASADADRILRLLADHVGEVVTRDRPRVSATLPETGERFQGAFMP
FT                   IVSSPAFAIRKRPEVVFTLPEYVDQGIMTEHQAQVIRAAATGRQNILIVGGTGSGKTTL
FT                   ANAILAEPAFAQDRVVLIEDTAELQCSAEDKIQMLTKRTDPPVTMTDLVRDTLRLRPDR
FT                   IIIGEVRDGSALDLLKAWNTGHPGGLATIHANSALEGLTRLEDLIGEVTHRIPYRAITQ
FT                   AINVIVYIERTAMGRRVREVSRLTGREGDGYILETGVEP"
FT   gene            complement(40137..42113)
FT                   /locus_tag="Caul_5331"
FT   CDS_pept        complement(40137..42113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5331"
FT                   /product="TRAG family protein"
FT                   /note="PFAM: TRAG family protein; KEGG: aav:Aave_0724 TraG
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5331"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74450"
FT                   /db_xref="GOA:B0T9Q1"
FT                   /db_xref="InterPro:IPR003688"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9Q1"
FT                   /protein_id="ABZ74450.1"
FT                   /translation="MSARPKIILPLAAASVLIALSIATQIVAHDFHYPREFGHGLLDVG
FT                   QARIYAPWAFIGWYGRFAARYQQAFDMAAMIALAAVFVPSMLLIGLTKSTRRAPREFGK
FT                   DAWATEAHVRKAKLVHGDGQISGRVLGRFNGKYLTYRGVEHAIIVGASRSGKGAGHVVP
FT                   TLIAWPQSAFVYDRKGELWHITADHRKTFSHVFYFAPTDPNTVRWNPLFEVRKGPMEIA
FT                   DIQNVVGILVDPLGRKAGDLNFWDQSATDFFTAIILHVLYSEEDTKKNLAQVRRLLINI
FT                   DPTLHAMKHTKHRHRPDLHAPGGLARGADGKPIAEVHPEILLGATALDSMDERVKSNVL
FT                   ATCRASLSLWADPYVEYATSWSDFSIGDLVCSESPVTFYIITPQAHADRLAFLVRVFTR
FT                   QTINSLMEREHFDSRGRRKAHRLLLLLDEFPKLGSLPFLENAMGEMAGYGITAHLICQS
FT                   FNDVFSKYGDKTPIFDNMHITATFATSEPTSIDKVIRRAGKALEMRESYSDPRSIFGSS
FT                   HRSTSQSEHERYILTEDRVRELDDDQQFLFVNNTKPIRAEKIRYYDEPFFKARTGDYFH
FT                   GVPAKYEQRPGTADLPGPAQIDWLGVRAAEPAPAGLKGVVPPPAPEETDDGPQPAGDSG
FT                   QGLHAPVSSLRWTGDDDDDGSLG"
FT   sig_peptide     complement(42027..42113)
FT                   /locus_tag="Caul_5331"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.984 at
FT                   residue 29"
FT   gene            complement(42128..43624)
FT                   /locus_tag="Caul_5332"
FT   CDS_pept        complement(42128..43624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5332"
FT                   /product="MobA/MobL protein"
FT                   /note="PFAM: MobA/MobL protein; KEGG: xcv:XCVb0008
FT                   MobA/MobL family plasmid mobilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5332"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74451"
FT                   /db_xref="InterPro:IPR005053"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9Q2"
FT                   /protein_id="ABZ74451.1"
FT                   /translation="MASFLCQVQTIQRGLGRSAVAAAAYRSGQSLTDDRLAMEFDFSNK
FT                   DGIEHAEIMAPDDAPQAYRDRAALWNAVEAAERRKDAVPAQEVLLALPHELDFEQRRDL
FT                   VRAFVQEHLVAKGMIADVAMHRPGKEGDQRNFHAHIMVTTRRVDRAGFGGKNRDWNHAS
FT                   FIPQLRAAWSDVQNRHLRHHLGPDAPQVSHLSLAARGVDRAPTVHLGPAATALERKDIA
FT                   SERGELNRDVRARNDKARDLRCDYQATADRIAKTAPEIEVAVPKLVVEAEQVLGKMVAQ
FT                   RTAWAAEREALSAPKMPSAGRVERELTAEAATAKARARAHLQQTEERVKKTRSRRLELV
FT                   AWVRNPARMIWAKHAELNAIGRARKAYRRAEVGLQVRQDWVRSPKGQAFVAARRQPGLE
FT                   AAADVVRQRRTLERKIKRMDNRIGLAGRTISDLRLAHELGERELRVPNQSPDETRFFRD
FT                   IGRPAREALQRFPTPVQEQALERLRRGQGRSIGRAIIPGR"
FT   gene            43884..44570
FT                   /locus_tag="Caul_5333"
FT   CDS_pept        43884..44570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5333"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5333"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74452"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9Q3"
FT                   /protein_id="ABZ74452.1"
FT                   /translation="MIAVDKRKRNTRPSKYRPRSEIQKQKRKDLWAARETDRKLGRRIS
FT                   DEDALKLRLEELEAALRDMGRTGIHNKRHTVPLEDIADDGQRFAVLKARVERLEALWAI
FT                   NQRKRETRGKIILGGALLAEAADEARQEGEADLLHRLVDILDRRVESVRDRLTVRELLG
FT                   NVPLPLRQGGDPGEDLLGALEAVGGEAPDFDAMAESALADDDDRLTPSDVDKDYADLDA
FT                   TWRQPA"
FT   gene            complement(44567..45469)
FT                   /locus_tag="Caul_5334"
FT   CDS_pept        complement(44567..45469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5334"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5334"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74453"
FT                   /db_xref="GOA:B0T9Q4"
FT                   /db_xref="InterPro:IPR011105"
FT                   /db_xref="InterPro:IPR042047"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9Q4"
FT                   /protein_id="ABZ74453.1"
FT                   /translation="MDAAALAGLCALLARGMSAQPLPAGVNCPAAMATPPSISAAAAPP
FT                   SGSMSLAARLGGPEAREAIARVAFAEAANQGDSGLAAVVYTIMNRLQDGRWGSSVEAVL
FT                   NARAQFEPVMRAGGSWRNLPPVSEAQRARVSTIINLAIEGRLPDLTNGARFFQNARIVA
FT                   AREAAGAVSPGLTNFGGAPSSAVIGAHTFYVEAGRGGAAKGEAGRGGRSSSPRPSPAGP
FT                   KAALSAPNDGIFVGENRAFPGPATLPPEAVEGPVAVLTSVSTGADLQAARVDQIGDQPV
FT                   DPSRAMFVLSDGRPSDRRH"
FT   gene            complement(45469..46008)
FT                   /locus_tag="Caul_5335"
FT   CDS_pept        complement(45469..46008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5335"
FT                   /product="conjugal transfer protein TraF"
FT                   /note="KEGG: sal:Sala_2493 conjugal transfer protein TraF"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5335"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74454"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9Q5"
FT                   /protein_id="ABZ74454.1"
FT                   /translation="MIHGLVRRRLLVIAAALAPAVLLGALALVVQGPSLLWNRSDSEPR
FT                   GLYIRSAAAPSRGQIIAFPAPPSVLTYASGRMAYMRHMPILKEVAAMSGDTVCTLDGKL
FT                   VINGVWRAPVLAHDGESRPLPHWRACRRLGEGEFFVFSNRIPNSFDSRYYGPVRHEAIV
FT                   GVFRPIMTQADRPGDV"
FT   sig_peptide     complement(45925..46008)
FT                   /locus_tag="Caul_5335"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.546 at
FT                   residue 28"
FT   gene            complement(46318..47349)
FT                   /locus_tag="Caul_5336"
FT   CDS_pept        complement(46318..47349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5336"
FT                   /product="parB-like partition protein"
FT                   /note="TIGRFAM: parB-like partition protein; PFAM: ParB
FT                   domain protein nuclease; KEGG: pde:Pden_5036 ParB-like
FT                   partition proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5336"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74455"
FT                   /db_xref="GOA:B0T9Q6"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR037972"
FT                   /db_xref="InterPro:IPR040873"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9Q6"
FT                   /protein_id="ABZ74455.1"
FT                   /translation="MASTTGKNRSILAGLVGPAVTETPTPERGAPATERLSTRLTGLAR
FT                   VTAGDIKEKTLKLVDPARCRMWARHNRRYDLLNESVCSDLLESLRSQGEQEFPAIVRRV
FT                   EGDPACDFEVICGARRHWAISYLKNVEHRDIRYLVEERELTDEQAFRLADVENRSRKDI
FT                   SDYERALDYRHAVETFYGGTAQRMAERLEVPKAWLSRFLDLAKLPTDVVEAFGDVRQLR
FT                   ENHAREIKPLLADGASRPRVMTEAKRLAVQQAEMIAKGQRPLDAPKVMVLLKRAAAGEA
FT                   KPMIKSGKPGTAVTNAAGATLFTLATKGSKKVVLELALDAAASNADFAEAFQRELLRMR
FT                   PKG"
FT   gene            complement(47362..48567)
FT                   /locus_tag="Caul_5337"
FT   CDS_pept        complement(47362..48567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5337"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid ac-diamide synthase; KEGG:
FT                   pde:Pden_5035 cobyrinic acid a,c-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5337"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74456"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9Q7"
FT                   /protein_id="ABZ74456.1"
FT                   /translation="MAKSALTESSASGPVLLDAMTALSDRAHDVITRLRTSVFAPGEEK
FT                   IVDLRFTITKAAEMVGRTSEAIRQAEADGRLPAPRLSAAKRREGYSLAEINHMRDVFGT
FT                   RPRRGPEDPPIILAVQNFKGGVGKSTLTCHVAQYLALKGYRVAVIDCDSQASTTTIFGF
FT                   NPDIDIDDEQTLLPFFRHGGEPDLKYGLRATAWPGIDLIPANLGLYQAEYEAAARLRGN
FT                   PDALDRLRRGVESMADEYDVVLLDPPPALGMLSLAVLRAANALLIPTPPSTVDFASTAH
FT                   FLRMIVETLEVMQGHLGARGYHFLRVVATKVDEGKSAHTQIRDMMAAVFGSDMLSASLL
FT                   DSAEIDNANVQLRTVYELAGPPTKTYERCRNNLDRLNGEIELLIRKAWPSHRSDLRRLG
FT                   LG"
FT   gene            complement(48876..49841)
FT                   /locus_tag="Caul_5338"
FT   CDS_pept        complement(48876..49841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5338"
FT                   /product="plasmid replication initiator protein-like
FT                   protein"
FT                   /note="KEGG: nar:Saro_3589 plasmid replication initiator
FT                   protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5338"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74457"
FT                   /db_xref="InterPro:IPR018777"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9Q8"
FT                   /protein_id="ABZ74457.1"
FT                   /translation="MSKRTIRQQEFDLFVPRMNSLPLKDQREVMERPFFSLSKRKRLKP
FT                   IEYTSPDGEVWVHVSANPAFGIATIWDADILIWATSRINQMREAGENDLPRTLHTTTYD
FT                   LLKAIKRDTGGKGYRELQAALQRLEATTIQTSIRGTKRNTKAQFGWLDEWILESDAVTG
FT                   APKGLTLTLSNWVYEGVIKDRSLLTLHADYFALSGGVERAIYRIARKHAGDQASGWTCR
FT                   VSVLHDKTGSESPLKQFNYLLKRIVAANDLPEYDASFVNAADNSPAVHFIRRDAAERAA
FT                   IKADLARLAANSERRTREDARTLAVDGLFEKRKVKPSGER"
FT   gene            complement(50088..50456)
FT                   /locus_tag="Caul_5339"
FT   CDS_pept        complement(50088..50456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5339"
FT                   /product="single-strand binding protein"
FT                   /note="TIGRFAM: single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n; KEGG: rsq:Rsph17025_1816 single-strand binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5339"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74458"
FT                   /db_xref="GOA:B0T9Q9"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9Q9"
FT                   /protein_id="ABZ74458.1"
FT                   /translation="MLNKVQLIGFTGAEAEIRTTSGGKKVATLRVATNRYTKAGGERKD
FT                   YTTWHQVEIWNQGTVGWLGSKALPTGSKVFVEGEIRHDRYTDKDGVERFFSKVVVATPQ
FT                   HELRSLDRPDAAPASEEE"
FT   gene            complement(51281..51502)
FT                   /locus_tag="Caul_5340"
FT   CDS_pept        complement(51281..51502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5340"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74459"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9R0"
FT                   /protein_id="ABZ74459.1"
FT                   /translation="MVSMGMAQAVYQHAHDFYDTGSWYVVAECWDLLAIAEELDRQEEI
FT                   TAIPFELDTAAIAHFHQMIHARTGGTRH"
FT   gene            complement(52160..53092)
FT                   /locus_tag="Caul_5341"
FT   CDS_pept        complement(52160..53092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5341"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nar:Saro_3977 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5341"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74460"
FT                   /db_xref="InterPro:IPR019627"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9R1"
FT                   /protein_id="ABZ74460.1"
FT                   /translation="MQLTAFSPVTGAMSNFEAQALLLDDPRVHPAEDALQQLGHALMNE
FT                   VLDVFSETALEDFQSTICESLIGAFHSAAQRIEREADKARDDLNRFARDFDGSEIADTE
FT                   MQAATQKARAADVATLALEMVRDAAAASYTTSTGDVWSPWKGSAKASRTTAAQIEAREA
FT                   IRSAKARKHSATDPGAIIVAFRAAPQADSADDANRIFDALNWALVQWPQMALATTGAKG
FT                   GEKIAIKWAKQKNVTLVLAKADFDRHGRAAPFRANDELIALEPVCVLTLTNTLNPERGA
FT                   GMQPFGPALNLGQKAGEKGIRHQVVKARA"
FT   gene            53686..54027
FT                   /locus_tag="Caul_5342"
FT   CDS_pept        53686..54027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5342"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   nwi:Nwi_2869 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5342"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74461"
FT                   /db_xref="GOA:B0T9R2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9R2"
FT                   /protein_id="ABZ74461.1"
FT                   /translation="MSARNMLLLAPPHPVELALKELGANLRTARLRRNLTIEEVAQKIG
FT                   VGRRAVSDAERGKPSTSVATYAALLWAFDLLADVHSLADPARDQEGLILSRSKAHVRAR
FT                   RGEALDNDF"
FT   gene            54176..54508
FT                   /locus_tag="Caul_5343"
FT   CDS_pept        54176..54508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5343"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="SMART: helix-turn-helix domain protein; KEGG:
FT                   csa:Csal_0225 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5343"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74462"
FT                   /db_xref="GOA:B0T9R3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9R3"
FT                   /protein_id="ABZ74462.1"
FT                   /translation="MATPHHPSTAVRQSLRKLGGDIKDARRRRGLPAQVVAERAFTSRS
FT                   TLRRIEAGDNAVGIGIYAAVLQALGLLDRLGDMAAPGQDEVGLSMASQALPMRVRLKRV
FT                   RAGDHG"
FT   gene            54501..55748
FT                   /locus_tag="Caul_5344"
FT   CDS_pept        54501..55748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5344"
FT                   /product="HipA domain protein"
FT                   /note="PFAM: HipA domain protein; KEGG: bbt:BBta_7391
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5344"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74463"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9R4"
FT                   /protein_id="ABZ74463.1"
FT                   /translation="MADVEVHIDFSAGLRRVGTLHRQPRRGGEAVVFEYHPAWLADAAR
FT                   FSLEPALTLGQGAFAPAAGLSMFGSIGDSAPDTWGRRLMQRAERRQAERDGRQVRALSD
FT                   ADYLLGVADVSRLGALRFREPGEADFRAPTQTGVPGLVELGRLMGVTERILRDEETDED
FT                   LAMIFAPGSSLGGARPKASVIDQHGSLSIAKFPKEADDYSIELWEEVALRLAKRAGIRT
FT                   PRHELVKIADKSILLSRRFDRDGETRIPFLSALSMLGLRDGERGSYPELVDVLTQHGAQ
FT                   AKQDAVELYRRMVFNVLISNVDDHLRNHGFLWAGQSGWTLSPAYDLNPTPTDVRPRILT
FT                   TNIDLDEGTCDLGLVESVAELFGLGPKPAREIIAQVGQATRIWRDVAVEIGARPAEVRR
FT                   MQSAFEHTDLERALAI"
FT   gene            complement(55855..56109)
FT                   /locus_tag="Caul_5345"
FT   CDS_pept        complement(55855..56109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5345"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nha:Nham_1130 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5345"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74464"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9R5"
FT                   /protein_id="ABZ74464.1"
FT                   /translation="MAKYDPLCRYLRRQRLAEFELSFAEMERVISGMLPGRATRPQWWT
FT                   NVPDPDSTHVQRRAWADAGYEALLIVGKDRVRFKRTAQP"
FT   gene            complement(56253..57014)
FT                   /locus_tag="Caul_5346"
FT   CDS_pept        complement(56253..57014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5346"
FT                   /product="DNA repair protein RadC"
FT                   /note="PFAM: DNA repair protein RadC; KEGG: atc:AGR_C_2959
FT                   DNA repair protein RadC homolog"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5346"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74465"
FT                   /db_xref="GOA:B0T9R6"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9R6"
FT                   /protein_id="ABZ74465.1"
FT                   /translation="MPRPTHRNDATPCQTADLFAAAGVGEMTARYAGPSSPAPSNGTLG
FT                   ARAATGGLASLSDIEALELLLSRSLANGARATAVALLARFGCLRRVLTADLAALSTFVD
FT                   TRVGIDLQLIYDAARRLAAAELPGRCVVSSWTALIDYLKLTMAHCEREAFRVLFLDKKN
FT                   QLIADEILNHGTVDHAPVYPREVVRRALEVSASAVILVHNHPSGDQTPSSADIEMTKKV
FT                   VDAARTLGIAVHDHVIVGRAEVASFKALGLI"
FT   gene            complement(57157..57561)
FT                   /locus_tag="Caul_5347"
FT   CDS_pept        complement(57157..57561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5347"
FT                   /product="antirestriction protein-like protein"
FT                   /note="KEGG: acr:Acry_3504 antirestriction protein-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5347"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74466"
FT                   /db_xref="InterPro:IPR041459"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9R7"
FT                   /protein_id="ABZ74466.1"
FT                   /translation="MPNRRMADARKTSLRQTPCGIIRIAALWDLCRYRHKSHWSGADHR
FT                   LGRTFGQRFGDAAYAFEELVAEIGSAAIGLRIGLRPQILDSHAAYLGHWVKILKDRPGA
FT                   LLEASGHAQRAVDHLLAYSQPAQASQPLAA"
FT   gene            complement(57564..58556)
FT                   /locus_tag="Caul_5348"
FT   CDS_pept        complement(57564..58556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5348"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; integrase domain
FT                   protein SAM domain protein; KEGG: acr:Acry_3266 phage
FT                   integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5348"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74467"
FT                   /db_xref="GOA:B0T6S1"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B0T6S1"
FT                   /protein_id="ABZ74467.1"
FT                   /translation="MSAAALPALIQRFFTDRLCVQMEASPHTVAGYRDTFRLLLRYAGA
FT                   RCGKPPVKLTVEDIDADLVADFLAHTETARGNSARSRNTRLAAIRSFFRYVAMSDPTWL
FT                   LQCQRILAMPNKRYVKRTVTFLDADEMAALLAAPDRTTWAGRRDHALLLLAIQTGLRAS
FT                   ELVGLKLGDVVLGNGAHIRCMGKGRKERATPLRRETAKLLGAWIGNDKDENRPLFPSIR
FT                   GERLSRDALEHLVRKHCLSASRTCPSIGTKRVTPHTLRHSTAMDLLHHGVDPAVIALWL
FT                   GHENVETTQIYIHADMRMKEKALARVAVPATPSGRFRPDDKLLAFLEGL"
FT   gene            complement(58553..59494)
FT                   /locus_tag="Caul_5349"
FT   CDS_pept        complement(58553..59494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5349"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: acr:Acry_3506
FT                   phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5349"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74468"
FT                   /db_xref="GOA:B0T6S0"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B0T6S0"
FT                   /protein_id="ABZ74468.1"
FT                   /translation="MSLTDQLDRYLSVRRGLGYDLGTSERILRRFTRFADGEGAAYIDT
FT                   PLFLRWHATLAEAQTSTRGARLSAVRLFAQWLSSFDPAHEVLPRGLLPNAIARSRPHIY
FT                   SDAEIGAIIMAAKMLPSIYGLRGLTCSTLFGLIAVTGLRISEALALDGEDLEINHGVLR
FT                   VRQGKLGKERLLPLDPSVVAQMIDYRVERDRLIGHPVTPMFVTDKATRLTDCAARYNFA
FT                   HACQQIGLRTPQPYCKHGKGPRIHDLRHSFAVRTMIGWYRTGKDPAREMIRLTTYLGHS
FT                   DPSNTYWYLEAVPELLDLAMARATADGREAVQ"
FT   gene            complement(59491..60702)
FT                   /locus_tag="Caul_5350"
FT   CDS_pept        complement(59491..60702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5350"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: acr:Acry_3507
FT                   phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5350"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74469"
FT                   /db_xref="GOA:B0T6R9"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B0T6R9"
FT                   /protein_id="ABZ74469.1"
FT                   /translation="MSENLKTCVEPYLAAFEQTYAAENYQTRTIIAYRCLARKFGAVLD
FT                   EAGIAPPSVTLDCVEPLTRDLPRERKNTIRLDTIARRFVQHLVDIGVAQPVPLTDSEIA
FT                   RATLLADFETYLAKQRGLSPRSIPHSVGFARRFLDYRFGKALPDPGRLCPADVIGFMEH
FT                   VLASARRDKTVATHVRIFLQYLFARGATATNLALSVPKTAKRWAARMPRHLSPDGVEAV
FT                   LASVRDNHLHGARDYAMLLVMARLGLRAAEVVAIQLDDIDWRAGELMVRGKGKLHDRLP
FT                   LTAEVGDALSRYLREERGPATCRTLFVAHRAPHRPFKDGTIVNAILKDALKATGQKPVT
FT                   PYVGSHLLRHSLATQLVNTGASLDEVGDMLRHRSRSSTMIYARLDIDGLRSIAQPWPVA
FT                   GGTL"
FT   gene            complement(60762..61424)
FT                   /locus_tag="Caul_5351"
FT   CDS_pept        complement(60762..61424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5351"
FT                   /product="domain of unknown function DUF1738"
FT                   /note="PFAM: domain of unknown function DUF1738; KEGG:
FT                   nwi:Nwi_0255 antirestriction protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5351"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74470"
FT                   /db_xref="InterPro:IPR013610"
FT                   /db_xref="InterPro:IPR041459"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9S1"
FT                   /protein_id="ABZ74470.1"
FT                   /translation="MSNPLEPLLNEIIARLERGVPPWRQPWANGADPSTPLRSDGQPFS
FT                   GSNAWLLAFAGAERGYTSPFWFTFRQALAIGAPVAKGARSALAILYKTRVVDGRDVADS
FT                   SEAGEGEAKSLRYLKTYAVFNAEQLTDCPQIYLEVPKIDPAVRAAARDAVLDAIPARLE
FT                   IGGNTACYVRAADLIRMPPPEAFGCVEDWKSTFAHEAVHNAAIRIMPHGAALARLAA"
FT   gene            complement(61573..65838)
FT                   /locus_tag="Caul_5352"
FT   CDS_pept        complement(61573..65838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5352"
FT                   /product="probably methylase/helicase"
FT                   /note="KEGG: xau:Xaut_3026 probably methylase/helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5352"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74471"
FT                   /db_xref="GOA:B0T9S2"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR026741"
FT                   /db_xref="InterPro:IPR026937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR039187"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9S2"
FT                   /protein_id="ABZ74471.1"
FT                   /translation="MNATFPLFSALQTPGAAQDKAANTLAAARALTPHLNRSRALDRKL
FT                   VASTMTISFGGSDAEGAWSWRDAYDAIEAALVLQLRRLSPQIGRLEDAPAQIAALLASV
FT                   TDLTLTHTRRSEEQVALDQFSTPPALAALAVLAAQVRPGDKVLEPSAGTGLMAIIAEAC
FT                   GATLELNEIAPHRSALLDGLFPAVSRTRHDAAHLKDILPSSGSFQAVIANPPFQRLEGH
FT                   LHAAIDCLAEGGRLSAIVPTRLFEDAGAMQALARRGRVVALIAFPPRAYAKHGTSVETG
FT                   LLVLDCVEECGGVPVKVVSGETLADIAKLIAALDPRPTAQPRQFRSVSNVAFLAPRARA
FT                   LATPSTRLGFLAGASPVAFETIAWSGEGHDVGLYQAYRVSRLDLQGSRPHPSALVESGP
FT                   MASVAPPAPTYRPLLPTNIVQEGLLSDAQIETVIYAGEAQSGLLPGWWVLGEAPHKLVL
FT                   VKEGAPGAFQLRRGFFLGDGTGCGKGRQAAGVIADNMAQGRLKAVWISRNDTLLEDARR
FT                   DWTAIGGSATDITPQSAWKQADAIRMDRGVLFTTYATLRQPARGMRLSRLDQIVGWLGA
FT                   DFDGVIAFDEAHAMANAAGGGQGARGPKKASQQGMAGLALQNRLPNARVMYVSATGATT
FT                   PENLAYAARLGLWGGPEAPFNTRDAFMDAVEKGGVAVMELIARELKALGLYIARSLSFD
FT                   GVEYQALRHVLTGDDVEIWNAWADAYQLIHQNLRAALEAVGITQDGKAKSGQAACAVMS
FT                   AFEGAKLRFFGALLAGLKSPTLIAAIRDDLVQGRSSVVQIVSTNEAVMERRLAQIPPEE
FT                   WNNLTIDLTPKDQVLDYLMGAFPIAAMEAIDDKEGNVTMRPLIVDGQPVVSQEALRLRE
FT                   ALVVHLACLPAVPGVLDAVLGALGPDNVAEITGRSRRVVLRDGRRVVERRSASSAKAET
FT                   DAFMSGKKRVLVFSDAGGTGRSYHADLNCANQDRRRHYLCEPGWRADAAIQGLGRSHRT
FT                   NQASAPLFCPVTTDIHGEKRFTSTISRRLDSLGALTKGERRTAGNGLFRPEDNLESPWA
FT                   HRALQAFYVALHWGNVPAMDRVTYEQKTGLQLLDSDGQLKKAEDLPPMNTWLNRLLALR
FT                   IEDQNALFETFDAVLTSILERAAASGALDKGMEDIVADDLTVTSEEVIRTDAVSGAQTK
FT                   VVTFAVRTRRVLASAADALAGLDPQTLEYVVNTKSQRAGLVVKGLTTTDDDDRLVQAVR
FT                   LIRAEKAAVLPLKTYEESAWEVVAEPIWRATWDAEVAGADPWHTRQLALVTGLLLPVWS
FT                   SLPSKRTFVRRLKAPDGRRWLGRVLGPADVTKLKIALGISDVATAVGSGNNAASMVLGE
FT                   NISIALAGGFWLRRAKVMDRYRLEVVGAGSQRAMFQALGCFVEIINYTPRVFVPVDQPQ
FT                   VLCAVLAKWPAQTILPAAA"
FT   gene            complement(65981..66361)
FT                   /locus_tag="Caul_5353"
FT   CDS_pept        complement(65981..66361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5353"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rpe:RPE_3948 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5353"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74472"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9S3"
FT                   /protein_id="ABZ74472.1"
FT                   /translation="MAIPDPEPGLVVQFNYLWSSEYDRGRQEARYPRSFAVVLSYRRTA
FT                   DGATIALLAPITHSEPRDGDRAIEIPLAVKRQLGLDDQRSWVMVDEVNETAWPGYDLHQ
FT                   TSRANMPMASFHPACFGGSRRR"
FT   gene            complement(66368..66634)
FT                   /locus_tag="Caul_5354"
FT   CDS_pept        complement(66368..66634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5354"
FT                   /product="prevent-host-death family protein"
FT                   /note="TIGRFAM: prevent-host-death family protein; PFAM:
FT                   protein of unknown function DUF172; KEGG: nha:Nham_4513
FT                   prevent-host-death protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5354"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74473"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9S4"
FT                   /protein_id="ABZ74473.1"
FT                   /translation="MMEVSATEFAKRFSRYRQAAQREPVAVTHHSRVTEVLVSKHDYDE
FT                   YMQLKSRATRAFRVEDLSDEAIEALGKAQMDPRNNHLDALMDD"
FT   gene            complement(66798..68855)
FT                   /locus_tag="Caul_5355"
FT   CDS_pept        complement(66798..68855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5355"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH02002 putative plasmid stabilization
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5355"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74474"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9S5"
FT                   /protein_id="ABZ74474.1"
FT                   /translation="MTDTQTVSPTRMDEITVRLGDLGLAPENLRFQEPADDGVPQLAET
FT                   VLAAGVLIPPIVRAGLKSEQAFMTLDGRRRRFSLLVLRDRGDIDDDYPVVCKLAASKAQ
FT                   QAAAIILPNAEVAPVHIADIIGAIGKLRKAKMDTAGIARALGYAELEIKRLEALSAVHP
FT                   SVLKALRLGKLNLKQVRLFARMPDKKQQGELAETALDGHFHDYQLHQVINGSRLTIEDD
FT                   RFGLVGMARYTAAGGRVESDLFAELADVLLDPGKLQDLWRERAAPFVEGFKQLGLAVYI
FT                   GRDAGFRAPEGFETLPYVYPGDLTDETKAVLAAARQRVAQAARDLGGVDLAADDAALTI
FT                   FPLLQAKMEVASAPLKRLALGAVILSPDGATGISAEFFAAPVSEELLDGAGDDLAGENG
FT                   ADEDDASGGQGNGARYGRSASDVEVPKADVDVEGSSHVLHETRTDVATRGLIRDLADNP
FT                   AAALTALVAQLFKQLALQGGPGHEESALAINATGYRRGQTPAIGALDGDIRARLEARRV
FT                   VYKASGLRPIAWVDGLAHGDKMALLAELTAITLNLREARTSNIRDSARAEAIELAQLCA
FT                   ADISAHWTPDPDYLAVHSKRQLLVLLDEMQLDDPRAKTLKKDELVVLVADAAAERQWAP
FT                   QVLSWESTTVETQPPADEDQDQDDGDEALADDLTPGPAAPSPEVSVQHAA"
FT   gene            complement(68979..69872)
FT                   /locus_tag="Caul_5356"
FT   CDS_pept        complement(68979..69872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5356"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nwi:Nwi_1259 virulence-associated protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5356"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74475"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9S6"
FT                   /protein_id="ABZ74475.1"
FT                   /translation="MSLCHIVKALGGELYAGGRRANIPAPGHSCADRSVSLLLEDDRVV
FT                   VHTFGDGDWKAVLDHLRDNRLIDVHNAPTSVSGGGPRAAVVAKPPDPQRLDAARRLWEG
FT                   GRAVPGTLCERHCRLRHIRRALPGPEILRHGGDTPVSAYVQTRHRRPALMAAICDAQGA
FT                   FTAVEVTYLAPNGHKALDLRLARKTVGPVPAGTAARLDPAAPEMLVAEGVFTTLSATER
FT                   FSLPGWALMSTRNLKTWRPPPGVRSVLIAADRGLDGAASAQILAARLQRQGVATRIEFP
FT                   PEPFGDWNDVEAALRD"
FT   gene            70328..70663
FT                   /locus_tag="Caul_5357"
FT   CDS_pept        70328..70663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5357"
FT                   /product="protein of unknown function DUF736"
FT                   /note="PFAM: protein of unknown function DUF736; KEGG:
FT                   bbt:BBta_7309 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5357"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74476"
FT                   /db_xref="InterPro:IPR007948"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9S7"
FT                   /protein_id="ABZ74476.1"
FT                   /translation="MATIGTFIKRGDDLHGAIRTLTLDVDLVMRPAAKTRADGPDFLIY
FT                   AAGTAKGPNGIDTQLGAGWKRTCDQNCLHIDVELDDPAFPGPLSATLVEDQVAPSGERF
FT                   RMVWARA"
FT   gene            70795..71916
FT                   /locus_tag="Caul_5358"
FT   CDS_pept        70795..71916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5358"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS111A/IS1328/IS1533; transposase
FT                   IS116/IS110/IS902 family protein; KEGG: smd:Smed_6239
FT                   transposase IS116/IS110/IS902 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5358"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74477"
FT                   /db_xref="GOA:B0T9S8"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9S8"
FT                   /protein_id="ABZ74477.1"
FT                   /translation="MDQEIIFVGLDVHKATIAVALAPDGRSNEVRFQGSVPHRPGAMAD
FT                   LGRRLQSKHPGARLTFCYEAGACGYGLARELTDAGYECLVIAPSLIPSRPGDHIKTDKR
FT                   DATMLAKMHRAGELTTVWVPDASHEAVRDLVRAREAAMYWRNRARQALSSFLLRQGYRY
FT                   GGRSAWTASYWRWLATLVLEHPAQQIAMQEYILAIHEADARHDRLVKQIEGIIPTWSMA
FT                   PLVTALQAMRGIAMITAATIVAEIGDLGRFATPRKLMAYLGLVPAEHSSGAKIRRRGIT
FT                   KAGNPRARRLLVESAWTYAKSPRVSQVIQRRQEGVELEIVKIAWKAQLRLHDRYRRLAA
FT                   TGKPKNVVITAIARELVGFIWAISQRISPPATA"
FT   gene            72407..72802
FT                   /locus_tag="Caul_5359"
FT   CDS_pept        72407..72802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5359"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5359"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74478"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9S9"
FT                   /protein_id="ABZ74478.1"
FT                   /translation="MTKDLGSPPGQPDPSAKTSEEAWIVGSNPEQAIRMRSLSVYLSNG
FT                   GALKDVRLVEGEDERWTMFVRLINRPGEYRLNLFKSDQPKTYRDVDLAIATVRDDFGYY
FT                   GSITLATEQRPKIGKAQAGPTTDSDED"
FT   gene            complement(72799..73299)
FT                   /locus_tag="Caul_5360"
FT   CDS_pept        complement(72799..73299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5360"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsh:Dshi_4011 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5360"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74479"
FT                   /db_xref="GOA:B0T9T0"
FT                   /db_xref="InterPro:IPR021679"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9T0"
FT                   /protein_id="ABZ74479.1"
FT                   /translation="MVAAQGWELFAHPLLLDQFDRLVAAVEQERAKKPKTYQSGANAKL
FT                   LAALRRLIFEVIPEDPARADYRQGTTLGADRKHWFRAKFGGGRFRLFFRYDSKSRIIVY
FT                   AWVNDETTLRTYGAKTDAYAVFRGMLDKDTPPDSWDALLKAASNEPAVQRLAGAGLTPT
FT                   EGG"
FT   gene            complement(73303..73623)
FT                   /locus_tag="Caul_5361"
FT   CDS_pept        complement(73303..73623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5361"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="KEGG: pla:Plav_3434 transcriptional regulator, AbrB
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5361"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74480"
FT                   /db_xref="GOA:B0T9T1"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR031848"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9T1"
FT                   /protein_id="ABZ74480.1"
FT                   /translation="MPSIEKVATITAKGQTTIPKAVRQALGADYGGKIAYRIDEHGVSL
FT                   HRVETPEDPALGAFLEFLATDIRDHPERIQSISSELRARIEALTAGLEIDLNAPIDGTV
FT                   AL"
FT   gene            complement(73782..74375)
FT                   /locus_tag="Caul_5362"
FT   CDS_pept        complement(73782..74375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5362"
FT                   /product="mobile mystery protein B"
FT                   /note="TIGRFAM: mobile mystery protein B; PFAM:
FT                   filamentation induced by cAMP protein Fic; KEGG:
FT                   xau:Xaut_4941 mobile mystery protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5362"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74481"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR013436"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9T2"
FT                   /protein_id="ABZ74481.1"
FT                   /translation="MTDEDLHSGDEAATNLTPEARIGLIPTWIITRDDLNRAERANIAA
FT                   GLRWARRGRFDVLDPASLFTLHRRMFEDVWRWAGKPRESEKNIGVADLWKVREHLHQLT
FT                   GDIAAQVAAATRSPDEIAVDFHYRMVSIHVFPNGNGRHARLSADLLAERLEHEPFSWGR
FT                   ADLVHAGETRAAYIAAIKAADGFDLKPLVAFARS"
FT   gene            complement(74372..74836)
FT                   /locus_tag="Caul_5363"
FT   CDS_pept        complement(74372..74836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5363"
FT                   /product="mobile mystery protein A"
FT                   /note="TIGRFAM: mobile mystery protein A; PFAM:
FT                   helix-turn-helix domain protein; KEGG: atc:AGR_pTi_183
FT                   DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5363"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74482"
FT                   /db_xref="GOA:B0T9T3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR013435"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9T3"
FT                   /protein_id="ABZ74482.1"
FT                   /translation="MDRRKSAAEARRSLDRVLAPYRALTHRRPPRGWTRAIRDAFGMTA
FT                   SQLGVRMGVTQPTVQKLERSEQEDTIQLGSLRRLAEALNCELVYAFVPREPLQQTYETA
FT                   ARAVARRELGAISHSMALEDQAVDDADEDDRLRRFIEDELDPREVWAARP"
FT   gene            complement(74947..76353)
FT                   /locus_tag="Caul_5364"
FT   CDS_pept        complement(74947..76353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5364"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5364"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74483"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9T4"
FT                   /protein_id="ABZ74483.1"
FT                   /translation="MQTAHSEDWRPGFAKRAENFPAVCAAAESWRWQPGESIARVAAAV
FT                   LKGTPSLSIPQRMTLLLYVEHLNQDRLEQNAACVWPSTGLVAEYLGCSESQARANRKAL
FT                   EAAGYLVRDYTRANRPAGVEAYDLRPLMARLEELEGVDDAIREGIAARRAAYSETVAFP
FT                   MKYSAQAPESRRLEQSQKNLMSSVQEMAAAEPRNHSEKRPSTRPENQNLTGSSNQRPRT
FT                   RQDRAIGSSERASGFSSAKSEASVYAEMVRQELQTAIQVCPRLAPLIRDTLLANPASAT
FT                   PEDAARVAAAAAEFLPQPERNNDQTAIWGWRKHGIRIVTMMAIALEDPEVRSACSYFGK
FT                   LATQERGASDLRLNLARILRQKGDLPPAEESALAVEPELPPLMFAPGADEVPWPEINAE
FT                   LRRLIREGAHGSWFNRVGFHGIDDGLISLSTPTGIAAERIKRDYVEAIKLAAENVGVFV
FT                   DRVMISVRKR"
FT   gene            complement(77070..77324)
FT                   /locus_tag="Caul_5365"
FT   CDS_pept        complement(77070..77324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5365"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5365"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74484"
FT                   /db_xref="InterPro:IPR018733"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9T5"
FT                   /protein_id="ABZ74484.1"
FT                   /translation="MARETKTTLALPKIDLEEKALDVRLRLKGKAAVDLADYQRAYAQT
FT                   NGHAVELDHLAAHILAAFIDADRGFQAWRRSNLAPGARS"
FT   gene            complement(77326..77664)
FT                   /locus_tag="Caul_5366"
FT   CDS_pept        complement(77326..77664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5366"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5366"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74485"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9T6"
FT                   /protein_id="ABZ74485.1"
FT                   /translation="MTATTEKLGLFLPQGLHEQMVQAAAKRLSGRKTPRGGVRLVYEQA
FT                   FNDLLEALDAGQLVAFPAMRGAKHRISVRVCGLLCARIRGRLDPLNLKLTDFASTAIAG
FT                   FLHPPEGA"
FT   gene            complement(77675..78931)
FT                   /locus_tag="Caul_5367"
FT   CDS_pept        complement(77675..78931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5367"
FT                   /product="conjugation TrbI family protein"
FT                   /note="PFAM: conjugation TrbI family protein; KEGG:
FT                   rpa:RPA2224 possible trbI, a component on a type IV
FT                   secretion system (Y10832)"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5367"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74486"
FT                   /db_xref="GOA:B0T9T7"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="InterPro:IPR042217"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9T7"
FT                   /protein_id="ABZ74486.1"
FT                   /translation="MRHLPPDPPLDGRPSYEPERKASSASVLSAPRFPVTRWNRKYLMA
FT                   GAAVLASIVAGGFYLGFGGAHATKGRPDDSQNAADTSSPQTPEIATRYAAGYADPAVRP
FT                   GTTSLPPPDALAPPAPTTQAAGQPGQPAPVDPAVQAAREQALAARSASPFFGGAQAQPQ
FT                   AASQTGPLAPDPGPMLAAALVPGFGTPPASAAGDVQPANGQAGKRQFAAGARVDDYLTS
FT                   PLQAPISPWEVKAGTIISAALITAINSDLPGQVIAQVTEPVYDHRTGRTVLIPQGSRLI
FT                   GQYDSQVAHGQSRSLIAWNRVIMPDGRSINIGSMAGADLSGAAGLQDKTDGHFWQLARG
FT                   VALSTVFSVGAAAAQDAGTRSSGGLVINSAGSGISTSAQQVGQQVTARDLNRQATLRIR
FT                   AGWPLRVIVNKDMILAPYP"
FT   gene            complement(78935..79972)
FT                   /locus_tag="Caul_5368"
FT   CDS_pept        complement(78935..79972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5368"
FT                   /product="P-type conjugative transfer protein TrbG"
FT                   /note="TIGRFAM: P-type conjugative transfer protein TrbG;
FT                   PFAM: Conjugal transfer protein TrbG/VirB9/CagX; KEGG:
FT                   pap:PSPA7_3698 conjugal transfer protein TrbG/VirB9/CagX"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5368"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74487"
FT                   /db_xref="InterPro:IPR010258"
FT                   /db_xref="InterPro:IPR014142"
FT                   /db_xref="InterPro:IPR033645"
FT                   /db_xref="InterPro:IPR038161"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9T8"
FT                   /protein_id="ABZ74487.1"
FT                   /translation="MSAMRDRSLRAWGAPGRVGGLVIVLAMAGGGAVLAQAGAPQSVTA
FT                   SSVIPAPASRSAPAGAVTTTTTTSVAPIANAAAPRRPQRRSAPRTYARPGPLSTVQSAN
FT                   SSARDYPTSGAYINSALYYDFEPGRLYTVHASPHFLTAITLRPGEKLISKAAGDTIRWV
FT                   LGETVQGAGASQQVIVMVKPIRGNLRTNIILTTDQRTYLLDARSYEGDTYTSVISWNYP
FT                   QEEMRDAQAARAAEAQSVVASGLAIDRLHFGYDVRTIHSRKPSWQPIRVFDDGLKTYIQ
FT                   FPTNMAATQAPPLFLIGADKQVQLVNYRYLGGYYIVDRMIDVAELRLGEKNQTVVRITR
FT                   TRDRG"
FT   sig_peptide     complement(79859..79972)
FT                   /locus_tag="Caul_5368"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.968) with cleavage site probability 0.479 at
FT                   residue 38"
FT   gene            complement(79969..80652)
FT                   /locus_tag="Caul_5369"
FT   CDS_pept        complement(79969..80652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5369"
FT                   /product="Conjugal transfer protein"
FT                   /note="PFAM: Conjugal transfer protein; KEGG: mlo:mlr6403
FT                   conjugal transfer protein trbF"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5369"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74488"
FT                   /db_xref="GOA:B0T9T9"
FT                   /db_xref="InterPro:IPR007430"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR035658"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9T9"
FT                   /protein_id="ABZ74488.1"
FT                   /translation="MNPFNRPNDRYGSSAPVESPYLRASREWDNRIGSAVVQAKNWRMA
FT                   AFGCMGLAALALGGFIYEASNTNIATYVVPIDNYARPGRIELAGRTYQPTTAEIGYFLA
FT                   DWVRRTRSKSIDPIVIRDNWTGAYHFVAGPAIGQLNTYAKANDPFANVGAQAINVEIVS
FT                   VLARSPSTYQVQWRETQFNAGTSGVTENWTGLLTAKINPPKNEAELRANPLGIFITAFQ
FT                   WSREL"
FT   gene            complement(80679..81992)
FT                   /locus_tag="Caul_5370"
FT   CDS_pept        complement(80679..81992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5370"
FT                   /product="P-type conjugative transfer protein TrbL"
FT                   /note="TIGRFAM: P-type conjugative transfer protein TrbL;
FT                   PFAM: TrbL/VirB6 plasmid conjugal transfer protein; KEGG:
FT                   pde:Pden_3200 TrbL/VirB6 plasmid conjugal transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5370"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74489"
FT                   /db_xref="GOA:B0T9U0"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="InterPro:IPR014150"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9U0"
FT                   /protein_id="ABZ74489.1"
FT                   /translation="MTTADPAALDQFIRAFTGQVGGGFGAIASDVQTVLAILVVISITL
FT                   TAVLWAIDETQNVLAPLVRKILLIGFFSWLVTNWHSLSLTVVNGFAKLGLQASGGGSIG
FT                   DFTKAPTRAVEAGLSVVVDLIKYIGDLAQQNGGFGALVHIDMIIVAGVAAIGILLAFII
FT                   LAIEIAVTIIEFYIVTLIAFVVVPFGVLSQTSFLAERAIGYVISVGFKFMALAVIAGIG
FT                   INIFETYTLSAQPTVAEEAGLLLSAIFLMMLSLKVPSIAGALISGGPQLNSGSALMGAA
FT                   GVAAGAAGGALAGRAVAGAMGSLAGGGGQVAAARAASGAINSGGSSGGGSSGGGGSPSG
FT                   SGPAPGSPRSPASSDASASRAAGGGVSPDGAPPPEPSPSKPSPTSSPGGASLVARAEAR
FT                   RGDGLTSMARNTAAAATAGGDSQGPGMSATATRRDPEP"
FT   gene            complement(82220..82942)
FT                   /locus_tag="Caul_5371"
FT   CDS_pept        complement(82220..82942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5371"
FT                   /product="P-type conjugative transfer protein TrbJ"
FT                   /note="TIGRFAM: P-type conjugative transfer protein TrbJ;
FT                   KEGG: rpa:RPA2229 putative conjugal transfer protein TrbJ"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5371"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74490"
FT                   /db_xref="InterPro:IPR014147"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9U1"
FT                   /protein_id="ABZ74490.1"
FT                   /translation="MVKLLSTTAAIAALAMGMSAATPPPARAQMTVIDPAAIAQMTSQV
FT                   ANSLRQIEQLQSQITNQVAMLQKLGTDVTQPLTQINQQATQLLQQAQAIGYNSQNIAQQ
FT                   FQQLYPSDMTGQSFAQIRQRLASWESNSRLTMQDSMAAQNQLVRSQATTAGAVDSAVAA
FT                   SQGAAGQTAAVQATNQLLAALSTQLQGLQTILIAQARTQDTILAQQQAGAIAARAETAR
FT                   ATAFTKKGSSLPNITDFK"
FT   sig_peptide     complement(82856..82942)
FT                   /locus_tag="Caul_5371"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.909 at
FT                   residue 29"
FT   gene            complement(83300..85774)
FT                   /locus_tag="Caul_5372"
FT   CDS_pept        complement(83300..85774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5372"
FT                   /product="CagE TrbE VirB component of type IV transporter
FT                   system"
FT                   /note="PFAM: CagE TrbE VirB component of type IV
FT                   transporter system; SMART: AAA ATPase; KEGG: mlo:mlr6400
FT                   conjugal transfer protein trbE"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5372"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74491"
FT                   /db_xref="GOA:B0T9U2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018145"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9U2"
FT                   /protein_id="ABZ74491.1"
FT                   /translation="MLYLREYRPKADRLFDHLPWVALIGPGLILNKDGSFQKTLAFRGP
FT                   DLASSTDAGLVATRAQLNNALRRLGSRWCLHIEALRAASQDYPASQFPDLVSDLVDEER
FT                   REAFEGHERHFESRYFLTFTYLPPEEAVSTAESLLLENAPSGRGAAGMYRAALSDFLST
FT                   VRQIADILTAVMPEVHELSDDETLTYLHGCISTKRHYVKAPETPAYLDAFLTDDDFQGG
FT                   LLPRLGASFVRTISVRAYPATSSPGLLDRLNELGISYRWVCRFLPLDKEDARKAVTTVR
FT                   KRWFAKRKGVMALLKEAITREPSVLEDPDAAAKSMDADAALAILGGDYASIGYFTPTVT
FT                   LMDTDPDRLADRVREVESAINRVGFVCKVEDVNAVEAWIGSLPGQAYADLRRPLVSSLN
FT                   LCDMMPMSAIWPGPTRNEHLGSECAKRGHPGAQPPLMFTRTAGTTPFRFDLHQGDVGHT
FT                   MIVGPTGAGKSVLLNAIAVQWLRYPEAQVFFFDKGASSRAATLLTGGQFYALGSEESEL
FT                   AFQPLADIDTADDRSWTQEWVQDLVAAEGVEITPQVKEEIWSGLRNLAAGPRDQRTLTL
FT                   LAATIQDHSVKAALKPFTLSGPHGHLLDASQNTLKAGTWQTFEMAELMGNKSALAPVLT
FT                   YIFRTLEKRFDGRPTLLILDEAWLFLDQGSFAAKIREWLKTLRKFNVAVVFATQSLADI
FT                   ARSSIAPALIESCPTRVFLPNPDAQTPQIAELYQGFGLNPQQIRIIANATPKREYYYQS
FT                   MSGNRLFELGLGPFSLAVVGSSSPGDQQLMTRLLAEHGAAQFCERFFAAKGQAAVASYL
FT                   AAQRDAAHPKVA"
FT   gene            complement(85872..86138)
FT                   /locus_tag="Caul_5373"
FT   CDS_pept        complement(85872..86138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5373"
FT                   /product="type IV secretory pathway VirB3 family protein"
FT                   /note="PFAM: type IV secretory pathway VirB3 family
FT                   protein; KEGG: pla:Plav_1837 putative conjugal transfer
FT                   TrbD transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5373"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74492"
FT                   /db_xref="GOA:B0T9U3"
FT                   /db_xref="InterPro:IPR007792"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9U3"
FT                   /protein_id="ABZ74492.1"
FT                   /translation="MAQSQVEGFEIAFHSSLSEPVTIAGVPRMIAVLNGTLTAVLALGL
FT                   QVPLIGIPFGLAIHGACYWLAKRDPYFFDALGRHIRQRPYLDA"
FT   gene            complement(86140..86496)
FT                   /locus_tag="Caul_5374"
FT   CDS_pept        complement(86140..86496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5374"
FT                   /product="Conjugal transfer protein TrbC"
FT                   /note="PFAM: Conjugal transfer protein TrbC; KEGG:
FT                   aav:Aave_0727 conjugal transfer protein TrbC"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5374"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74493"
FT                   /db_xref="GOA:B0T9U4"
FT                   /db_xref="InterPro:IPR007039"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9U4"
FT                   /protein_id="ABZ74493.1"
FT                   /translation="MNLIRNVSSAPHRFGRAAHSAILTVGVGLLLATPAWAGGGGTAMP
FT                   WEGPLTTVMQSLSGPVAKAIGIIAIVLAGLGFAFAEGGSAMRKGIGIVFGLAIAFTATT
FT                   FVSTFFNLTAGAAF"
FT   sig_peptide     complement(86383..86496)
FT                   /locus_tag="Caul_5374"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.998 at
FT                   residue 38"
FT   gene            complement(86568..86885)
FT                   /locus_tag="Caul_5375"
FT   CDS_pept        complement(86568..86885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5375"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpe:RPE_0699 filamentation induced by cAMP
FT                   protein Fic"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5375"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74494"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9U5"
FT                   /protein_id="ABZ74494.1"
FT                   /translation="MSDRKAAERAAFERVFYPDSRVLVNELGLRDAASLDAAERLFTDT
FT                   RIEEGMPAAAAEPTYAGFKAIHHHLFQDLYAWAGQERAAASDGNKLYQECRECFLYKNS
FT                   T"
FT   gene            complement(86885..87076)
FT                   /locus_tag="Caul_5376"
FT   CDS_pept        complement(86885..87076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5376"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5376"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74495"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9U6"
FT                   /protein_id="ABZ74495.1"
FT                   /translation="MGRWSSSDPADVAWRREQMSANNDIEGVRRDPQADQLMARLDAEG
FT                   KTPAQKRDALRGYFAQKA"
FT   gene            87511..87813
FT                   /pseudo
FT                   /locus_tag="Caul_5377"
FT   gene            complement(87792..88218)
FT                   /pseudo
FT                   /locus_tag="Caul_5378"
FT   gene            complement(88389..89837)
FT                   /locus_tag="Caul_5379"
FT   CDS_pept        complement(88389..89837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5379"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: swi:Swit_4513 RND efflux system, outer
FT                   membrane lipoprotein, NodT family"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5379"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74496"
FT                   /db_xref="GOA:B0T9U7"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9U7"
FT                   /protein_id="ABZ74496.1"
FT                   /translation="MPMRTYWLFALLPVLSACTVGPDYVGPPDKGISSRFVRMEDTAVI
FT                   ATPLVARWWETLDDPILDGIEERALRANPNMAASQARLRQARAMLRIERANAAPNVAAG
FT                   ALAGHGRVPESGSGAAGAMIPALVGTDERSFDLYTAAFDASWEIDLFGGRRRGVEAATA
FT                   TAQAAEATLADAQVSLTAEVAHAYIGLRDTQKRIVLAKRSVELQQQMLDLTRQQFERGV
FT                   ASALDVERLSMQFENTNARVAPLVAQAEGFMNALAWLCGEQPGALDAILDPPRPAPLPP
FT                   PAVAIGDPEAMLRRRPDVRAAERRLAADTARIGVAEAARFPRLSWMGVIGIGGTQPSDL
FT                   THLDDFVALGAPTLQWSVLNFGRVQGQIRQRESARDEAEALYDAAVLGALRDTEDALAR
FT                   FRAGRATVAILARAKASADRSANLTQQNYRAGRASLIDALGAERHRIDAEDGLSAATAG
FT                   LTADYVALQKALGLGWLDGGVSAG"
FT   sig_peptide     complement(89760..89837)
FT                   /locus_tag="Caul_5379"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.728) with cleavage site probability 0.644 at
FT                   residue 26"
FT   gene            90015..90608
FT                   /locus_tag="Caul_5380"
FT   CDS_pept        90015..90608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5380"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: rpe:RPE_3837
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5380"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74497"
FT                   /db_xref="GOA:B0T9U8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9U8"
FT                   /protein_id="ABZ74497.1"
FT                   /translation="MTDTRTAILDAAARLYAADGYSAVSMRDVATEVSMTQANLYYHFR
FT                   DKAQLVEDTLEHVLVTRMSSLEDLFKTTASPEYKLQFFVEWFVTLLFNDLIFTQLMLRE
FT                   LIDGDMERVARLSRAVFDKPFSLIDGIVSAYSPGKNSTLTTASVIALIIGHVQMARILP
FT                   YLSSGHADHADPKIIAAHVLSTLQRALKDQSDAL"
FT   gene            90598..91692
FT                   /locus_tag="Caul_5381"
FT   CDS_pept        90598..91692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5381"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   pol:Bpro_5559 secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5381"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74498"
FT                   /db_xref="GOA:B0T9U9"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9U9"
FT                   /protein_id="ABZ74498.1"
FT                   /translation="MPFRDHAKRRTLPALGLALTTLAGCGEHGKTVDREPPAVRLPTTV
FT                   VQRADLPDFVAIPGAVTSDDRVDISSRVTGYVLLIAVHEGQSVRRGQVLARIDAREIEE
FT                   AIRQARAGLSAAQADLAHAEDDVIAQEPLAQTGAISRDVFRGASLRRDVARSTVARAQA
FT                   ALGAAQAQRPYVTIASPIDGVIVARPGQAGELATPGRTLVTVEARRRLLFKMFVPETDV
FT                   RHIAVDAPIEVRLDRLSDRTLSGVVRGIVPSGDTTTRRYEVDIALPPDPGLMPGMFGRA
FT                   RLVTGRRQSPRVPASAIVERGGLTGVFVVGKDGRVAFRWLRTGKEADGYVEIASGLGGG
FT                   ETILARADTSVRDGARLVQGPRTR"
FT   sig_peptide     90598..90687
FT                   /locus_tag="Caul_5381"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.771) with cleavage site probability 0.665 at
FT                   residue 30"
FT   gene            91689..94976
FT                   /locus_tag="Caul_5382"
FT   CDS_pept        91689..94976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5382"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   pna:Pnap_4181 acriflavin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5382"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74499"
FT                   /db_xref="GOA:B0T9V0"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9V0"
FT                   /protein_id="ABZ74499.1"
FT                   /translation="MSVPRLNLAGRLASSFITSKLTIVFIVGVLMAGVFAVALTPREEN
FT                   PQIVVPGAVVTVALPGASAQEVDQLIVGPLEGILSEMSGVDHTYGVARNSLGAVQVQFK
FT                   VGESPEDSLVKLYNRVMANRERLPAGAGIPTIRAVDADDVPVVTVTLASNAYDDYGLKR
FT                   VADRMAERLRSLPDVSVVSVRGGRDREIGVAFDPERLVAFSIALPQAYAAITANNLSTP
FT                   LSGPLRNGKVETIQLRGAFASVDDVRDLVVGVHASRPVYVRDVAIVTDGPPIEITALSR
FT                   FAFGSADTRARHAGTGEMPAVTIAVAKKKGANAVLVSRSVVDRIARMQQSFVPKGIHVV
FT                   VTRDDGKKADAAVNVLIEHLAIALFTVSLIMVLFLGWREALIVTLTVPLIFSITLAADY
FT                   FGGVTINRVTLFALILALGLLVDAAIVVIENIHRHYNTASSLTKQQATILATNEVGNAT
FT                   NLATLAVMLVFGSLFLVTGMAGNYFYPVAYNVPIAMAGSIIVAYIVTPWAANRWLRRHP
FT                   AADHDEPDDGHGHGHRDWMQRLYLRLIGPLQFNRRARRGLALAIFALILASSLQGAWQF
FT                   IRPSGVSGAVSPLGVALGFMPKDNKNTFNIVISMAETTPVEETDRMVREIGRLLSTNPN
FT                   VINYQSWIGQSGVVDFNGLLQGTADRRGGDVAEIRVNLVDKHARRLSSIEIVRAMRPKV
FT                   DEIRASYPGARVRLVEDPPGPPVRATVLAEIYGPESEGLRRLSAKVEAEFARTFDMVDI
FT                   SNTEPVDVLEQVLVPDREKAALSGVSVAQIAELLRLVYGGELVGRAHPADERNPVDIRA
FT                   YVPRRHAVDPTKLDGLFVNNTSGQPVALSELVKVSSSTADRPIQRKDNERVAFVGGELS
FT                   QSVPLYAVFDLNRRLSGINAPDGQPLTTGNLRFSPRAPDTIGGYQLLWDGEMRMTLDIY
FT                   RDMIVALGVALTAVYLLLVAYYRSFLIPMIVMSSVPLGIIGIFPGHWLFGVDFSATSII
FT                   GIIALSGVVIRNSLLIVDFIQENLKQGMTLDEAVRMAGAVRLRPIILTTLAIVLGSAIM
FT                   VSDPVFGGLAISLIFGTLVSTALTVFVVPILYQLNAVRRPKGPALSE"
FT   sig_peptide     91689..91799
FT                   /locus_tag="Caul_5382"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.965) with cleavage site probability 0.725 at
FT                   residue 37"
FT   gene            95221..95691
FT                   /locus_tag="Caul_5383"
FT   CDS_pept        95221..95691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5383"
FT                   /product="late embryogenesis abundant protein"
FT                   /note="KEGG: pna:Pnap_2516 late embryogenesis abundant
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5383"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74500"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9V1"
FT                   /protein_id="ABZ74500.1"
FT                   /translation="MSAKATTEKARTATQAAVETATRNAERTRKAVSVASSEAWAAAVQ
FT                   AAQDAQTAAALAARQSKEAHRQAGAESRVAAQAASEAAGTAAKAAEEASARTADAAKTA
FT                   AEARLDASAQTVAAAREAARKAVEAADKAALAAREAARKAEEAAKEESAKAG"
FT   gene            95747..96223
FT                   /locus_tag="Caul_5384"
FT   CDS_pept        95747..96223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5384"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_5553 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5384"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74501"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9V2"
FT                   /protein_id="ABZ74501.1"
FT                   /translation="MSESNRPTTIQDKLMADVKLIVADAEALLHATADQAEEKVTDLRT
FT                   RLQANLKAAQDRLAEAETTLMDATAETFRAAVVASALATSEAANKASEAAGEAAQKAEE
FT                   AVQKAAEVGKDAATHAVEAARDAARKAAAAARETAVKALDAVGKMAREAKDLIN"
FT   gene            complement(96706..97254)
FT                   /locus_tag="Caul_5385"
FT   CDS_pept        complement(96706..97254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5385"
FT                   /product="ATP-dependent transcriptional regulator,
FT                   MalT-like, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; KEGG: pmy:Pmen_0429
FT                   regulatory protein, LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5385"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74502"
FT                   /db_xref="GOA:B0T9V3"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9V3"
FT                   /protein_id="ABZ74502.1"
FT                   /translation="MQHDPEGSTSLTDLRTLLWTTHDASNWVDSRFPRCSAPPFAYAGT
FT                   ERPTIAEQRAADAVDIASRSGCYRTLLDEREFLEAFGSISAPLLNLVPSESELGHRELG
FT                   PGDRNVRSPSGEISIVLTRKELAMIQRIKEGFSNRDIAEKHRISEDTVKWHIRNIFSKL
FT                   QVKNRVQALLKAEQIGILR"
FT   gene            97523..97870
FT                   /locus_tag="Caul_5386"
FT   CDS_pept        97523..97870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5386"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   swi:Swit_5080 transposase IS3/IS911 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5386"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74503"
FT                   /db_xref="GOA:B0T9V4"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9V4"
FT                   /protein_id="ABZ74503.1"
FT                   /translation="MSRMTLMTGPERRRRWAHHERQQILLAAFAPGAVVADVSRQHDVS
FT                   TSLIYKWKREALAEATGGPAFSPAVVIDEPSPAPVGPELAVIVELASGARVSINANASP
FT                   RLVAATLQALR"
FT   gene            97867..98214
FT                   /locus_tag="Caul_5387"
FT   CDS_pept        97867..98214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5387"
FT                   /product="IS66 Orf2 family protein"
FT                   /note="PFAM: IS66 Orf2 family protein; KEGG: nha:Nham_2996
FT                   IS66 Orf2 like"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5387"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74504"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9V5"
FT                   /protein_id="ABZ74504.1"
FT                   /translation="MIPIASGVRVWIAAGHTDMRKGMQGLALLVQEGLGRDPFAGDVFV
FT                   FRGRGGSLIKALWHDGLGLSLYAKRLDRGRFVWPVSADGAVALTAGQMSYLLEGIDWRN
FT                   PQHTWRPSAAG"
FT   gene            98285..99973
FT                   /locus_tag="Caul_5388"
FT   CDS_pept        98285..99973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5388"
FT                   /product="transposase IS66"
FT                   /note="PFAM: transposase IS66; KEGG: mag:amb3325
FT                   transposase and inactivated derivative"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5388"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74505"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9V6"
FT                   /protein_id="ABZ74505.1"
FT                   /translation="MDADLAALPDDIEALKAALLVARAEVAQAQDVAARAQAEASRAQA
FT                   EAAEAKARVSDDQALIAHLKLQIQKLNRERFGPSSERTARLLDQLELQLEELEASATED
FT                   ELAAEMAAARTTTVAAFSRKRPSRQPFPEHLPRERVIVPGPTACACCGGLRLSKLGEDV
FT                   TETLEVVPRSWKVIAHVREKFSCRDCEAIGQAPAPFHVIARGWAGPSLLAMILFEKFGQ
FT                   HQPLNRQADRYAREGVPLSLSTLADQVGACTAVLAPLFQRLEAHVLAAERLHGDDTTVP
FT                   VLAKGKTDTARLWVYVRDDKPFAGSAPPGAVFYYSRDRGGEHPQAHLSGYAGLFQADAY
FT                   GGYGKLYEPGRNPGPILEAACWAHARRPFFVLADLEQNARRKARGAAPAVISPIALEMV
FT                   QRIDALFEIERGISGQDADRRLAVRQALSAPLVAEMEIWMREQRAKLSRGHDLARAFDY
FT                   MLKRWAAFTRFLDDGRVCLSNNAAERALRGVAMGRKSWLFCGSDRGGQRAAVMYSLIVT
FT                   AKLNDIDPQAWLADVLARIAEHPSQQLDELLPWNWQPLATADRAA"
FT   gene            complement(99989..100792)
FT                   /locus_tag="Caul_5389"
FT   CDS_pept        complement(99989..100792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5389"
FT                   /product="regulatory protein, LuxR"
FT                   /note="KEGG: pmy:Pmen_0429 regulatory protein, LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5389"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74506"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9V7"
FT                   /protein_id="ABZ74506.1"
FT                   /translation="MTRGLSCPPLLRGGSFSAPVVFGAPTIALGLAWSQIFSHDHERAA
FT                   GLLADLRAVDLEFFDQQTRRKVECWRDLVAAIGMATADNLIESRLQCEAWVKLHGDADL
FT                   VCKGAILTCLCFIAGSEHRFDDQIKLTFDATSINNIADHRYALGWLHSATIYSALAKGD
FT                   VRSGAELLRMARKDENANINSTPFSANLLNTLELEIQYEANRLDGINIRIDDILEFVRQ
FT                   HGVVDFIFSAYRTAAAIDRHNGDLKGAIGRLQEMRVIAGEFVRIR"
FT   sig_peptide     complement(100721..100792)
FT                   /locus_tag="Caul_5389"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.854) with cleavage site probability 0.816 at
FT                   residue 24"
FT   gene            complement(101034..101603)
FT                   /locus_tag="Caul_5390"
FT   CDS_pept        complement(101034..101603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5390"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: maq:Maqu_0424
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5390"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74507"
FT                   /db_xref="GOA:B0T9V8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9V8"
FT                   /protein_id="ABZ74507.1"
FT                   /translation="MVGMDTKAALLDSAEHAVRARGYDGFSYADLAADVGIRKASIHHH
FT                   FPTKADLALALIARYSENFFLRLNQISESHRTGGARLNHYIAACRDALDGGRKLCLCVA
FT                   FCVGRDGLSPEVLAKLDLFHRTVAAWLGEVFAVGKADNSIAYVMDYAAEAHACLAQMEG
FT                   AQLIARAASDARRFDAAVAQLQQRIA"
FT   gene            101710..102090
FT                   /locus_tag="Caul_5391"
FT   CDS_pept        101710..102090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5391"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: swi:Swit_2866
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5391"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74508"
FT                   /db_xref="GOA:B0T9V9"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9V9"
FT                   /protein_id="ABZ74508.1"
FT                   /translation="MYFHVMLGANDLDASRRFYDATFGVLGVSAKGPFRDDPPAFLYGE
FT                   PETGLFLVTKPQDGKEACHANGGTVMFKARSKAMADAWYEAGLASGGSDVSGPPAPGAL
FT                   PNTVMGYLRDPTGNKVAVVAFV"
FT   gene            102130..102813
FT                   /locus_tag="Caul_5392"
FT   CDS_pept        102130..102813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5392"
FT                   /product="anti-ECFsigma factor, ChrR"
FT                   /note="KEGG: rde:RD1_0536 transcription negative regulator,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5392"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74509"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR025979"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9W0"
FT                   /protein_id="ABZ74509.1"
FT                   /translation="MDLNTDFSQRVLIHGDSVPWVPSPAANVDRRMLDRIGGEVARATS
FT                   IVRYAPGSLFPPHTHGGGEEFIVLDGVFQDEHGDYPAGTYVRNPPTSRHQPASAKGCTI
FT                   FVKLWQFDPTDRTGVNINMAEQVAVAVLGRPGVAVIPLFRDLRETVSLETWSPGAEISA
FT                   DVPGGAELLVLDGTCLESGESMRALTWLRIPVGSQIQAVAGDQGTRVWIKTGGLRFTNP
FT                   PGSQP"
FT   gene            complement(102944..103228)
FT                   /locus_tag="Caul_5393"
FT   CDS_pept        complement(102944..103228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5393"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ccr:CC_2741 IS511, transposase OrfA"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5393"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74510"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9W1"
FT                   /protein_id="ABZ74510.1"
FT                   /translation="MARKHGVSEGTIYAWKAKFGGMSIRRQIRRRRDNECVADRRDVAA
FT                   ARFPNFVVHRRSTVTGRPKPFATATPGQPTVANPINGLTLERLRKHPSV"
FT   gene            complement(103516..105273)
FT                   /locus_tag="Caul_5394"
FT   CDS_pept        complement(103516..105273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5394"
FT                   /product="putative methyl-accepting chemotaxis sensory
FT                   transducer"
FT                   /note="KEGG: rle:RL4038 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5394"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74511"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9W2"
FT                   /protein_id="ABZ74511.1"
FT                   /translation="MSRNQIAAFSTSVEPADGLAAGLENARSRIETRFLEGGTVLLGVL
FT                   DSVSKMIDTLDTMMVSLNGEAAERTRADLARIMAKLTELPRLEEDRQHSLSKIADIEHS
FT                   LVEEVVRMRETLRYLHSFALTAKITGAGVSEFAGFAEEIIDRIGYGGDQVKSFAAKLVE
FT                   LSVQLKPAAARGQQILTSYRELVPKIAAELARVFGQLTEHHNQLAVAAKSVRKLADAVQ
FT                   AKLATVLSAMQVGDITRQRIEHCQSSLYLIDEYLDSVAGRALDAGQRSRLRACVLTLVH
FT                   RQLDQTRADFRRDTAKIVSTVGSFNMDISAILSLRQGMNDDEGTGNSLIRQMESNIASA
FT                   QGVVQTVTATATESDTLSRSTGRIVRELLDGIEIVRVVRTDIQYMALNMNLRCSRIGEQ
FT                   GRAINVVTTELRVFAGQMADSTESILGRLQELGVCAEAAGRGADVTGDTEIGLYQQLAV
FT                   ALDDIRQAADRMEASLTAVEQQGRAAVQQMETTIAKLDFQAELGDILDHCAELVAEQAS
FT                   ASLPDTSDLQGPMGEVGSGIGRLYTMAAERELHAKFFGASPTPAVSQAAAGASAAPASD
FT                   EELFDETLF"
FT   gene            105703..106002
FT                   /locus_tag="Caul_5395"
FT   CDS_pept        105703..106002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5395"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   ccr:CC_2728 ISCc3, transposase OrfA"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5395"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74512"
FT                   /db_xref="GOA:B0T9W3"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9W3"
FT                   /protein_id="ABZ74512.1"
FT                   /translation="MRPKSLAAKATPGERVVKDIRRATRRHFSAEDKIRIVLDGLRGED
FT                   SIAELCRKEGIAQSLYYVWSKEFMEAGKRRLAGDTARAATTDEVRDLRRESTAF"
FT   gene            complement(106916..109432)
FT                   /locus_tag="Caul_5396"
FT   CDS_pept        complement(106916..109432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5396"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: ccr:CC_3336 TonB-dependent receptor,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5396"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74513"
FT                   /db_xref="GOA:B0T9W4"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9W4"
FT                   /protein_id="ABZ74513.1"
FT                   /translation="MRFTQVLCGTASAAVLAGLSVASVAQAQQTETMTVDSIVVTAQKR
FT                   EQNLQDVPVVVTAVGAKLLQDTGVKDIKDLTILTPGLTVTSTTSEASTTARVRGVGTVG
FT                   DNPGLESSVGVVIDGVYRPRNGVSFGDLGEMDRIEVLKGPQGTLFGKNTSAGVINIVTK
FT                   EPEFGFGAAAEATLGNFNAHGLSASVTGPLFGTETLAGRLYVAARERDGYNDVLTGKGP
FT                   SKRDQDQDQGFYTIRGQLLFVPNDEATFKLIGDYTKRDENCCGAVQIRTGPTAPILNAL
FT                   AGGVALAPTAKPYDRVAYSNRGAPSSIEDKGISLEGNIELPIGELTSITAIRNWRTDNG
FT                   QDSDFSTADLAYRNKDGTNYSEFTTYTQELRLAGKTGNLDWLVGTFLADERLDNKANFL
FT                   YGNDYEQYLGRLLSRSAANPAGIGNFISLLTGRAPNTTFTPGQGLYDKYNQRAKTIALF
FT                   TSNTYQFTDAFSITAGLRYSIDKKDLDTYQTTSDGGVGCGIGLSTAGQARIAGIVGAAA
FT                   TPTVVGNLCLPWANPLFNGRGTHQKRTDKEWSGTIKAAYRFSPEVFSYASYARGYKGGG
FT                   FNLDRTQSSNGLQSGGLGVVPIYDTSFEGEFVDSYEIGLKNTLFNRSVLLNLTGFYQKF
FT                   TDFQLNTFLGTSFAVASIPEVTSQGVDADFLWFTPVRGLTVQSGFTYAKTEYGNQKIPN
FT                   DSTNALALLPGQRLSLAPEYSASGSLTYERPVGDSYKARFNVGAKYSSEYNSGSDLFPP
FT                   KLQESYTVVNARIGVGTADDAWTVELWGQNLFDEEYTQVGFNAFLQGSSGLSATQATYV
FT                   PANDTITYDAFLGAPRTYGVTLRAKF"
FT   sig_peptide     complement(109349..109432)
FT                   /locus_tag="Caul_5396"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.894 at
FT                   residue 28"
FT   gene            110076..110201
FT                   /locus_tag="Caul_5397"
FT   CDS_pept        110076..110201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5397"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="KEGG: mmr:Mmar10_2756 transposase IS3/IS911 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5397"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74514"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9W5"
FT                   /protein_id="ABZ74514.1"
FT                   /translation="MPSEMKRLRQLKDENARLKRIVTDLSLDKEMLQDVIHARAC"
FT   gene            complement(110878..112494)
FT                   /locus_tag="Caul_5398"
FT   CDS_pept        complement(110878..112494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5398"
FT                   /product="ABC-1 domain protein"
FT                   /note="PFAM: ABC-1 domain protein; KEGG: sfr:Sfri_1807
FT                   ABC-1 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5398"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74515"
FT                   /db_xref="GOA:B0T9W6"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9W6"
FT                   /protein_id="ABZ74515.1"
FT                   /translation="MPPLTLSQNDFRRLATVLRTLAPSAARPGLRKLGLLRGGVTDDTS
FT                   DATYEGFVTALEALGPTFVKLGQIMATRSDLLPPELTERLGRLHDSVAPVPFEQIREQL
FT                   AIDLGGTPEDIFAEFFPTPIAAASIAQVYAARLTTGEEVVLKVRRPGIGAIMRADLRLL
FT                   AAAARVVERRAPALRRHQPVRVVSELSEALLEEIDFRIEARNQSEVRKRATVFHVPIVH
FT                   ERFTTERTMVSTRIRGRSPNAMFRNEEPALARALAPEAARGLLGMILLDGVFHADPHPG
FT                   NVLVTPDGRLALLDFGSVGRLSVKRREQVLVVLGSLVDADVAAVSDVLMEWAGRSGPPP
FT                   TGLEQGVERFFLRYAADSGRPIRLAEAIGEFLSIARDNALTLPPDLLLLLRALGIAEGL
FT                   ARTLDPELDVVDAIAPVVVKAFASRFAPKALATRAFRAFKELDQILATGPEAIRRGIGR
FT                   LSRDGLAIRVSSSELADLPLAVKRAGESLSLAVVVAALVVAAAIVTVANGGQVAAPGRT
FT                   AILVVSGVGLVAFVVRLLRRD"
FT   gene            complement(113108..113836)
FT                   /locus_tag="Caul_5399"
FT   CDS_pept        complement(113108..113836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5399"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein;
FT                   SMART: AAA ATPase; KEGG: swi:Swit_4981 IstB domain protein
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5399"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74516"
FT                   /db_xref="GOA:B0SXT4"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:B0SXT4"
FT                   /protein_id="ABZ74516.1"
FT                   /translation="MQRHEMIEALGQLGLKGMAGAFDETVTTGLQRNRTAMEILADLLK
FT                   AETNHRQAASIRYRLTAAKLPVMKDLAAFSFEGSPINEGLVRSLYDGAFLANHRNIVLV
FT                   GGTGTGKTHLAIAITANVVRSGARGRYFNTVDLVNRLEDEARRGKAGALAAQLSRLDLV
FT                   VLDELGYLPFAQSGGQRLFHLVSKLYERTSVIITTNLTFAEWPTVFGDAKMTTALLDRL
FT                   THHCDIVETGNDSWRLRNRA"
FT   gene            complement(113823..115331)
FT                   /locus_tag="Caul_5400"
FT   CDS_pept        complement(113823..115331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5400"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   sal:Sala_0850 integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5400"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74517"
FT                   /db_xref="GOA:B0SXT5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:B0SXT5"
FT                   /protein_id="ABZ74517.1"
FT                   /translation="MVETVVRIRREYAAGKAIKAICRDLRLSRKVVRKAIRAEEGAFSY
FT                   QRTTQPFPKIGPVRDRLVQLLTENEARPRRDRLRLTRVWDLLVQEGYDGSYDSVRRYAA
FT                   RWREETKTAPGDGGTAFVPLMFAPGEAFQFDFSHEDVEVAGQPMRVKAAHVRLCASRAV
FT                   YVRVYPRETQEMVFDAHARAFAFFGGVPTRGIYDNMKTAVDAVFLGKQRVFNRRFLLMA
FT                   DHYMFEPTACTPAAGWEKGQVENQVQTSRERFFKPRLRFASLEELNGWLEAECRRWARL
FT                   HPHPEQREITLAQALEAERPALQAILAPFDGFHEVEHAVTGTCLITFDRNRYSVMAKAA
FT                   KRTVQVRAYADKIVVRCAGEVVAEHARSFGRGRTIYDPWHYLPVLARKPGALRNGAPFQ
FT                   DWSLPPALTRLSKKLGRGDEADRRFVRVLAAVLIDGLDVVDDAVREALDAGAASDEVIL
FT                   NILARRREPPAPQPITTCEALVLRHPPIADCARYDLLRGPRAAA"
FT   gene            115582..116364
FT                   /locus_tag="Caul_5401"
FT   CDS_pept        115582..116364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5401"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; KEGG: pla:Plav_1798
FT                   regulatory protein IclR"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5401"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74518"
FT                   /db_xref="GOA:B0T9W9"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9W9"
FT                   /protein_id="ABZ74518.1"
FT                   /translation="MQKPDPSIVKSAARTLEIFEYFDEVRRPAHIQDVALSLGYPHSST
FT                   GALLRSLTDLGYLEYSIEDKTFFPSIRVSLLGNWVGDETLSLRLIQQQMREIAEATQMT
FT                   VVLGARSGGYCHYVRAIQGTTPVRYHLKAGTRLCLARSTVGSALLSMETTDRQPRLIAQ
FT                   ALSVWDSDEGAPRPEKLAADLALVAARGYAFNSGLVNAQAAMLAIPLAIRTQTRPLAIG
FT                   LAAPKNLFRGRRPELIRILREALGRLADQTHHQIDKSR"
FT   gene            117214..118074
FT                   /locus_tag="Caul_5402"
FT   CDS_pept        117214..118074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5402"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: pla:Plav_1777
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5402"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74519"
FT                   /db_xref="GOA:B0T9X0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9X0"
FT                   /protein_id="ABZ74519.1"
FT                   /translation="MNRPTPVAFKTSDGIVLAADRYGARGRGSVILAHGGGQTRHAWAK
FT                   TASALADREWEVIALDLRGHGDSGWSPTGDYRIHRFAEDLVDVVGTMPGRAAIIGASLG
FT                   GLAGLYAEAEVAPGSFSSITLVDIVPSMDSDGAAKVMEFMGAHVAQGFGSLEEAAAVIA
FT                   AYLPHRPRPKDLSGLAKNLRQCDDGRLRWHWDPGFVSGVHRGRTAQDIDAFQARLPGLT
FT                   PPVHLIRGRLSELVSLEAAENFVALLPNAKFTDVAGASHMVAGDRNDAFLNAAVEFLES
FT                   LDHQP"
FT   gene            complement(118760..120373)
FT                   /locus_tag="Caul_5403"
FT   CDS_pept        complement(118760..120373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5403"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   maq:Maqu_0617 drug resistance transporter, EmrB/QacA
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5403"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74520"
FT                   /db_xref="GOA:B0T9X1"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9X1"
FT                   /protein_id="ABZ74520.1"
FT                   /translation="MPQTEALFARYGSMYRWLATAAAMVSAIAVVLSSTIVNVAVPAIM
FT                   GQFGIDQTRVQWLATGFLAAMTVTMLLSAWCERTFGQRQTMMVALGVFLFGSVLGGLAP
FT                   DDTVLIVSRVIQGAAAGVIQPLAMVVMFQVFPPDKRGAAMGIFGIGVVLAPALGPWVGG
FT                   LLMDSFDWRFLFYLGIPFGLGGITLANLFLPDRDPAAAKARLDWPALVWLSVALLALLE
FT                   TMSSGQRQGWASTPVLAGFAITMTCAAAFLVRESRIPHPLLDLRVFASPPFAAAAAVSF
FT                   VLGAGLYGTTYLLPVFVQQIQNFTPTQAGLLLMPAGFVLVIVFPAAGMMSDRLSPGLLI
FT                   GAGMAIFAYSSWLTAHVSADTAFWTLAWWTVIGRIGMGFVFPSLSSAALKVLPLELLSQ
FT                   GSGSMNFTRQLGGALGTSILGVIIERRTAFHGDALAATQTSDNSTTGNYLMEAARTVHA
FT                   MGLGPLEQLPAAGWLLGQGVYYQAAAAAYRDGFLITAMVFAAALAPTFVLHRALSRVAG
FT                   RSLTGSGSASGGEASRATKV"
FT   sig_peptide     complement(120254..120373)
FT                   /locus_tag="Caul_5403"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.766) with cleavage site probability 0.657 at
FT                   residue 40"
FT   gene            complement(120360..121334)
FT                   /locus_tag="Caul_5404"
FT   CDS_pept        complement(120360..121334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5404"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   maq:Maqu_0618 secretion protein HlyD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5404"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74521"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9X2"
FT                   /protein_id="ABZ74521.1"
FT                   /translation="MTPALPQMSLRFPARLAGRIVQLDVKAGDQVKRGQLLVSIEPRDA
FT                   QYSLAEIDANIANLRAQRAQLLAQQSLVRNTVGNQAGVSSATVDSAQADYLTRQAELTV
FT                   ARAAFQRTEILYGKGLVAKSRFEEDQARLRAAEQTAVRARAAISGAKAGAEVTQTGLQQ
FT                   VQVIAEQIAGVDAQIDALAARREQQRLDLGRRQIAAAFNGVIDQTVVDAGEYVSPGSRI
FT                   LLYHDPHSVWVDVNVKETEFRKLRVGAPAKVKVDAYPGRTFAARVQRLGGAATSQFALL
FT                   PNPNPSGNFTKVTQRLPVRLAIIQQQNLLRPGMMAEVTIDATD"
FT   gene            complement(121488..121916)
FT                   /locus_tag="Caul_5405"
FT   CDS_pept        complement(121488..121916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5405"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG: maq:Maqu_0113
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5405"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74522"
FT                   /db_xref="GOA:B0T9X3"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9X3"
FT                   /protein_id="ABZ74522.1"
FT                   /translation="MSARQAFGQAANLMSRRWRARLDERLKDTGLSQARWLALLELSSS
FT                   DGGLTQRDLADRLGIEAPTIVRQLDDLERRALIARREAPNDRRAKCVTLTPAAEPVLDH
FT                   ITCIAATLRDELLADISDADLATCLSVLGRVNRRLDQR"
FT   gene            complement(122146..122724)
FT                   /locus_tag="Caul_5406"
FT   CDS_pept        complement(122146..122724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5406"
FT                   /product="yecA family protein"
FT                   /note="TIGRFAM: yecA family protein; KEGG: bms:BRA0555 IS66
FT                   family element, orf4, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5406"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74523"
FT                   /db_xref="InterPro:IPR011978"
FT                   /db_xref="InterPro:IPR036255"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9X4"
FT                   /protein_id="ABZ74523.1"
FT                   /translation="MTLEALEDWFERAKPPVHTAGVSMMDGFLAGVVISPAFIHPETWL
FT                   WHLIGDHEKRAYAGTKADAAVQAIVAHYNKISDVLANAPHAYAPIYMRTDEGEVLVEDW
FT                   ANGFYGAMRLNMAAWQPLFETFESAAPLTAILVNCTKPDGAPIYDGMSPAIPALELGET
FT                   WRIIPEAVSVIREQCAPRRAASMGTLATK"
FT   gene            complement(122748..124314)
FT                   /pseudo
FT                   /locus_tag="Caul_5407"
FT                   /note="transposase IS66; orf3"
FT   gene            complement(124364..124717)
FT                   /locus_tag="Caul_5409"
FT   CDS_pept        complement(124364..124717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5409"
FT                   /product="IS66 Orf2 family protein"
FT                   /note="PFAM: IS66 Orf2 family protein; KEGG: smd:Smed_6365
FT                   IS66 Orf2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5409"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74524"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9X5"
FT                   /protein_id="ABZ74524.1"
FT                   /translation="MIAFGPELKIVVAAQPIDFRKGVNGLVALVTQALHADPYCGDIFV
FT                   FRSKRADRLKLIAWDGTGVLLVSKVLESGAFFWPPVVNGVVRLNSSQMAMLLAGMDWRR
FT                   VIERPVNRPTKAG"
FT   gene            complement(124714..125055)
FT                   /locus_tag="Caul_5410"
FT   CDS_pept        complement(124714..125055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5410"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   bmb:BruAb2_0666 hypothetical transposase IS66 family
FT                   element, orf1"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5410"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74525"
FT                   /db_xref="GOA:B0T9X6"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9X6"
FT                   /protein_id="ABZ74525.1"
FT                   /translation="MISGVYRRKSWSAQDKALITAESFEPGARVSDVARRYDVSLGLLH
FT                   HWRRKVRQHGAPAEPMFVPVRLASDEVAPVARSEGRIEIELAGARIWVTSAVDAATLRV
FT                   VFAALRTGA"
FT   gene            complement(125052..125213)
FT                   /locus_tag="Caul_5411"
FT   CDS_pept        complement(125052..125213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5411"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5411"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74526"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9X7"
FT                   /protein_id="ABZ74526.1"
FT                   /translation="MEWAPMIAGMRRLDRQLGEGLGTPAAQGVIRTIISIILIIDLADL
FT                   LVDGAGSR"
FT   gene            complement(125281..126039)
FT                   /locus_tag="Caul_5412"
FT   CDS_pept        complement(125281..126039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5412"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein; IstB
FT                   ATP binding domain protein; SMART: AAA ATPase; KEGG:
FT                   bja:blr8220 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5412"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74527"
FT                   /db_xref="GOA:B0T9X8"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013690"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9X8"
FT                   /protein_id="ABZ74527.1"
FT                   /translation="MLAHPTHDRLIGLGLAGMAKAFEEQRSSPDLAALSFEERVGIMAD
FT                   REAAERDTKRMSARLKFAALRQDACVEDIDLRTPRGLDRTLLARLVAGDWIDRRQNCLI
FT                   TGPTGVGKSWLACALGHKACRDGRSVFYQRVPRLFEALALARGDGRHGRLLKTLGRIDL
FT                   LILDDWGLSVLGQSQRIDLLEILEDRNGRGSTIVTSQIPADQWHEVIGDPTLADAILDR
FT                   LVHNAHRLNMTGESMRRITARRDLDAGLNP"
FT   gene            complement(126060..127217)
FT                   /locus_tag="Caul_5413"
FT   CDS_pept        complement(126060..127217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5413"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG: bja:blr1834
FT                   putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5413"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74528"
FT                   /db_xref="GOA:B0T9X9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017895"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9X9"
FT                   /protein_id="ABZ74528.1"
FT                   /translation="MPTERLSMRRIRDLLRLKFENGLSSRLIATSLGISKGSVGDYLQR
FT                   AQVAGLSWPLPDDMTDTALERRLFPGPPAPSVVPRCEPNWAQVDQELRRPGVTRSLLWQ
FT                   EYRADHPDGYGYAWFCQHYDAWKRRVSPTMRQNHAAGEKVFVDFAGDTIDVIDPLTGVA
FT                   QAMKLFVAALGASSYVYCEARPSEGLADWIGCHVGMFAFFGGVTAIIVCDNLKSGVTKP
FT                   DRYEPGINRTYQDMARHYGTTVMPARPYKPRDKAKVEQSVLLVERWVLARLRNRRHAAW
FT                   TPARILAAAEKIGPATAALSQAIMTDRPHPEQGFRTCLGILALEKTYGPARLEAACQRG
FT                   DQIKARSVSSIRSILKTGLDRAFLEPEPDPQPLSHGNIRGRAYFH"
FT   gene            complement(127451..128128)
FT                   /locus_tag="Caul_5414"
FT   CDS_pept        complement(127451..128128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5414"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: atc:AGR_pAT_139 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5414"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74529"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9Y0"
FT                   /protein_id="ABZ74529.1"
FT                   /translation="MALAKNGVAIKEIVRRTGHSRGLVRQILRGQRSDVFRLRESSLEG
FT                   YLPWLDAQWSAGRRNGAELWRQLRAQGFRGSLRVVTEWATRRRRADQVNADTLSHIPSA
FT                   RTISRLMTTSRDTLSKAETVTVAAVETGVPALIEAREIIAAFHVMIRRKTEGDLCAWIE
FT                   RGRASLVASFANGVDRDISAVRAAITSGWSNGQTEGQITKLKLVKRQMYGSRREHPTYR
FT                   CVA"
FT   gene            complement(128263..129072)
FT                   /locus_tag="Caul_5415"
FT   CDS_pept        complement(128263..129072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5415"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein;
FT                   SMART: AAA ATPase; KEGG: rsq:Rsph17025_3496 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5415"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74530"
FT                   /db_xref="GOA:B0T9Y1"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9Y1"
FT                   /protein_id="ABZ74530.1"
FT                   /translation="MKPADPIDAGRLTLALNELRLPAIKTIWPDFAVRADKEGWPAARF
FT                   LAALTEHELAERASRRIQRHLDEARLPPGKTLDGFDFDAVPTVSKAQVMALAAGDSWLD
FT                   NGANLLMFGPPGGGKSHLAAALGLALVENGWRVFFTRTTDLVQRLQTARRDLQLEAAIA
FT                   KLDKYHLLILDDLAYVTKDQAETSVLFELISARYERRSLLITANQPFGEWGRIFPDQAM
FT                   TLAAVDRLVHHATIFEMNVESYRRRTAIERKRGPGRPLIRATIKTSA"
FT   gene            complement(129069..129548)
FT                   /locus_tag="Caul_5416"
FT   CDS_pept        complement(129069..129548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5416"
FT                   /product="putative transposase"
FT                   /note="KEGG: bja:bll5000 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5416"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74531"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9Y2"
FT                   /protein_id="ABZ74531.1"
FT                   /translation="MRLYDDRLDVYLGASLQMTMPRGRARPNGKHGHVVDYRHVIHSLK
FT                   RKPMALLGLVYRDKLFPRQAYSRAFEAMVAKLPARTACRNMVDLLALALAHDRACEGEL
FT                   AERITLDLDGGRLPDMKVLRALFMPDIAALPEIIVSYTSLSLYDELATVFTGVAA"
FT   gene            complement(129704..129904)
FT                   /locus_tag="Caul_5417"
FT   CDS_pept        complement(129704..129904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5417"
FT                   /product="IS30 family, transposase"
FT                   /note="KEGG: ccr:CC_1761 IS30 family, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5417"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74532"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9Y3"
FT                   /protein_id="ABZ74532.1"
FT                   /translation="MSRTQPFLPRGIHREIRRNWFDDGPWLRGYFAIAADERASSRRRR
FT                   VGKLHHDPELARFVTERLRET"
FT   gene            complement(129973..131364)
FT                   /locus_tag="Caul_5418"
FT   CDS_pept        complement(129973..131364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5418"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: swi:Swit_0451 RND efflux system, outer
FT                   membrane lipoprotein, NodT family"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5418"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74533"
FT                   /db_xref="GOA:B0T9Y4"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9Y4"
FT                   /protein_id="ABZ74533.1"
FT                   /translation="MMRRLFSIVLCGLAVQGCAVGITPAPPAARVTAPIAWRAPAAGGQ
FT                   PAVSPTWWDAFGDPELRHAVEAALLHNLDIAAAETRVREADALFVQAHSALVPTLTASV
FT                   AVQDAQALNSLGRASDSATAQPQLQIAYEVDLWRRLRQADASARALLQASQYGRAAVAL
FT                   SIAGATARGYIGLASLDAQLQIARETLASRDEALRLATRRADNGVTSRLELTQARSERE
FT                   GAAQRVPALVLAVERQENGLRLLLGGLPGPVPRGAISSLTLPTVAPGLPSELLQRRPDI
FT                   SQAEAQVRAADAALAASKAALLPQVRLTGSVGELFVQHLDPVSVWSVGGSALATIFDAG
FT                   RLSSQVAGAEARRDASAYAYRHTVLNAFSEAENALEGVSDLTEQRTAAERQRVALREAL
FT                   HHATSRYRAGYASYLEQLDAQRGLLSAELAVVQLQEAQLSNSLTLYQALGGGWSRGGRQ
FT                   AGPDE"
FT   sig_peptide     complement(131305..131364)
FT                   /locus_tag="Caul_5418"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.552 at
FT                   residue 20"
FT   gene            complement(131364..132521)
FT                   /locus_tag="Caul_5419"
FT   CDS_pept        complement(131364..132521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5419"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   swi:Swit_0452 secretion protein HlyD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5419"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74534"
FT                   /db_xref="GOA:B0T9Y5"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9Y5"
FT                   /protein_id="ABZ74534.1"
FT                   /translation="MSAPNSDNPHHPNTAPQPEDVSPANNAPRTETPAPAAPPVKARSP
FT                   VPTLVAVCLGLVAILLILFAWKLPPFSGAGERTDNAYIRGRVTIVSPQVSGYVAEVRVK
FT                   DFDNVEAGQALFRVDDRIYRQRLDQAKATLAARQADLDNATQTGASRRATLGARVAEVG
FT                   SAEAQLVRAQADMARVSELALDGSVSLRERDQSLAGLRAAEATVRQAAAGRDVAEQDVV
FT                   AVGVNREALVAAVEGARAAVRLAEIDLSNTVITVTENGQLGQVGARLGQYVTAGSQLVS
FT                   LVPPSYWVIANFKERQTSRMAVGQKVHVSVDALGDRHLAGRIEQISPATGSEFAVLPAQ
FT                   NATGNFTKIAQRLPVRIALDPGQQGLERIRPGMSVVAYVDTPGER"
FT   gene            complement(132549..134270)
FT                   /locus_tag="Caul_5420"
FT   CDS_pept        complement(132549..134270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5420"
FT                   /product="transporter, putative"
FT                   /note="KEGG: pfl:PFL_2540 transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5420"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74535"
FT                   /db_xref="GOA:B0T9Y6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9Y6"
FT                   /protein_id="ABZ74535.1"
FT                   /translation="MTHSPFFAPRAKLGQPIGEVPEWKPHELPMIPGSPSTPDMPVRRR
FT                   VLFGLVSVLLGLTGSLGTALVTVNLFQIQGELGLTPVEGAWLTSAYLMTNIAMNLLLVK
FT                   YRQQFGVSSFVKVFLSLYALAAVAELLVHSFPTGVAVRAFSGVAGAALSGMTVFYAMQT
FT                   LPAKMKIQSLLIGIGITQLGIPIARVISPMMIDLGGWQTLGALEAALALASVVAVHLVA
FT                   IPHGMRIHAFEPADILSFLLLASGLALFVAVLSLGRLEWWFERPWLGIAAASGVALVTI
FT                   GWIHEHRRANPLIDTWWFTSASYVRFAVSILFVRMLLSEQPVGTTGLLQALNMAPEQLR
FT                   HLYATVAVATLAGTLVGAFSLMISPKLVLAQSFATLTLIALGSWMDAHATVQTHPANLF
FT                   LSQALVSFAAAMFMGVVVMQGLDHLMRRGFGSIITFVVTFSLTQVLGGLLGGAILSTFQ
FT                   TLRSAHHAAYLAEALTATNPQAAMTIQTYVGAYASTIADPAARTTQGLSVVAQQVLQQA
FT                   NILAFNDVFFLIFWIALAQLVLTAAFTGRSLWQARRQATASATAPPDDVRTAGAVV"
FT   gene            complement(134267..134815)
FT                   /locus_tag="Caul_5421"
FT   CDS_pept        complement(134267..134815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5421"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: xcb:XC_3478
FT                   transcriptional regulator TetR/AcrR family"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5421"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74536"
FT                   /db_xref="GOA:B0T9Y7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9Y7"
FT                   /protein_id="ABZ74536.1"
FT                   /translation="MSPRGELITRNRAAILAAAHHVFSTVGVQAPLELIVEASGVGRGT
FT                   LYRHFADRTALLVALFDAEVERIMNGLAPHPVERQIEVFLTHVATNGERSPALSEAWRA
FT                   LPPDHVEMRASRERLKDLLKRPLQAAIDTGRLRATTTPDTLILVARMIGAGVRAPVADG
FT                   KLEQTALAVVLHGLLASPS"
FT   gene            complement(134856..135200)
FT                   /locus_tag="Caul_5422"
FT   CDS_pept        complement(134856..135200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5422"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mlo:mll9327 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5422"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74537"
FT                   /db_xref="GOA:B0T9Y8"
FT                   /db_xref="InterPro:IPR007069"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9Y8"
FT                   /protein_id="ABZ74537.1"
FT                   /translation="MVAVLHTWGQNLHHHPHIHCVVPGGGLSPDNQRWVACRPGFFLPV
FT                   RVLSRLFRRLFLEHLQDAFETGELRFFGKLAGLAASFGHYLWRDEADVGVRTRATRGKS
FT                   QTKESAITGV"
FT   gene            complement(135505..136605)
FT                   /locus_tag="Caul_5423"
FT   CDS_pept        complement(135505..136605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5423"
FT                   /product="putative transposase"
FT                   /note="KEGG: nha:Nham_3895 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5423"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74538"
FT                   /db_xref="GOA:B0T9Y9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9Y9"
FT                   /protein_id="ABZ74538.1"
FT                   /translation="MGRASLRMRTGVTVHLSPTDRKRLRVIVDDGNSPQKHVWRARIVL
FT                   CTADGLGTAAIMRAAGVSKTAVWRWQERFMDEGVDGLLRDKTRPARVQKLADEVAERIV
FT                   ALTLGEPPGETTHWTGRVMAGVAGVSLTSVQRIWKAHGLAPHRIRTFKLSNDPRFAAKV
FT                   RDIVGLYVDPPAHAVVLSVDEKSQIQALDRTQPGLPLKKGRAGTMTHDYKRHGTTTLFA
FT                   AFDVLEGKVIGRCVQRHRHQEFIHFLNAVEREVPAGKTVHAILDNYATHKHPKVIAWLG
FT                   RHPRWTFHFTPTSASWINAVEGFFAVLTKRRLKRGVFKGVVDLQAAINRFVAEYNQHPK
FT                   PFVWTADPDKIIAAANRGHQTLESIH"
FT   gene            complement(136633..137229)
FT                   /locus_tag="Caul_5424"
FT   CDS_pept        complement(136633..137229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5424"
FT                   /product="major facilitator family transporter"
FT                   /note="KEGG: hne:HNE_3053 major facilitator family
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5424"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74539"
FT                   /db_xref="GOA:B0T9Z0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9Z0"
FT                   /protein_id="ABZ74539.1"
FT                   /translation="MKAPMKKGGAVTALISLTAINFVCLYDRVQISGLAQPIKEEFGLS
FT                   DTQLGLLSGTAFGLTYATMAIPLGWLSDRTNRIKLLSAALALWSLMTAFAAVTQNFAQL
FT                   ALSRIGVAVGESSFTPTAHSLLADYFPPHRRGFAIGIETAGAMAGIMTGLAVSGWLAAA
FT                   FGWRRHRWPRPQRSPPRTQGRVPAPLRHPSGLMPT"
FT   gene            complement(137295..138434)
FT                   /locus_tag="Caul_5425"
FT   CDS_pept        complement(137295..138434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5425"
FT                   /product="MobA/MobL protein"
FT                   /note="KEGG: sal:Sala_3191 MobA/MobL protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5425"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74540"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9Z1"
FT                   /protein_id="ABZ74540.1"
FT                   /translation="MRLDGAERREVRFDLKDYAQIDHGYASTIHKSQGVTVDRAHVLAT
FT                   EGLDRHAAYVGMSRHRETLAVHYGGDDFKDRDQLVRTLGRERAKDTTLDYPRQYDRTFA
FT                   ERRGTEPAVPIGSEIVVERPGPGSSDRRAFANFKLRPGPERGTFANFKPRAPAAATERA
FT                   APKPIQLDRPGREALVRGVRDYTRAFEDVVRMHDKRLPVLPHQDAALKRAAQDLAKISP
FT                   EGARDLHTALSRNPDLARGVERPGGLDQALKAMTYEGRVRADPSLRADRFVGDWKTLGA
FT                   QRDALKGWEHTEARKAVESRMKTMAQGLGRDAELYALLDGRRRDLGLAIGSGLERGRNL
FT                   TTELTRTLSRGLGEHTHEVLRGIGLSDEEIALARAKGVI"
FT   gene            complement(138389..139081)
FT                   /locus_tag="Caul_5426"
FT   CDS_pept        complement(138389..139081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5426"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ccr:CC_1156 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5426"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74541"
FT                   /db_xref="GOA:B0T9Z2"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9Z2"
FT                   /protein_id="ABZ74541.1"
FT                   /translation="MAANLLPHYLGLALPVAFFIALFIVITTLSDSSEIDALLAGGRSL
FT                   TRIVAPFVVIGVLLGLFSVIVFGYLQPYSRYAFRSVMHAAITAGWNGRLPGRAFVEDGE
FT                   QLITADESVAAGQALMGIFIKRPDANKREEVIAASSASLVAEPDGEKVALMLTDGRRTA
FT                   QDGQGEDLALATERGERRFAVGDRVMFLRNERSMGVKNVRSERWSGSTGRPLRCASMAR
FT                   SGARSGST"
FT   gene            complement(139117..139623)
FT                   /locus_tag="Caul_5427"
FT   CDS_pept        complement(139117..139623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5427"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ccr:CC_1157 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5427"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74542"
FT                   /db_xref="GOA:B0T9Z3"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9Z3"
FT                   /protein_id="ABZ74542.1"
FT                   /translation="MLIRPKQRTCWSLVLICKESANAFSALSPQAFSDLDPVVAGVERV
FT                   LRQVVAYVKIKYLMLMMVDPDVHFHVIPRYAGTREHDGVAIPTRAGPAPRTSAPPSNCH
FT                   RTRRRAWLDRRRRSGLRRDQAHRHLLFRADRPLLLRMLTRPLLGCLGVTIAALILDAYC
FT                   GCSTS"
FT   gene            139750..140229
FT                   /locus_tag="Caul_5428"
FT   CDS_pept        139750..140229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5428"
FT                   /product="conserved hypothetical secreted protein"
FT                   /note="KEGG: gbe:GbCGDNIH1_0243 hypothetical secreted
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5428"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74543"
FT                   /db_xref="InterPro:IPR018673"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9Z4"
FT                   /protein_id="ABZ74543.1"
FT                   /translation="MKAPTAILTTILGLLALSLSAVPALADAGCEGADSATSLTVQVSG
FT                   MTSARGEIAITVYGSDSKKFLAPKGKLLRVRPKTVAPTTHACFNLPGPGTYAVAVYHDA
FT                   NANEDFDRSVLGMPAEGFGFSNDAPTRFGLPAFEAVRFSVETGLNLIPIKLRYLK"
FT   sig_peptide     139750..139830
FT                   /locus_tag="Caul_5428"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.979 at
FT                   residue 27"
FT   gene            140528..142175
FT                   /pseudo
FT                   /locus_tag="Caul_5429"
FT   gene            142172..143086
FT                   /locus_tag="Caul_5430"
FT   CDS_pept        142172..143086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5430"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eli:ELI_12580 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5430"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74544"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9Z5"
FT                   /protein_id="ABZ74544.1"
FT                   /translation="MTTVLDLVGAELDAPVPPAATAFAHVLTQRFEAPAAVLFYGSILR
FT                   TGDLDGVLDFYVLTHKPPRGARGVASRLLWPDVGYYEIEHEGRTLRAKVAAMTLAQFSR
FT                   AVTGAGADTTIWTRFVQPSALLWSDSPATTQTVRQAIATASVTAARFAAALGPAQGASA
FT                   DYWTALFRQTYAAEFRVEKGGREQSILAVDPARWDALLATAWREAGLGDVSANGTAAPA
FT                   LDAREQRRVNAAWTRRRRLGKPLNIARLLKATFTFEGAARYGAWKIERHTGVAVPLTPW
FT                   RERHPILAAPGVLWRLRKARRQS"
FT   gene            complement(143083..144306)
FT                   /locus_tag="Caul_5431"
FT   CDS_pept        complement(143083..144306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5431"
FT                   /product="8-amino-7-oxononanoate synthase"
FT                   /EC_number="2.3.1.47"
FT                   /note="PFAM: aromatic amino acid beta-eliminating
FT                   lyase/threonine aldolase; aminotransferase class I and II;
FT                   aminotransferase class-III; KEGG: ccr:CC_1162
FT                   aminotransferase, class II"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5431"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74545"
FT                   /db_xref="GOA:B0T9Z6"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9Z6"
FT                   /protein_id="ABZ74545.1"
FT                   /translation="MGLFDKHLAYREAYQAIRQAGADPFNVRFDSVVSPTEGTIDGLSV
FT                   ILLGTNNYLGLTFDPEAIASSVKSVQERGTGTTGSRIANGSFEAHVELEESLAKFYGRK
FT                   STMVFTTGYQANLGVLSTLVGRGDHLILDADSHASIYDGARLGHAEVIRFRHNDPEDLY
FT                   KRLRRLKDVPGERLIVVEGIYSMMGDTAPLKEIAAIKREMGGYLLVDEAHSMGVLGETG
FT                   RGLAELEGVEADVDFIVGTFSKSLGAIGGFCVSDMDDFDVMRVICRPYMFTASLPPAVV
FT                   SSTVTALRRLEEQPQLRHKLMANARRLYEGLSALGFVTGPAASPIVAVVMPDQERAIAM
FT                   WNMLLANGVYLNLALPPATPDSRPLLRTSVSAAHSEAQIDRVLEAFAQVGAQLDVIEAP
FT                   KQRASACG"
FT   gene            complement(144309..144560)
FT                   /locus_tag="Caul_5432"
FT   CDS_pept        complement(144309..144560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5432"
FT                   /product="acyl carrier protein, putative"
FT                   /note="KEGG: ccr:CC_1163 acyl carrier protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5432"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74546"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9Z7"
FT                   /protein_id="ABZ74546.1"
FT                   /translation="MDVVTDLTLHEIGLAASRVLGRAVEVTDDTHIGRDLAVDSLALMN
FT                   IMLELEGHFDISIPLDRLASVETGGDLSNLVTDLRNRA"
FT   gene            complement(145034..145729)
FT                   /locus_tag="Caul_5433"
FT   CDS_pept        complement(145034..145729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5433"
FT                   /product="plasmid pRiA4b ORF-3 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   plasmid pRiA4b ORF-3 family protein; KEGG: rru:Rru_A0351
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5433"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74547"
FT                   /db_xref="GOA:B0T9Z8"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="InterPro:IPR012912"
FT                   /db_xref="InterPro:IPR024047"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9Z8"
FT                   /protein_id="ABZ74547.1"
FT                   /translation="MIWRQVEAPTSITLKVLHDIIQQTIGWFDYHLWEFTIGKRRYGLP
FT                   MDEDWGTTPRKEAAKVRLRDVLEPKTTVIDYVNDFGDNWEHRITVTDVRVGDPQTAYPR
FT                   YIGGEGSGPPEDCGGVPGFYEMLEARGDPDHPNHAQAAEWLDDYDPDVIDEEPIKYALS
FT                   APDHTLFRSGRQFAAWLGLTPRANSSGGKERLGGISKMGDGYLRRLLVVGATAVIRMAR
FT                   QESYVPAPA"
FT   gene            complement(145783..146148)
FT                   /locus_tag="Caul_5434"
FT   CDS_pept        complement(145783..146148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5434"
FT                   /product="transposase, mutator type"
FT                   /note="KEGG: acr:Acry_3212 transposase, mutator type"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5434"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74548"
FT                   /db_xref="GOA:B0T9Z9"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:B0T9Z9"
FT                   /protein_id="ABZ74548.1"
FT                   /translation="MDAVAAQAALDAFEAGDWGRKYPAIGLSWRRAWNEVIPFFAFPHD
FT                   VRRLIYTTNAIEALNSKLRRAVRARGHFPTDEAALKLLFLVLNRSEKEWTMPAREWHMA
FT                   KAQFAVLFGQRFNRAAA"
FT   gene            146394..146558
FT                   /locus_tag="Caul_5435"
FT   CDS_pept        146394..146558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5435"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5435"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74549"
FT                   /db_xref="UniProtKB/TrEMBL:B0TA00"
FT                   /protein_id="ABZ74549.1"
FT                   /translation="MTTQRNKVYAVTVITAVAQQLGLGEDSIKAFTDEGVEELQALLEA
FT                   YRQDPNLFR"
FT   gene            complement(147361..150036)
FT                   /locus_tag="Caul_5436"
FT   CDS_pept        complement(147361..150036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5436"
FT                   /product="ATP-dependent transcriptional regulator,
FT                   MalT-like, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; KEGG: pmy:Pmen_0429
FT                   regulatory protein, LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5436"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74550"
FT                   /db_xref="GOA:B0TA01"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B0TA01"
FT                   /protein_id="ABZ74550.1"
FT                   /translation="MTDTSPRQSAQPPTGSTNERVASLASRCLSRPRLFAVDKSIRCHL
FT                   LRAPQGYGKTVAMAQYWAEHRQAFAATAWVSVKECRRDLQLLADRICAQISATHEASGQ
FT                   DRSPPPTESLRNLHDLAAWLWETRDRLGSKVLICIDDLEFDLHSIHQIEAFMLATPAEV
FT                   EFIAASSADIGFARMKARRDTHELRHGALAFTLDEAKAVTLAGERQAVSEAEIHSLWKR
FT                   TEGWPEIFCLLMQAASERRSTDRLIADHITGVDIDLDKYFRSTILHSLPDDTLSFCVCA
FT                   SILGSVSAEYFNHVFLRNDGAYFIDKLSTERMLFQPRDRSQTAYEFHPLLREFLEHRFS
FT                   VEYGGLKPNLLARAAQWQRQNNNSRESINLSLRAGEHGSAADVASENMMDIALREGEID
FT                   QIQFWQGSFSAAVISGSPTIALGLAWAQIFSHDHRRAEGLLVDLRAADLGGLDQQIRRK
FT                   IECWCDLIAAIGEATRDNLSESRRQCEAWMKIYDEADLVSKGAVLTCLCFIASSEHRFD
FT                   DLRALFLVASSVNNIAAHRYALGWLHSAMVLAELSRGDMRAGTALIQKARDDNNAQIKL
FT                   TPFSVNLLNTLALEIQYEANQLDDIESRVDESLDFVRQHGVVDLTFSAYRTAAAIARRS
FT                   GNPLRAAELLQELRVIAGESGLFRLEVLARLTLADMFIAESVEQATSILPSRSHSIFFT
FT                   THGPYLRARQSLTEARIAARQGKFHLSNRFANVALDHARRLGLGSLEVAALLCNAVAFA
FT                   GTGKLALSEQRVADAIDIASRFGCYRTLLDERWHLEALGSISTPLLNLIPSEEELGRRP
FT                   APVDHLIRSLRSETSVVLTRKELAMLQRIREGLSNRDIAIKHRISEDTVKWHIRNLFAK
FT                   LKVKNRIQALMESERIGILH"
FT   gene            complement(150169..151071)
FT                   /locus_tag="Caul_5437"
FT   CDS_pept        complement(150169..151071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5437"
FT                   /product="tISRso5; ISRSO5-transposase protein"
FT                   /note="KEGG: nha:Nham_4262 tISRso5; ISRSO5-transposase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5437"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74551"
FT                   /db_xref="GOA:B0TA02"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:B0TA02"
FT                   /protein_id="ABZ74551.1"
FT                   /translation="MSNGVTVHLSPTDRKRLRAIVDDRTNSQKHVWRAQIVLATADGLG
FT                   TVEIMRTAGVSKPAVWRWQDRFMAEGVEGLLRDKTRPPRIPKLADEVADRIVALTLGEP
FT                   PGETTHWTGRVMAQVAGVSLTSVLRIWRAHGPAPHGIRTFKLSNDPKFAAKVRDIVGLY
FT                   VDPPAHAVVLSVDEKSQIQALDRTQPGLPLKKRRAGTMTHDYKRHGTTTLFAAFDVLEG
FT                   KVIGRCMQRHRHQEFIRFLNAVEREVPAGKTVHAILDNYATHKHPKVIAWLGRHPRWTF
FT                   HFTPTSAAARGHQVLDSIH"
FT   gene            complement(151265..152503)
FT                   /locus_tag="Caul_5438"
FT   CDS_pept        complement(151265..152503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5438"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: ccr:CC_3525 ferredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5438"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74552"
FT                   /db_xref="GOA:B0TA03"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028202"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B0TA03"
FT                   /protein_id="ABZ74552.1"
FT                   /translation="MNRSDEHVLILGAGHAGGTAAALLRQYGFEGSVTLVGEELMAPYH
FT                   RPPLSKAGLRSDHSAASLALKPVEFYAGHGIDIRLGVRAEKLTRQTKAVHFSTGEVLTY
FT                   DFLIIATGARPIKLPVPGSDLAGVLELRTADHAERLRAVIQSGQRLAVIGGGYIGLEVA
FT                   ASARALGAEVVVIERETRLLARVAGQDLSAFFLDYHRERGVSFELGTTVSGFEGQDGRV
FT                   SGVKLDDGRTIACAAALIGIGATPNDEIARDAGLDTARGVIVDLEARTGDPAIFAIGDV
FT                   ALRPMPIFDRVFRMESVPNALEQAKQAASAIVGRAPPPSEVPWQWSDQYDLKLQIAGYA
FT                   FDVDRVILRGERASARFAVFHLKGDQVQCVEALNSPQDFIFGKQLIASRKSVDLGKLGN
FT                   SAIPLKEIVEIAA"
FT   gene            152721..153932
FT                   /locus_tag="Caul_5439"
FT   CDS_pept        152721..153932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5439"
FT                   /product="Alkane 1-monooxygenase"
FT                   /EC_number="1.14.15.3"
FT                   /note="PFAM: fatty acid desaturase; KEGG: maq:Maqu_0440
FT                   alkane 1-monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5439"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74553"
FT                   /db_xref="GOA:B0TA04"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR033885"
FT                   /db_xref="UniProtKB/TrEMBL:B0TA04"
FT                   /protein_id="ABZ74553.1"
FT                   /translation="MSSIARNPSANTAPDRYVDRKRYLWMLSVVWPAAPLIGLYLVSMT
FT                   GLGVFYAFTLVVWYVAIPALDILFGNDPNNPPEAAVARLEADRYYRVLTYLTVPVHYAS
FT                   LIVSAWWVATQPMAWWEVVALALSLGIVNGLALNTGHELGHKKEAFDRWMAKIVLAVVG
FT                   YGHFFIEHNKGHHRDVATPEDPATSKMGESIYKFSLREIPGAFKRAWSLERVRLERLGK
FT                   GVWRLDNEIIPPLLITVVLYTSLLLAFGPNPKLLVFLPIQIAFGWWQLTSANYIEHYGL
FT                   LREKMADGRYERAQPRHSWNSNHIASNLILFHLQRHSDHHAHPTRSYQSLRDFKDLPEL
FT                   PSGYPGMFFMAMIPPVFRSVMDRRVVEWAGGDLGKIQIDGARRKQIERKFGAASRQQAR
FT                   AAAE"
FT   gene            154085..154303
FT                   /locus_tag="Caul_5440"
FT   CDS_pept        154085..154303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5440"
FT                   /product="Rubredoxin-type Fe(Cys)4 protein"
FT                   /note="PFAM: Rubredoxin-type Fe(Cys)4 protein; KEGG:
FT                   abo:ABO_2708 rubredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5440"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74554"
FT                   /db_xref="GOA:B0TA05"
FT                   /db_xref="InterPro:IPR018527"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR024935"
FT                   /db_xref="UniProtKB/TrEMBL:B0TA05"
FT                   /protein_id="ABZ74554.1"
FT                   /translation="MARYQCPDCSYVYDEVRGEAHEGFPPNTSWAQIPEDWACPDCAVR
FT                   DKLDFIPLGSGEVGEKAGPLSSPGAER"
FT   gene            154300..154518
FT                   /locus_tag="Caul_5441"
FT   CDS_pept        154300..154518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5441"
FT                   /product="Rubredoxin-type Fe(Cys)4 protein"
FT                   /note="PFAM: Rubredoxin-type Fe(Cys)4 protein; KEGG:
FT                   pmy:Pmen_0441 rubredoxin-type Fe(Cys)4 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5441"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74555"
FT                   /db_xref="GOA:B0TA06"
FT                   /db_xref="InterPro:IPR018527"
FT                   /db_xref="InterPro:IPR024922"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR024935"
FT                   /db_xref="UniProtKB/TrEMBL:B0TA06"
FT                   /protein_id="ABZ74555.1"
FT                   /translation="MIGGGQGAEPSGAAVETEPFAKWHCVTCGHIYDEALGDPDAGVEP
FT                   GTRWADVPADWYCPDCGATKEDYEPYG"
FT   gene            154583..156043
FT                   /locus_tag="Caul_5442"
FT   CDS_pept        154583..156043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5442"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase_; KEGG: maq:Maqu_0438
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5442"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74556"
FT                   /db_xref="GOA:B0TA07"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B0TA07"
FT                   /protein_id="ABZ74556.1"
FT                   /translation="MNFYAITATTEAPVHPCGEGAIRSLFASQRRSALENRTKFTLKAR
FT                   LAMLSRLKATMKSREDEIIRALCTDFRKPESEVRLTELFPVYQEISHARRHLRSWLRPH
FT                   RVHDSLGMFGIAAEVRYQAKGVCLIISPWNYPVNLSFGPLVSALAAGNTVIIKPSELTP
FT                   ATSALVRDIVEQTFPRDLVAVCEGDAEVSQALLDLPFDHIFFTGSPQVGKIVMAAAAKH
FT                   LTSVTLELGGKSPTIVDSTANIEQAACKIVWGKFANNGQTCIAPDHVYVARDQASALVD
FT                   ALRHEIRRVYGQTDGEQKAGPDYCRIVNRRHFDRLTALADDATSRGATLLEGGARDSDQ
FT                   NYFAPTILGGTTPQMAISQEEIFGPLLPIIEYDDISVVIDAINAGPKPLAMYVFSNDAA
FT                   AREDIILRTSSGGVCVNNNVVQFLHPNLPFGGVNNSGIGAAHGFYGFKAFSHERAILRD
FT                   KFSVLRLLFPPYTPTVKKLINLIVRLLG"
FT   gene            156092..157720
FT                   /locus_tag="Caul_5443"
FT   CDS_pept        156092..157720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5443"
FT                   /product="glucose-methanol-choline oxidoreductase"
FT                   /note="PFAM: glucose-methanol-choline oxidoreductase; GMC
FT                   oxidoreductase; KEGG: maq:Maqu_0606
FT                   glucose-methanol-choline oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5443"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74557"
FT                   /db_xref="GOA:B0TA08"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B0TA08"
FT                   /protein_id="ABZ74557.1"
FT                   /translation="MFDYIIVGAGSAGCLLAERLSANPRTRVCLLEAGPPDRSPLIHMP
FT                   IGIALLSKSKILNWAFETQPQANLDGRRLFWPRGKTLGGSSSINAMVYIRGHRDDYDSW
FT                   GEAADPIWSYDNVLPLFKAMESNERFGTDAFHGGDGELHVSDLRTRNPLSDAFVEAGQQ
FT                   AQFPHAVDFNGKMQDGVGLYQVTQHKGRRWSSARAFLSKAKGRPNLRIVTGARATRIIL
FT                   EGRKAVGVTYAAGGKLVDVRTRGGEVILSGGAVNSPQLLLLSGIGGAAELNALGIPVVV
FT                   DLPAVGKNLQDHLDITIMHEANDRTPIGIAPSFIPRALSGALSYAFLRKGFLTSNVAEA
FT                   GGFVKSTPSRSRPNLQFHFLPTLLKDHGREMAFGYGYTLHVCDLLPKSRGRIGLTSPDP
FT                   LDDPLIDPNYLSAPEDIETMVAAVKIGRQILSAPSMAAFSKTELVPGPSVQSKADIMAD
FT                   IRRRAETIYHPVGTCRMGRDPQSVVDPSLRVRGVQGLRVVDASVMPTLVAGNTNAPTMM
FT                   IAERAAELILGKTKLALSANIEAFR"
FT   gene            157811..158494
FT                   /locus_tag="Caul_5444"
FT   CDS_pept        157811..158494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5444"
FT                   /product="OmpW family protein"
FT                   /note="PFAM: OmpW family protein; KEGG: pmy:Pmen_0436 OmpW
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5444"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74558"
FT                   /db_xref="GOA:B0TA09"
FT                   /db_xref="InterPro:IPR005618"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:B0TA09"
FT                   /protein_id="ABZ74558.1"
FT                   /translation="MRKNGAYMYARLAQYATALAVLSVFPQAALAQNSEGFKLWAVSLN
FT                   ATRVFVDEDAPDITLAGGPVPGSNVRIGDATSATIDIGYFFTPNVAGNLFLGVPATAQI
FT                   DGAGSLEPLGTLAKVNYGPIILSAQYHFNNLGKVHPYLGVGVGRIVFLNERDRALLNFS
FT                   IDDSWAPAAQVGVRYELGAEWMLNADVRYVPFSTHATGSLGGAPVRTRLDIDPILTSAG
FT                   VTYRF"
FT   sig_peptide     157811..157906
FT                   /locus_tag="Caul_5444"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.997 at
FT                   residue 32"
FT   gene            158550..160184
FT                   /locus_tag="Caul_5445"
FT   CDS_pept        158550..160184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5445"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   bam:Bamb_1895 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5445"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74559"
FT                   /db_xref="GOA:B0TA10"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B0TA10"
FT                   /protein_id="ABZ74559.1"
FT                   /translation="MGLMMDRPLMISQLIEHAAEYHGDNEIVSRSVEGPIHRHTYADAA
FT                   RRSRQLAKALEALGVAPGDPIGTLAWNGYRHFEIYFAVSGIGAICHTINPRLFPEQIAY
FT                   IINHANDRFIFADLNVLAILEGLEKSLAGVRGVIVMTDRAHMPASSALPNMLCYEDLVA
FT                   AQDEAFDWPEFDENSAASLCYTSGTTGNPKGVLYSHRSTILHAYAINSANALGLTVDDA
FT                   ILPVVPMFHANAWGIPYAAPMVGAKLVLPGFKMDGASLFELFDSEDVTVAAGVPTVWQE
FT                   LLRFCEAGGRSLGKLQRTLIGGSAPPRAMIERFDREHGVRVMQGWGMTEMSPLGTITSM
FT                   RRGERDLPAETQYDLIAKQGRPIFGVSLKIVDDAGRELPKDGVAFGNLLVRGPWVARSY
FT                   LHGEDPSAFTDDGWFHTGDVCTIDPHGYMTITDRSKDVIKSGGEWISSIDLENVAMDHS
FT                   GVQEAAVIGIVHPQWDERPLLVVVRRSESKVTREELLNSFEGKVAKWWIPDDVVFVDSL
FT                   PHTATGKLLKAKLREDFRGYKAPSTAG"
FT   gene            complement(160651..161682)
FT                   /locus_tag="Caul_5446"
FT   CDS_pept        complement(160651..161682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5446"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG: ccr:CC_1761
FT                   IS30 family, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5446"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74560"
FT                   /db_xref="GOA:B0TA11"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B0TA11"
FT                   /protein_id="ABZ74560.1"
FT                   /translation="MGSRYDHITLEERHLICRWRDAKVPVRVISERLGRHPSTVHREIR
FT                   RNWFDDGPWLRGYFAIAADQRASSRRRRVGKLHRDPELAHFVTQRLRETWSPEQIAGHL
FT                   KATRQLQAYACHETIYRYVYGPDGRAAELYKLLPRMRRRRRARYARRPRGGLHIPLQNT
FT                   IAQRPAHIGERQGYGHWECDLIAFRQEYGRHNITTLVERRSRYLIMIKNPSRSSTGIMA
FT                   GLAERLEPLPPPMRQSITFDRGTEFAFFATLKRSLEIESYFCKPQAPWQKGTVENTNGR
FT                   LRRFLPSDTDIALIPPEKLLELTTRLNRIPRKCLGYRTPEDVLGEQIAATAGTRATNGL
FT                   CAT"
FT   gene            complement(161945..162256)
FT                   /locus_tag="Caul_5447"
FT   CDS_pept        complement(161945..162256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5447"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   mag:amb2064 predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5447"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74561"
FT                   /db_xref="GOA:B0TA12"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B0TA12"
FT                   /protein_id="ABZ74561.1"
FT                   /translation="MTSLAKLRQKLLTDPEVKAEYERLGPIFAVVGEMIEARQAAGLTQ
FT                   AEIASRMGTSQSVVARLENARHMPTFEMIARYAAAIGRRLDIHLVPSGGEHSPSQAWS"
FT   gene            complement(162253..162579)
FT                   /locus_tag="Caul_5448"
FT   CDS_pept        complement(162253..162579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5448"
FT                   /product="protein of unknown function DUF891"
FT                   /note="PFAM: protein of unknown function DUF891; KEGG:
FT                   mag:amb2063 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5448"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74562"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="UniProtKB/TrEMBL:B0TA13"
FT                   /protein_id="ABZ74562.1"
FT                   /translation="MTWTVETLGAVVDTEIAALPKDMQASFLRLAERIEAVGLERIGQP
FT                   HVKHLHDKLWEMWFGGRDGIARAIYVTAIGRRVIVVHAFVKKTQKTPRAALELAERRAK
FT                   EIKP"
FT   gene            complement(162668..165115)
FT                   /locus_tag="Caul_5449"
FT   CDS_pept        complement(162668..165115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5449"
FT                   /product="type III restriction protein res subunit"
FT                   /note="PFAM: DNA primase small subunit; type III
FT                   restriction protein res subunit; DEAD/DEAH box helicase
FT                   domain protein; SMART: DEAD-like helicases; KEGG:
FT                   dsh:Dshi_4007 type III restriction protein res subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5449"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74563"
FT                   /db_xref="GOA:B0TA14"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0TA14"
FT                   /protein_id="ABZ74563.1"
FT                   /translation="MSDREDRQRRLQERLRQLEQERAAIEDELAGMVMAAARETSRPPA
FT                   MALQQPRQDQAFDNRAKVELFRSLFRGRSDVFPLRWENLKTGKSGYAPACANEWKRGLC
FT                   EKPRIKCSVCANQAFIEVSDQVITHHLRGQGPGGAAFVAGVYPVLPDDTCWFLAADFDE
FT                   AEWRRDVKAFAETCRAWDVPVAIERSRSGNGAHAWIFFSEPISASLARRLGSALITETL
FT                   DRTPDIGFASYDRLFPSQDTVPSGGFGNLIALPLQGLARQAGNSVFLDDDLDPYDDQWR
FT                   CLAGVRRLKRDTLEALVDAASAAGRILGVRIPVDDDDEEPWLAPPSRRRTPPAIAGPRP
FT                   SNLTMVVADQLYIPRSGLPSGLVARLIRLAAFQNPEFYAAQAMRFATHDKPRIVSCAEL
FT                   TVNHIGLPRGCFDVAMDLFASLGVAVEIEDQRRRGAAINISFSGVLRPDQELAVDALLP
FT                   HDIGVLAATTAFGKTVVAARMIAERGVNVLVLVHRRQLMDQWVERLGAFLNTAPGMIGK
FT                   IGGGKRKPSGLIDIALIQSLVRKGEVDDIVGDYGHLIVDECHHLSAVSFEQVARRTKAR
FT                   YVLGLSATVTRKDGHHPIIFMQCGPVRKRVDARAEAARRPFDHHVRIRQTAFRLPDSEA
FT                   NAAAVPIQDVYRALAGDEGRNELIFNDVLAALEAGRSPVVITERTDHLEALADRLSRFA
FT                   KNVIVLRGSQSERKRREAMERLAAIPEQDERVIVATGRYLGEGFDDQRLDTLFLTMPIA
FT                   WRGTLAQYAGRLHRLHDPKREVVIYDYVDRDVPVLARMAARRATGYSGIGYTTVQRPGL
FT                   FDR"
FT   gene            complement(165121..165675)
FT                   /locus_tag="Caul_5450"
FT   CDS_pept        complement(165121..165675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5450"
FT                   /product="Resolvase domain"
FT                   /note="PFAM: Resolvase domain; KEGG: xau:Xaut_2245
FT                   resolvase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5450"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74564"
FT                   /db_xref="GOA:B0TA15"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:B0TA15"
FT                   /protein_id="ABZ74564.1"
FT                   /translation="MIFGYARVSTDGQSVAAQVAELTEAGCAKVFSETASGARTDRSQL
FT                   KRSIAALGEGDVLVVTRLDRLARSTRDLLNVLAAVSEKKALFRSLRDVWADTTTAHGRL
FT                   MLTVLGGLAEFERELIRARTGEGRARAKARGVQLGRRPKLSVDQRRFVAAERAKGESVR
FT                   HLARVLGVSKATIGRIPAAES"
FT   gene            complement(165749..166675)
FT                   /locus_tag="Caul_5451"
FT   CDS_pept        complement(165749..166675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5451"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5451"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74565"
FT                   /db_xref="UniProtKB/TrEMBL:B0TA16"
FT                   /protein_id="ABZ74565.1"
FT                   /translation="MESAPTIAWNTQADFWSGLGCDDPQDLAPSHGLFDQLSEATRLDA
FT                   NELRRFFAPDLATIGAPLVLSRPAFIRGAACPACCRDAADKRGDHFVSASSAGLWRVSC
FT                   PEHRVRLAGLDGYGLILQDGTVRFAHEGSRISIGATRLAGRPAEFTLAFEDAVIRALSG
FT                   QPPGSEWLPRTPATFLASATALIEVVLRRPGSTTTFAHQFDEIRNGSATFSIGSTDRRH
FT                   GTALLADQGPRDRMNACAAVATLLARPHARSHPFATLMRWNDPNSPDPFAYVFDEFDDR
FT                   LRAVVADRLKAWPDCIATPAREALHQS"
FT   gene            166795..168171
FT                   /locus_tag="Caul_5452"
FT   CDS_pept        166795..168171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5452"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG: bja:blr1834
FT                   putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5452"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74566"
FT                   /db_xref="GOA:B0TA17"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017895"
FT                   /db_xref="UniProtKB/TrEMBL:B0TA17"
FT                   /protein_id="ABZ74566.1"
FT                   /translation="MPTERLSMRRIRDLLRLKFENGLSSRLIATSLGISKGSVGDYLQR
FT                   AQVAGLSWPLPEDMTDTALERRLYPGPPKGSIVPRSEPNWAHVDQELRRTGVTRSLLWQ
FT                   EYRADHPDGYGYAWFCQHYDAWKRRVSPTMRQSHAAGEKVFVDFAGDTIDVIDPLTGVA
FT                   QAMKLFVAALGASSYVYCEARPSEGLADWIGCHVGMFAFFGGVTAIIVCDNLKAAVTNP
FT                   DRYDPGINRTYQDMARHYGTTVMPARPYKPRDKAKVEQSVLLVERWVLARLRNRRFFSL
FT                   AELNLAIVDLVGELNARVMRAYGASRAELFATVDAPALKALPAAPYAFAIWKRCRVAPD
FT                   YHVEVEGCWYSVPYRLIRELVDVRIADRTVEAFHKGERVASHAKSPGRRGHTTIADHMP
FT                   SAHRRHASWTPARIMAVAERVGPATAALTLNPSATAISVAEPTSTDPSIWRSHACTPHP
FT                   "
FT   gene            168149..168907
FT                   /locus_tag="Caul_5453"
FT   CDS_pept        168149..168907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5453"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein; IstB
FT                   ATP binding domain protein; SMART: AAA ATPase; KEGG:
FT                   bja:blr8220 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5453"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74567"
FT                   /db_xref="GOA:B0TA18"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013690"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:B0TA18"
FT                   /protein_id="ABZ74567.1"
FT                   /translation="MLAHPTHDRLIGLGLAGMAKAFEEQRSSPDLAALSFEERVGIMAD
FT                   REAAERDTKRMSARLKFAALRQDACVEDIDLRTPRGLDRALLARLVAGDWIDRRQNCLI
FT                   TGPTGIGKSWLGCALGHKACRDGRSVFYQRVPRLFEALALARGDGRHARMLKSLARVEL
FT                   LILDDWGLSVLTQGQRIDLLEILEDRNGRGSTIVTSQVPADQWHEVIGDPTLADAILDR
FT                   LVHNAHRLNMTGESMRKITGRRALDAGLNP"
FT   gene            complement(169109..169612)
FT                   /locus_tag="Caul_5454"
FT   CDS_pept        complement(169109..169612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5454"
FT                   /product="TniB"
FT                   /note="KEGG: nha:Nham_4580 TniB"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5454"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74568"
FT                   /db_xref="InterPro:IPR008868"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0TA19"
FT                   /protein_id="ABZ74568.1"
FT                   /translation="MQLRRLGARLLIIDETNNLVIGTGSAQRKTLAALRRLSNRLELSL
FT                   ACFGTMEALHALTSDPQVEGRVQPFQLTRLRNDADYAMIVRSVIAFYPLRQSSVVDQPL
FT                   INAVHDLTAGSPGKTFRLLNAAAVHAIDTGEEQIASKTLRLDDVTRHVRTAATMRRRGR
FT                   AAAG"
FT   gene            complement(169579..169986)
FT                   /locus_tag="Caul_5455"
FT   CDS_pept        complement(169579..169986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5455"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsq:Rsph17025_4235 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5455"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74569"
FT                   /db_xref="InterPro:IPR008868"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0TA20"
FT                   /protein_id="ABZ74569.1"
FT                   /translation="MVSEADADLDDETRVAKILADRWVHYPQGEAALTRMAELLRGARR
FT                   IRMPSLLVVGEPDVGKTTILKKFMHAHAPIFDAETGRTSSEVVAMEAPPEADEARLYSA
FT                   ILQAIGAPEGGGSLIWSGSCTCSSGALVLAC"
FT   gene            complement(169980..171623)
FT                   /locus_tag="Caul_5456"
FT   CDS_pept        complement(169980..171623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5456"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; Transposase-like
FT                   Mu; KEGG: ajs:Ajs_2648 integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5456"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74570"
FT                   /db_xref="GOA:B0TA21"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR015378"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:B0TA21"
FT                   /protein_id="ABZ74570.1"
FT                   /translation="MVDDPDMRPTGGAEERWRRALERQPELRKLVEAPSRSRADVETAA
FT                   TRLGLHISTLYRLLRRFEVDRTAEAITGRARGWCPGRSRVPALIETVIDAAIQDFFLTK
FT                   QAPSAAALHREIELRCRATGLATPAISTVHRRLRKLGRKTVAGRREGRGAAEAQTMRPG
FT                   ALQIDRPNMLWQIDHSPADVVIVDVETRAPIGRPWVTLVIDVASRVIAGLHVSLEDPSV
FT                   ISVGLALRHAILDKADALREREVAADWPAFGLPDGVHSDNGSDFRSATFQRACANLGIE
FT                   IDYRPLGAPRYGGHIERLIGTAQQEMHLLPGTTFSNVSQRGDYDSDGSAALTLDEFETW
FT                   LWRFIASDYNMRIHSVTGRPPLVAWRCGVDGQGFAPRRPSDPERLAFEFLPSVPRAITR
FT                   QGVVFNRIHYYEPFLEPLFDTGDRRLLVRYDPRDLSRLYLATAQGVQSIRYRNLARPPM
FT                   SLWELRAARRRLAAEGAAHVNEDALFEARRRNVELVGRAKSETRRQRRDAERRDRGYAA
FT                   ALAPDPPQPDPEPVASLGPISGRVGEIEQW"
FT   gene            172128..172715
FT                   /locus_tag="Caul_5457"
FT   CDS_pept        172128..172715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5457"
FT                   /product="protein of unknown function DUF1520"
FT                   /note="KEGG: xau:Xaut_4587 protein of unknown function
FT                   DUF1520"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5457"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74571"
FT                   /db_xref="GOA:B0TA22"
FT                   /db_xref="InterPro:IPR012899"
FT                   /db_xref="UniProtKB/TrEMBL:B0TA22"
FT                   /protein_id="ABZ74571.1"
FT                   /translation="MPMSFKSLLLAAALGLGAPAYAAEQPAPPHDHSHAPDQAAAPATP
FT                   AAKGGMMAKGGMKGGMMEMAPMHCMGLSEPRLSGLKAELNITERQLRAWNTFAEAARAD
FT                   PRPMPAGMTMPMAKKPGDMPMPMKSDAKPGGDGMMAMMMAKPLPERLAHHETMMKAHLK
FT                   ALHKSRTAVLGLYRVLTPEQRLMADKSLCGMP"
FT   sig_peptide     172128..172196
FT                   /locus_tag="Caul_5457"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 23"
FT   gene            172831..173496
FT                   /locus_tag="Caul_5458"
FT   CDS_pept        172831..173496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5458"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: noc:Noc_2405
FT                   dithiol-disulfide isomerase involved in polyketide
FT                   biosynthesis-like"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5458"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74572"
FT                   /db_xref="GOA:B0TA23"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B0TA23"
FT                   /protein_id="ABZ74572.1"
FT                   /translation="MKRVPIVYFSDLLCLWAHISELRVDAARATYGEQVRFEYRFCSVF
FT                   GDTARKIADGWGGYAGFNEHLRRAASDYPEVQVNPDIWLTVRPASSTGAHLLLKAVHLD
FT                   EAAGGCAPQTYERTVRGLRRAFFEAAQDIARWEVQCAVGRSCGVDVGRIEALIDDGAAF
FT                   AALASDYKDAAAMGIQGSPSFVLNEGRQKLFGNVGFRILDANIQELLRAPQTEQASWC"
FT   gene            complement(173613..174185)
FT                   /locus_tag="Caul_5459"
FT   CDS_pept        complement(173613..174185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5459"
FT                   /product="Resolvase domain"
FT                   /note="PFAM: Resolvase domain; KEGG: swi:Swit_5093
FT                   resolvase, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5459"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74573"
FT                   /db_xref="GOA:B0TA24"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:B0TA24"
FT                   /protein_id="ABZ74573.1"
FT                   /translation="MLIGYARVSKGDDQSTAAQMRALKGAGCDRLFEEAASGGRWDRPQ
FT                   LHRMLDQLRPDDIVVVWKLDRLSRSLKDMLHILEKLEAAGAGFRSLTESIDTTSPAGRM
FT                   MMQMVGSFAEFERAMIRERTSAGLAEARAAGRIGGRRAKLSAAQRADVLENVLSGRKAA
FT                   AEMARLYKVSEATISRIVSAGRQSTAA"
FT   gene            complement(174258..175124)
FT                   /locus_tag="Caul_5460"
FT   CDS_pept        complement(174258..175124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5460"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74574"
FT                   /db_xref="UniProtKB/TrEMBL:B0TA25"
FT                   /protein_id="ABZ74574.1"
FT                   /translation="MPTATIADLCIPQSRRPAWAVALDPDGRRGGACPVCCREAGVQGR
FT                   DHWWPAQSVMLLWVSCPVHRCTLVDLDGLAFVSTGGVLKLTLQDGGALGAPRTSRVLSE
FT                   RTLALEASLANALAALPIGPGWRVRSARSLLQATEILIDLVLYKETGQTPFAWLFEPER
FT                   IGGPFILSLQASEPIKGLDALQGQSVRSRRNVLSALAALLSRPARLEGEIAEILSWRTA
FT                   PDHQGPYRTLVDHIGRDGRRRLEAALQHLPNAIALPAVAALADEAGIGGNGLHKPLAFR
FT                   NDYERGL"
FT   gene            complement(175301..176194)
FT                   /locus_tag="Caul_5461"
FT   CDS_pept        complement(175301..176194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5461"
FT                   /product="TniB family protein"
FT                   /note="PFAM: TniB family protein; KEGG: rsq:Rsph17025_4235
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5461"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74575"
FT                   /db_xref="InterPro:IPR008868"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0TA26"
FT                   /protein_id="ABZ74575.1"
FT                   /translation="MVSAITDTSGLADAARIDTVLSDRWVAYPQGQAALQRLAELLRGA
FT                   QRTRMPSLLIVGDPDMGKTTILRKFMRGRSPTFDPETGRSQMEVVAIEAPPEADELRLY
FT                   GAILDAIGAPVPARRAMEAERAVHGQLQRLRTRLLVIDETNNLMIGTGAAQRKTLAALR
FT                   RLSNMLSLSMAYFGTLEALNALTSDPQIEGRAQPFRLARLAKDETYAAIVAAVVSHFPL
FT                   RMKSEVDGAFVGTVHEISGGSPGKTFRLLNAAAVAAIDSGREQITVERLHAEEVVRHVR
FT                   TAMAMRRGARARAAAE"
FT   gene            complement(176188..177846)
FT                   /locus_tag="Caul_5462"
FT   CDS_pept        complement(176188..177846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caul_5462"
FT                   /product="Transposase-like Mu"
FT                   /note="PFAM: Integrase catalytic region; Transposase-like
FT                   Mu; KEGG: rsq:Rsph17025_4236 plasmid replication initiator
FT                   protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caul_5462"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74576"
FT                   /db_xref="GOA:B0TA27"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009004"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR015378"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:B0TA27"
FT                   /protein_id="ABZ74576.1"
FT                   /translation="MARTGASHEPQSEERRWDLAVARQRELRPLLDNPNRTRAEVEAAA
FT                   QRLNVHTATVYRLLARYAVGETAQAVVTGVGGWKGGRPRLHARVIELIDMAVERLFLDR
FT                   QAISKAQLGREIARRCASESMAMPSRSVISRRLQRIGEREQVRRRKGPGAAEAVTMRPG
FT                   SLTVTQPNAVWQIDHSPADVILVDADSRAPIGRPWVTLVIDVASRVVTGLYVSLDPPSV
FT                   VSVGMALQHAILPKDEALAERGISAEWPAFGLPELVHTDNGSDFRSRSFSHACSNLGIE
FT                   TDRRPVGAPRYGGHIERLIGSVMSEMHLLPGATFSNVAARGDYASDAAAIMTIDEFEVW
FT                   LRRFVAGDYNRRIHASLSAPPLETWRRLCSEQAVTPRQPLDPEGLAVAFLPRISRTITR
FT                   QGVSFHHVRYYEPFLAPLFDSGLRRIELAYDPRDLSRLLVETPQGVRALRYRNLTRPPM
FT                   SLWELRAARRRLRAEGRAQVDEAALFAAREANGALVATAARESRRIRRESVRRERHRAE
FT                   VKPAPTAEDEIPPEPIDVGAPTNPTSGFVVEIEPW"
XX
SQ   Sequence 177878 BP; 31652 A; 56630 C; 57684 G; 31912 T; 0 other;
     gaaagttcgc gcgattcggt gtcatggtcg cgacagttca gaggtcgcat cgattgcgag        60
     cagaacgggt cgttgaattc ggacagtcgc agcgaattcg aacggtcagt tagttggatt       120
     tcaggggctt actgggccgg tctagtcgcg ttcatttcga acactgacat gcggtaaggc       180
     gtttcccgat ctgtcgtgga tcgacattat cggaaattaa gttccgccag tccgaaccgg       240
     cgcggtggcg atcggcggtg acggtcggtt tcgaaatcgc ggattcaggc ccgcaggtct       300
     tgcggcgcgg gctcggcggc gcgatccgcc gccgcccagc ggccaatcac ggccagcatc       360
     tcgcgggggt tgatcggctt ggccaggtgc gtgttcatgc cggcgcgatg gtagtcggcc       420
     acctgggctg gcagcacatt cgcggtgagt gcgatgatcg gcagggtggc gaactcgccg       480
     cccaggcttc ggatgatctg ggtcgcctgg acaccgccca ttaccggcat atgcacgtcc       540
     atgagcacca ggtcataggc gcagacctgc accgcctcga ccgcctcggc gccgttcgag       600
     acgatgtcga cctcgacgcc gaccgagcgg agaatcgtgg agaccagctc ctggttcgcc       660
     tcggtgtctt ccaccagcag caggcgcacc gcgcccgcgt cgatggcaag gtcctcggcg       720
     cccggctgtt cgacatgggc ggccggcgcc agggcgaccg agaaccaaaa cgtcgagccc       780
     gatccaaccc ggctctcgac cccgatctct ccgcccatca actccaccag ccggcgacag       840
     atggccaagc ccaggccggt gccgccaaac tctcgcgaga ccgatccgtc ggcctgcacg       900
     aagcgttgga acacctggtc cagggcggcg tccggaatgc cgataccggt gtcggaaatg       960
     gcgaaccgga cttggggcgg gccgccggcc cctacgtcct cgctaacccg gatcgtcacc      1020
     ccgccatgat tggtgaactt cacggcgttg cagatcaggt tgagcaggat ctgccgcaac      1080
     cgcccggtgt cgcccctcag cccatcacaa agcccgtcat ccacgaaaat cgccaggccg      1140
     acacccttgc gctctgcctg atccgccaga agggccacgg tgtcttcgac tagcttgcgc      1200
     agaccgaatg gctcgctctc cagctcgacg gcgccctctt ccagcttgga aaagtccagg      1260
     acgtcgttga cgatcgaatg cagcgccttg ctggcgtcct cgatgcgggc cagccagtgg      1320
     cgttcctgag gagctagcga cccctcccgg gcgagcagtt ctgcaaaccc gatgatcgcc      1380
     gtcagcggcg tgcgcagctc gtggctcatg ttggctagaa actcggattt cgaccgcgcg      1440
     ccggcctccg cgcggtcctt ggcggcgatc aaatcgcgct cgatcaggtc gcgctcggtg      1500
     atgtcgttga cgatccagat ttcgcctaca ctgtcgttac aggcgcggaa ctcgatgcgg      1560
     cgcacctcgc cgtccctgcg gcggatcgag ccctcgaccg tcgccggaaa accctgcgcc      1620
     cgttggtcaa gatagtgagc gatcagcttg ccggaggtgt cgccgtagag tttctcgaac      1680
     caggcttcca gcgtcggcag ttcggcgcgg gcataccctg tgacctcttc catcgccgca      1740
     ttcatcgaca ggacgccggc ccgcacgtgg acggctccgg ctggcagcaa ctcgatgatc      1800
     cgcgccaggc gctcagcgac ctcggcgtcc ggctccgcag cttcccgtgt tcgcgccatg      1860
     gcccgacccc atcccaatcc gcaaaatcaa ccctttgcgc ctgagcaagt aaggtaacga      1920
     tgaaatctga aggctacatg tagagcgata gcagcggcgc gcgctcggga ccgctgactt      1980
     cgaccgcacc ccgacagatc gtcaaatcta cccaacttca cacttgcagc gcaggggccg      2040
     tccacagatg gctgccctgg tcggtgttga agatctgcgg cggcccgtaa cgggccaggg      2100
     cctcctccag aggctggatg caaaactcgg cgtccatgct gttggagagc cgccaggaga      2160
     ggactttccg cgtcgcccag tccatcaccg ccaccaggta caggaagccc cgccgcatcg      2220
     ggatgtacgt gatgtcggcg caccagacct ggttgggccg gtcgatgacc agcccgcgca      2280
     gcaggtactt gtaggcccgg tgctccgggt gcgggatcgt ggtgcgcgcc gcacgccgga      2340
     caactgcgat ggcgccccgt ccacgccgcg acctgcgact ggacgacccg gcgctgaatg      2400
     gcgaccatca ccgccttggc ctcgcgaatg gacaggccga ggtcttctgg ccgctccgcc      2460
     accttcttga aggcggctat ctcctcggcc gctccagcgg tgccctcgtc gtcggtgatc      2520
     tgaagcagga tgctgacgtg catggcgcac accttcgggt gcggcgcggg acgagcgagc      2580
     tttccacaag cgccggagtg gaaagcccgc ggccgatccg gcggaagcgg tcgccagcct      2640
     accctggacc tcgcggcgtt ccgacaccac gggcttgcac tccgaagcag ttggagcaag      2700
     ctcaggtgat gactgccatc acccgtgccg cgaccgccat cgccgccgtc ctcgtccgcg      2760
     aaggggtcga ctacgcccag agcaaggcgg tgttcagagc ggcgcggaag cgggccggcc      2820
     tgagcgcgcc gcccgagcgc cgaggcgggg tggaccggct gacggtcgag gaggagctcc      2880
     gctttctcga ccgggcctat gcgcagggcg gccgcaccgg cttgatgctg cagacgctcc      2940
     tcgaaaccgg cgcccgcgcg tccgagctgg tccagcttcg gatcgaggac gtgagccttg      3000
     ccgagcgcgt cgtcaccatc cgcgagggca agggcggcaa gcgccgcgaa atcccgatcc      3060
     ggcgcgacct ggcccagctg cttcagctcc acatcggggc tcggcgcgcg gggccgctgt      3120
     tcgccagccg ccagcagggc tccggcccga cgccgcacgt gctcacccgc cagcggatcg      3180
     gccaggtcgt gcgcgaggtg gcccgcgacg ccgggatcac caaacgggtc tacccccacc      3240
     ttctgcgcca caccgtcgcc acccgcctgc tggcgctcgg catggacatc accgaccttc      3300
     aacggttcct cggacacgag agcatcacaa cgacccgtct ctacgccgag accaccgccg      3360
     ccacgctgca gcgcaagttc gacgccctca ccgatccggc cgcccacacc ctcgtcgccg      3420
     tcattcgcca gcggcagggc gacgacgctg cgctgctggc cgccggtctt ctggcccagc      3480
     gccgggcgga gcgggtcacc actgctggtg catgagaact tggtgctcgc ccttccacag      3540
     acgggcgttg accgatcgcc ggacgaacgg ccgcccctga gcgtgctcgc gcgctttgcc      3600
     tcgctcaacg gcgcgctcca gccgccagag ggtctcctcg tcgggctcct caggccgcgg      3660
     ttccagcacg aactcgccca gcacgtcggc gagttcgcga acctcttgca gcacctccca      3720
     cgacgtcgcg tcgttgcggt gggccatgaa gctctcgggg ctgccgcaat cctccggcgg      3780
     gcagtggccg gcgccgccgg tgcaggtcgg gtagacggcg tccggctccg gccgcagccg      3840
     gccctcgatg cggacctcgt gcgcccacgg gatgttgagg tcgtattcgt aggagaaccg      3900
     cgcgcccttg cgcagctgga gcgccgctag gtgtagcgaa gcgcaatgat gaccaggccg      3960
     acgcgcaatc gaacgccgtt ttcggcgcac attagctgag accggagcgt ctccccggcg      4020
     cacgctgttt gagactgggc gcacggtcgg tgagacgaac gcgagatcga gaagctcgac      4080
     gcacaatggc tgagacggtt aagcggcggg accgagcccg acagccggct gctctcgttc      4140
     gatgccggag tccttcgctg caataagttc tgcgaggcgt cacattgatt gtccgccgtc      4200
     agcccaggct tcacgtcaac gacgtgctcg accccgtcat gctcacaata ggtgatcttg      4260
     gccacttgct tttctccagc cgctgtttcg cggcgaaaat ccttttgggg aggcgtcctg      4320
     cgacgccgcc cagaacgtag aattctgtgc gacctgaatc ttaccgcgca cggttcgcag      4380
     tctacttggt gctgaagggg ggcttcagga acgcgcgggg atcatgaccg gcatggacga      4440
     ataaccccgg atcaagaccg acggcacgcg ctgcgggtcc tcaagcactt ggatctcagg      4500
     aaaacgaggc aggatctctt cccagagaat ccgtagctgc agctcggcca gacggttgcc      4560
     cacgcagcgg tgaattccaa agccgaagga caggtggttg cgcggccgct ctcggtcgat      4620
     gatgtaagct tcagggttct cgatcgcctc ctcgtcccgg ttgcccgagg cgtaccagat      4680
     cagcaccttg tcgcccttct tgatgagctt gccgccaagc tcgaaatcct gtgtggcggt      4740
     gcgccgcatg ttggagagcg gggtctgcca gcgaatggtc tcggagacca tggagggaat      4800
     caggctggga ttctcgcgca gctttcgcag ctgatcgggg ttctggttca tcgctaggat      4860
     cgagcccgtc atcgtattgc gggtggtgtc attgccgccg atgatcaaca ggagcaggtt      4920
     tccgaggtac tccatgcggt ccatgtttcg ggtggcctca ccgtgggcca gcatcgagat      4980
     cagatcgccc ttgggagggg cgttgacccg ctcgttccag agccgcgtga agtaatccac      5040
     gcagccaaag agctccattc ttcgctcggt ctcatagtcg tccgtaacga ataggcccga      5100
     ctcaggcacc gcagtagcga tgtccgacca gcgggtcagc ttgcgccgtt catcccaggg      5160
     aaagtcgaac agggtggcca gcatctgggt agtgagttcg atggaaaccc gatcgaccca      5220
     gtcgaagggc tcgccgatcg gcagttcgtc cagggtcttg gtgatgcggc tgcggatcaa      5280
     cggctccatc aggtggaggt tggccggcga gacaatcggg ctgacggttt tacgctggac      5340
     gtcgtgcttg ggcggatcca tcgcgatgaa catcggaagc gtaaagtctt ctttcggatc      5400
     gaagatcgtg atcgatggct ccgacgagaa cacctcgtga ttgatgtcga cggccattat      5460
     gtcggcatac tttgtaatgg accagaaggc gccatccggg tggtgatgcg ccgggtgtag      5520
     atgaaccggg tcctccttgc gcaaccgctc caagtatggc cacaccgtgt cggtgcgcca      5580
     gagctcggtg tcggcgaggt tgatgtcctc caacggcatt gcgtaggcct ttgcgcgggc      5640
     ctcggccctc agatcgatcg cgccgtcgct cattgaattc tccatctctt gcttatcccg      5700
     tcaatcaaga tgacgggcac ctcgggtccc taggacaaac ccctcataac ccttgtcggc      5760
     gctggcctga cacatctgca ggtacagtgg aacaccgccc ggataattca ataattcccg      5820
     tggcttaccc ggaatattag cacccatgta ccaggagtca gccaggggaa agagcgtcat      5880
     ggcgccaacc gcctcgacat ggtccttcca ggtctgttcg gcggcggtgg tcgcctcgaa      5940
     ccggctgacg cccgcgtcgc gcatgcgtcc caggaattcg accacccagt cgccctgcag      6000
     ttcggcgcag gtcgggccat tgcagaaccc cgaggggctc tgcggcccgt agaggaacag      6060
     caggttggga aagccagcgc tggccatgcc caggtgagtt cgcgcgccct tggcccactt      6120
     ctccttgagc gtgagcccct cgacaccgcg gatgtcgatc tgcgtcaggc cgccggtcac      6180
     ggcatcgaag ccggtggcaa gaaccaggag atcgagctcg tactcccgct ctgcggtctt      6240
     tacgccgccg ggggtgacct ccaggattgg cgtctccttc aggtccacca actcgacgtt      6300
     gtcctggttg aagacgtcgt agtaggtctg ctcaagggac gggcgcttga ccccgaacgg      6360
     gtgcggcggc tgcttcgggg caagcttttc ggcgagcttc ggatcgcgga tccgcttctg      6420
     caccttctcg cgccagaagt cgtaggcggt gcgattggcc tcgaggttca tcatcacgtc      6480
     gtagaaggtc gaggcccaga aactaaatcc tccggccgcc caactcgcct catagatgtc      6540
     ctgccgttct tccggagaga cctcaagcgc ggacttgccg ctggcgtgga aatcgaagcc      6600
     gccgaagctc tcgcgccggc gcgcgaaccg cgcggggtaa tccctcttca tgtcgcgctg      6660
     ggttgcctcg tccaggctgc actgttgcat ggccagggca aggatcggcg tacgctgaaa      6720
     gacggtcagc tgagcggcca cgcgtgcggc ctcctgcacg acctgcacgc cgctggcgcc      6780
     ggtgccgatc acgccgacgc gcttgtccgt catgtcgagg ccgtcctgcg gccaccacgc      6840
     ggtgtgatgt ttgacgcctt cgaaccgctc cagccccgcg atgtccggaa tatagggctt      6900
     ggcggcgaat cccgtgcaga gcaccaggaa tcttgcgcgc acggctccgc cgtccaggat      6960
     gctgaccacc cactggttgc ggtcgcggtc gaactctgcg ccttcgactc gggtgttgaa      7020
     tcggatgtcg cggctcagat cgagcttctg atcgacgtaa tggaaatagc gacgcagttc      7080
     gtcccaggct gggaatcgct cggtccaggt ccagtcgcgc cagagatcct cgctggagaa      7140
     ctcgtacatc gggacgtggg tgtccacacg agcgccgggg tagcagttcc agtaccagat      7200
     gccaccgaga tcggcgccgg cctcaagcag ccgcaccgag aaccccagtt ggcgaaggcg      7260
     gtggagttgg tagaggccgg tgaagcccgc cccgaccaca acgacatcga cctcttcggc      7320
     ggcgtgaatt tcgggcggaa cagtgggttg agtcttcata atttcaggcc agtcccaaat      7380
     ctcgtcgcgc gaactcggtg accgtcttgt agtccgcctt gccgttcgaa gcccgcaacg      7440
     gaacctgggt cagcaggatg tgcttggggg tcttgtagcc agccaggctg gcgcgcacgt      7500
     gccgacgtac atcatcctcg tcgaacgtga cgccgcttgc cagcaccacc acgccggtga      7560
     cggcttggcc ccacttgtcg tcgggcacgc cgaccacgag cgcgtcctcg atatccgggt      7620
     gggtcttcag cgcctcctcg acctcctcgg gatagacctt ctcaccggcg gtgttgatac      7680
     aggcgctgcc ccgtcccagc agcgtcatgg ccccgtcggc ctccactgtg caccagtctc      7740
     ctgggatcga gtagcgctgg ccggcgatgg tgcgaaaggt cttggcggtc ttttccggat      7800
     ccttgtaata gcccagagga atagggccgc cgatggcgat gatcccggcc attccgctgc      7860
     cgggttcgac aaggttttct tcctcatcga agaccttgca ccgggcgccg atctggaacg      7920
     tcgcggtctt aacctcaccg tccttggtca tggccgaaga gccgaagccg agcgcctctg      7980
     acgcaccgaa ggagtccatc agcaccacct gcggaatgtg ccccaacagc ccggacttga      8040
     cctcacggct ccacatcacg cccgaggaaa cgatcgagac caggctcgag gtgtcgtaac      8100
     gcccgcgttg ctcgtccagc gccttcagca tcggcttggc gaatgcgtcg cctaccaggg      8160
     cgatggactg cacgcggtgg cgcgcgacga ccgaccaaag ttcgtcggcc tcgaacgagg      8220
     cgttctgaag ggtgaccacg cagccgccgt tcatcatgca tccgatcgcg gtgatgagac      8280
     cggttccgtg catcatcggg caggctggaa gggttcggct tccgggaccg gcggcgcgaa      8340
     cgaagtcgag atgcgcgtcg agggtttccg gcgcgggccc gagccgccgc accgcgtcga      8400
     gctgggcctc acgcatgtcc tcatggcgcc acatgacccc cttgggcatg cccgtcgtac      8460
     cgccggtata gatgaacaga aggtcgtctg gagaccgctc gatccccaag ggcgcgccct      8520
     cgccggtcgc ggccaggtct tcatatcgct ccgagaaagg cgccggcgga tcgtcgtcgc      8580
     cgatctcaat gaacgtggcg accttggaca gccgatcctt cagctggagg attgtgtcgc      8640
     gaaactcgga gccatagatg acggtctgcg catccgagtc gtcgaagatg tagaacacct      8700
     cgttgggctt gtagcggtag ttgacgttta cgtgcgtcag gcggcccttg aaacaggcgg      8760
     ccagggcctc gccgtactct gggcggttgc gcatatagaa cgccactttg tcgcccggct      8820
     tcgcgccccg ggctaggatc gcgcgcgcca gattgttcga ccgacgcgac gtctcccccc      8880
     aggtgatcgt tcgatccccg tgaatgaagg ccggcgcgtc cgccgggagg gccttcggga      8940
     gggcgtcgag gatatcgccg aaattccagg tcatgggcat gcttcctaag cggcgatcca      9000
     gccctgaacg cgggcggcct cgttgcggac gagctccggc cctccgagca gctggcgatc      9060
     cagaccgatg cgcttgaacc agtagtggag cccggcgagg tcggtgaagc ccatgccgcc      9120
     gtgcacttcg gtggaggtcc gcgcgacgaa ccggccgacc tcggagaggt gtgattttgc      9180
     gtggcatgcc atcagggtcg attcgtcagg tgcatggtca aaggcgtgcg ccgcatacca      9240
     gaccagcgag cggcagggct caagggccgc cgccatctcg gcgcacatgt gcttgaccgc      9300
     ctggaaggac ccaatcggcc ggccaaactg cacgcgcgtg ccagcgtagg ccacggcctg      9360
     ttcgatcata gccgtgccgg cgcccaggat gtcggcggcc agcataatgc gccccgcgtc      9420
     gatgatacgg cgggtggtcc ggccgccgcc gccgggcaac ggatcggcct tgacgcccgt      9480
     catccggagt tcgccgactg agcgggtctt gtcgatggtc gtcagcggaa tctgcgtgag      9540
     accgggcgcg tcggctgcga ccaggtgcaa tgcgccggtg gtgtccgcca ccacgaacag      9600
     gtcggcgtcc gcagcgtcga gcacgaacaa tgctgtcccg tccagccacc cgtccctggc      9660
     gacaaccccg accccgtccc ggacctccac ggcttggctg actgcgacgg ccgccctcgc      9720
     cgccccggtc gccagctgcg gcagccacgc ctgctgttgg ctgtccgacc cgccgagcag      9780
     gatcgccagc ggcgccatca catgcgcgcc cgcgaaatgc gccggcgcga cgctgaagcc      9840
     gagcgtttcg gccaccagcg ccgcttccag caggccaagg cccatcccgc cgaattccgg      9900
     ggggatgata acccccggca cgccgagatc cgccaggccc gccgcgacat cggggctgta      9960
     gggcttcgcg gcggcggcga tatctcgcac atggcgcagc ggggattgct ccgcgagata     10020
     acgggccacg gcgtcctgca gcatgcgctg ctcgctcgaa agaccgaatt ccattaggag     10080
     cggctccctt ccgtggtggg cttcggctca cgcggcatgc cgagcccccg ttcggcgatg     10140
     atgttcttct ggatctgcgc ggtgcccccg ccgatgatca ggccaagctg gaacatgtag     10200
     gcctgctgcc agctgccgtg ggagcgcagg tgcgggctgc cgtcgtagag cacgccgagc     10260
     tcgccaaggg cgtcgatcgc cagcgccgat atctggtggg ccagctcgca ggactgtagc     10320
     ttgacgatca gccgcgcgag ccccgcttcg ccgccgttcg ccgaggcgct cagcacgcga     10380
     agcccattga atttcatcgc cgcgagttcc gcctgcagcc gcagcagacg atctcgcagg     10440
     atcgggttgt ccatgatccg gccatcgccg gctgtctcag tccgcatcag ctccgccaag     10500
     gcaaggaagc ggctttcgag ctggcccggg tcccccagca ttccgcgttc gtgcttgagg     10560
     gtggcgttgg cgacgaacca gccctgcccg cgctttccca cgatctggga cttcgggacg     10620
     cgcacgtcgg tgaagaaggt ctcgttgaac tcggcgtgcc cggtcatggt caccaggggg     10680
     cgaacctcga tccccggcgt tttcatcgaa aagatcagat agctgattcc gtcgtgcttt     10740
     cccttgtccg gctcggtgcg cacgaggcag aagatcatgt cagcctcgcg ggccgtgctg     10800
     gtccagatct tctggccatt aatgacgaag tcgtcgccat cctccgttgc gcgcgtctga     10860
     aggctggcga ggtcggaccc cgagcccggc tcggagtatc cctgacacca gataacctcg     10920
     ccgtggatcg tcggcccgat ccactggcgc ttctgatctt ccgtccccag ctccaacagc     10980
     gtcggaacca gcatcgaaat gccctggctc tgtagccccg gtgggacgcc ggtccgggcg     11040
     aattcctcgc cgatgatgcg ggacttcagg atgtccggcg cggccccata ccctccatat     11100
     tccttcggga tggtccgcgc ggcgtaacca tgggcgatca acagtttctg ccaggctacc     11160
     gcttctgctg agggccgctg cgcagccccg ccgcccttgg gggcggcatg gcggtgggcc     11220
     tcaagaaaga cgagcacttc gcgccgaaaa gcctggtgtt cggcgctgta ggtgagatcc     11280
     atcagcctgt cctttcgaga ggatcgtggt ggcgcttccg tggggcgcag ctcatcgcgc     11340
     gagctgttcg gatggctgga agcaaggcag gcggaagccg tctccaagct ctcggaagat     11400
     cagttcaacg cggataccca gttgcagggc gttgcggtcg cagttcagca accggctcgc     11460
     catccgcacg ccttcgtcga gctccaccag cgcggcgaca taggggattt ccccggcgaa     11520
     ggcggggtga agcgcctgat gggtgacggt ccaagagtaa aggctgccgg tcccgcggac     11580
     tggcgcccag gcgaaatctg gagacccgca ccgcgcgcac atgtagcgcg gcaggaaccg     11640
     ccaggcgccg cagtccgaac aacgctggaa gcgcaggcgt ccatcctggc attgacgcca     11700
     aaaggcgtcg tccatgggat cttgggtcct gggaagcggc gcgggaatgg tggggggttg     11760
     catgggggtc aggtcctcaa gatcgccaga ctgccgtcgc cgagatcgcc ccatccggtg     11820
     accagaccaa ttctggcgcc tggcacctgg cgcgcgccgg cgtcgccgcg aagctggcgc     11880
     accgcttcca gcacgtggtt gaggccccag acgtgggcct cgctgagcag accgccgtgg     11940
     gtgttcagcg gatagcgacc gccgagttgg atctggccgt ctttcacaaa gtcgtagatg     12000
     ccgccgggcg cgctgaaccc cagcgcctcc agttgcagca gcacgacata ggtgaagcag     12060
     tcgtagacct gcaggaagtc catgtcgcgg gcggtgacgc cggccatctc gaaggctcga     12120
     ggcgcagcgt aggacaggcc gattttgagc atatcgggcc gagagggaat gtcgtctgcc     12180
     ggataggggt ggccttcggc ggcgccggcg atcagcacgg gccggtgcgg catgtcgcgg     12240
     gcccgctcgg cgctggtcac tacaaccgcg caggcgccgt ccgtctccag gcaacagtcg     12300
     tagaggcgta agggctcgga aatccaccgc gcgcccaggt aggcgtccat gtccagaggt     12360
     tggccatagg tcacggcccg tgggttgagc tgggcgtgcg cacggcaggc cagggccacc     12420
     tcgcccatcg cctcgtcggg caccccgtag aggtgcttgt ggcgcatcgc gatccaggaa     12480
     tacatttgtg ccggcatcat cacgccgtag ggcatgtaga aaccctggat ggtgcgggtc     12540
     agcgtgttca tgttcatggc ccgctgcggc ggccggcccg gctttggacg aagcgcggag     12600
     tagccattcc accccagcac cacgaggacg ttgtcggcga cgccggcagc aacggccgtt     12660
     gcggcgttct gcagcgctgt ggtggggcta gctccaccca tatgcacggt ggaggcgtac     12720
     cgcagcacat cgacaccaag gttggcggca agctcctcgg acgatgtgta gatcggaggc     12780
     ggcaccatcc cgtcaatctg cgagggcttg agccccgcgt cggcgatggc cttgcgggcc     12840
     gcctccagca tcaggtccac ggcggtgcgt tccgagcctt tgacgtattc ggtctcgccg     12900
     atgccaacga tggcggcctt gtcgctgaaa ctcacggctc tttcctgtct ttcgaacatc     12960
     ggcgaagcgt tacgacctga agactgtcgt tctaggtggg cgggatcagg cacgagtgga     13020
     tggactcatc tccggtcacc tgacgcgcca gcgtccggat ggccagttcg gcgtccttca     13080
     actcgaagtc gtgagtgtgc atcagctcaa gtggcagcga ccgtgcctcg atcaggtcga     13140
     tggcctttcg gtatcccgac gaggtcacgc cgatcgcccc cttgatggtg atctccttga     13200
     agacgatcag gtctgagaca aagtccggta ttggcttgaa gcccttcacc cccgccagga     13260
     cgatcgtacc gccgggacgc acatagctga gggcttcgcg cactgggtcg gtggcgtagg     13320
     aggtcacctc cacgacgaca tcggcgccac gcccgccggt gagttctttg atgcgttcga     13380
     tggcgttctc gttctggaca tcgatcgtat ggtgcgcccc gaagatccgg gcgaggtcga     13440
     gcttgcgggc gtcggcggcc atgcccgtca cgatgatctt cccagcaccc gcctgccgcg     13500
     cggcgatgac gctggccaga ccgcgctggc ccggtcccag tatgacgata gtgtcgccga     13560
     cctgggtctg agggatctcc accgcccagc ggaacccggc ccccagcggg ttgaacatca     13620
     ccgcgagctc gggcggcaag gtcttgtcca tcttgtgaac gatcgtgttg ggggcgaggt     13680
     acatgtactg ggcataggcg ccccagagcc ccggcatgtt cgatagcgga atgtaggaat     13740
     agatctgccg gtcggcgcag aggtggtagc ggccgcccaa gcaggtgtca cagctatgac     13800
     aagacagcat ggtctcgacg gcgacccgat cgccgacatc gacgccccaa cggcgcgcgg     13860
     ccttgtcacc gatcgcctcg atgatcccta cgggctcgtg cccggggatc accggcatag     13920
     gcgttttcag aaccccctcg aattgctcgt agtcgctgcc acagatcccg caggcctcga     13980
     tcctcagaat cgcgctgtcg gcttcgatat cggggatcgg caagtcacgc atttcaagcg     14040
     tgcgcggcgc cgtctgaacc atcgcaaagg tcttggcggg aatcacgagc ttcgcctcca     14100
     gctgcgcagc aacaaatcat aacacatata tgtggcggaa aacgtatatc tgttatatcc     14160
     ccatctaggc aaggaccttc gatcagcttc cgcaggctca cgccctcagc ccttcgcaat     14220
     ggaatgaacc caatgaccgc cgacgccccg aggatcgacc ttctgagtct ggaagaggcg     14280
     gcgaacgcgg ccgggtcggc ggggatttct gaacagatgg cgccgctcag cgtgtttcgc     14340
     gtcctcctgc ggcatcccgc ggtggcgggc gagcttgcct ccacgctcac taccctcctc     14400
     tttcgaggca acaagctcga cgcccgcctg cgcgaactga tcatcatgcg gatcggctgg     14460
     aggaccggct cagtctatga gtggacccag cactggcggg tggcccgcgg gctcgacatt     14520
     cccgaggccg acctggcggc ttcccgtgac tggcggggag ccgcgaacct gtcggaggcc     14580
     gacagggctg tgctgcaggc caccgacgac acgctcgatc agggcatgat ctcggacgcc     14640
     gcctgggagg cctgctgcct ccacctggcg acggacgccg agcgcattga gctggtggtt     14700
     gcgatcggca actggaccat gttctcccag ctcctgaaga gcctgcgcat tccgctggaa     14760
     gacggtgtcg aggcctggcc gccggatggc caagcgccac gaacctgagt gtcccacccc     14820
     atagagccgg agtttccatg acacgcatac cgatttcgtc cgatctcgtc gggttggagc     14880
     tccccgccac cacccagacc tggacctcca aggacaccat gctctacgcc ctgggcgtcg     14940
     gcgggcgacc ggcggaagac ctggacttca tctatgaagg ccgcggcccg aaggttctgc     15000
     cgacctatgc cgtgatcccg ggcggcggcg ccttgggggg tctgatgcgc accgtcgaca     15060
     tgcgtctgga gatgctgctt catggcgaac agtccatcga gctgttccgg cccctccccc     15120
     ccgaagccag cgtcgaggtg agcggccgca tcaccgaggt ctgggacaag ggaaaggctg     15180
     ccgttctggg cgtcgagggc gtggcccgcg acgccgacgg cgaccttttc cggacccacg     15240
     ccacgctgtt cgtccgcggc gcgggcggtt tcggcggcga gcgcggtccc tcgggcggag     15300
     atagcgccgc gcccgaccgg gccccggata ttacggccag cttccagacc cgtcccgaac     15360
     aaggcgcgat ctaccggctg tcgggcgatc gcaaccccat ccatatcgac ccggcgttcg     15420
     ctaggatggg cgggttcgac gcgcccttca tgcacgggct gtgcacctac ggcattgtgg     15480
     gtcgcgccat cctgcgagag ctatgcgccg acgatccggg cgccttccat tccttccagg     15540
     gccggttcgc tgaccgggtg ctgtatgggg acactatcgt caccaagatc tggcgcacag     15600
     gcgacggcga ggccatcgtg cagggcgaaa ccgcagacgg ccgtatcgtc ctgtctcaag     15660
     ccagggcgaa attcgcagtc ccagcatagg catcgacatg tcgccctatc ctcacctgct     15720
     gtcaccgctg aacctggggt tcgtgacgct cccgaaccgc acgctgatgg gctcgatgca     15780
     caccggcctt gaagaggcgc cggatggata cgatcggcag gctcggttct tcgcccgacg     15840
     ggcgcaaggc ggcgcgggtc tgatcgtaac cggtggcgta tcgcccaatg aggctggccg     15900
     gctgggccgg aacggcgcgg tgatgcgtga ggccgccgtg gcgggacacg gccgcatcac     15960
     gtccgctgtg caccagtcgg gcggactcat cgtcctgcaa ctcctccacg cggggcgcta     16020
     tgcgcgtcac gagggcctcg tcgccccgtc gccgatcgcc tcccgaataa acccgctgac     16080
     gccgcgcgag ctgaccgagg aggagattct cgccacgatc gaggacttcg cgaacgccgc     16140
     gatgctggcc aaggaggctg gctacgacgg ggtggagatc atgggttcgg aaggttactt     16200
     gctgaaccag ttcctggcgc cgcggaccaa tcagcgcact gatcgctggg ggggctctgc     16260
     agccaatcgc cagcggctgc ctaccgagat cgtccgggcg gtccgcgctc gttgcggtga     16320
     tgagtttatt ctcgtctacc ggcagtcgtt gctcgatctt gtggagggtg gcagcacctt     16380
     cgacgaggtg gtcgatcagg ccaagacggt cgcggccgcc ggcgcgaacc tggtcaatac     16440
     agggatcggc tggcacgagg cgcggatccc caccatcgcc cacatggtgc cccgcggagc     16500
     tttcgcgtgg gccgcggcac ggctcaggtc ccatctcaac ttgccggtcg tggcgtcgaa     16560
     ccggatcaac accccggagc ttgccgaccg cctcatcggc gacggcaacg ccgacatggt     16620
     ttcaatggca cggcccttcc tgtccgatcc cgacttcgtc gccaaggccc gggccgggcg     16680
     acgcgccgcg atcaatgtgt gcattggctg caatcaggcc tgcctggaca acgccttcac     16740
     cggccagctc acgacctgca tggtcaatcc cgccgcctgc cgcgaggccg aattcggcga     16800
     tgtcgcgggg ccgatcgaac ccaagcgtgt cgcggtcgtt ggcgcggggc ccgcgggcct     16860
     ggccgcggcg gtgacgagcg cggagcgggg ccacagggtc accctgttcg agatgtcaga     16920
     gcggatcggc gggcagttca atctcgcgcg gcggattccg ggcaaggagg actatgccga     16980
     aaccatcgca tattacggcg cgcggctgtc cgagctcggg gtcgaagtgc ggttgggaac     17040
     gcttgcccgc gcgcaggagc ttctcgccgc cgcctacgat catgtgatcc tggccaccgg     17100
     cgtggagccg cgagccctgg actcggtcgg ggtggacgac cctcgtgtgc tcacctatgc     17160
     gcaggccatc gaaatgcccg aacgagcggg cgacacggtg gcgatcctgg gcgcgggcgg     17220
     cattggcttc gacgtggctc aactgctggc gcatccgact ggcgcgggcg atcccacgga     17280
     gcccgacatt gaggggttct cccgggattg ggggatcgac acggccttta ccgagtgcgg     17340
     cgccctgcag cggccgccga cgtcctggcc ggcggcccga cgggtcacga tcttccagcg     17400
     caagccggga tcagcattcg gcgcgggcct gagcaagacg cgcggttggg ccaacgtcca     17460
     ggaggtggcg cgccgcggtg tcgccatgac cggggatgtc gtctatggac atctctcgtt     17520
     ggagggcctg catatcacag tgggcggcat ccctcgattg gtcgtggccg acacgttcgt     17580
     gttatgcatc ggccaggagc cgcaagccgg aatcgccccg gcgctggcgg ctgggcgggt     17640
     tccatattcg ctggtcggcg gcgcgcgaga cgctgctggt ctggatgcgg tgcgggccat     17700
     cgaggaggga acccgggcgg cgctcacgat ctgagcggcc ccaaggattc gaatgcatgc     17760
     caaaacctga tcagtccgtc gttaagtccg ccgcccggac cctggaaatt tttgaatact     17820
     tcgacgaagt ccgcaggcct gcgcatatcc aggacgtggc cttggcgcta ggctatccac     17880
     attccagcac tgcggcgcta ctccgcagcc ttgccgatct cggctacctg gagttttcct     17940
     ccgacgacaa gacattcttt ccatccatcc gggtctccct gctcggtcac tgggttggcg     18000
     acgaaatcct cccgctccgg cgcattcagc agcagatgcg tgacatcgca gagcaaaccc     18060
     agatgaccgt ggtgctgggt gcggcgagcg gcggctactg ccagtacgtc cgcgtgatcg     18120
     agggcgcgac gccgatccgc taccacgtca aggcgggtac gcggcgatgc cttgctcgct     18180
     cgacactggg ccgcgtgctg ctggccatgg cccctcctga tcgcagggcc cggctgatcg     18240
     ccgaaggcct ggcggtgtgg gacggcgatg aagcgccgcc gcccgccgag ggggtcgcca     18300
     gagacgttgc ccaggtcgct gcccgaggac acgccttcca tgccggccta gtcaacgaca     18360
     acgccgcgat gctggccatc cccctctcgg tcagtccgcc cgcacatccg ctggcccttg     18420
     gcctggccgc ccccaaggac ctgttccggg gtcgccgcgc cgagttgctc aaaatcatag     18480
     gcgacgtgct cggaagcccg ggcccggccc acaagaccgc ctgagcgtcg gactttcgtc     18540
     aggcgggtct ggggttctgg atcaggacgg tgccctgcgc cgagcagcag agccggccct     18600
     cgttttccat ctcgatcctg acgaccgcgg tctgtttgct catggagatg atttccgcat     18660
     gcgccgtgac cgtcccgcgg ctgaccgggg cgagcaggtt gatcttgaac tcggtcgtgg     18720
     ccgcccactg gcccttctcc atatgggggt agcagacgca tcccaacacg tgatcgcagg     18780
     cggcagacag gacgccgcca tgcatgttgc cgaagcccgt cagcagcttt gggtcgacag     18840
     ccatctccgc cgtgaggccg cccggttcca tggccacgat ccgcaggccc aggaactcgg     18900
     ggaggccggt catccgattg ctcgaagcca tgaaggcttc gaccatctcg gcgtgaaact     18960
     cgggcattct gcgcgggatc attgcatttc ctttcacggc ttagcgaaaa cggtcggcgc     19020
     gagcgagcgc ggtctcggcg ccgctgacga ggtcttccag gacgtcccgg gcggggcgaa     19080
     tcgccttgat gagccccatg ccctggccgg caaacccagg cgcgatatcc ttgcgctggt     19140
     ccagggtcgc cgccgcgagc acgggcccgg cgatgatcga ctggaagggc atgggcagcg     19200
     gtgacttctc cgcgtccacc cacgcctgcg cccacttatt gcgaatgatc ctggccggct     19260
     ttccggtgac ggattttgac actaccgtgt cgccatcgcc gtactcgacc agaacctcct     19320
     tctggaattg ctgaatgccg gcttcctccg tcgccaggaa agcggtgccc acccaggcgc     19380
     cttcagcccc cagcatcatc gcggcggcta cgccgcggcc gtcggcaata ccgccggccc     19440
     cgagcaccgg gatgcgcccc gccatggcgt cgacgacctg ggggataagc gccatggtgc     19500
     cgatcggcga attgtgtccg cccccgtcat gtccctgagc gaccaccacg tcgatgccag     19560
     acgcggcgac ctgcagcgcg tgcttcacag acccgatgac ggccatgatc tttgtaccgt     19620
     tctcccgcag tcgctccatc caggggccgg ggtttcccag gcccgcggcg tagaccggca     19680
     ccttttcctc gatcaccacc tccatttgcg cctcgaagaa ctccttggag aagaacgcgg     19740
     ggccgccccg agcttcggcg ttggtgtcct cgcgcggacg gacgaccttt tgcaggcctt     19800
     cctggcgcat gaagtcggct gcaaacgcct gatagtcgcc aagcagatcc atgggcgacg     19860
     gcttgccgcc ctcgccggag cctgccgccg cgtcgaccac ctcgcggcgg accgaggccg     19920
     gcagcaatgt gtcgacgccg aagggcttgt cggtgagcga tcgcacttcg cggatccacg     19980
     cgcgaagttc ctcgggcgag caggctgcgg cgccaaggat tcctagccct ccggcattgg     20040
     agaccgccgc tgccaggcgg ggaacactgg ccccgcccat tccggcgagg acgatgggat     20100
     agcggatacc gaaaatctcg cagatgcggc tgtgcaaagc catgacagtg ttccttgtct     20160
     ctgatgatga gggtcgctga gccgaccttg ggtcagcgac cctggaagac aggcttgcgt     20220
     ttctgcatga aggcgagtgg cccctcccgg gcgtcctcgg ttcggaagac aggggcagcc     20280
     atttcggatt cgatctgcat ggcttcagct tccggtcggc ccaggcaagc tcgcgccgac     20340
     cggcggatgg cctgtaccgc aatcggcccg ttggcggcga tgcgctcagc cagatcaagg     20400
     gctgtgggca gcacgtcggc ctgggggacc acgcgattga ggaaccccaa ctcgagcgct     20460
     tcagcggcgg taatgagatc gccggtgagc agcagttcca tggcccgggc atagggtatt     20520
     tgtcggggca gtctcaccgt cgaaccgcct cctgggaaga tcgcccactt gacttcctgc     20580
     accccaaact tggcggattc ggacgcgacc cgcaggtccg tcccctgcgc cagttccatg     20640
     cccccggcga tcgcgtgacc gttgatcgcc gcaatcaccg gcttgaccac gtcgaaggtc     20700
     cgaagaagcc ctcggcccag catctctccg tccgccagca ggcgtcgatc ccactcgtct     20760
     tcgggtggcc gcgcgcgact catcaacgga atgaaccgtc caagatcggc tccagaacag     20820
     aaagccttat caccggcgcc ggtgaccacc gcgacgcgga tgtcggggtc gtcacgcact     20880
     gcggtccagg tgtcggccag tcgaaccagc atctccgggg agatggcgtt tctggcctca     20940
     ggccggttga gggtgatgag cgcgacatgg tccttccgct cgaacgtaac gacgtcgctc     21000
     atgctttctc cgacacatat gtgttttgtt atgacatctt catgctacgc tgactttccg     21060
     gatgaaggaa agcctgaagc gaacgttgcg gcggtccgcg gcggaaaagg ccgattggca     21120
     ggatcggtcg tcggcgccgg caggctgttc ccgtaagagg attatcgatg actgaaccgc     21180
     accgtaccgt cttcagaacg gccgacggcc tcgacctcgt cgccgaccgc tacggcgcgc     21240
     cgatccgcgg cggcgtgctg ctggcgcacg ggggcggcca gactcggcac gcctgggcca     21300
     agaccgcggc ggcgctggcg gatcgcggct gggaagccgt cgccctggac ctgcgcggcc     21360
     acggcgacag cggttggtcg ccgacgggcg actaccagat ggaacggttc gcgggcgacc     21420
     tcgcaaccgt cgccaacgag atgggcggac gtccggcgct gatcggcgcg tcgctcggcg     21480
     ggctcgcggg attgctcgct gaagccgaga tcgcgcctcg gagcttcagc tccataaccc     21540
     tggtggacat tgtgcccaac atggacatgg acggcgccgc taaagtcatg ggcttcatga     21600
     gcgcccatat cggcgaaggt ttcgctagcc ttgaggaggc ggccgatgtg atcagctcct     21660
     atttgcccca ccgcccaagg ccttcgaacc tttccggatt ggcgaagaac cttcggtgcg     21720
     gcggcgatgg tcgatatcgc tggcattggg atcccagctt cgtcgcaagc gcgaaccggg     21780
     aacggtcgag gcgagatgcg caggcgttcg acgccgggct ggccagtctg gccctgccag     21840
     tgcacctcat tcggggtcgg ctgagcgaat tggtgacgcg ggaagccgcc gaagatttcg     21900
     tcgcaacagt aaagaacgcc cagttcaccg atgtcgccgg cgcatctcac atggtcgcgg     21960
     gggaccgtaa tgacgccttc ctcgacgccg tggtgggctt tctcgatcgg ctggagcctg     22020
     tgtgaaaacg ccggagcagc tgagcggttt accgcgaagt tgccgccgcg ggcgcaactc     22080
     gaaaggctcc atagccgaca ctacaaagaa cgaagccaga tggagagtgg ccctgttcgc     22140
     cggtgagcct gggttctgtt gacggagtgg attgaacgaa cccgctacgc gggattggtg     22200
     cgagctgttt gaggggaagg cccctgtctg agaggatttg gtgtcgagcc aaccctcctg     22260
     acaggagcac cccagatggc cgagatgagc cctcttcgct gtcgcatggt cgaggacatg     22320
     tccgtccgca acctctcgcc ggcgacgcag cgatctacct tcacgcagtc tcgaagttcc     22380
     gccggtattt tagtcggtca ccagaccggc taggcttgga ggatgttcgg gcctgccaag     22440
     tccatttggt ctctacgggc atctcgtggc ccgccctgaa ccagactgtt tgcgcacggc     22500
     gcttcttcta tggcgtcacg cttggccacg gcgagatccc ggagcggatc gtctacgccc     22560
     gagagccgcg taagctgcca gtggtgctgg gcaccgacga ggtggttcac tttctggaag     22620
     ctgtgcccag cctgaagaca cgggtcgcgc tgacgacggc ttatgcggcc gggctgcggg     22680
     cgtccgaggc cggcagcctg aaggttggcg acgtcgatag cggccggatg gtcattcggg     22740
     ttgaacacgg caaaggcggc aaggaccagt atgtcatgct gtcgacgcag atcttgagca     22800
     tcctacgtgc ggtgccgccc ttaggatcga tcttcgggca gttcctacga tcgagctagt     22860
     cgttcacctg gccggctcac ggagtagcgg cgtcaacggc ggcctctaac gcggcataga     22920
     cgatgggctt ttcaacgact ggaaagccaa ggccccggac catatccacg ttgccggtga     22980
     cgtaaatcac cggcagtacg ccgatctcgg tcagaatggc ctcgacggct tgcggccctg     23040
     ttccctccaa aattcggtag tcggcggtga tgagatctgg acgatgtccc ctagcgagga     23100
     tcaaagcctc ttgtggacta tcggctatgt caaaggacag aaatccgaga tgacgcaaat     23160
     gcgcttcgat ttcgagggca atcaacatct cgtcttcgat gatcaagcca tgacggctat     23220
     cggcgctcat gcaatgcctg cccaatcatg accgagaacg tcgcgactca tggagtccga     23280
     ttgtcgaacc atgacagcaa agggccggcg cgtcgatgct cggaagaatc gggaagtgca     23340
     aactcaatcg tcgccgcagt tctgctttct caccttcagc ggagggccat ctctttccag     23400
     atggcctgaa gtgtccgaat ctgctcatcg acggaatccc taagatcgtg ggcgccggtc     23460
     agagccaaac cgacctgtgc gccccgacgc caaatcaccg tggcgtcatg ggcgacgcca     23520
     tcacggggta ctaggagcct gacggatagc gtcaacagga cagggctttc aagctcgatc     23580
     cgtgcgccgg ccgggctgag gttgcggata ccgcaggaaa tagtcacggc gggatcgccg     23640
     taagccaacc ttcccgcgag aaaggttcgc tggcgcgggg ctcgccgacg ttccatcgca     23700
     cgcggcgtta tgggggagtg atgggcgacc atgccgacag gctagatcga aaagctttag     23760
     ctttgattgc ttagaaccgc acaacgtagc tcttccgcca aacgtgatcg ccgaatatcc     23820
     ctgccccgca ctctacagga tcaggagtgg tgaagaggga gtccgcgcgg ccacgcgtgg     23880
     ccttggccgc agcagtcttg caatgcgcgc aaggagttgg acgtcatcaa agggcttggt     23940
     cagaaaatca cgagcgccga gcgccatagc ccgctggacg tcgcctgggg cgttacgagc     24000
     ggtcaacacc atgaccggta tcggcgcgag cgggggcttc ttgcgcaagg cgtccagaac     24060
     gccgaacccg tcgaggttgg gcatgttgat gtccagcacg acggcggccg ggcgcgtctg     24120
     ctggatacct tgaacggctt cccaaccgtc tcgaccatag gcggtgtcgt agccggcgag     24180
     cgtcaggcgg gtgacgatca gatcgagaac gccgcgatca tcctcggcca cgaagaccct     24240
     ccccttgcgg gcttcaggct gcgtcatcaa ggggatcctc cggccaagcc atggctttgg     24300
     cgatcgccgt caataaattc acccctgtca ggggtttgcc aaccatgcca tcgaacagac     24360
     ccgtcgcttg ggcctgatcg acgtccgccg agaaggcgag gatcggaatg gtggcgttgg     24420
     gcccgtcctc ggtgcggatg caccgggccg cgcccgcgcc gtcaaggccc ggcatccgaa     24480
     gatccatgag aatgacgtcg aacggcgccg cgttggcggc cgccacagct ccgagtccgt     24540
     ccacgacttc ggtgagttcg acgtcgaacg gcgacagcat cgcccggaca agatcgcggt     24600
     tgatccgatt gtcatccgcc acgaggattc ggcagccggc gggcagcatg atctgacctt     24660
     gtggcggagc ggcgatgggc gcggcgacgt ccagttcggg agctggaatt gtaaaccaga     24720
     agcaggaccc ttcaccgacc ttgctctgcg ccccgatgtc gccgcccatg gcttcggcga     24780
     gacccttgca gatcgccaag ccaagaccgg tgccgccgtg tttgcgggtc gaggacgcat     24840
     caacttggga gaaacgttgg aacagctgat cggcgcgatc ctcgggaacg cccgggccag     24900
     tgtctgtcac cgcgaatgac aggaatccgc caagcggttc gaagatggcg tcaacgcgga     24960
     cgctgccgac catcgtgaat ttcacggcgt tgccgatcag gttgagcaat atctggcgca     25020
     cccggtcggg gtcggcccga acggtccgtg gcagagtctc cagcccgccc aggtgaagcg     25080
     cgatcccctt ctcggcggct tgggtcgcga agaggtcgag ggtttcggtc gccaacttcg     25140
     cgggcgacat cggtcgtggc gcgatctcga cctgcccggc ttcgagcttg gaaaagtcga     25200
     ggatgtcatt gaccgtaaga agcaaggcct ggccggcatt gcaggcgcgc ttcagataac     25260
     cgcgcgtggt gtccgacagt tccggctgct cctcggccag ccgcgagaac cccagcaccg     25320
     ccgtcagcgg cgtgcgcagt tcatggctca tattggccag gaactccgac ttcacggcgg     25380
     cggcggcctc ggcctcggcg cgcgccgcgc gcaactccgc ttccagcact ctacgggcgg     25440
     agatgtcgcg cacgacatcg gtgatgccgg tgatggcgcc agtctccgga tcgaaggcca     25500
     gggtcgggcg ggcttccaac cacagttcgc gaccatcctt gtgccgcacg cgatattcca     25560
     cggcgatcgg cggttccgcg cctcgcgatt tgaactgttt ggcgacggcg gcttggacgc     25620
     cgggtacgtc ttcgggggcg atccaatcga ggatgttggt cccgaccaac gcctcgggtg     25680
     catagccggt cgtgggcagg attgatggcg agacataggt cacctgcccc ttgacgtcgc     25740
     tgtgcatgat caggtcgctg gcgttttccg ccaggagtcg atagcgcgct tcgctctggg     25800
     ccaaggcggc ctgcgcgtgt tgctgctcgg tgacgtcgct catcgtgccg accacggcga     25860
     tgacttggcc atcggcgtcc ttttggacca gcatgtttcc agtaatgtct cgcaactggc     25920
     cgtccgcccg aatgaggcgg aagacggcct ccatcgtcgg ctggcccgtc gtgagggcgc     25980
     ggtgcaagcg ctggctggac tcggcttgat cgtccggatg ggtcatggcc aggagggcgt     26040
     cgaggtcgag cggcaacgcg gggtcgagac cgtagatctg gtacatctgt tcggaccagg     26100
     tcaccgaccg cgtcgccacc tccaaccgcc aatgacctag tccggccatg cgctcggccg     26160
     ttgccgctct ctgggcctgt tctcgggcct catcgcgcgc ggcgatcgtc gcgtcctcaa     26220
     gcgccttgcg gtctgtcgcg tcgcggatta ccgccacgat ctcgagcggc tgatcctgtt     26280
     cgtcccgcac caatcggaag ctggtctcga cccagacggt ccgcccatcc ttgtggatcg     26340
     ctctgtgttg aagggtcttt tgctccaaac cttgggccat ctgtccgaat atcgccagga     26400
     tctgggatcg gtcgtcttgg tggacaaagt cctgagctga gcgaccggtc atctcctcag     26460
     gtcgatagcc gagaagccgc tcgatcgtcg gcgagatgta gccgctgccg ccgtccagac     26520
     ggatgcgcgt gacgacgtcg ctcatattgt cggcgagtaa cttgtagcga cgttcgctgc     26580
     gcttgatcgc attcaagatg cgtgtctgat cggtgatgtc ctggaatacg ccgaacaccg     26640
     ccgtcgcctc gccgtgctca tcgagttcgc acacgcccct ggagatcaca tcgcgaatct     26700
     cgccgtctgg acggttgatg cgcagttgag cttcaaaaga gcccttggcg gccacggcct     26760
     ccctgacgca ggccgtcaac ttggcccggt cgtcgggatg atagagggct agcgagttcc     26820
     ggaggtcggg ttcaaagtct tcgcggctga ccccatggat cgtatagacc atgtccgacc     26880
     agcccacatc gccggctccg acctcaatgc gccaatggcc gacgcccgac acgctctcgg     26940
     tcagttccag cagacgctgc ttttcgctgg ccaaccgatg cgcgcgcgcc agttccagtt     27000
     catcaacgac gatcctggcc agcatcttca ggcggtcgag cttggcgggt gttggacggc     27060
     gacggggttt ggtgtcgatg acgcacaagg tgccgagggt tcggccatcg cgcgtggtca     27120
     gcaccacgcc ggcgtagaaa cggatatggg cggcgccggt gaccagggga tcggttgcga     27180
     aacgccggtc cgtcgccgca tcctcgacga ccaacagggc attggggccc atgccaagag     27240
     cctcggcgct caacgtccag gcctgcggcg gactgttggc tgctacggcg ggcgtggata     27300
     ggggcgatga gccttcaatc tcggtcagcg acaccaaggc gagcggggtc ttgaagaggt     27360
     cggccgccaa ggccgtcaca aggccgaacc gttcctgggg tggcctgttc agcgcctcga     27420
     ctatacgaag cgcttcaagt cgccgcgctt ctgcttcccg catgacctgc cgcttcccca     27480
     ttttgatcat tttgcacaac agcgctatcg cattggttaa ttgttagcgc ggcaattggg     27540
     cgcagcgcag gctccagtcg gcgaagccgc acggctcaac gcggtgtgta atttcgtcgc     27600
     agatcgtcgc gattcacctc gtgttaagca cgcggccatg aaggtcttgg tcggcgaccg     27660
     cgatcggacc gtgctcgaac tcctgcagat ccagttggac ctggcaggtt tccacacgtg     27720
     catcgctcgt agcggtccgg cggtcctcga cacccttaaa ttggtccgtc ccgccgctat     27780
     ggtcctcgat ccaggtctgc ctgagattga cggctacgaa gttctgcaga cgctgacgcg     27840
     acgcggtgaa aagcccgtcc agcctgacct gcctctgagc tttcatccag cgcggaccag     27900
     agtctcggca ttggttacgc cggatggcgc ggttggagca acaggccgag ccgtggagtt     27960
     tctacattgc gcagcgggtc ggcctgttgc gttcaggtgc gcggcatagg ccgcaggggt     28020
     ctggtagccg atcgatgagt gtggccggcg ggtgttgtaa tcttcggccc aggcggcgag     28080
     cttctggcgg gcgaggctga agaacagggt ctcgttgagc agttcgtcgc gcatccggcc     28140
     gttgaaactc tccacgaagc cgttctgggt gggcttgccc ggcgcgatat agtgccaggc     28200
     gacgcgatga tcctccgccc aggccagaat ggccgtcgag gtgaactccg tgccgttgtc     28260
     gctgacgatc atccctagcc ggccatgacg ggcgatcagc gccgacagct cccgcgccac     28320
     gcgccgacct gagatcgagg tgtcagggat cgccgccaga cattctcggg tgacgtcgtc     28380
     gaccacattg agaaccctga accggcgtcc gcccgcgaac tgatcgtgca cgaagtccag     28440
     cgaccagcgg gcgttggcct tggcctccac caggatcggc gcccgtgtgc cgatggggcg     28500
     gcggcgagcc cggcgcttgc gcaccggcag accttcctcg cgatagagcc gatagatgcg     28560
     gttcttgccg gaaggctcgc cctcccgccg cagcaggacg aacagccgtc gatagccaaa     28620
     ccgtcgccgc tcggcggcca ggctgcgcag tcgctcacgc agctcggtgt cgggcgcgcg     28680
     gcgagagcgg tagcgcacca tcttgcggtc cgccttgacg atggagcagg cccgccgctc     28740
     gctgatctcg aacaccgtcc gcagatgagc gacgccttcg cgcacggcgg cgggccctac     28800
     cattttttga gagcagctcg ttcaacgccg ccttgtcgag catggcgtcg gccagcagcg     28860
     acttgagccg tcggttctcg tcctccagcg ccttcagccg ctgggcctcc gacacgctca     28920
     tgccgccgaa cttggccttc caggcgtaga tcgtgccctc cgagacccca tgcttgcggg     28980
     ccaactcgcc cgccttcgcc ccagcctcgt tctcccgcag gatcccgatg atctgctctt     29040
     ccgtaaatct cgctcgcttc atgtccgtcc tctcaaggga cggactctag ctccgcgtgg     29100
     aggaaaaaat caggggcagg tcacctcgaa cgtggcgagc ctcataaatt acggcgaacg     29160
     gtatcggtcg ggtgagcgga tctcctcggc gtttgtggag gcgacggtca acgctgtggt     29220
     gagcaagcgg ttcgccaaaa agcagcagat gcaatggagc cgctgcggcg cccacctgct     29280
     cctgcaggcc cgcaccaaga cgctcgacgg aacgctgcga tcaacattcg agcgctggta     29340
     tccgggtttg gccaacgaca acgatcaacg cctcattctg gcgcagactg cgtgacccac     29400
     cccacacttc ctcatgctct cctgcttggt cagcttcgac cgcgatcact gcctagtgaa     29460
     agccatggca gccaaaagca cttgtgtgca agcctcgttt cgccggccca ggactacctt     29520
     cccaaccgtc agaccagtag ttcgctttca tttggagcag ttgaaatggg cggacggagt     29580
     agccgggcga cccgcgccag gagttggctc tcgctgaacg gcttcgtcag atagtccttc     29640
     gcgccgaggc ctacggcacg ccgcacatct tcagcggtgt gccgggccgt taggacaagg     29700
     acggggatac gcttggcgcc agaataggcc ttgagcgcct cgaggacgcc gaagccatcc     29760
     atttccggca tgttgatatc caggaccatc gcatccggcc gcaactctct gacgcgtccc     29820
     accgcctcgg ccccagttcg ggcggtatgg acgtcatagc ccgccatctc gagccgcgtg     29880
     cggatgagat ctcgaacgcc gaggtcgtcc tccgccacga ggatccgcga cctaaccgac     29940
     atcggcgaat tcctgaggct gcggatcctc cgcgaacgcc gtggctcgag ctatggaggc     30000
     gatcagcgct ccggcgccta ccggcttggc gacgacgtcc tgaaagccag cggaaatcaa     30060
     tcggtccgcc atattggtgt ctgcgtccgc agtgaaggcc aggatggggg tggcgtcatt     30120
     tgggccctgc gaggcgcgta ttctccgcaa ggcgcccagc ccatcgagcc ttggcatgcg     30180
     caggtccatg aggatcacgt cgtatggcca ctccgccgcc atctgtgcag cctcttcgcc     30240
     atcaactgct tcggaaacct cggcgccgac gcctgccaag aacaagcgcg ccagttcgcg     30300
     attggtcggg tggtcgtcga ccacgagcac gcggacgccg ccgaacgtca gccgttccat     30360
     cgccaagcca tcggtgttgc cttgcgaaag gctcgacaag ggcgcgggga ccttgaacca     30420
     gaaccgactg ccctcaccca tccggctctc gacgccgatc tccccgccca tggcctccac     30480
     caagcctttg cagatcgcca agcccaggcc cgttccgcct tgaacccgcg tcaacgaccc     30540
     atcgacctgc gaaaaccgct tgaagaggcg atcctgcttg tccggggcaa cgccttctcc     30600
     ggtatcgatc acatcgacgc tgaggacctc ggcggcgcga tcgtagcgcg tgcgcagggt     30660
     aacgctgccg cccgtggtga acttcaccgc attgccgaca aggttgagaa ggatttggcg     30720
     tatccggtcc ggatcgactg caatgatcag atcgtcgtct gcggcctccc catccagggt     30780
     gaggttcagg tctttggcgc cggcctgtgg cgtgaacagg tccaatgtgg cgcggctgag     30840
     cttggccaag gaggccggtt ggacctggaa gctcacctgt ccggcttcca gcttcgagaa     30900
     atccaggatg tcgttgacgg tgcacaggag cgcacggctg gcgtcgccga cgcgttccac     30960
     ataggtgcgg gtcaggtcgg tcaggtcgct ctgctcggcc gcgagactcg tgaagccgat     31020
     gatgctggtc agcggcgtgc gcagctcatg gctcatattg gcgagaaact ccgccttcac     31080
     ccccgcagcg gcttcggctt cggctcgcgc tagccgaagc cgggcctcga ggagcttttg     31140
     gtcggtcacg tccaccatgg ttccgatcat ggcgatgacc tcgccgccgg gaccgtgttc     31200
     ggcgcgagaa ttgcgcgcca ggtatcggac ctcgccgttg gcacgcacga tccgtgagat     31260
     cgaattctcg tcgacctcac ctgtcgcgag ttggcgcttc agtcgggccg ccacagcctc     31320
     agcgtcgtca ggatggatca tgcctatcag cgcctcgagg tcgagcggcg cgtcggaggc     31380
     gaggccgaag atatggtaca tctgggtcga ccaggtgacg tcgcgagtgc gcgcatccac     31440
     gcgccagttg ccaaggccgg caaccccctc ggcgacctca gcccgccggg cttgctcctc     31500
     ggccttgtcg cgcgcctggg ccatggccgc ttccgtgcgc ttcaggtcgg tgatatccac     31560
     gctgaccgag acagtgcccc catcgccagt gcgccgttcg gtgatccgca gccatcgtcc     31620
     gccagcggtt tgctgcgtca ggctgggcgc ctcgtcacgg cgagctgcgt ttcgttcggc     31680
     gagccactcc gtctctcgcc cgaccgcctc agggtagacg ccatggacaa ggctcgattc     31740
     cagcaagtcg gagaatggca tgccagcgac gaggatcgcc ccagatgtcc tgcaaagatc     31800
     gtcgtactgc gtgttccacg ccaccagccg atcgttcgcg tcgtagaagg ccaagccttc     31860
     cggcatgaca tcgagcgcct cgcgcaggcg gcgaaggttt ccattgcggc tggcggcgtc     31920
     gagggccacg ccgccgatcg cggtgataag gatcagcgca gtgaccgcca cggcgacggc     31980
     cgccatcacc ggatccgaca tcagcgaagc gggcaccgcg atgctgagat caggaactat     32040
     cgtcacggcg gtcatccccg tgaagtgcat cccgacgatc gcgagactga gcagacctcc     32100
     ccctgcggct tgctgcttaa gccccgcgcc ggggcgggcg acaaagaggg ccgcgctagc     32160
     gaacagcgcg ccaatcagca cggaggccac gatgtagttc acgtcccact ggaagacgcc     32220
     ggtcgtccgg tagccgctca tgccgacgta gtgcatggag gtgatgccca ggccgacgac     32280
     gaggccgccg ccgatcgacg tcagtcgccg ccgagaatct gcagtcgtcg ctgaacccgc     32340
     ggcaaagccc aaggtggtgc tgatgacggc gacagccagc gaccccattg tggccagggc     32400
     ctcataaccc gtcggtagcc cagtcttaaa cgccagcatg gcgacaaaat gcgtcgtcca     32460
     gatgccagaa ccggcgacca agcccgtcat ggcgagccag gtccaacgcc tccacaccgg     32520
     aaacgttgga accttcgaat agaggaagaa cgtcgccagc gtggccggga cacagacgag     32580
     cgcggcgacc acgaccagcc accaattgtg ttctgtggcg acgcacagca atattttgaa     32640
     cattatggcc gctccgagcg catttcgaac gaccatcccg gcccgtggtt aacagaacag     32700
     tcggggatgg agctaaacgc gttctgagga ccggccagga gccctgaatt ctgtcgattt     32760
     ccgggctaga agcccttgtg tacaatgggt tgtggtcaat catcgaggtc atggctgcgc     32820
     caattcgcca caagccggcg tcagccgatg gaccaaggcg acggcgacgg gtcggaccat     32880
     tcgatgtgtc ggttgccgac aacttcctgc aggtcatcgc caatcatgca gatgatgtga     32940
     cccgcttgag gggcgaccaa gtcgcggccc cgaccaccct cgcctatttc ttggtgccga     33000
     ccggagagag cgggcctgca agtatctctt ccagcacttc atatctaaac ggcttcaaca     33060
     acaatggccg gtcgcggtcg atgtccctca gaccatggcc gccgtggctc gtggccaagg     33120
     cgaacggcac gcctcgcgcg gcaagggcgc cggccacggg atggcttctg tggccgtcga     33180
     gatttgagtc cagcagggcg gcatcaaagc gttgcgtgcg cacgaggtcg acggccatga     33240
     tcgatcacgg tggctgcggc cacggactcg catccaagat cggctagcgt tttccgatca     33300
     gtctgcatca tagcctgcgg cggcgaagta gttggcgcat tcgttgggtg tgaaggcgtc     33360
     gatagcctgg gcgatggtct tccaaagctg ttcgacggtt cgggcggcgg ccttgcgcag     33420
     cagggccttg aggcaccgga cggcctggcc aagccgcacg cccacgtgat gttgacgacg     33480
     cgcgaggttg tcccggaggg gccgggcgcg ccgggcgctt tcggcaagaa ggaccgcgag     33540
     tggaacagca ccgacctttt gaccgactgg cgcgagcgct gggctgagca tgtgaccgag     33600
     cgcctggccg aactcaacat cgatgcgcgg atcgatcacc ggacgctgga ggcgcagggc     33660
     atcgacctgg agggccttcc cgtaaactct gcgccaaaag tgacgctaag aaagtcgtgg     33720
     aatttcaatg tgttgtgcga ccatggaggc atagcgcatt gatttataat gacattcagc     33780
     tgtttcagcc cgtcagcttc aagcgaccgc tgacgtcggc aatccgagca gagcggatcg     33840
     gttaacaccc cgctcaaagg tcatgacccc gcgaaggttg atatgctcat gcccgatcga     33900
     cgtgatgtgg gcgaggacgc cattggaaaa gataccaggg tcccggtcct actgccgacc     33960
     gatgggtcta tccccgcaaa ggtcccaaac gcgacatagg atttggcggt tctgtggcgc     34020
     ccgtcagcca atagcagtta cgcgtatctc caagacccgc cccgccgcag tggcaagaaa     34080
     ggaaccggcc gggcggatag accgagcagc gcggcccaat gttcccgctt tgcgccgaag     34140
     gtcaaactgg gcgcctgaaa cggttccgcg gcctaatcgc ggatttgacg gcgctggcgg     34200
     ccgatggggc gttggacgcc gatggtctga gggcacggct cgcaacgttg gtggagccgt     34260
     tccaacccga gcttcagatt tctcaggtcg ccgccatccc cggctagaca gcccgatatc     34320
     ccagctcgag ctctcgatgc cagcaagttc ggcgcggctg caatccgccg atgccgttga     34380
     aaaagcggct ggctgctgaa ggcgtgcgct ggcgtggtca ggctgtgacg ggcttcgtga     34440
     tgcttcgggc cttcaggtga gtgccggggc gatctgcaac tggattttgc gcaggttatg     34500
     agcggtggcg gcgagtagga actcgttggg tgcgccgcac ggaccgcgaa ggcgcagccg     34560
     gtccagcccg aggatgcgct tgaggtgggc gaacagcatc tagagtttct tccgctcgcg     34620
     cggggaggtt acgtaggcgt cgatcgtggc gatgtcgcgg gagatgtccc tagactcctt     34680
     ttagatggaa tgggtcacct tccgagccgg ctccttcggg cagcagccgg gcgtcagcgc     34740
     gcaggcgtcc caatcgatct tggaggcacg ataccgatag gaccgggcgg gtgtcggggt     34800
     catcggcgcg gaaggctcgc cgatattgct tcaggtcctt gccgcccgga tagcgatata     34860
     ggtcggcggc ggatcatagg tggggttgtc tcgggagacg gtcccgccgg tccggccaga     34920
     cttgtcgacg gtcgggatgt gggcgcgatc ccatggtggt tgaccagcca ttccagcgtc     34980
     tcgttcgagc tatagccggt gtcggcggca aggcggtcgg ggtggagatc atgcctctcc     35040
     tgaacccgtt cgatcatggt gcggaccgcg gtcagctcgg ccggccgtgc cgcggcggac     35100
     gtctctacat cgacgatcat tcaagacctt cgccagcttg agttgatggg ggggcggaag     35160
     aggggcgtca actcagcgct gcgatcgtcc tcacctttgg cgcgcgagcg cggtccagac     35220
     gctcgcggag cgccttggac cttcgggagg ccggcggatg agtcgacgat gcggagcgat     35280
     cgaccaggac aagcagaacg ccattcttga ggcggcgctt gatgttgcgg gaagcgcaag     35340
     gccgtccctg gccgcgatcg ccagcacggc gccggtatca cgccagaccg ctcataagca     35400
     gttcggcggc gcgcctggcc tgaagcgcgc ggttctcaac tggtgccgag cagcgctccg     35460
     cgacccactc gtcgccgctt tcgcgctgat gcggcttccg cctgggcggc tgctgttgcc     35520
     tgatttcagg cagggtagag tgcctttcga cttggcgcag ttatcctgtc ggcaccacgg     35580
     ccaggtcgag cggatgaacc tcacgatcaa ggaagccacc gtcaaacgct tccgctacga     35640
     cagccacgat cagctgcgca tgcacctcgc cgacttcatg gccgcctaca acttcgctcg     35700
     caggctcaag accctcaacg gcctaacgcc ctacgaatac atcgccaaaa aattgggttt     35760
     cagagccaga gcgatccatc ctcgatccga tccacaagat gccgggactg aacgctggaa     35820
     caaggccaac gaactcttcg cggccgcctg acgtctcgaa gggcggaccg tcgaggaaac     35880
     ttcacagtcc gcccatctgg cgcattgtca gttgcgtatt atatcagcgt cgctgttcgt     35940
     tcccccgcgc tgaggtttgc ccatgatccc ccacttcaag atcgccgccg ctggtatggt     36000
     cctgtccgcc gttctggcct ctggtgcctg gtcgaagacc ggagaggcga aggcgcccgc     36060
     agtgcccgcg tctgcaactc cggccgtgag cgaggatgtc gcccgcttca agatcggctc     36120
     gctggaagcg atttccctgc gtgacggcgg tctgaccgtt cccaacgaca acaaggtcct     36180
     cggcgtcggc cgcacgccgg aagaggtcgc cgccgtcctg accggagctg gcgcgccagg     36240
     ggagaccatc agcttgtcga tccagccgct gctggtccgc acgggcgagc gtctggtcct     36300
     gatcgacaca ggcgtcggct cgggcatggg cggcgcgggt ggcaagctgc attccagcct     36360
     gaccgccgcc ggcgtcgatc cggcggacat caccgaaatc ctgatttcgc acagccacgg     36420
     cgaccacgtc ggcggcctcg tcggggccga cgggaagttg cttttcccca atgccgtgat     36480
     ccgcatcgaa gccaacgagt gggatttcat gcaggccaac gccgagctga agtcggtggt     36540
     cgacgccatc ctccccaaga tccaggtctt ccgctacggc tccgaagtcg cgccgggcat     36600
     cacggcggtc gagatcgccg ggcatacgcc gggccattcg ggctttgaga tcgtctcggg     36660
     agcggaaaag ctgctctata tcggcgacgc catgcactct tcgatcatct cggtgcagaa     36720
     gccggactgg caaatccagt tcgacaacga cgcgcctgtc gccaccgcca gccgcattgc     36780
     cctggacgaa cgcgctgccg ccaacaactt gcgactctac ggctatcact tcgcctatcc     36840
     gggcgtgggt cgcatcgaaa agaccggcga cacctatcgc tgggtcccgg aagccgcccc     36900
     ggccaactga ggccggcggt catgacctga ggggggcggg ccgtcataag gcccgctttc     36960
     ccacgcccga tcccggtctg gcgcgtgaag ttcactacgg acgatgcgtg gaccgccgtt     37020
     gagatcgccc ttccattcgg ggaggggccg ggccgcatca tgttgaagag accagaaggt     37080
     ccaagcgcca cagcgccaaa tacaagatcg accgcgccat gggtgaaaac ctgtggggcc     37140
     gtgccaagag cccgttccta ctggcctcgc ccaacgccta taacgcgctg ggcgtcggca     37200
     cgacacagct gcacaacaag accgtagtct ataaccacaa gcgccacggc aagttcgccc     37260
     tgggcggccg cacctatgat ttccgcatga aacccgcctt ccccaagaag ctcagccggg     37320
     agttcctgtt ggtcgatctg gtcaacaatc tcgaccagct cggcgaagac ccccgggagg     37380
     tcctggagcg cgtcaaggat cgcctgtcct cgagcgacac ggcacgcctg aagaaggccg     37440
     cccagaccta tggctccgaa cgggccaaga agttcttcgc tcgcgccctc gccgaggtcg     37500
     gagtccagga tgccgcctga tttcctgcac aaccatcgcc agttcggcga cctgatccgc     37560
     atcgtcggcg ccaacgagaa gatcgagccg gccctgatcg agaaggacta ctggatcatg     37620
     cagagccttt acggcctgca gcagatgggc ctcaccttcg agctgaaggg cggcacttcc     37680
     ctctccaaag gctattgctt catcaaccgg ttctccgcgg atatcgacaa cccggcccaa     37740
     gtgaaatcgc ttgagcagta gcggacgcta gggcccagcc tttccaggca actcggaaaa     37800
     cggcgcacct catggcggac tgatttcagt tggacggctt atgagtttca gatagacaag     37860
     acttcagttt caattagacg tcacttggac ttcagtgttc atgtatcctc gccatgccat     37920
     cgaccggatc cgcgaagccc tgagcgacac ccgggtggtg ctgctggcgg ggcctcgcca     37980
     agcgggaaag acgaccttgg cccgctcgct cgccgaagcc ggccgcacct atctgaccct     38040
     ggacgacgcg accactctct cggctgccaa ggccgacccc gccggcctgg tgcgcggcct     38100
     agacaaagct gtcatcgatg aagtgcagcg ggcacccgat ctgcttctag cgatcaagga     38160
     cagcgttgat cgggacaccc gtccgggtcg cttcctcctg accggctcag ccaatctaat     38220
     gaccctgccg cgcgtggccg actccctggc aggccgcatg gaaaccatcc gcctgatgcc     38280
     tctggcgcag tcggagatcc tgggacagcc ggcgtcacgg tttctcgcat ccctgttcgc     38340
     gggccaggca ccgccgccag gcccgcctcg cctaggcgcg gacctgatcg acctggtcct     38400
     ggcgggcggc tatcccgagg ccctcgcgcg taagacctgg gctcgccgac aggactggta     38460
     cgctaattat atcgaggccg tggtcgggcg cgacgtgcgc gacatcgcca atatcgacca     38520
     acttgaccgt atgccgcgcc tgctacgcgc cctggccgag cactcgggac agctgattaa     38580
     tcacgccggc gtcggcgcca gtctcgatct caaccatgtg acgacgcaaa aatacaccgg     38640
     cgtctttgag cagctgttcc tcgtgcgcac cctgccgcct tggcacaaca acgccctcaa     38700
     acggctgact aagaagccca aactgcactt cctcgactca ggcttgctcg cggcgctgag     38760
     gggcctgacc cccgaacgcg tagccgcgga ccgatcaaat ttcggtgcgg tgctcgagac     38820
     cttcgtcttc gccgaagtgc tcaaactgac tgggtggagc gacgagcgct tctcgctaag     38880
     ccattttaga gacaaggagc aggacgaggt cgatatcgtc ctagaagatc gacagggcaa     38940
     gatcgtcggc ttggaggtca agggatcagc gacggtgcgc agcgaggatt tcgcgggcct     39000
     gcgcaaactg gcgcaggctg tgggtgatcg cttcgcgttc ggggcggtac tgtacgacta     39060
     tgaacaggtc gtgccgttcg gcgagcgcct ggccgccgcg ccattgtcca gcctttgggg     39120
     ttagggctca acgccggttt ccaagatata gccgtccccc tcgcgccccg tcaggcggct     39180
     cacctccctg acccgccgtc ccatcgccgt ccgctcgatg tagacgatga cgttgatcgc     39240
     ctgagtgatc gcccgatagg gtatccggtg ggtcacctcc ccgatcaggt cttccaggcg     39300
     cgtcagtccc tctaaggcgc tgttggcgtg gatggtcgcc agaccgcccg gatggcccgt     39360
     attccacgcc ttcaagagat ccagcgctga cccatcccgc acctccccga tgatgatgcg     39420
     gtcaggccgc agacgcaggg tgtcgcgcac caagtcggtc atggtcaccg gcgggtccgt     39480
     ccgcttggtc agcatctgga tcttatcctc ggccgagcac tggagctcag cggtgtcctc     39540
     gatcagcacc acgcggtcct gggcaaaggc cggctccgcc aggatggcgt tagcgagcgt     39600
     tgtcttgccc gagcccgtac cgccaacgat caggatgttc tgacgccccg tcgccgccgc     39660
     gcggatcacc tgcgcctggt gctcggtcat gatcccctgg tccacatatt ctggcagggt     39720
     gaacaccacc tctggccgct tgcggatcgc gaacgcgggg ctggatacga tgggcatgaa     39780
     ggcgccttgg aaccgctccc cggtctccgg aagcgtggcg ctgacccgag gccggtctcg     39840
     ggtgaccacc tcgcccacat gatcggccag cagccgcagg atccgatcag cgtcggcgct     39900
     ggccaggctc tggccggtga acgacctccc ctccccgatc cggtccaccc agatcttgcc     39960
     atccgggttg accatgacct ccactaccat gcggtcggcg agcgcgctgg cgatcaccgg     40020
     gcccatagcc tgcttcagcg cggcgacctt gcggtcggtg acgacggggt ggtgctgcgg     40080
     catttgaaaa ccaattcaat tggagacatg ggggcgtcgg cgtctcggca ggtccgtcag     40140
     ccaaggctgc cgtcgtcatc gtcgtcgcca gtccatcgca ggctcgagac cggggcgtgg     40200
     aggccctgcc cgctgtcgcc ggcgggctga ggtccatcat ccgtctcttc gggcgcaggc     40260
     ggcggcacga cacccttcag gccggccggg gccggctctg ccgcgcgaac cccaagccag     40320
     tcgatctgag cgggccctgg caggtcagcc gtacccggcc gctgctcgta cttggcgggc     40380
     acgccgtgga aatagtcccc cgtccgcgcc ttgaagaacg gctcgtcgta gtagcggatc     40440
     ttctccgccc ggatcggctt ggtgttgttc acgaacagga actgctggtc gtcgtccagc     40500
     tcgcggaccc ggtcctcggt caggatgtag cgctcgtgct cactctggga ggtcgagcgg     40560
     tgcgagctgc cgaagatgct gcgcggatcg ctgtagctct cgcgcatctc cagcgccttg     40620
     ccggcgcgcc ggatcacctt gtcgatgctc gtaggctccg aggtcgcgaa ggtggcggtg     40680
     atgtgcatgt tgtcgaagat cggcgtcttg tccccgtact tggagaacac gtcgttgaag     40740
     ctctggcaga tcaggtgggc ggtgatgccg tagccggcca tttcgcccat ggcgttttcc     40800
     aggaagggca ggctgccaag tttgggaaac tcgtcgagca gcagcagcag tcgatgcgcc     40860
     ttgcgccgcc cccggctgtc gaaatgctcg cgttccatca ggctgttgat cgtttggcgc     40920
     gtgaacaccc gcaccagaaa ggcgaggcgg tcggcatggg cctggggggt gatgatgtaa     40980
     aaggtgaccg ggctctccga gcacaccagg tcgccgatcg agaagtccga ccagctggtg     41040
     gcgtattcca cgtaggggtc ggcccacagc gatagcgacg cccgacaggt ggccagcaca     41100
     ttggacttca cccgctcgtc catgctgtcc agcgccgtgg cgcccagcag gatctccggg     41160
     tggacctcgg cgatgggctt gccgtcggcg ccccgcgcca gcccgcccgg cgcatgaagg     41220
     tccggtctgt ggcgatgttt ggtgtgcttc atcgcatgaa gggtcggatc gatattgatc     41280
     agcaggcggc ggacctgggc gaggttcttc ttggtgtcct cctcgctgta gaggacgtgc     41340
     aggatgatcg cggtgaagaa gtccgtcgcg ctctggtccc agaaattgag gtcgcccgcc     41400
     tttcggccca gcgggtccac caggatgccg acgacgttct ggatgtcggc gatctccatc     41460
     ggccccttcc gcacctcgaa cagcggattc catcgcacgg tgttggggtc ggtcggcgcg     41520
     aaatagaaga cgtggctgaa ggtcttccgg tgatcggccg tgatgtgcca aagctcccct     41580
     ttgcggtcgt agacgaaggc gctttgcggc caggcgatca gggtgggaac gacgtggccg     41640
     gcccccttcc cgctgcggga cgcgcccacg atgatggcgt gctccacacc gcgataggtg     41700
     aggtatttgc cgttgaaccg gccgagcacc cgtccgctga tctggccgtc accatggacg     41760
     agcttggcct tgcggacatg ggcctcggtc gcccaggcgt ccttgccaaa ctctcgcggc     41820
     gcccggcgcg tgctcttggt cagcccgatc agcaacatcg acgggacgaa cacggccgcg     41880
     agcgcgatca tcgccgccat gtcgaaggcc tgctggtagc gcgccgcgaa gcgcccatac     41940
     cagccaatga acgcccacgg cgcgtagatc ctcgcctgcc ccacatccag caggccgtgg     42000
     ccgaactcac gcgggtagtg gaagtcgtga gcgacgatct gagtggcgat cgatagggca     42060
     atcaacacgc tggccgctgc tagcggcagg atgatcttgg ggcgggcgct catggggcgt     42120
     ttcgctccta ccggccggga atgatggcgc ggccaatcga ccggccctgg ccacgtcgca     42180
     gacgctcaag cgcctgttcc tggaccggcg ttgggaagcg ctgcagggcc tcgcgcgccg     42240
     ggcggccgat atcccgaaag aaacgggtct cgtcgggtga ctggttgggg acacgaagct     42300
     cccgctcgcc aagttcgtgc gccagccgca ggtcgctgat cgtgcggccg gccaacccga     42360
     tccggttgtc catccgcttg atcttccgct ccagcgtgcg ccgctgacga accacgtcgg     42420
     cggcggcttc caggccgggc tgccggcgcg ccgcgacgaa cgcctggcct ttcggtgagc     42480
     ggacccaatc ctggcggact tgcaagccaa cctctgcccg gcgataggcc tttcgggcgc     42540
     gtccgatggc gttcagctcg gcgtgtttcg cccagatcat ccgcgccgga ttgcggaccc     42600
     aggccaccag ttccaggcgc cgcgaacggg tcttcttcac acgctcctcg gtctgctgaa     42660
     ggtgagccct cgcgcgcgcc ttggcggtcg ctgcctccgc cgtcagctcg cgttcgaccc     42720
     ggccggcgct cggcattttc ggcgcggaaa gcgcctcgcg ttcggccgcc cacgccgtcc     42780
     tctgggcgac catcttgccg agaacctgct cggcttcgac gaccagtttc gggaccgcga     42840
     cttcgatctc aggagcggtc ttggcgatgc ggtcggcggt cgcctgatag tcgcatcgaa     42900
     ggtcgcgcgc cttgtcgttg cgagcccgga cgtcacggtt caattcgccg cgctcagagg     42960
     cgatatcctt gcgctccagc gccgtggccg ccggccccag atgcacggtc ggggcccggt     43020
     caacgccgcg cgccgccaga ctcaaatgcg agacctgcgg agcgtccgga ccaaggtgat     43080
     gacgcagatg tcggttctgt acgtccgacc acgcggcgcg cagctgcggg atgaagctgg     43140
     cgtggttcca gtcgcggttc ttgcccccga aaccggcacg atcgacacgg cgggtcgtga     43200
     ccatgatgtg ggcgtggaaa ttgcgctgat cgccctcctt gccgggccgg tgcatggcga     43260
     cgtcggcgat catgcccttg gcgaccaggt gctcctgcac aaaggcgcgg accaggtccc     43320
     ggcgctgctc aaaatcaagt tcgtgcggca gcgccaggag gacctcctgg gcgggcacgg     43380
     cgtccttacg gcgctccgcg gcctcgacgg cgttccacag ggctgcgcgg tccctgtagg     43440
     cctgcggcgc gtcatccggc gccatgatct cggcgtgctc gatcccgtcc ttgttcgaga     43500
     agtcgaactc catggccagg cggtcatcgg tcagcgactg gcctgatcgg tacgccgccg     43560
     cggccacggc cgagcggcca aggccgcgct ggatggtctg cacctgacac aggaacgacg     43620
     ccactgaact gccctcccct gccggcgtga gccggcggga tcgctaaggg ctcggccctt     43680
     ggctcaaacc ccaggccgtc gcaggccgtg cgggggtttg agggtgtcgg gcggagcctg     43740
     accgcatcgt tggctgggcg tagcccaacc aatgaggata tgcgccattg tctgcaacac     43800
     ctctgccacc accatggacc atcaggcgct attttgatag aaaaagtgca tcacgctctt     43860
     tctcttcatc aagggtgcct gtcatgatcg cggtcgataa gcgcaagcgg aacacccggc     43920
     cttccaaata tcgcccccgc agcgagatcc agaagcagaa gcgcaaggac ctctgggccg     43980
     ctcgggaaac cgaccgcaaa ctggggcgcc ggatcagcga tgaagacgca ctgaaacttc     44040
     gactggagga gcttgaggcg gccttgcggg acatgggccg cacgggaatc cacaacaagc     44100
     gccacaccgt tccgctcgaa gatatcgcgg acgacggcca gcgtttcgcc gtgctgaaag     44160
     cccgggtcga acgcctcgaa gcactgtggg cgatcaacca gagaaagcgc gaaacccggg     44220
     gcaagatcat cctcggcggt gcccttttgg cggaggcggc cgacgaagct aggcaggaag     44280
     gcgaagccga ccttctgcat cggctggtcg atatcctcga ccgccgggtg gagagcgtca     44340
     gggaccggct gacggtgcgc gaactgctcg gaaacgtgcc ccttcccctt cgccagggcg     44400
     gcgatcccgg cgaggattta ctgggcgcgc tggaagccgt aggcggcgaa gcgcccgact     44460
     tcgatgcgat ggcggagtcg gccctggccg acgatgacga ccgccttacg ccgagcgatg     44520
     tggacaagga ttatgccgac ctggacgcca cctggcgcca gccggcctag tggcggcggt     44580
     cgctcgggcg gccgtcggat agcacgaaca tcgcccgcga gggatcgacc ggctgatcgc     44640
     ctatctggtc cacccgcgcc gcctgtaaat ccgcccccgt agagaccgac gtaaggaccg     44700
     cgacggggcc ttccacggcc tccggcggca gcgtggcagg tccgggaaac gcccggttct     44760
     cgcccacgaa gatgccgtcg ttcggggcgc tcaaagcggc cttggggccg gccggcgagg     44820
     gcctgggcga gctcgaacgc cctcccctgc ccgcctctcc tttggcagcg cctccgcggc     44880
     ccgcttccac atagaaggtg tgggcgccaa tcaccgccga ggatggagcg ccgccaaagt     44940
     tcgtcaggcc cggcgacacc gcgcccgcgg cttcccgggc cgcgacgatc cgggcgttct     45000
     ggaagaaccg cgcgccgttc gtcaggtccg gcaaacggcc ctcgatcgcc aggttgatga     45060
     tggtgctgac ccgagcccgc tgggcctccg aaacgggcgg cagattgcgc cagctgccgc     45120
     ccgcccgcat caccggctcg aactgcgcgc gggcgttcag cacggcctcg acgcttgagc     45180
     cccagcggcc gtcctgcagc cggttcatga tggtgtagac gacggctgcc aggccgctgt     45240
     cgccctggtt cgcggcctcc gcgaaggcga cacgggcgat ggcttcgcga gcctctggtc     45300
     ctcccaggcg ggcagctaac gacatggatc ctgacggggg tgcggcggcg gccgatatgg     45360
     agggcggagt ggccatcgcg gccggacaat tgacgccggc cggcagcggc tgagcgctca     45420
     tcccgcgggc cagaagggcg cacagaccgg cgagggcggc ggcgtccatc agacgtcacc     45480
     tgggcggtcg gcctgggtca tgatcgggcg gaagacgccg acgatcgcct cgtgccgaac     45540
     cggtccgtag taccggctgt cgaagctgtt ggggatgcgg ttggagaaca caaagaactc     45600
     gccctcgccc agacggcggc aggcgcgcca gtgcggtagc ggccggctct cgccgtcatg     45660
     ggcgagcacg ggcgcgcgcc acacgccgtt gatcaccagc ttgccgtcga gggtgcagac     45720
     ggtgtctccc gacatcgccg cgacctcctt taggatcggc atatggcgca tataggccat     45780
     gcgaccgctg gcgtaggtca ggaccgaggg cggggctggg aacgcgatga tctggccccg     45840
     gcttggagcc gcagcgctgc gaatgtagag gcccctgggc tcactatccg agcgattcca     45900
     cagcagcgac gggccctgaa cgaccagggc cagggcgccc agcagcacgg ccggagccaa     45960
     tgccgccgcg ataaccagga gcctgcgtct cacaaggcca tggatcatgt ctcagcccta     46020
     tgttgacgcc ccctgcttgc gatcagccac ggggcgtggc gcactgggag accgcgcagg     46080
     atgcgctttc tttgagtgcc ttttatggca aaaagtcccc tgccctacca gagatgaccg     46140
     atcggtgctg gggtggtgcg gatcgcgcga tcgggacagg accgcgcaag gcggtgtcgg     46200
     gagccggtca ctgaaacccc gacgatccgc cgagttgcca attcgcaact cggcgatggc     46260
     gggggagcgc cagggagccg ctttgtgctc caatccgaga gttgccaatt ggcaacttca     46320
     gcccttgggc cgcatccgga gtagctcacg ctgaaaggct tcggcgaaat ccgcgttgct     46380
     ggcggcggca tccagcgcca gttccaggac caccttcttg gatcccttgg tcgccagagt     46440
     gaacagggtc gcgcccgccg cgttggtcac tgccgtaccc ggcttgcccg acttgatcat     46500
     gggcttcgcc tcgcccgccg cagcgcgctt cagcagcacc atgaccttcg gcgcgtccaa     46560
     aggccgctga cccttggcga tcatttcagc ctgctgaacc gccaggcgct tggcctcggt     46620
     catcacccga gggcgcgacg cgccgtcagc caggagaggc ttgatctcgc gggcatggtt     46680
     ctcgcggagc tgccgcacat cgccgaaggc ttcgacgaca tcggtcggca acttggcgag     46740
     gtcgagaaag cgcgaaagcc aggcctttgg tacttccagc cgctcagcca ttcgctgagc     46800
     agtgccgccg tagaaggttt ctacggcgtg gcggtagtcc agggcccgtt cgtagtcgct     46860
     gatgtccttg cgtgaccggt tctcgacatc ggccagacgg aaggcctgct catcggtgag     46920
     ctcgcgctcc tcgacgaggt agcggatatc gcgatgctcg acgttcttga gatagctgat     46980
     cgcccagtgg cgccgcgccc cgcaaatgac ctcgaaatcg caggccgggt caccctcgac     47040
     ccgccgcacg atcgcgggaa actcttgctc cccctgggag cgaaggcttt caagaaggtc     47100
     gctgcagaca ctctcattca ggagatcgta gcggcgattg tgccgcgccc acatccggca     47160
     tcgagccgga tcaaccagct tgagggtctt ttccttgatg tcgccggcgg tgacacgggc     47220
     aagcccggtc agccgcgtgc tcaggcgctc tgtggcgggc gcaccccgct ccggcgtcgg     47280
     ggtttcagtg accgccgggc ctacgaggcc cgcgaggatg gagcgattct tgcctgttgt     47340
     ggatgccatg accgccctcc cctaccctaa acccagccgg cgcaggtccg accgatggct     47400
     tggccacgcc ttgcgaatca aaagctcaat ctcgccattc aggcgatcga ggttgtttcg     47460
     gcagcgctca tacgtcttag tcggcggacc ggccagttca tagaccgtgc gtagctgtac     47520
     gttggcgtta tcgatttctg cggagtcgag caacgaggcc gacagcatgt cggagccaaa     47580
     caccgcggcc atcatgtcgc ggatctgagt gtgggcgctc ttcccctcgt cgaccttggt     47640
     cgccacgacc cggaggaaat gatagccacg cgcgcccaga tgcccctgca tcacctcgag     47700
     ggtctcgaca atcatccgca ggaaatgggc ggtcgaggca aagtcgacgg tcgagggcgg     47760
     cgtcgggatc aagagggcat tggcggcgcg taatacggcc agcgacaaca tccccaacgc     47820
     cggcggcgga tccagtagga ctacgtcata ctcatcggcc atactttcaa caccgcgacg     47880
     cagccgatct agggcgtccg gattgccgcg aagtctcgcc gccgcctcat attccgcttg     47940
     gtatagtcct aggttcgcgg ggatcagatc aatgcccggc caagcggtag cccgcaggcc     48000
     atacttgagg tccggttctc cgccgtgacg gaagaagggc aggagggtct gctcgtcgtc     48060
     gatatcgatg tcggggttga acccgaagat tgtcgtggtg ctcgcttggc tgtcgcagtc     48120
     gatcacagcc acccggtagc ccttcagcgc gaggtactgc gccacatgac aagtcagggt     48180
     gctcttacca acgccgccct tgaaattctg gactgccagg ataatcggcg ggtcctcggg     48240
     gccgcgacgc ggccgggttc cgaaaacgtc gcgcatatgg ttgatctcgg ccaggctgta     48300
     gccttctcgc cgctttgcgg cgctaagcct tggggcgggg aggcggccat cggcctcggc     48360
     ctggcggatg gcttcagagg tccggccaac catctcggcc gctttagtga tcgtgaagcg     48420
     cagatcgacg atcttctctt ccccaggtgc gaacaccgag gtccgcagcc gggttatgac     48480
     gtcatgggcg cgatcgctga gtgccgtcat ggcgtccaag aggacgggcc cagacgctga     48540
     gctttccgtg agcgcagatt ttgccatggc cctctccttt gcaaatctcc aacgagatgg     48600
     ctggaatttg ccaagttttt ggtcggatgc aatgaagaat aagttaacag cgcggcgcgc     48660
     ctgaaccctc ctggttcaag gcgacggcaa gccagcctgt ccgccgcgcc ccgttagaaa     48720
     aattcttaga gacaaggtta gacagagtta aaggccgcga aatgcccaga aaaccgttat     48780
     gaaacaggag cttcgagaag tcccggtcac caataccccg agcccaaggt cactgaaacc     48840
     ccgtgcctta ggtcaccgtt cccccgttga acaggtcacc gttcccccga gggcttgacc     48900
     tttcgctttt cgaacaagcc atcaacggca agcgtacggg cgtcctcacg ggtccggcgc     48960
     tccgaattgg cggctaggcg cgccagatct gccttgatcg cggcgcgttc cgcagcgtcg     49020
     cggcggatga aatggacggc cggcgaattg tccgcggcgt tgacgaaact tgcgtcgtat     49080
     tcgggcaggt cgttggcggc gacaatccgc ttgagcaggt agttgaactg tttcagcgga     49140
     ctttcgctgc cggtcttgtc gtgcagcacg ctcacacggc acgtccagcc cgacgcctgg     49200
     tcgccggcgt gcttgcgggc gatccgatag atggcgcgct caacaccgcc ggagagggcg     49260
     aagtagtcgg cgtgcagggt cagcagcgac cggtccttga tgaccccttc atagacccag     49320
     ttggacaagg tgagtgtcag gcctttcggg gctccggtca ccgcgtccga ctccagtatc     49380
     cattcgtcga gccagccgaa ttgcgccttg gtgttgcgtt tggtccctcg aatcgaggtc     49440
     tgaatcgtcg tggcctccag tcgctgaaga gcggcctgga gttctcgata acccttgccg     49500
     cccgtgtcgc gcttgatcgc cttgagcaga tcataggtcg tagtgtgcaa ggttcggggc     49560
     aggtcgtttt cgccggcctc tcgcatctgg ttgatgcgtg aggtcgccca gatcaggatg     49620
     tcggcgtccc agatggtggc gatgccgaaa gcggggttgg cgctgacgtg gacccagacc     49680
     tcaccatcgg ggctggtgta ttcaatcggc ttcaggcgct tacgcttcga cagcgagaag     49740
     aacggccgct ccataacctc gcgctgatcc ttcagcggca ggctgttcat ccgggggacg     49800
     aacagatcaa attcctgctg tcgaatcgta cgcttagaca tgaccaacca caccacgagt     49860
     gacgaatttg ggaaagggcg gggcgcttcg ccacagaagt tgccaattgg caacttctgc     49920
     caaaacggcc tgtgtgtccc cgcgctaatt gtgctttcag gtgccgagcc ggcctgatcc     49980
     gtaagacgcg aataaagcag agcgatcatc catctcctct cacgattaag gtagacgctg     50040
     tgggcaccgt caagccgccc gcccggcgaa ccgggcgggc gctagagcta ctcctcctcg     50100
     gaggccggag cggcgtcagg ccggtccagc gaccgcagtt catgctgcgg cgtggcaacc     50160
     acgaccttgg agaagaaccg ctccacaccg tccttgtcgg tgtagcggtc gtgccggatc     50220
     tccccctcga cgaacacctt cgagcccgtc ggcagcgcct tggagccgag ccagcccact     50280
     gtgccctggt tccaaatctc gacctggtgc caggtcgtgt agtccttccg ctcgccgccc     50340
     gccttcgtgt agcggttggt ggcgacccgc agggtggcga ccttcttgcc gcctgacgtg     50400
     gtgcgaattt ccgcttcggc tccggtgaaa ccgatcaatt ggaccttgtt cagcatcgtc     50460
     tttctccatc tgccgctagg gaaatcccgg cggctcgcgg tccctgccgc gatcacgcga     50520
     cctgcaaggg cggggatgag ggacaggcca aaacccggtc cggttggaaa ccggcctgca     50580
     cggagcgcag cggaggaagg ccggagggtc catccggtcc gccgcgcgca gcggggtcgg     50640
     ctttgacctg gaccgccccg acctaggttg aagtgattga tcgcgcggac cgcagccagc     50700
     cgggcgtcac aacggcttgg agatgatcag aacaagggcc gcgagggcac ggggcgacgc     50760
     ggaccgttca acactaggca agggtcgctg cccgccgacg cctctgattg acgaccgcgg     50820
     agcgggcaag gggaggggct gaactcggcc cacctggccg ccatggaacc cggtgcgggg     50880
     gctgacacgc cctggggaaa agggatcgct gcgttggtcc agccggggag atggctgaca     50940
     gaagaaacgt cagtcacggg gtcggtcgcc tggtccgggc ctgccaccac ggcgcatacg     51000
     cacatcgcgg gccttcccag ccggcatcgg cacttaggag agatgctcgg ccccgcccgg     51060
     ttcgccgggc gggctgttgg ctaaaatctc gccggattac gcacccgttc gaggcctcca     51120
     aggcgcgacg tcagaacgaa tcgccaaccc caaggctgag tggccgccgg cctgcctgac     51180
     acaagggctt ggatttcgtt cgacccctgt tccgccggct tcatccaagt tggggaaggg     51240
     cagggggaac ggcgcccgtc gaagcgggcg ccgagttagt tcagtgccgc gtgccgcccg     51300
     tccgcgcgtg gatcatctgg tggaagtggg cgatggcggc ggtgtcgagc tcgaagggga     51360
     tcgcggtgat ctcctcctgg cggtccagct cctcggcgat ggccagaagg tcccagcatt     51420
     cggcgaccac ataccagctg ccggtgtcgt agaagtcgtg ggcgtgttga taaaccgctt     51480
     gagccatccc catgctgacc atctttcgtc tccctcttac gctgctggat ctgcgggctc     51540
     gttcccgcga tctcgcgacc gcccagggcg ggtgaaaggg aggggccaaa ggacgaatcc     51600
     ccgtgaaaac cggcctgcag cgcagcgaag gtcggagggt ccgcggggtt cgcctcgctc     51660
     aggcgaggtc gcctttgacc ctgaccgtcc cgtcctaggt tcgtgagatt aatcgcggac     51720
     gagttcgacc ccgcggcgcc caacccggga gacgactggc ggattggtgc tggcgccgac     51780
     atgcggatca ccacagccag acccctgacg ccctcagcgc cttgggcgcc ccctcgcgga     51840
     accctcacag gcgctggcga tggcgacatc ctcaaggtaa acggcgcagc gccgggcctg     51900
     ccgcctggac ccgtcggttc tcaccgcctc cgcaccgaca ggcacgcgcc cgccaaaatc     51960
     ggcgattggt ggcgtcgcga cccatcacct ggcgatccgt gcgacagcga tccgcagcgc     52020
     ggccggaggc gggacgccgg cgagaggggc tttcccgcta ggaagctagg aagctaggaa     52080
     gcgggagcgc agcgcacctc cactctttca cccgccagaa ggcgggtgcg gcggcccgaa     52140
     ggccgccgcg acgtgggcct tacgcccgcg ccttgaccac ctggtgacgg atacccttct     52200
     cgccggcctt ttggcccaga ttgagggccg gtccgaaagg ctgcatccca gcgccccgct     52260
     cgggattgag cgtgttcgtc agggtgagca cgcacactgg ttcgagggcg atcagctcgt     52320
     cgttggcccg gaacggcgcc gcacggccgt gtcggtcaaa atccgccttg gcgagcacca     52380
     gcgtcacgtt cttctgcttg gcccacttga tggcgatctt ctcaccgccc ttggcgcccg     52440
     tggtggctag cgccatctgc ggccattgga cgagagccca gttcagggcg tcgaagatgc     52500
     ggttcgcatc gtcggcgctg tcggcctggg gagctgctcg gaaggctacg atgattgcgc     52560
     cggggtcggt cgcggagtgc ttgcgggcct tggccgaacg gatggcttca cgagcctcga     52620
     tctgggcggc cgtggtgcgc gaagccttcg cagaaccctt ccaggggctc cagacgtcgc     52680
     cggtcgatgt cgtatagctg gcggccgcgg cgtctcggac catctcaagg gccagggtgg     52740
     cgacatcggc ggcgcgggcc ttttgggtgg cggcctgcat ctcggtgtcg gcgatctcgg     52800
     aaccgtcgaa gtcgcgggcg aagcggttga gatcatcccg ggccttatcg gcctcacgct     52860
     cgatgcgctg ggcggcggaa tggaaggcgc cgatcaggga ctcgcagatg gtcgactgaa     52920
     aatcctccag ggccgtttcg gagaagacgt cgagcacttc gttcatcagg gcgtggccga     52980
     gctgttggag agcgtcctct gcggggtgga cccgggggtc gtcgagcagc agggcctggg     53040
     cctcgaagtt gctcatggcg ccagttacgg gagagaaggc tgtaagttgc attgggagaa     53100
     atcccttttc ggagtggggt gcggagccca tcggctcgtt gaccgtctcg cgccgacggc     53160
     cggcgtcccc cgcaagggct ttgagcgcag cgtcccttgt ggtgggcacc gggcggtggc     53220
     gaggtcacaa caagccagag gggttcgggc cctcatcgac aggacggatc cactgcctct     53280
     tgcactcgct ccctcatccc tggcgccgtg ggctcggggt ccagaacctg cgatgatccc     53340
     cgccgcaccc ccagacgcga caacccctgg gcctcgccga acgacgcgcc ggcctcccca     53400
     agattgaaag aggatcagcc gacacggagg acactgcgcc tctccaccgt cagcacaggc     53460
     tgaggccgac aaggctgatc acagccccgg ccgcggcgcc taccctcgcc gacatccggc     53520
     agccgctacc caaaaggtcc gcgccgacag ccgttgctca taatatgctc ttgagagatc     53580
     agtaatcggc tttaggtacg ttcaagggtg catagcctgc ggcccgccga actgcgattt     53640
     gcttctcacc gcgacgtagg tcgttccatt aagtcttgat cgcccatgtc agcccgcaac     53700
     atgctgctcc tcgctccgcc ccatcccgtt gaacttgccc ttaaggaact cggggcgaac     53760
     ctgcggacag cgcggttgcg acgaaacctg acgatcgagg aggtcgccca gaagattggc     53820
     gtgggtcgcc gcgcggtgtc ggatgccgaa cgtggcaagc catcaaccag tgtcgcgacc     53880
     tatgccgccc tgctttgggc cttcgacctt ctcgccgacg tacacagtct ggccgatccc     53940
     gcccgcgacc aggaagggct gatcctatcc cgctcaaaag cgcacgtccg cgcacgacgc     54000
     ggcgaagcct tggacaacga tttctaggcc taatggcgca agccatcgtg caggttccca     54060
     aaccgccgct cgtggatagg ccgcgctagg acagacggct ttcctccaag ccacttactt     54120
     tactgagagc ttggtgatac ataatccttc attagcggag cgccaaggtg ccatcatggc     54180
     aacgccacac catccctcga ctgctgttcg ccaaagcctt cgcaagctgg ggggcgatat     54240
     caaggacgca cgccggcgtc gtggcttgcc ggcgcaggtc gttgccgaac gcgccttcac     54300
     gtcacgctcc acactgcgcc ggatagaggc cggcgacaac gccgtgggca tcggcatcta     54360
     tgcagcggtg cttcaggctc tgggcctgct ggatcggctt ggggacatgg ccgcgccggg     54420
     ccaggacgag gttggcctct cgatggcgtc gcaggccctg cccatgcgcg tgcggctcaa     54480
     gcgggtgaga gcgggcgacc atggctgacg ttgaggttca catcgacttc tctgccggcc     54540
     tgcgccgggt cggcacgctc caccgtcagc ctcggcgcgg cggggaagct gtggtcttcg     54600
     aatatcatcc cgcctggttg gcggacgcgg cccgcttttc actggagccc gcattgaccc     54660
     tgggccaggg cgcattcgcg ccggccgcgg gcctgtcgat gttcggctcg attggcgatt     54720
     ccgcgcccga tacctggggc cgccggctga tgcagcgcgc cgaacgccgc caggccgagc     54780
     gtgacggccg ccaggtgcgc gccctttcgg acgccgacta tctcctgggc gtggccgacg     54840
     tatcccggct aggcgcgttg cgcttccgcg agcccggtga agccgatttt cgggctccga     54900
     cccaaaccgg tgtgcctggc ctcgtcgagc ttggtcggtt gatgggcgtc accgagcgca     54960
     ttctgcgcga tgaagagacc gacgaagatc tcgcgatgat cttcgcgccc ggctcctcac     55020
     tgggcggcgc gcgccccaaa gcctcggtga tcgaccagca tggcagcctg tcgatcgcca     55080
     agtttcccaa agaggccgac gactatagca tcgagctttg ggaggaggtg gcgcttagat     55140
     tggccaagcg tgccggcatc cgcaccccac gtcatgaact ggtgaagatc gcggacaagt     55200
     ccattctgct gtcccgacgc ttcgaccgag atggcgagac gcgcattccc tttttgtcag     55260
     ccttgtcgat gctggggctg cgcgacggcg aacggggcag ctatcccgag ctggtcgatg     55320
     tgctcaccca acatggcgcc caggccaagc aggacgccgt cgagctctat cggcgcatgg     55380
     tgttcaacgt cctgatctcc aacgtcgatg accatctgcg aaaccacggc ttcctgtggg     55440
     cgggacaaag cggctggacg ctttcgcccg cctacgacct caaccccacg ccgaccgacg     55500
     tccggccgcg cattctcacg accaacatcg atctggatga aggcacctgc gacctgggcc     55560
     tagtggaatc ggtcgctgaa ctcttcggcc tgggtccaaa gcccgcacgc gagatcatcg     55620
     cgcaggttgg ccaagccacc aggatctggc gcgatgtcgc cgtcgagatc ggcgcgcggc     55680
     cagctgaggt ccgccgtatg caaagcgcct tcgaacacac cgatctagag cgggcattgg     55740
     cgatctgaac ctgctttggc gagctggccg gatggactgc tggacgccag catcgtcaag     55800
     gagcaatccc atcaaagggc aagcttgcgt gcacccagcc ctagccgccg tcgctcaggg     55860
     ctgcgcagtg cgcttgaagc gcacgcggtc cttcccgaca atcagcaagg cctcataccc     55920
     agcgtcggcc caggccctgc gctggacgtg ggtggagtca ggatcgggga cgttggtcca     55980
     ccactgcggc cgtgtggcgc ggccgggcag catcccgctg atgaccctct ccatttcggc     56040
     gaaactcagc tcgaattccg ccaagcgctg ccggcggagg tagcggcaaa gggggtcgta     56100
     tttggccatg cgccaccttg ccccaccaat cccgatcgac caatcccccc gagtttccgt     56160
     ggcggctttg tgaccctgct gcacacttaa agacccgccc agtgcgctat cctgacaact     56220
     ccacaacgct tcgtcacgct acagtaggat acctagatca atcccagcgc cttgaagctg     56280
     gcgacctcgg cgcgcccgac aatgacgtgg tcatgcaccg cgatacccag ggtccgggcg     56340
     gcgtcgacga ccttcttggt catctcgatg tcggccgacg agggagtctg atcgcccgat     56400
     gggtgattgt gaaccaaaat cacagccgac gcggacacct ccagcgcccg ccgcacgact     56460
     tcgcgcggat agacgggcgc gtggtcgacg gtgccgtgat tgagaatctc atcggcgatc     56520
     agctggttct tcttgtcgag gaacagcacg cggaacgcct cgcgttcaca gtgggccatg     56580
     gtgagcttca ggtagtcgat gagcgccgtc cacgaggaga cgacgcaacg ccctggcaat     56640
     tcggccgccg caagccgacg cgcggcgtcg tagatcagct gcaggtcgat gccgacacgg     56700
     gtgtcgacga acgtcgaaag tgcggcaagg tcggccgtca gcacccgccg aagacaaccg     56760
     aaccgggcca gaagtgctac ggccgtggcc cgggcgccgt tggccaggga ccgagagagc     56820
     aggagttcga gcgcctcgat gtcgctcagg ctcgccaggc cgccggtcgc ggccctcgcg     56880
     cccagcgtcc cgtttgaggg ggctggagac gaagggccgg cgtagcgagc ggtcatctcg     56940
     cccacgcccg ccgcggcgaa cagatcggcg gtctggcaag gtgtggcgtc gttgcgatga     57000
     gtgggtctgg gcatggaagc ctcaaggagc cagcgccgga ccaaatcccg gttcgctcgc     57060
     gagctcccgc ccttcctccg actttcccat cgggccgggc agggcgggcg ccgaacccgc     57120
     caaccctcgc aacaccgggg caggggcctc gcgcccctac gcggccaggg gttggctggc     57180
     ctgcgccggc tgactgtagg cgagcaggtg atcgacggcc cgctgggcgt gcccggaggc     57240
     ttccagtagg gccccggggc ggtccttcag aatcttgacc cagtgaccga gatacgccgc     57300
     gtggctgtcg aggatctggg gccttagccc gatccgcagc ccgatcgccg cactgccgat     57360
     ttcggcgaca agctcctcga acgcataggc ggcgtcgccg aaccgctggc cgaaggtgcg     57420
     gcccaggcga tgatccgcac cgctccagtg cgacttatgc cgatatcggc ataagtccca     57480
     taatgccgcg atccggatta tgccgcatgg cgtctgtcgg aggctggttt tccgggcatc     57540
     tgccatgcgg cggttcggca taattagaga ccttccaaga acgcgaggag cttgtcgtcg     57600
     gggcggaacc ggcctgacgg ggtggctgga acggcgacgc gagcgagcgc cttttccttc     57660
     atccgcatat cggcgtggat gtagatctgg gtggtctcga cattctcgtg accaagccag     57720
     agcgcgatca ccgctggatc gacgccgtgg tggagcaggt ccatcgccgt gctgtggcga     57780
     agcgtatgcg gtgtgacccg cttggtaccg atgctcgggc acgtgcgcga tgccgagagg     57840
     cagtgcttgc ggaccagatg ctcaagagcg tcgcggctca gtctttctcc ccggatcgac     57900
     gggaacaacg gtctgttctc atccttgtcg ttgcctatcc acgcccccag cagcttggcc     57960
     gtctcgcggc gaagcggggt cgcacgctcc ttccggccct tgcccatgca gcggatgtgc     58020
     gcgccgttcc cgagcacaac atcaccgagc ttgaggccga ccagttcgga tgcccgcagg     58080
     ccggtctgga tcgcgagcag gagcagcgca tgatcgcgcc gccccgccca tgttgtgcgg     58140
     tccggcgctg cgagcaacgc cgccatctcg tcggcgtcga ggaacgtcac cgtgcgcttc     58200
     acatagcgct tgttgggcat ggcgaggatg cgctggcatt gcagcagcca ggtcggatcg     58260
     ctcatcgcga cgtagcggaa gaacgatcgg atcgcggcaa gccgggtgtt gcggctgcgc     58320
     gcgctgttac ctctcgctgt ctcggtatgg gcgaggaagt cggcgaccag atcggcgtcg     58380
     atatcctcga cggtgagctt gaccggcggc ttcccgcatc gagcgcctgc gtaccgcaac     58440
     agcaggcgga acgtgtcgcg atagcccgcg acggtgtgtg ggctcgcttc catttggacg     58500
     cacaaccgat cggtgaagaa gcgctggatc agcgcgggca aggcggcggc gctcattgca     58560
     cagcttcccg gccatcggcg gtggcccgcg ccatcgccag atcgagcagt tccggaaccg     58620
     cttccagata ccagtacgtg ttggagggat cgctatggcc cagataggtc gtgagccgga     58680
     tcatttcgcg cgccgggtct ttgccggtgc gataccagcc gatcatcgtc ctcaccgcga     58740
     agctgtggcg aagatcatgg atgcgcgggc ctttgccatg cttgcagtat ggctgaggag     58800
     tccggagccc gatctgctgg cacgcgtgcg cgaagttgta tcgggcggca cagtcggtga     58860
     ggcgagtggc tttgtcggtg acgaacatcg gcgtgaccgg atggccgatc agccggtcac     58920
     gctcgacacg atagtcgatc atctgggcga ctacgctcgg gtcgagtggc agcagccgct     58980
     ctttgccgag cttaccctgt cgaacgcgca gcacgccatg attgatctcg aggtcttcac     59040
     catcgagtgc cagcgcctcg ctaattctca ggcccgtgac ggcgatgagt ccgaacaacg     59100
     tcgagcaggt cagcccgcgc agaccataaa ttgacggcag catcttggcc gccatgatga     59160
     tcgctccgat ctcggcatcg ctgtagatgt gcggtcgcga ccgtgcgatg gcgttcggca     59220
     gcagacctcg cggcagtact tcatgtgccg gatcgaagct gctcaaccac tgcgcgaaca     59280
     gacggacagc gctgagcctc gcccctcgag tcgaggtctg ggcctccgcc agcgtggcat     59340
     gccagcgcag gaacagcggc gtgtcgatat aggcggcacc ctcgccgtca gcgaaccggg     59400
     taaagcggcg gaggatgcgc tcgctggtgc caaggtcgta gccgaggccg cgccggacgc     59460
     tcagatagcg gtcgagctgg tcggtgaggc tcatagcgtg cctcccgcaa ccggccaggg     59520
     ctgcgcgatc gaccgcagcc cgtcgatgtc gagccgcgca tatatcatcg tcgatgaccg     59580
     cgatcggtgt cgcaacatgt cacccacttc gtcgagcgat gcacccgtgt tcaccagttg     59640
     ggtggcaagg ctatgacgca gcaggtgcga tcccacataa ggcgtcaccg gcttttggcc     59700
     ggtcgctttc aaggcatctt tgaggatggc gttgacgatc gtcccatcct tgaacggtcg     59760
     atgtggcgcg cgatgtgcga cgaacagcgt gcgacaggtc gccggtcctc gctcctcacg     59820
     aagataccgg ctcagcgcgt cgccgacctc cgcggtgagc ggcagacggt cgtgcagctt     59880
     gcccttgccg cgcaccatca gttcgcccgc gcgccagtcg atatcgtcga gttggatcgc     59940
     gacgacctcg gccgcacgca gcccgagccg ggccatgacc aacagcatcg cataatcccg     60000
     cgcaccatgc aggtgattgt cgcgaacaga cgcgagcacg gcctcgacac catcgggcga     60060
     caagtgacgc ggcattcgtg cagcccagcg tttcgccgtc ttcggaacgc tcagcgccag     60120
     attggtcgcg gtcgcgccgc gcgcgaacag gtattgaaga aagatacgga cgtgggtcgc     60180
     caccgtcttg tcgcgacgcg cgctggccag cacatgctcc atgaagccga ttacgtcggc     60240
     ggggcacagg cgacccggat cgggcaatgc cttgccaaac cgatagtcga ggaagcggcg     60300
     cgcaaaaccc accgagtgcg gaatactgcg cggactgagg ccgcgttgtt tggcgagata     60360
     agtctcgaag tccgccagca aagtcgcacg cgcgatctca ctgtctgtca gcggtaccgg     60420
     ctgcgccacg ccgatatcga ccaagtgttg gacgaaccgg cgcgcgatgg tgtcgaggcg     60480
     tattgtattc ttccgctctc ttggaaggtc gcgcgtcagc ggctcgacgc agtcgagggt     60540
     tacggacggg ggtgcgatac ccgcttcgtc cagaaccgcg ccgaacttcc tcgccagaca     60600
     ccgataagcg atgatcgtcc gagtctggta gttctctgcg gcataggtct gctcgaacgc     60660
     cgccagatac ggctcgacgc aggttttcag gttttcggac atgatcttcg tgctccatgt     60720
     tgtcggagcg acgaagatta tgccgaatgg cccgcacgta atcatgccgc caaccgcgct     60780
     aatgcagcgc catgcggcat aatccggatc gcggcattat ggacggcctc gtgagcaaag     60840
     gtggacttcc agtcctccac gcatccgaac gcctcgggcg gcggcatccg gatcaggtcg     60900
     gccgcgcgca catagcaggc ggtgttgccg ccgatctcca acctggccgg gatcgcatcg     60960
     agcaccgcat cgcgcgccgc cgcccgcacg gccggatcga tcttcggcac ctcgaggtag     61020
     atctgcggac agtcggtcag ctgctcggcg ttgaacaccg cgtaggtctt cagatagcgc     61080
     agggacttgg cttccccctc gccggcctca ctggaatcag cgacatcgcg gccatcgacg     61140
     acacgggtct tgtagaggat cgccaacgcg cttcgggcgc ccttggcgac cggcgcgccg     61200
     atcgccagcg cctgccggaa ggtgaaccag aaggggctcg tatagccgcg ctccgcgccg     61260
     gcgaacgcaa ggagccaggc gttggaaccg ctgaacggct ggccgtctga tcgcaggggc     61320
     gtggacgggt cggccccgtt cgcccacggc tgacgccagg gcggcacgcc gcgctccagg     61380
     cgggcgatga tttcgttcaa cagcggctca aggggattgg acatctggtc ctccggcggt     61440
     ttcgcgccgg atccattccc ggtcgctcaa ccctccggtc ccttcctccg cctttccccc     61500
     aagcgccgcc gtcgcccccg gcgcatcacg caaaaggagc cgcaggcgca agcccacggc     61560
     tcttgatgac ctctacgccg ccgccggcag gatggtctgg gctggccact tggccaggac     61620
     ggcgcagagc acctgtggct ggtcgacagg cacgaagacg cgaggggtgt agttgatgat     61680
     ttcgacaaag cagccgagcg cctggaacat cgcgcgctgg gagccggcgc cgacaacctc     61740
     aagccggtag cggtccatca ccttggcccg gcgaagccag aacccgcccg ccagggcgat     61800
     ggagatgttc tcgcccagga ccatactggc cgcgttgttg ccagagccga cggccgtggc     61860
     gacgtcgctg atcccaagcg cgatcttcag cttggtgaca tccgcggggc ccagaacccg     61920
     cccaagccag cgccgcccgt ccggagcctt cagccggcgg acgaaggtcc gcttgctagg     61980
     cagactgctc cacaccggca gcagcagacc ggtgaccagg gccagctggc gggtgtgcca     62040
     gggatcggcg ccggcgacct cggcgtccca ggtcgcgcgc cagatgggtt cggcgaccac     62100
     ctcccaggcc gattcctcat aggtcttcag gggcagcacg gcggccttct cggcgcggat     62160
     cagccggacg gcctgaacca gacggtcatc gtcgtcggtc gtcgtcaggc ccttcaccac     62220
     caggccggcg cgctgcgact tggtgttgac cacatactcc agcgtttgcg gatcgagccc     62280
     ggccagcgca tccgccgccg acgccagcac gcggcgtgtg cggacggcaa aggtcacgac     62340
     cttggtctgc gcgcccgaca ccgcgtcagt ccggatcacc tcctccgacg tcaccgtcag     62400
     gtcatcggcg acgatgtcct ccatgccctt gtccagagcg cccgaggcgg cggcccgttc     62460
     gaggatgctg gtgagcaccg cgtcgaaggt ctcgaacaag gcgttctgat cctcgatccg     62520
     cagcgccagg agccggttga gccaggtgtt catcggcggc aggtcctcgg ccttcttcaa     62580
     ctggccatcg ctgtcgagga gctgaagccc ggtcttttgc tcgtaggtca cccggtccat     62640
     cgccggcacg ttcccccaat gcaaggcgac gtagaaggcc tgcagtgcgc ggtgcgccca     62700
     ggggctttcg agattgtcct cgggccggaa gaggccgttg ccggctgttc ggcgctcacc     62760
     cttggtcagg gcgcccaggc tgtccagccg ccgcgagatc gtcgaggtga accgcttctc     62820
     gccgtggatg tcggtcgtga ccggacagaa cagcggcgcg ctggcctggt tggtccggtg     62880
     cgagcggcca aggccctgga tcgccgcgtc ggcccgccag ccgggctcgc agagatagtg     62940
     ccggcgacgg tcctggttcg cgcagttcag gtcggcgtgg tagctgcgcc ccgtgccgcc     63000
     ggcgtcggag aacaccagca cccgcttctt gccgctcatg aaggcgtcgg tctcggcctt     63060
     ggcgctcgac gcgctgcgac gctccaccac ccggcggcca tcgcgcagga cgacccggcg     63120
     cgagcggccg gtgatctcgg cgacgttgtc cgggccgagc gcgcccagga ccgcatccag     63180
     cacacccgga acggcgggca ggcaggccag gtggacgacc agcgcctccc gcaggcgcag     63240
     ggcctcctgg ctgacgaccg gctgaccatc cacgatcaac gggcgcatcg tcacattgcc     63300
     ttccttatca tcgatcgcct ccatggcggc gatagggaag gcccccatca gatagtccag     63360
     cacctggtcc ttgggggtca gatcgatggt caggttgttc cactcttcgg gcgggatctg     63420
     cgccagccgg cgctccatca ccgcctcgtt ggtcgagacg atctgcacga cgctggaacg     63480
     tccctggacg aggtcgtcgc ggatcgccgc gatcagggtc ggcgacttca ggcccgccag     63540
     cagcgcgccg aagaagcgca gcttggcgcc ctcgaaggcc gacatgaccg cgcaagcggc     63600
     ctgaccgctc ttggccttgc cgtcctgcgt gatgccgacc gcctccaggg cggcgcgcag     63660
     gttctggtgg atcaactggt aggcgtcggc ccaggcgttc cagatctcga cgtcatcgcc     63720
     ggtcagcaca tggcgcaggg cctgatattc caccccgtcg aacgacagcg accgggcgat     63780
     gtagaggccg agcgccttca gttcgcgggc gatcaactcc atgaccgcca cgccgccctt     63840
     ctcgacggcg tccatgaagg cgtcgcgggt gttgaacggc gcctccggcc cgccccacag     63900
     gcccagacgg gcggcatagg ccaagttctc gggcgtggtc gcacccgtgg cgctgacata     63960
     catcacccgc gcattgggca acctgttctg cagggccagg cccgccatcc cctgttgcga     64020
     ggccttcttg ggtccacgag ccccctggcc gccgcccgcc gcgttggcca tggcgtgggc     64080
     ttcgtcaaag gcgatcaccc cgtcgaagtc ggcgcccagc cagccgacga tctggtcgag     64140
     gcgcgaaaga cgcatccccc gcgccggctg acgcagggtg gcataggtgg tgaacaggac     64200
     cccccggtcc atgcggatcg cgtcggcctg cttccaggcg ctctgcgggg tgatgtcggt     64260
     ggcggagccg ccgatcgccg tccagtcccg ccgtgcgtcc tccagaagcg tgtcgttcct     64320
     ggaaatccac accgctttca ggcggccctg ggccatgttg tcggcgatga ccccggcggc     64380
     ctggcggccc ttgccgcagc cggtgccgtc gccgaggaag aagccgcgcc gcagctggaa     64440
     ggcgccgggg gcgccctcct tgaccagcac cagcttgtgc ggcgcttcgc cgagcaccca     64500
     ccagcccggc agaagccccg attgcgcctc gccggcgtag atcactgtct cgatctgggc     64560
     gtcggacagc agcccctcct gcacgatgtt ggtcggcagg agcgggcgat aggtcggggc     64620
     cggcggcgcc accgacgcca tggggccgga ctccaccagc gcggaggggt gtggacggct     64680
     gccctgcaag tccaggcggc tgacccggta ggcttggtag aggccgacgt cgtggccctc     64740
     gcccgaccag gcgattgtct cgaacgccac cggcgacgcc ccggccagga accccaggcg     64800
     ggtcgagggg gtggccaggg cgcgggcgcg cggcgccagg aaggcgacgt tggagaccga     64860
     tcggaactgg cgcggctggg cggtcgggcg cggatccagc gcggcgatca gcttggcgat     64920
     atcggccagg gtctcgccgc tgacgacctt gacggggacg ccgccgcact cttcgacgca     64980
     gtccaagacc agcaggccgg tctcgacgga cgtcccgtgc ttggcatagg cccggggcgg     65040
     gaaggcgatc aacgccacga cccggccgcg gcgggcgagc gcctgcatcg ccccggcgtc     65100
     ctcgaagagg cgcgtgggta cgatggcgct gagccgtccg ccttcggcaa ggcagtcgat     65160
     ggcggcgtgc agatgaccct ccagccgttg gaacggcgga ttggcgatca ccgcctggaa     65220
     gctgcccgac gagggcagga tgtccttcag gtgcgccgcg tcatggcggg tgcgcgagac     65280
     ggccgggaac aggccatcga gcagagccga acggtgcggc gcgatctcat tgagctccag     65340
     cgtcgccccg cacgcctcgg cgatgatcgc catcaggccg gtgccggccg acggttcgag     65400
     caccttgtcg ccaggccgga cctgggcggc cagcaccgcc aaggcggcca aggccggcgg     65460
     cgtggagaac tggtcgagcg cgacctgctc ctcgctgcgg cgggtgtggg tcaaggtcag     65520
     gtcggtgacg ctggccagca gcgccgcgat ctgcgccgga gcgtcctcga gccggccaat     65580
     ctgcgggctg agccgacgca gctgcaggac aagggccgcc tcgatggcgt cgtaggcatc     65640
     gcgccacgac caggcgccct cggcgtccga gcccccgaag gagatggtca tggtgctggc     65700
     caccagcttt cgatccagcg cccgcgaccg attgaggtgc ggggtgagcg cccgggcggc     65760
     ggccagcgta ttggcggcct tgtcctgggc ggcccctggg gtctgaaggg cgctgaagag     65820
     ggggaatgtc gcgttcatgg cggagatctt ccgatcaccc gtggcggagg gctcctccct     65880
     ccagtcccat cgggctcacc aagcccgctc ccttccccaa tcctttcagc ggctgatcag     65940
     cggggaaccc gttttagccg gctatccttc agcacctgca tcatctcctc cttgatccgc     66000
     cgaaacaggc tgggtgaaat gaagccatag gcatattggc cctggatgtt tggtgcaggt     66060
     cgtagcccgg ccaggccgtt tcgttcacct cgtcgaccat cacccaggac ctctggtcat     66120
     ccagaccaag ctgccttttg acggccaggg ggatttcgat ggcccgatca ccgtcacgcg     66180
     gctcggaatg ggtgatcggc gccagaaggg caatcgtcgc accgtccgca gtgcggcgat     66240
     acgaaaggac gacggcgaag gagcggggat aacgcgcctc ttggcggccc ctgtcgtatt     66300
     cgctgctcca gagatagttg aattggacga cgagaccggg ttcgggatct gggatcgcca     66360
     tccctggcta gtcgtccatc aacgcgtcaa gatggttatt acgaggatcc atctgcgcct     66420
     tccccaacgc ttcaatagcc tcgtccgaca aatcctcgac gcgaaacgcc cgagtggctc     66480
     ggctcttcag ctgcatgtat tcgtcatagt cgtgcttgga gacgaggacc tcagttacgc     66540
     ggctgtggtg cgtgacggca accggctccc gctgagccgc ttggcggtaa cgggagaagc     66600
     gctttgcgaa ctcggtcgct gaaacttcca tcatgacggc actcctaatt accgcaattt     66660
     acgggttttc cggaatttat caatgcggtg tttcgtcaga accggggaag ccaaatagaa     66720
     aaggaccccg ccggaattac cagcgaggtc cccctggcag ccaaggccgc ctggacttat     66780
     ccagatgcgg cccccgatca ggccgcgtgt tgaaccgaga cctccgggga aggtgcggcc     66840
     gggcctggtg tcaggtcgtc agccagggcc tcatcaccgt cgtcctggtc ctggtcctca     66900
     tcggccggcg gctgcgtctc aaccgtggtg ctctcccagg acagcacctg cggcgcccac     66960
     tggcgctcgg ccgcggcgtc agccaccagg acgactagct cgtccttctt tagggtcttg     67020
     gcccgaggat cgtctaactg catctcgtcc agcagcacca gcagctgcct cttggagtgg     67080
     acagccaggt agtcggggtc aggcgtccag tgcgccgaga tgtcggcggc gcaaagttgc     67140
     gccagctcga tggcttcggc ccgtgcggag tcgcggatgt tgctggtgcg ggcttcccga     67200
     aggttcaggg tgatggcggt aagttccgcc agcaaggcca tcttgtcgcc gtgggcgagg     67260
     ccgtcgaccc aggcgatggg acgaagtccc gaggccttgt agaccacacg ccgcgcctcc     67320
     agccgggctc gaatatcacc gtccagagcg ccgatcgccg gcgtctggcc acggcggtag     67380
     ccggtggcat tgatggccag cgccgactcc tcatggccag gcccgccttg cagcgccagc     67440
     tgcttgaaca gctgggcgac caaggctgtc agggcggcgg ccggattgtc ggcaagatca     67500
     cggatcagcc cgcgcgtagc cacgtcggtg cgggtctcgt gcaggacgtg gctggagccc     67560
     tcgacatcaa cgtcggcctt gggcacttcc acgtcgctgg cggagcgacc gtagcgcgcg     67620
     ccgttgccct ggccgccgct cgcatcgtcc tcgtcggccc cattctcccc agccaagtca     67680
     tccccagccc catccagcag ctcctccgac accggcgcgg cgaagaactc ggccgagatc     67740
     cccgtcgccc cgtccggcga caagatgacg gcgccgagcg ccagccgctt cagcggagcc     67800
     gaggccacct ccatcttcgc ctgcagcagg gggaagatcg tcagcgccgc atcgtcggcg     67860
     gcgagatcga caccgccgag gtcacgcgcg gcctgggcca cccgctgccg cgcggccgct     67920
     agcaccgcct tggtctcatc ggtcaggtcg ccggggtaga cgtagggcag ggtctcgaag     67980
     ccttccgggg cccggaagcc ggcgtctcgc ccgatgtaga cggcgagccc aagctgcttg     68040
     aacccctcga cgaagggggc ggcgcgctcc cgccacagat cctgcagctt gccgggatcg     68100
     agaaggacat cggccagttc ggcgaacagg tcggactcga cccgcccgcc ggcggcggtg     68160
     tagcgggcca tcccgaccag gccgaagcgg tcgtcctcga tggtcaggcg cgagccgttg     68220
     atcacctggt gcagctggta gtcatggaag tgaccgtcga gcgcggtctc cgccaactcg     68280
     ccctgctgct tcttgtcggg catccgcgcg aacaggcgga cctgcttgag gttcagcttg     68340
     cccaggcgca gggccttcag cacgctcggg tggacagctg acagggcctc caggcgcttg     68400
     atctccagct cggcgtagcc cagggcgcgg gcgatgccgg cggtgtccat cttggctttg     68460
     cgcagcttac cgatggcgcc gatgatgtcg gcgatgtgga ccggggcgac ctcggcgttg     68520
     ggcaggatga tcgcggcggc ctgctgggcc ttgctcgccg ccagcttgca gacgacggga     68580
     tagtcgtcgt cgatgtcgcc gcggtcgcgc aggaccagca agctgaaccg gcggcggcgg     68640
     ccgtccagcg tcatgaaggc ctgctcgctc ttgaggcccg cccgcacgat cggcgggatc     68700
     aggacgccgg cggccagcac ggtttcggcg agctggggca cgccgtcgtc cgccggctcc     68760
     tggaagcgaa ggttctcggg cgcgaggcca aggtcgccga ggcggacggt gatctcgtcc     68820
     atccgggttg gggagacggt ctgggtgtcg gtcatcgggg tgaggttcca gcgccgtggg     68880
     cgagggtcat cctgcccctg agcgcaccca accccctccc tacctccctc ctttccagag     68940
     ccgtcgcctg gccagccccc gcccctggcc gggaaggctc agtctcggag ggcagcctcc     69000
     acatcgttcc agtcgccgaa gggttcgggc ggaaactcga tccgcgtcgc gacgccctgg     69060
     cgttgcaggc gagccgccag gatctgcgcc gaggcggcgc cgtccaggcc gcgatcggcg     69120
     gcgatcagca ccgagcgcac gccgggcggc ggccgccagg tcttcaggtt gcgggtcgac     69180
     atcagggccc agccgggcag gctaaaacgt tcggtggccg agagcgtggt gaacaccccc     69240
     tcggccacca gcatctccgg cgccgccgga tccaggcgcg cggccgtgcc ggccggcacg     69300
     ggtccgaccg tcttgcgcgc caggcgcagg tccaaggcct tgtggccgtt cggtgcgagg     69360
     taggtgacct cgacggcggt gaacgcgcct tgcgcgtcgc agatcgccgc catcagggcc     69420
     ggccggcgat ggcgcgtctg gacgtaagcg gagaccggcg tgtctccgcc atggcgcagg     69480
     atctcggggc cgggcagggc gcgccggata tggcgcaggc ggcagtggcg ctcgcagagc     69540
     gtccccggga ccgcccggcc gccctcccag agccgcctgg cggcgtccag gcgctgcggg     69600
     tccggcggct ttgcgaccac ggccgcgcga gggccgccgc cagacaccga ggtcggcgcg     69660
     ttgtggacgt cgatcagccg gttgtcgcgc agatgatcca gcaccgcctt ccagtcgccg     69720
     tcgccgaagg tgtggacgac gacccggtcg tcctccagca gcagcgagac cgaacgatcg     69780
     gcgcagctgt ggcccggggc ggggatattg gcgcgccggc cgccggcata gagctcgccg     69840
     ccgagcgcct tgacgatgtg gcacagggac atggatcacc tccgcgtttc agcgccgcgg     69900
     cgctgcaagc ccggcgtggg ccaggccaag cccgcacacg ggctgctcgc caaaccagcc     69960
     cctcactccg acctttgagc accgcgcggt cgccagcccg ctgtccctgt caagtcagac     70020
     cccgccccaa ataggtcctt ttcttatata aaagttaccc tgcaaccgtc ggacgtacct     70080
     ggcgtttcaa ctgagaaatt tgccaaaaac tctgcggttg aagacggagg tcttggcgat     70140
     tttgacaaca ggacgcccag agggtcctga ccgacggcgc gccgatccta cagcgcttgg     70200
     tcctgaaaat ggtctcgaag gcccacgggc cgcaggaaca ccgccgtcat ctgacgaccc     70260
     ggcaacggtg agcaatgagt tatcgagacc gcgaccagcg cgtttcgtca cacgcaggag     70320
     acctctgttg gcgactatcg gtactttcat caagcgtggc gacgatctgc acggcgcgat     70380
     ccgcactctg accctggacg tcgatctggt gatgcggccc gccgcgaaaa ccagggccga     70440
     tggccccgac ttcctgatct acgccgccgg caccgccaaa ggcccgaacg gcatcgacac     70500
     ccagctcggg gccggctgga agcggacctg cgatcagaac tgtctgcaca tcgacgtcga     70560
     gcttgatgac ccggccttcc cgggaccgct ctccgccacc ttggttgagg accaggtcgc     70620
     gccgagcggc gagcgcttcc gcatggtctg ggcgcgagcc tagacgcgga ggatgggggc     70680
     gttgcgggga ccgccccgct gacctgatgt ccaccggtgt ggcgctgacg agcggttgtg     70740
     cgatcgttcg agcggcgcca gcgagaccgg cgcgagattg gacaggagag gacagtggat     70800
     caggaaatca tcttcgtagg attggatgtg cacaaggcta cgatcgccgt ggcgctggcg     70860
     cctgacggcc gatcgaacga ggtcagattc cagggctccg tgccgcatcg cccgggggct     70920
     atggcggacc tggggcgtcg gttgcaaagc aagcatccgg gcgcccgact aacattctgc     70980
     tacgaggcag gggcatgcgg gtacggcttg gcgcgcgagc tcaccgacgc cggctacgaa     71040
     tgcttggtga tcgcgccttc gcttatcccg tcgcggcccg gagaccacat caagaccgac     71100
     aagcgcgacg ccaccatgct ggcgaaaatg catcgcgctg gggaactgac gacggtctgg     71160
     gtaccggacg ccagccacga ggcggtccgt gacctcgtcc gcgcccggga ggcggccatg     71220
     tattggcgga accgggcgcg ccaagcgctc tccagcttcc tgctgcggca gggctaccgc     71280
     tatggcggcc gtagcgcctg gacggcgtcc tactggcgct ggctggcgac gcttgtactt     71340
     gagcatcccg cccaacagat cgcgatgcag gagtacatcc tggcgatcca tgaagccgac     71400
     gcgcgacacg atcggctcgt gaagcagatc gaagggatca tcccgacttg gtcgatggcg     71460
     cccttggtga ccgcgctaca ggcgatgcgc ggcatcgcga tgatcaccgc cgccaccatc     71520
     gttgccgaga tcggagacct cgggcgcttc gcaacgccgc gtaagctgat ggcctacctc     71580
     ggcctggtcc cggccgagca ctccagcggc gccaagatcc gccggcgcgg catcaccaaa     71640
     gccggaaatc cccgggcgcg gcgtttgctt gtcgaaagcg catggaccta cgccaagtca     71700
     cctcgagtca gtcaggtgat ccagcgccgg caggaaggcg tcgagctgga gatcgtgaag     71760
     atcgcctgga aggcgcagct gcggctacac gaccgctatc gccgactggc ggcgacgggc     71820
     aagccgaaga acgtggtgat cacggccatc gctcgggagc tggttggctt catctgggcc     71880
     ataagccagc gtatcagccc gcccgctact gcctgaacaa gacaaggctc taaggaggaa     71940
     ggtaacacgc gtccatacgc agtatcgggg gcggggccgg caaggagatc tctcgacccc     72000
     ctcttgtggc cggtcatcga accgacgccc gcccgctgac agagcaagct ccgagacgaa     72060
     aaccgcggtc ctgcggtacc caacccgcgc atgagtgtct gatcaaccgt cgtcttgagc     72120
     cccgcctccg accctgcgca tggactctga acgcgagcgc ccggcctaat cagtcgggcg     72180
     gcttggtcgt gcctgaaccc ttgacaaatg gacatgagtg gagggggtga ccggagaccc     72240
     tacaggctct gatccagggg gagggcgctc ccccaagaac accctaaagg tcggtttgat     72300
     gaggaatggg accagtcaat ctgcgatagg gcggactttg gtttgctgat atttgaactg     72360
     gcctagccgg accatcgagc gccagctaat cgaggggatg ctttcattga ccaaagacct     72420
     cggttcccct ccgggccaac ctgaccccag cgcaaagacc agcgaagaag cctggatcgt     72480
     ggggtccaac cccgaacagg ccattcggat gcggagcctt tcggtctatc tgagcaatgg     72540
     cggcgccctg aaggatgtcc gcctggtcga aggcgaggac gagcgctgga ccatgttcgt     72600
     gcggctgatc aaccggcccg gcgaatatcg cctcaacctc ttcaagtccg accaacccaa     72660
     gacctaccgg gacgtcgatc tggctatcgc caccgtccgc gacgacttcg gctattatgg     72720
     ctcgatcacc ctggcgacag agcagcgccc caagatcggc aaggcccagg ctggcccgac     72780
     cactgacagc gacgaggact agccgccttc ggttggagta agacctgcgc cggccaggcg     72840
     ctgaacggct ggctcgttcg aggcggcctt caacagagcg tcccagctgt cgggcggggt     72900
     gtccttgtcc aacatcccgc gaaagaccgc ataagcgtcg gtcttggcgc cataggtgcg     72960
     caaggtcgtc tcgtcgttga cccaagcgta gacgatgatc cggcttttgg agtcgtatcg     73020
     gaaaaacagg cgaaagcgcc cgccgccgaa cttggcgcga aaccagtgct tcctatccgc     73080
     gcccagggtc gtgccctggc gatagtcggc gcgggcggga tcctcgggga tgacctcgaa     73140
     gatcagacgc cgcagcgccg cgagcagctt ggcgttcgcc ccggattgat aggtcttggg     73200
     tttcttggcc ctctcctgtt cgaccgccgc gacaagtctg tcgaactgat cgagaaggag     73260
     gggatgagca aacagctccc agccttgggc agcgaccatc ggttaaagcg cgaccgtgcc     73320
     gtcgatgggg gcattgagat cgatttccaa tcccgcagtc agggcctcga tacgagcccg     73380
     tagctccgac gagatcgact ggatccgctc cgggtggtcg cggatatcgg tcgccaggaa     73440
     ttccagaaaa gcgcccagcg ccgggtcttc cggcgtctcg acgcggtgaa gactcacccc     73500
     gtgctcgtcg atgcggtaag cgatcttgcc cccatagtca gcacccagcg cctgacggac     73560
     cgccttgggt atggtggtct ggcccttggc ggtgatggtg gcgaccttct cgatagacgg     73620
     catagggcga actccttcac caaataagta aggaaaaatc cttacctttg caagcgccga     73680
     aatctgccat cgccaccctg gcctctgacg ggccttcacc caatagttca cccacgaaca     73740
     cccaatatcg gctcccggtc gtcccgggcc gactgcggcg atcacgatct ggcgaacgcc     73800
     acgagcggtt tcagatcaaa cccatcggcc gccttgatcg cggcgatgta ggcggcccgg     73860
     gtctcgccgg cgtggactag gtcggcgcgg ccccagctga agggctcgtg ctccagccgc     73920
     tcggccagca ggtcggccga cagtcgggcg tggcgtccgt taccgttggg aaagacgtgg     73980
     atcgagacca tccgatagtg gaagtcgaca gcgatctcgt cgggcgagcg cgtagccgcg     74040
     gcgacctggg cggcaatgtc gccggtcagc tgatgcagat gctcgcggac cttccacaag     74100
     tcggccacgc cgatgttctt ctcggattct cgcggcttgc cggcccagcg ccagacgtcc     74160
     tcgaacatcc gccggtgcag ggtgaacagg ctggcgggat cgaggacgtc aaaacggccc     74220
     cggcgcgccc agcgcaggcc ggcggcgatg ttggcgcgtt ccgcccggtt gaggtcgtcg     74280
     cgggtgataa tccacgttgg gatcagcccg atccgcgcct cgggcgtcag gtttgtcgcg     74340
     gcctcatcgc cgctatgcag gtcctcgtcg gtcaaggccg cgccgcccag acttcgcggg     74400
     gatcaagctc gtcttcgatg aagcgccgca ggcgatcatc ttcgtcggcg tcatcgacgg     74460
     cctggtcttc gagcgccatc gaatggctga tcgctccaag ttcccgccgc gctacggccc     74520
     tggcggcggt ctcataggtc tgctgaagag gctcgcgagg cacgaaggcg tagaccagtt     74580
     cgcaattcag cgcctcggcg aggcgccgca ggctgcccaa ctggatggtg tcttcttgtt     74640
     ccgagcgctc cagtttctgc acggtcggct gggtcacccc cattcggacg ccgagctggc     74700
     tggcggtcat gccgaaggcg tcccggatcg cccgggtcca gccacggggc ggacggcgat     74760
     gggtgagcgc ccggtagggc gccaacaccc gatcaagtga gcgccgcgcc tcggcggcgg     74820
     attttcggcg atccacgata caccctacag gctgtctata gcgaacaata aaacacccta     74880
     taagatataa attatcatat cgtctatagc tcataggcca tatcttggtt tggcgcgccg     74940
     ctgcgatcat cgctttcgca ccgagatcat cacccggtcg acgaatacgc cgacgttctc     75000
     ggccgccagt ttgatcgctt cgacatagtc gcgcttgatc cgttccgcgg cgatgccggt     75060
     cggggttgaa agcgagatca gaccgtcatc gatcccgtgg aacccgaccc ggttgaacca     75120
     actgccgtgg gcgccttccc tgatcagtcg gcgcagttcg gcgttgatct cgggccaagg     75180
     cacctcgtcg gcgccgggag cgaacatcag tgggggcaat tcaggttcaa ccgcgagggc     75240
     ggattcttcg gccggcggca aatctccctt ctggcgcagg atccgagcca ggttcagccg     75300
     taggtctgaa gccccccgtt cctgagtagc cagtttgccg aagtagctgc aggcgctgcg     75360
     gacctcggga tcctccagag cgatggccat catcgtgacg atgcggatcc cgtgtttgcg     75420
     ccagccccag atcgcggttt ggtcattgtt ccgctctggc tgcggcagga attccgcagc     75480
     ggcggcggcc actcgggccg catcttctgg cgtggcgctg gcagggttgg ctagcaaggt     75540
     gtctcggatc agcggagcca ggcgtggaca gacctgaata gcggtctgaa gctcctggcg     75600
     gaccatttcc gcatacaccg aggcttccga tttcgcgctg gagaaaccgc tggctcgctc     75660
     cgaagagcca atggcgcggt cttgtcgggt gcgcgggcgt tggttcgagg atccggttag     75720
     gttttggttt tcgggccttg tagagggccg tttctcagaa tgatttcgcg gctctgccgc     75780
     ggccatctct tgtacagaag acataaggtt cttctgggac tgttctaggc gccgggattc     75840
     cggcgcctgg gcgctatatt tcatcgggaa ggctaccgtc tctgaatagg cggccctgcg     75900
     ggcggctatt ccctcgcgga tagcatcgtc gacgccctcc agttcctcaa gccgcgccat     75960
     caagggtcga aggtcatagg cctccacccc cgccggccgg ttagcccggg tgtagtcgcg     76020
     caccagatat ccggcggcct ccagcgcctt gcggttggcg cgggcctggc tctcgctgca     76080
     gccgagatat tcggccacca gaccggtcga cggccagacg caggcagcgt tctgctccag     76140
     gcgatcctgg ttgagatgct cgacatagag cagcagcgtc atgcgctgcg gaatgctgag     76200
     cgacggcgtg cctttcagca cggcggcggc gacgcgggcg atgctctcgc caggttgcca     76260
     gcgccagctt tccgccgcgg cgcaaacggc cgggaagttc tccgcgcgct tggcgaagcc     76320
     tggccgccaa tcctcggaat gagcggtttg catgatgtcc cttcgggtcg ggacgaggcc     76380
     ggttcgacgg gctgaaatac gcaagaaccg gagacaaagc tccgccatcc ggtccttgac     76440
     gtcgttcaaa acgcgtcata gcttgaaccg gtcttctgcc gcctctcaca acggcactgc     76500
     gatttccgaa agcctccagc gccaactggc ggctttcgcc gttttagggt ctcgtcttag     76560
     gtcacggttc agatcctggt tgggcccggc caagaccggg cgatcacgct gaggcagggc     76620
     ctcggcgagg ggtcacgggc gctgaaggcc cggatcagac ggtcaggggg agggcatggt     76680
     ggtcgtcctt ctcaaggacg aggcccgcat cggcgtgtgc tgttcgacgg ccgcaaggag     76740
     gcgtttgggg tcttgacgcc aaaaacgaaa cgcctagcct gtccccatca aacgccgccc     76800
     agaagcagct tgatcgaatt tcacgagagc cctcgattgc cgtcgggggc tttcgccgtt     76860
     ttgggcctca tctcgctaag tcatcagtct ctccaaggca cgccgacccg cgcgctgcac     76920
     acgcgattcg ggaggatcaa gggtgggttg agtctggccg ccgccaaagg gccgggcagg     76980
     gccgaaaacc cccgaaaagg cccctccgaa gcgactctct gagcttgccc agaatcggga     77040
     atcgacagtc ccgctgagtc gcattgacct caggaccgtg cacctggcgc gagattggat     77100
     cgacgccagg cctggaagcc acgatcggca tcgatgaagg ccgcgaggat gtgggcggcc     77160
     aggtgatcga gctcgacggc atggccgttg gtctgcgcat aggcgcgctg gtagtccgcc     77220
     agatcgacgg cggccttgcc cttcaggcgc agacgcacgt cgagcgcctt ctcctcgagg     77280
     tcgatctttg gcagggcgag ggtcgtcttg gtttcacggg ccacgtcagg ctccttctgg     77340
     gggatggagg aaaccggcga tcgccgtact ggcgaagtcg gtgagcttca ggttgagggg     77400
     atccaggcgc ccgcggatgc gagcgcagag caggccgcag acccgcaccg agatccgatg     77460
     cttggccccg cgcatggcgg gaaaagccac gagctggccg gcgtccaagg cttccaacag     77520
     gtcgttgaac gcctgctcgt agaccagccg cacgccgcct cgcggggtct tgcgcccgct     77580
     cagccgcttg gcggcggcct ggaccatctg ctcgtgcaga ccctggggca ggaacagccc     77640
     cagcttctct gtggtggcgg tcatggcgcc tcgcttaggg gtagggggcc aggatcatgt     77700
     ctttgttgac gatgacccgg agcggccacc cggcccggat ccgcaaggtg gcctgccggt     77760
     tgaggtcgcg agcggtgacc tgctggccga cctgctgggc ggaagtggaa atcccgctgc     77820
     cggcgctgtt gatcacaaga ccgccggagc tgcgggttcc ggcgtcttgc gccgccgccg     77880
     cgccgacgga gaacaccgtc gagagcgcca cgccgcgagc cagttgccag aagtgaccat     77940
     cggtcttgtc ctgcagcccg gccgcgccgg agagatcggc gccggccatc gagccgatgt     78000
     tgatcgaacg gccgtcgggc atgatcaccc ggttccaggc gatcagcgag cggctttggc     78060
     cgtgggcgac ctggctgtcg tattggccga tcagccgcga gccctgaggg atgagcaccg     78120
     tgcgcccggt cctgtggtcg tacactggct cggtgacttg ggcgatcacc tggcccggca     78180
     gatcggaatt gatcgccgtg atcagggcgg ccgagatgat cgtgccggcc ttgacctccc     78240
     aaggactgat cggcgcctgc agggggctcg ttagatagtc atcgaccctg gcgccggccg     78300
     cgaactgacg cttgccggcc tggccattgg ccggctgcac gtcgccggcc gccgacgcgg     78360
     gcggcgtgcc gaagccaggc accagggccg ctgccagcat cggccccgga tcgggggcca     78420
     aagggccagt ttgggaggcg gcctgcggct gagcctgggc gccgccgaag aacgggctgg     78480
     ccgagcgagc ggccagcgcc tgctcgcgcg ccgcctgaac ggcgggatca accggcgccg     78540
     gttggccggg ctggccagcg gcctgcgtcg tcggggcagg gggcgcaagc gcgtccggcg     78600
     gcggcaagct ggtcgtgccc ggccgcaccg ccggatcggc gtagccagca gcatagcggg     78660
     tggcgatctc cggcgtctgc gggctcgatg tgtcagcggc gttctgcgaa tcgtcgggcc     78720
     ggcccttggt ggcgtgcgcc ccgccaaagc ccaggtagaa tccgccggcc acgatgctgg     78780
     ccaggacggc ggctccggcc atcagatact tgcggttcca gcgggtgacc gggaacctgg     78840
     gtgcgctgag cacgctcgcc gagctggcct tgcgttcggg ctcgtaagac ggccgcccat     78900
     caagcggcgg atctgggggg agatggcgca tcgatcagcc ccgatcccgg gtgcgggtga     78960
     tccgcacgac cgtctggttc ttctctccga gccgcaactc ggccacgtcg atcatccggt     79020
     ccacgatgta gtagccgccc aggtagcggt aattgaccag ctggacctgc ttgtcggccc     79080
     cgatcaggaa cagcggcggg gcctgcgtcg cggccatatt ggtcgggaac tggatgtagg     79140
     ttttcagtcc gtcgtcgaac acccggatcg gctgccagct gggcttgcgc gagtggatcg     79200
     tcctgacgtc gtagccgaaa tgtaagcggt cgatggccag ccccgaagcc acgaccgact     79260
     gggcttcagc ggcgcgggcc gcctgggcgt cgcgcatctc ctcctgcgga tagttccagc     79320
     tgatgacgct ggtataggtg tcgccctcgt agctgcgggc atccaggagg taggtccgct     79380
     ggtccgtggt caggatgatg ttggtccgca ggttcccgcg aatgggtttg accatcacga     79440
     tgacctgctg cgacgcgccc gcgccctgga cggtttcgcc gagcacccat cgaatggtgt     79500
     caccggccgc cttggagatc agcttctcgc ccggccgcaa ggtgatggcg gtgaggaagt     79560
     gcggactggc gtggacggtg tagagccgcc ccggctcgaa gtcgtagtag agcgccgaat     79620
     tgatgtaggc gccggaggtc ggatagtcgc gcgcgctgct gttggccgac tgcacggtgc     79680
     tgagcgggcc tggccgggcg taggtccgcg gcgccgatcg ccgctggggc cgcctgggcg     79740
     ccgccgcgtt ggcgatcggc gcgacgctcg tggtcgtcgt cgtggtgacc gcgccggctg     79800
     gcgcggagcg tgaggcgggc gccgggatga ccgacgaggc cgtcaccgat tgcggcgccc     79860
     cggcctgcgc cagaaccgcg ccgccgccgg ccatcgccag aacgatcacc aggccgccca     79920
     cccgaccggg cgcgccccag gctcggaggg atctatctct catggcgctc atagctcgcg     79980
     actccactga aatgcggtga tgaagatgcc cagcgggttg gcgcgcagct cggcctcgtt     80040
     tttcgggggg ttgatcttgg cggttaagag cccggtccag ttctcggtca cgccggacgt     80100
     tccggcgttg aactgcgtct cgcgccactg cacctggtag gtgctgggac tgcgggccag     80160
     gaccgagacg atctcgacat tgatagcctg ggcgccaaca ttggcgaacg gatcgttggc     80220
     cttggcgtag gtattgagct ggccgatcgc cgggccggcg acgaagtggt aggcgccggt     80280
     ccaattgtcg cggatgacga tgggatcgat gctcttggag cgggtgcgcc gcacccagtc     80340
     ggccaggaag tagccgatct ccgccgttgt gggctggtag gtccggccgg ccagctcgat     80400
     gcggccgggc cgggcgtagt tgtcgatcgg cacgacatag gtggcgatgt tggtgttgct     80460
     cgcctcatag atgaagccgc ccagcgccag cgcggccagg cccatgcagc cgaaggcggc     80520
     catgcgccag ttcttggcct ggacgacggc ggagccgatc cggttgtccc attccctgga     80580
     agcccgcagg taggggctct cgaccggagc cgagctgccg tatcgatcat ttgggcgatt     80640
     gaaggggttc atctacgctc ttctcactgg ggttaagcct acggctcggg atcgcggcgg     80700
     gtcgccgtgg cggacattcc ggggccctgg ctgtcgccgc ccgccgtggc ggccgccgcg     80760
     gtgttgcgcg ccatgctggt caggccatcg ccgcgacggg cttcggcgcg ggccacgagg     80820
     gaggcgccgc caggggaaga cgtaggggag ggcttgctcg gcgatggctc cggaggcggc     80880
     gccccatcgg gcgaaacgcc gccaccggca gcacgactgg ctgaggcgtc tgaggaggct     80940
     ggcgatctgg gggaccctgg agccggcccg gaccctgacg gagaaccgcc gccgcccgac     81000
     gagccgccgc cacttgaacc gcctgagttg atcgccccgg acgcggcgcg agccgcagcg     81060
     acttgccccc cgccgcccgc caaactgccc atggctccag cgaccgcgcg accggccaag     81120
     gccccgccgg cagcaccggc cgccacaccg gccgcgccca tcagagcgct acccgagttg     81180
     agctgcgggc cacccgagat caaagcgccg gcgatggatg gcactttgag agaaagcatc     81240
     atcaggaaga tcgctgagag gaggagcccg gcttcctcgg ccacggtggg ctgggccgag     81300
     agcgtgtagg tctcaaagat attgatgccg atgccggcga tgaccgcgag ggccatgaac     81360
     ttgaagccaa cagaaatgac ataaccgatc gccctttctg cgaggaagga cgtctgtgac     81420
     agcactccga aaggaaccac gacgaacgcg atgagcgtca cgatgtaaaa ttcgatgatc     81480
     gtgacagcga tctcgatcgc caagattatg aaggcgagca ggattcctat ggcagcaacg     81540
     ccagcgacga tgatcatgtc aatgtgcacg agcgcgccaa agccaccgtt ctgctgggct     81600
     aagtcgccga tgtatttgat gagatcgacg acgacgctga gacccgcctc tacggcccta     81660
     gtcggcgcct ttgtgaagtc gccgatagag ccgccgccgc tcgcttgcag gccaagtttc     81720
     gcgaacccgt tgacgacggt caggctcagc gagtgccagt ttgtgaccag ccatgagaag     81780
     aacccgatca ggaggatctt ccgcacaaga ggcgcgagga cgttctgcgt ctcgtcgatt     81840
     gcccacagga cagccgtcag ggtgatgctg atgacgacca agatcgcgag aaccgtctga     81900
     acatcactgg caatggcgcc aaacccgccg cccacctgac cggtgaatgc tctgatgaac     81960
     tggtctaaag ctgctggatc ggcggtcgtc atgcgatcaa aacttccttg cgccgactag     82020
     aggctgtcac gatcggggag gcggctaccc gttttattga aatagagcgg cgagcaaggg     82080
     tcgttgcgat ctcgattgtt tacatcagga catttctggg gctgagcggt ctggcgttct     82140
     gctgctgccg attgctccgc cttctcacag gccgtcaggc tgatgctgag cagggccgcg     82200
     agggggaaca ggagccgcat catttgaaat ccgtgatgtt ggggagcgag ctgccctttt     82260
     tggtgaacgc agtcgctctt gcggtctccg cccgagccgc gatggcgccg gcctgctgct     82320
     gggccagaat ggtgtcctgg gtgcgcgcct gagcgatgag gatggtctgc aggccctgca     82380
     actgagtgct caaggccgcc agaagctgat tggtggcctg aacggcggcc gtctgtccgg     82440
     cggcgccctg cgacgcggcg accgcactgt ccacggcgcc ggcggtcgtc gcctgcgacc     82500
     ggaccagttg gttctgggcc gccatcgaat cctgcatggt caggcggctg ttgctctccc     82560
     agctggcaag ccgctgtcgg atctgagcga agctctggcc ggtcatgtcc gacgggtaga     82620
     gctgctggaa ctgctgggcg atgttctggc tattgtagcc aatagcctgg gcctgctgga     82680
     gcagctgggt ggcctgctga ttgatctgtg tcagcggctg ggtgacgtcg gtccccagct     82740
     tctgcagcat cgccacttgg ttggtgatct gagactggag ctgctcgatc tggcgcaggc     82800
     tgttggcgac ctgggaggtc atctgggcga tggcggccgg atcgatgacc gtcatctgcg     82860
     cgcgcgcggg cgggggcgtc gcggcggaca tccccatcgc caaggccgcg atcgcggccg     82920
     tcgtcgacaa caactttacc atggtgagtg tcctttgctg gggggatggc agagtggggg     82980
     aggggccaga ggcccgccgc ggtcgcccgc tcgaacaggg gttcggtccg ctgtcggaag     83040
     atcaccgcgg cggcgaagag aacgaagccg gccaacatca ggaagaagtt gtggtgcagg     83100
     atcgtgccaa agacggcgaa gaaccccgga gcagcgagcg ccaagaaaaa cagccggcga     83160
     cggcgacggt tggcgaccca cgccagggga aggcgccggg caagccaggc gagccgcgcg     83220
     agatcgcgca cgctaagcgg cgagggctcc ggcccgaggt cgcggccgcc gtcagcatcc     83280
     gagacgaccc gaccatccat cacgccacct tcggatgggc ggcgtcacgc tgggctgcaa     83340
     ggtagctggc cacggccgcc tggcccttgg cggcgaagaa ccgttcgcag aattgcgccg     83400
     cgccgtgctc ggccagcaac cgggtcatga gctgctggtc cccaggcgac gaggatccca     83460
     cgaccgcgag ggagaaggga ccaaggccca gctcgaacag ccggttgccc gacatcgact     83520
     ggtagtaata ttcgcgcttg ggcgtggcgt tggcgatgat ccggatctgc tggggattga     83580
     gcccaaagcc ctggtaaagc tcggcgatct gcggcgtctg ggcgtccgga ttgggcagga     83640
     agacccgggt tgggcagctc tcgatcagcg ccggagcgat cgaggatctg gcgatatcgg     83700
     ccaggctctg cgtggcgaac acgaccgcga cattgaactt ccgcagggtc ttcagccact     83760
     cgcggatctt cgccgcgaac gagccctggt cgaggaacag ccacgcttca tcgagaatga     83820
     gcagggtcgg ccgaccgtcg aaccgcttct ccagggtgcg gaagatatag gtcaggacgg     83880
     gggccagggc ggacttgttg cccatcagct ctgccatctc gaaggtctgc caggtgccgg     83940
     ccttgagcgt gttctggctg gcgtcgagga gatgcccgtg gggtccgctc agggtgaaag     84000
     gcttgagcgc cgccttgacg ctgtggtcct gaatggtcgc cgccagcagg gtcagggtcc     84060
     gctggtcgcg agggccggcg gcgagattac gcagaccgct ccagatctct tccttgacct     84120
     gaggggtgat ctccacgccc tcggccgcca cgagatcctg cacccactcc tgggtccacg     84180
     accgatcatc ggcggtgtcg atgtcggcca acggctggaa ggcgagctca ctttcctcgc     84240
     tgcccagggc gtagaactgg ccgccggtca gcagggtggc ggcgcgcgag ctggcgccct     84300
     tgtcgaagaa gaagacctgc gcctcgggat agcggagcca ctgcaccgcg atggcgttca     84360
     gcagcacaga tttgccggcg cccgtggggc cgacgatcat cgtgtggccg acgtcaccct     84420
     gatgcagatc gaagcggaac ggcgttgtcc cagccgtgcg ggtaaacatc aacggcggct     84480
     gggcgccggg gtggccacgc ttggcgcact cggacccaag gtgctcattg cgcgtcgggc     84540
     caggccagat ggccgacatc ggcatcatgt cgcaaaggtt cagcgacgac accaagggcc     84600
     gccgcagatc ggcgtaggcc tggccgggca agctgccgat ccaggcctcg acggcgttga     84660
     cgtcctcgac cttgcagacg aagccgaccc ggttgatggc gctttcgacc tcgcggaccc     84720
     ggtcggccag ccggtcggga tcggtgtcca tcaaggtcac ggtcggcgtg aaatagccga     84780
     tcgaggcgta gtcgccaccg aggatggcca gcgccgcatc ggcgtccatc gacttggccg     84840
     cggcgtctgg atcctccagc actgaaggct cccgggtgat ggcctccttc agcagcgcca     84900
     tgacgccctt gcgcttggcg aaccagcgct tgcggaccgt agtcacggct ttgcgggcgt     84960
     cctccttgtc gagcggcagg aatcggcaaa cccagcggta gctgatgccc agctcgttca     85020
     ggcggtccaa caggcccggc gaagaggtcg ccggataggc gcgcaccgag atggtccgca     85080
     caaagctggc gcccaggcgc ggcagcaggc cgccctggaa atcgtcatcc gtcaggaaag     85140
     catcgagata ggccggggtc tccggcgcct tgacgtagtg gcgcttggtg gagatgcagc     85200
     catgcagata ggtgagcgtc tcatcgtcgg agagttcgtg aacctccggc atgaccgcgg     85260
     tcaggatgtc ggcgatctgg cgcaccgtgc tgaggaaatc gctcagggcc gcgcggtaca     85320
     tgccggcggc gccgcgccct gaaggcgcgt tctccagcag caggctctcg gccgtgctga     85380
     ccgcttcctc gggcgggagg taggtgaagg tcaggaagta gcgactctcg aagtgccgct     85440
     cgtgaccctc aaacgcctcg cggcgctcct cgtcgaccag gtcggagacg agatcgggaa     85500
     actggctggc cgggtaatcc tgcgaggccg ctcgcagcgc ctcgatgtgc aggcaccagc     85560
     gcgagcccag gcggcgaagg gcgttattca gttgggcgcg ggtagcgact aggccggcgt     85620
     ccgtcgagct ggccagatcg ggaccccgga aggccaaggt tttctgaaag ctgccatcct     85680
     tgttgaggat caggcccggc ccgatcagag ccacccaagg caaatgatcg aacaggcgat     85740
     cagccttggg acggtattcg cgcaggtaga gcatgggctg tcctctgcgt tgggggcgga     85800
     gcaggtgttg aagtcgccca gatgggcgca gggtagaatt tcgtcgcgcg ccggcgatgg     85860
     cgcgaccgta gtcaggcgtc caggtagggc cgttggcgga tgtgccgccc gagggcgtcg     85920
     aagaagtaag ggtcgcgctt ggccagccag tagcaggcgc cgtggatggc taggccgaat     85980
     gggatgccga tcaaggggac ctggaggccc agcgccagga ccgccgtaag cgtgccgttc     86040
     agcacggcga tcattcgcgg cacgccggcg atcgtgaccg gctccgaaag ggagctgtgg     86100
     aaggcgatct cgaagccctc gacttgcgac tgcgccatct cagaacgccg cgccggcggt     86160
     gaggttgaag aaggtgctga cgaaggtcgt ggcggtgaag gcgatggcca gcccaaagac     86220
     gatgccgatg ccctttcgca tggccgagcc gccctcggcg aaggcaaagc ccagtccggc     86280
     caagacgatg gcgatgatgc caattgcctt ggcgacagga ccggagagcg actgcatcac     86340
     cgtggtaagc gggccctccc agggcatggc ggtgccgccg ccaccagccc aagctggagt     86400
     ggccagaagt aggccgacgc cgacggtgag tattgcggag tgggcggctc gcccaaagcg     86460
     atgcggcgcg gacgagacat ttcggatcag attcatcgtg gggcttcctg atgccgacgc     86520
     ccgctaatgc cggactaccc aagattgaga cccatgcacg acaagggtca agtgctattt     86580
     ttatataaaa agcactctcg gcactcttga tataatttat tgccgtccga agcggcagcc     86640
     cgctcctgcc cggcccacgc atagaggtcc tgaaagagat ggtggtggat cgccttgaac     86700
     ccggcgtagg tcggctcggc tgccgcagca ggcatgcctt cttcgatccg cgtatcggtg     86760
     aaaaggcgct cagccgcatc gagcgaggcc gcgtcgcgca ggccaagctc gtttacgagc     86820
     acgcggctgt ctgggtagaa aacccgctcg aacgcggcgc gctcggccgc ctttcggtcg     86880
     ctcactaagc cttctgggcg aagtaaccgc gcagggcgtc gcgcttttgg gcaggggttt     86940
     tgccttcggc gtccaggcgc gccatcagtt ggtcggcctg tggatcgcgg cgcacgccct     87000
     cgatgtcgtt gttggcgctc atctgctcgc ggcgccaagc cacgtctgcg gggtcggatg     87060
     aggaccaacg gcccatggcg agcctccttc gaacgccctg aatatagcat cgggaaggcg     87120
     accgggggag gggaggagga tcgcccggcc tgcacgaccg aggggaggaa ggcaggggca     87180
     ctgtgagacc accatcggcg tagtcggctc gtgagttttc cgcaggcaag gcctatgctg     87240
     ccaaggtgca agaccatctc gacctccccg gcgcttcagg cgcgacctat cgcttcaggc     87300
     tcatagaaga tcctgcgcag ctaccttcaa cggcgggcaa cttcgtctat gtgcgctggc     87360
     gtgcgacgac cccgcaggtg atgtgctgcg gagccgtggg cagtctcctg gacgcccgcc     87420
     agcaatggga cgccgcggtg cgatctcaca gcgcccaggg actctacatc cgcctcaatg     87480
     tagctcgctc gacccgggga gaggagcacc ttgatctggt ctcacggtgg cgcccgccaa     87540
     tccctgcgct cgacgaatag gccgcagcga cttacctacg aacagtccct ctatccccgt     87600
     cgagccaaga ccaacaaaat gaagaagctt gtgccccaag gcgccaatag cgcgcagccc     87660
     caccatgtcg atctacatgt gggcgccttg atcaggacgc ggcgcaaggc cttgggaatt     87720
     tcacagtctg agcttgcgga ctcgctgggg ctgacctttc agcaggtcca aaagtatgag     87780
     cgggggtcta accgcgtaag ttcccgcagg atggccagcg atttcagcgg cggcgcggcg     87840
     gcggtcccgg ctttgaatcg ctcatgctca aagaacgtcg acgcaaatcg taggagcacc     87900
     ccgtagcgat ccgccgcgct gaccagaaga tcctcggctg cgaaggtggc cagtgcatcg     87960
     actttcggtt tggcatcgag gagcttagcc cagcccacct gggcttcgaa ccggtcgatg     88020
     gcgtcgccgc cagccgcccg cgcctgatcg acggcctcga tgacgccgct gaacagccgc     88080
     atgagctgag cgacctcgcg actgctggcc tgatatttcc gctcggcgct gcgacgaccc     88140
     ccggcgagtc agcgagccca ccatgttgtc gaacatgtcg acggccgcgt cgttgaaacg     88200
     ccattcgagg tcgacgagcc gggccacgac cgtcgcccgc cggcgccttc ccgagcatat     88260
     tgatcgaacc ggcgctcgtg agctatgagc gcccaacatg atcgacgtgc cgaaagatta     88320
     tgcccaaggt taccaatggc gacggaggtg atagcgatcc tcgccgcgac ttgcatcgag     88380
     ccctgtgttc agccggcaga tactcccccg tcgagccatc cgaggcccag cgccttctga     88440
     agcgcaacat agtctgccgt caaaccggcc gtggccgcgg agagaccgtc ctcagcatcg     88500
     atccgatgtc gctctgcgcc gagcgcatcg atgagcgatg ccctgccggc tcggtagttc     88560
     tgctgcgtca aattggctga ccgatcggcc gacgccttcg cccgcgcgag aatcgcgacg     88620
     gttgcacgac cggctcggaa ccgcgccaac gcgtcttccg tgtctcgtaa tgccccgagg     88680
     accgccgcgt catacagggc ttcggcttcg tctcgcgccg actcgcgctg cctgatctgc     88740
     ccttgcacgc gaccaaaatt cagcacgctc cactgcaacg tcggtgcccc cagtgcgacg     88800
     aaatcatcga gatgcgtcaa gtcggaaggt tgagtaccgc cgatcccgat gacgcccatc     88860
     caactgagcc gcgggaacct ggcggcttcc gccaccccga tacgggcggt atcggccgcg     88920
     agccggcgtt cagcggcacg cacgtcgggc ctccgcctga gcatggcttc cggatcgccg     88980
     atggcaacgg cagggggggg cagtggcgct ggccggggcg gatcgagtat tgcatcaagg     89040
     gcgccgggct gctctccgca gagccaggcg agggcgttca taaagccctc ggcctgggcc     89100
     acgagtggag ccaccctggc attggtgttc tcaaattgca tgctgagccg ttcgacatcg     89160
     agcgcggaag cgacgcccct ttcgaactgc tggcgcgtga ggtcgagcat ctgctgctgg     89220
     agttccaccg accgcttcgc caatacgatc cgcttctgtg tgtcgcgaag gccgatatag     89280
     gcatgggcga cctcggcggt caggctcacc tgcgcgtcgg ccagtgtggc ctctgcggct     89340
     tgcgcggtag ccgttgcggc ttcgactccg cgccgacgcc cgccgaacag atcgatctcc     89400
     caactggcgt cgaaggcggc ggtatataga tcgaaggatc tctcgtcggt tccgaccaga     89460
     gccggtatca tggcgcctgc agcgccggag ccgctctccg gcacgcggcc atggccagcc     89520
     agcgcaccgg cggcgacgtt cggcgccgcg ttggctcgct cgatgcgcag catggcgcgc     89580
     gcttgacgca accgagcctg ggaagccgcc atgttcggat ttgcacgcag cgcccgctct     89640
     tcaattccgt caaggatagg gtcatccagc gtctcccacc accgggcaac gagaggcgtt     89700
     gcgatgacgg cggtgtcctc catgcgcacg aagcgggatg aaatcccctt gtccggtggg     89760
     ccgacatagt cgggaccgac cgtgcaggcg gacagcacag gaagcagggc gaagagccaa     89820
     taggtgcgca tgggcatctc tttgctttgc gaccgcacac ttgcgcgcga ggcccgctga     89880
     acggcgtcac atcccggctt cggttcggct cgggaccgcc agccaatctg acggcaccga     89940
     atctgcggtc tagacaacgc tgtgacgggt agatagttat ctacttaacg gccgttcaac     90000
     aaggggatgt cggattgacc gacacgcgta ccgcaattct cgatgccgcc gctcggctct     90060
     atgcggcgga cggttattcc gccgtctcta tgcgagacgt cgccaccgaa gtctcgatga     90120
     cgcaggctaa cctatactat cattttcgag acaaggcgca gctggtcgag gatacgcttg     90180
     agcatgtcct ggttacaaga atgtcctctc tggaggattt gttcaaaacg actgcttctc     90240
     cggaatataa gttgcagttt tttgtcgagt ggttcgtgac gctcttgttt aatgatctga     90300
     tatttacgca actgatgctg cgcgagttga tcgacggcga tatggaaaga gtcgcgcgcc     90360
     tctcgagagc ggtcttcgac aagccgttct cgctgattga cgggatcgtc tcagcctatt     90420
     cgcctggcaa gaactcaacc ctgacgacgg cgtccgtcat cgccctcatc atcgggcacg     90480
     tccagatggc gcgcattctt ccatatctgt ccagcggcca cgctgatcac gccgatccga     90540
     aaatcatcgc cgcacatgtt ctttccaccc tgcagcgcgc gctcaaggac caatccgatg     90600
     ccctttaggg atcatgcgaa gaggcggacc ttgccggcgc ttggcctggc gctgacgacg     90660
     ctggccggtt gcggagaaca cgggaaaaca gtcgatcggg aaccgccagc ggtgcgtctg     90720
     ccgaccacag tggtccagcg cgccgatctg cccgatttcg tcgccattcc cggcgccgtc     90780
     acatcggacg acagggtcga tatttcctcg cgcgtcaccg gttatgtgct cctgatcgcc     90840
     gttcatgaag gccaatccgt ccggcgaggc caggtactgg cgcggatcga cgccagagag     90900
     atcgaagaag cgatacgaca agcgcgcgcc ggtctttcag ccgcccaggc cgaccttgcc     90960
     cacgccgaag acgatgtcat cgctcaggaa ccgctggcgc agacgggtgc gatatcgaga     91020
     gacgtgttcc gtggcgccag cttgcggcgt gacgtcgcgc gctcgacggt cgccagggcg     91080
     caggccgcgc ttggcgccgc ccaggcccag cggccttatg tcacgatcgc cagcccgatc     91140
     gacggggtca ttgtcgcccg gcccggacaa gccggagagt tggcgacgcc cgggcgcacg     91200
     ctcgtcaccg tggaggcgcg gcgccgcctg ctgttcaaga tgtttgtgcc ggaaaccgat     91260
     gtccggcaca ttgccgtcga tgcgccgatc gaggtgcgcc ttgaccgcct cagcgaccgc     91320
     accctgagcg gcgtcgtgcg tggcatcgta ccgtcgggcg ataccacaac gcggcgctat     91380
     gaggtggata tcgcactgcc cccggacccc ggtctcatgc cgggcatgtt cggccgcgcc     91440
     cggctcgtga ccggccgaag gcaatcgccc cgggtcccgg ccagcgccat cgtcgagcgc     91500
     gggggactga ccggtgtttt cgtggttggg aaggacggtc gcgtcgcctt ccggtggttg     91560
     cggacgggca aggaggcgga cggatacgtc gagatcgcct cgggcttggg gggcggcgag     91620
     acgatcctgg ctcgcgccga tacttctgtg cgtgacggcg cgagattggt tcaagggccg     91680
     cgaacgcgat gagtgttcct cggctgaatc tggcggggcg gctggctagc agcttcatca     91740
     catccaagtt gacgatcgtc ttcatcgtcg gcgtcctgat ggctggcgtc ttcgccgttg     91800
     cgctgacacc gcgcgaagag aacccgcaaa tcgtcgtccc aggcgcggtt gtcaccgtcg     91860
     cgctgccggg ggcttcggcg caagaggtgg atcagctgat tgtcggtcct ctcgaaggca     91920
     ttctcagcga gatgtccggc gtggaccata catacggcgt cgcgcgcaat tcgctgggcg     91980
     cggtgcaggt gcaattcaag gtcggggaat ccccggaaga ttccctcgtc aaactctaca     92040
     atcgagtgat ggcgaaccgc gaacgcctac cggcgggcgc cgggattccg acgatccggg     92100
     cagtggatgc cgacgacgtt ccggttgtca ccgtcacgct cgcgtccaac gcctatgacg     92160
     actatgggct caagcgcgtc gccgatcgca tggccgagcg tctgcgaagc ctgcccgatg     92220
     tttccgtcgt cagcgttcgc ggaggccgtg accgggagat cggcgtcgct ttcgatcctg     92280
     aacggcttgt cgccttctcc atcgcgctgc cgcaagccta tgcggccatc accgccaaca     92340
     acctgtccac accgctatcc gggccactgc gcaacggcaa ggtcgagacg atccagctgc     92400
     gcggcgcgtt cgcgtctgtc gatgacgtgc gcgatctggt cgtcggggtc cacgccagcc     92460
     gaccggtcta tgtgcgcgac gtcgccatcg tcaccgacgg ccctcccatc gaaatcacgg     92520
     cgctgagccg gttcgccttc ggttctgccg acacgcgcgc ccgacatgcg ggcacggggg     92580
     aaatgccggc ggtgaccatc gccgtcgcca agaagaaggg cgccaatgcg gttctcgtct     92640
     ccaggagcgt cgtcgatcga atagctcgga tgcagcaatc gtttgtgccg aagggcatcc     92700
     atgtcgtcgt gacccgcgat gacgggaaga aggccgacgc cgccgtaaat gtcctgatcg     92760
     agcatctggc catcgcgttg ttcacggtga gcctgatcat ggtgctgttc ctgggctggc     92820
     gtgaagcgtt aatcgtgaca ctgaccgtgc cgctgatctt ctcgatcacg ctcgccgcgg     92880
     actatttcgg cggcgtcacc atcaaccggg tgacgctctt tgcgctcatc cttgcccttg     92940
     gcctgctggt cgacgcggcc atcgtcgtca tcgagaacat tcaccgacac tataacaccg     93000
     cctcatcctt gaccaagcaa caggcgacga tcctggccac aaacgaggtt gggaacgcga     93060
     ccaatctagc caccttggcg gtgatgctgg tgttcgggtc gctcttcctc gtgacgggca     93120
     tggcggggaa ctatttctat cccgtcgcct acaacgtccc catcgccatg gccggttcga     93180
     tcatcgtggc ctatatcgtg acgccatggg cggccaatcg ctggctccgt cgtcatcccg     93240
     ctgcagatca tgacgagccc gacgatggcc acggccatgg tcatcgcgat tggatgcagc     93300
     gcctctatct gcgcctgatc ggtccgctcc aattcaaccg gcgcgcccgt cgtgggctgg     93360
     ccctggccat cttcgccttg atcctcgctt cgtcgctcca gggcgcctgg cagttcatcc     93420
     gcccttccgg cgtcagcggc gcggtctcac cgctcggtgt cgcgctcggc ttcatgccga     93480
     aggacaacaa gaacaccttc aacatcgtca tcagcatggc ggaaaccacc cccgtcgagg     93540
     aaaccgaccg gatggtccgt gaaatcggcc gcttgctctc cacaaatccg aacgtcatca     93600
     actatcaaag ctggatcgga caatcggggg tcgtcgattt caacggtctg ctgcagggca     93660
     ccgccgaccg gcggggcggc gatgtcgccg agatccgggt caatctcgtc gacaagcatg     93720
     cacggcgcct gagctccata gagatcgtgc gggcgatgcg gccgaaggtg gacgagatcc     93780
     gggcgagcta ccctggtgcg cgcgtccgcc tggtcgaaga tcctccaggg ccgccggtgc     93840
     gcgcgacggt gctggccgag atatacggac cagagtccga gggactgagg cgcctatcgg     93900
     ccaaggtcga ggcggagttc gccaggactt tcgacatggt ggacatctcg aacaccgaac     93960
     ctgtcgacgt gcttgagcag gtgctggtgc ccgacaggga aaaggccgcc ctctcgggcg     94020
     tttctgtggc gcagatcgcc gagttgctgc ggctcgtcta tggcggtgaa ctggtcgggc     94080
     gggcgcaccc ggccgacgag cgcaacccgg tcgatattcg cgcctatgtc ccgcgtcgac     94140
     acgccgtcga tccgacaaaa ctggacggcc tgttcgtgaa caacacgtcc ggtcagcccg     94200
     tggccttgtc tgagctggtg aaagtctcgt cttcgaccgc cgaccgaccg atccagcgca     94260
     aggataacga acgcgtcgcc tttgtcggtg gggaattgtc gcaaagcgta ccgctctacg     94320
     cggttttcga tctgaaccgg cgcctttccg gcatcaacgc gcccgacggg caaccgttaa     94380
     cgacgggtaa cctgcggttc agcccccggg cgcccgacac catcggcggc tatcaattac     94440
     tgtgggatgg cgagatgcgc atgaccctcg atatctatcg cgacatgatt gtcgccttgg     94500
     gcgtcgccct gactgcggtc tatctgttgt tggtggccta ttatcggtca ttcctgattc     94560
     cgatgatcgt catgtcctcc gttccgctcg ggatcatcgg aatctttccg ggccactggc     94620
     tttttggggt cgacttctcg gccacgtcca tcatcgggat catcgccctg tcgggggtgg     94680
     tgattcgaaa ctcgctgctg attgtcgatt tcatccagga gaatttgaag cagggcatga     94740
     cgttggacga ggcggtccgc atggctggcg cagtccggct gcgcccgatc atcctgacga     94800
     ccctcgccat cgtccttggg tcggcgatca tggtgagcga tcccgtcttc ggcggtctcg     94860
     ccatatcgct gatcttcggg acgctcgtgt ccacggccct gaccgtgttc gttgtgccca     94920
     tcctctacca gctgaacgca gtgcgccgcc caaaaggccc tgcgctcagt gaatgaactg     94980
     tgcgggaaag acttcccccg ctcagctatt tttgatttgg cgcaaacacc gtgacgacga     95040
     aacccgatac gcaaaaggcc ctgaattcac cggagacgca ggaccatgat gctcaagaag     95100
     ctgctgaccg tatctgcgat gatcggcgtc ttcgcaagcg cgggctgtca ggccaagaag     95160
     cctgaggagg ccgccaaaca agctacggaa ggtgcgcgta gtgaattcga caaggcagcc     95220
     ttgagcgcca aggcgaccac cgagaaggcg cgaacggcga cgcaggcggc tgtcgagaca     95280
     gcgactcgca atgctgaaag gacgcgcaag gcggtcagcg tagcttcctc ggaagcatgg     95340
     gctgcggcgg tgcaggcggc ccaggacgcg cagaccgccg ccgcgcttgc cgcccgtcag     95400
     tcgaaagaag cccaccgcca ggcgggcgcg gagtcacgag tcgccgcgca agccgcatcc     95460
     gaggcggcag ggactgcggc gaaggcggct gaagaagctt ccgcccggac ggcggacgcg     95520
     gccaagacag cggctgaggc ccggctggac gcctcggccc agactgtggc tgcggcaagg     95580
     gaggccgccc gaaaggccgt cgaagccgcc gataaggcag ccctagccgc tagggaggcg     95640
     gctcgaaagg ccgaggaagc tgccaaagag gaatcggcca aggccgggtg aagaggcccc     95700
     gtagaaatct atacttttcc tcaaatcgct gatcgagagg tttcccatgt ccgaatccaa     95760
     ccgccccact acgatccaag ataaactgat ggctgatgtg aagcttatcg tcgccgatgc     95820
     cgaggcgctt ttgcatgcca ccgccgatca agcggaagag aaggtcacgg acttgcgcac     95880
     gcgccttcag gcaaacctga aggcggccca ggatcgactt gccgaggcgg aaacgacgct     95940
     tatggacgcg accgccgaaa ccttccgcgc agccgtggtt gcgtctgcgt tggcgacctc     96000
     ggaagccgcc aacaaagctt ctgaagctgc cggggaggca gcccagaagg ccgaggaagc     96060
     agtccaaaag gcggccgagg ttggcaagga cgccgcaacg cacgctgttg aagccgcgag     96120
     agatgcggct cggaaagcgg cggcggcggc cagagagact gctgtcaaag cactggatgc     96180
     ggtggggaaa atggccaggg aggccaaaga tcttatcaat tagttgcttc atgccccggc     96240
     ccgatcggga tcactccgca gcgtctttga cccaagtgac cgcattcgtg cgatcattgt     96300
     tgaatatgcg gcgctcgcct cgtccggagg cgatcctcga atggtattcg atgcgggttc     96360
     gggacaccaa gtttgcaacg cggccgctct tctggcgaac ggccccgctc ctctgctgct     96420
     ggacgatggt atgttccgcc gtgcgagaga cggggcacct caagggtgta acatgacatc     96480
     tggcgtgatg cgattggatg gtcgcgagcg ctattcctca gtgcgcgggc cccgtaggcg     96540
     gccctacgac aatgtctccg cctgtggttc cgtccagtca ctatcggtgc gatgcgtgtt     96600
     cgcgtgcgtg attttcggac cgttcatggc atgaggaaat tcggcggggc attgcatcca     96660
     gaaaagcgca ttggtcggaa tgatcatact gcgataatat tatattcacc gcaggatgcc     96720
     gatctgttca gcttttagaa gcgcttgaac cctgttcttg acttgtagct tcgaaaatat     96780
     attgcgaata tgccatttaa cagtgtcctc acttatacga tgcttctcag ctatatcacg     96840
     atttgagaat ccttctttga ttctttgaat catcgctagt tccttccttg taagaacaat     96900
     agaaatctcg ccgcttggcg aacgaacgtt acggtcgccc ggcccgagct cccggtgccc     96960
     caattccgac tcggacggaa ctaggttcaa cagcggcgcc gagatcgacc cgaatgcctc     97020
     tagaaactcc cgctcatcaa gcaacgtgcg ataacacccg gagcgggagg cgatatcgac     97080
     cgcatctgcc gcacgctgct cggcgatggt cggcctttct gtccctgcgt aggcaaaggg     97140
     cggtgcagag cagcgcggaa atctcgagtc tacccagttc gaagcgtcgt gcgtggtcca     97200
     aagcaacgtt cgcaagtcgg ttagcgaggt ggaaccttcc ggatcgtgct gcaatgcgag     97260
     cctccgtcag cgattgtcgt gccctgagat acggaccgtg agacgtgaga aagatggggt     97320
     cgctgcggtt cggcaatatg gcggacgcct cctccgcgcg ctccacaacg aacaaatccg     97380
     cgagcgtcaa ccgcgcgaga acctcaagcc gcaaaaagcc gaattcccgt acccctccgg     97440
     tgaaggccgc cttgtagggc gcggggcggt tgtggatgct gcgctcgtaa gtagacctta     97500
     tgagcgcgca tagctgcaca gcatgagccg aatgacgttg atgacgggtc ccgagcgccg     97560
     tcgccgctgg gctcatcacg aacgccagca gatcttgttg gcggcgtttg ctccgggcgc     97620
     cgtggttgcg gacgtctcgc gtcagcacga tgtctcgacc agtctgatct acaaatggaa     97680
     gcgggaggcc ttggcggagg cgacgggtgg gccggcgttc tcgccggcgg tcgtcattga     97740
     tgagccgtcg cccgcaccgg tggggccgga gttggcggtc atcgttgaac tggccagcgg     97800
     cgcgcgggtg agcatcaacg ccaacgcttc gccccgcctg gtggcggcga cgcttcaggc     97860
     cctgcgatga tcccgatcgc ctcgggggtg cgcgtgtgga tcgcggcggg acacaccgac     97920
     atgaggaagg gtatgcaggg cctggctctg ctggtgcaag aaggcctggg tcgagatccg     97980
     ttcgccggcg acgtctttgt gttccgaggg cgcggcggct cgctgatcaa ggcgctgtgg     98040
     cacgacggtc tggggctgtc gctctacgcc aaacgactgg atcggggacg gttcgtgtgg     98100
     ccggtcagcg ccgatggcgc agtggccctg acggccgggc agatgtccta tctgctggag     98160
     ggcatcgact ggcgaaaccc ccagcacacc tggcgtccgt ctgccgccgg gtagccaaaa     98220
     atagtcggga aggcctgcat ttaggggcgc cacaagcggc gaaatttatg attccatcgg     98280
     ggtcatggac gctgacctcg cagccctgcc ggacgatatc gaagcgctga aggcggcgct     98340
     tctggtcgcc cgggccgagg tcgcgcaagc gcaagacgtg gccgcgagag ctcaggccga     98400
     agcctccaga gcccaggccg aagccgctga agccaaggcg cgcgtgtctg acgaccaagc     98460
     gctgatcgcc cacctgaagc tccagatcca gaagctcaat cgtgagcgct tcggccctag     98520
     ctcggaacgc acggcccgtc tgcttgatca gctggaactg cagttggagg agctggaggc     98580
     ttcggcgacg gaagacgagc tggccgccga gatggcggcg gctcggacca cgacggtggc     98640
     cgccttcagc cgcaagcggc cttcgcgcca gcccttcccg gaacacctgc cgcgtgagcg     98700
     ggtgatcgtg ccaggtccga ccgcctgcgc ctgctgtggc gggctgcgcc tctcgaagct     98760
     gggcgaagac gttaccgaaa cgctggaggt cgtgccccgg tcctggaagg tcatcgcgca     98820
     cgtccgcgag aagtttagct gccgcgactg tgaggccatc ggccaggcgc cggctccgtt     98880
     ccatgtgatc gccaggggct gggcgggtcc cagcctgctg gccatgatcc tgttcgagaa     98940
     gtttggtcag catcagccgc tcaatcgcca ggccgaccgc tatgctcgcg agggcgtgcc     99000
     gctcagtctg tcgaccttgg ccgatcaggt cggggcctgc acggcggtgc tggcgccgct     99060
     gttccagcgg ctggaggctc acgtgcttgc cgccgaacga ttgcacggcg acgacaccac     99120
     ggttccggta ttggccaagg gcaagaccga caccgccagg ctctgggtct atgtgcgcga     99180
     cgacaagccg ttcgcgggat cggcgccgcc gggcgcggtc ttctactact cgcgtgatcg     99240
     gggtggcgag catccgcaag cgcacttgtc aggttatgcc ggcctgttcc aggccgacgc     99300
     ctatggcggt tacggcaagc tctatgagcc agggcgaaac ccaggtccca ttcttgaagc     99360
     agcctgctgg gcacacgcgc gtcggccgtt cttcgtgctg gccgacctgg agcagaatgc     99420
     gcgccgcaag gctcgcggcg cggcgccggc ggtgatctcg ccgatcgccc tggagatggt     99480
     ccagcggatc gacgcgctgt tcgagatcga gcgggggatc agcggccagg acgcagatag     99540
     gcgcctagcg gtgcgacagg cgctcagcgc cccgctggtc gccgagatgg agatctggat     99600
     gcgcgagcag cgcgccaagc tctcacgcgg tcatgacttg gcccgggcct tcgactacat     99660
     gctcaagcgc tgggccgcgt tcacgcgctt cctcgacgac ggccgcgtct gtctgagcaa     99720
     caatgccgcc gagcgggcgc tgcgcggcgt ggccatgggg cgtaagtcct ggctgttctg     99780
     tggttctgat cgcggcggtc aacgcgcggc ggtgatgtac agcctgatcg tcaccgccaa     99840
     gctgaacgac atcgaccctc aagcctggct ggccgacgtc ctggcccgca tcgccgagca     99900
     tcccagccag cagctcgatg aactactgcc ctggaactgg cagcccctcg ctaccgctga     99960
     ccgcgccgct tagcttccga cgcggtcctc accggatgcg tacgaattcc cccgctatca    100020
     cgcgcatctc ttgaagacgc ccgatagcgc cctttagatc gccattgtgg cggtcaattg    100080
     ccgcagcggt gcgataagcc gagaatataa aatcgacaac gccatgctgt cgcacaaatt    100140
     caagaatgtc gtcgatgcgt atatttatgc cgtctagtct gttggcctcg tattgaattt    100200
     caagttccag ggtgttcaag agatttgcag agaatggcgt gctgttgatg tttgcgttct    100260
     catcctttct cgccattcgc aataactcgg cgcccgaacg cacgtcgccc ttcgcgaggg    100320
     ccgaataaat tgtagcactg tgaagccagc ccagggcata gcgatgatcg gctatgttgt    100380
     ttatcgaagt tgcgtcaaag gttaatttaa tttgatcatc aaatcggtgc tcgctccccg    100440
     cgatgaagca aagacatgtg aggatggcgc ccttgcagac gagatccgcg tcgccatgga    100500
     gctttaccca agcttcacat tgaagccggc tttcaatcaa gttatcggcg gtcgccatgc    100560
     caatggcggc aacgagatcg cgccaacact ctacttttcg tcgtgtttgt tgatcaaaaa    100620
     actctaggtc aaccgctcgc aagtcggcca gcagccctgc cgcccgctca tggtcgtggc    100680
     taaaaatctg ggaccacgcc aagccaaggg cgatcgttgg cgctccgaac acgacaggag    100740
     cggaaaagct gcctccgcgc aacagggggg ggcagctcag acctcgcgtc aacctccgcc    100800
     gaaagacagc ctcgcattgc gcgtcgagaa gcgtgaaccc gggaaaccga cttggctagt    100860
     tccagcccaa caaccggtac tcctccatgt caccctcctc tccggctctt ccgcagagaa    100920
     acagcccgcg gggtggaagc cgtccacgac atcaagaatg gtcgcctacg ggaactattg    100980
     ctgcagccag aagccgccgt tcgcctaata ccgaggaagg ggcattgctg cgcttatgca    101040
     atcctttgct gcaattgggc aaccgcagca tcaaaccgtc gggcatcact agccgctcgc    101100
     gcaatcaact gtgccccctc catttgagcc agacaagcgt gtgcctcggc agcgtaatcc    101160
     atgacatacg caatgctgtt atcagccttg ccgacggcaa acacttcccc gagccaggcc    101220
     gcgacggtgc gatgaaatag atcgagcttt gccagcacct ccggactcag gccatcgcgg    101280
     ccgacgcaaa aagcgacaca taggcagagt tttcttccgc catcgagggc atcccggcag    101340
     gctgcaatat agtggttcag acgcgctcca cctgtgcggt gagactcact gatctggttc    101400
     agcctcagaa agaagttctc cgaataccga gcgatcaacg ccagcgccag atcagctttc    101460
     gtggggaagt gatgatggat gctcgctttt cggatgccca catctgcggc cagatcggcg    101520
     tagctaaacc catcataccc gcgcgcgcga acggcatgtt cggcgctgtc taataacgct    101580
     gctttggtgt ccatacctac catttagtag gcttggaact gcaatcacgc aaggcttgcg    101640
     cagttacctg cctagtagta ggtagctcag cgcggccaca tttggccgcc cctggttgag    101700
     gagatagcca tgtattttca cgtcatgctc ggagccaatg atcttgacgc ttccagaagg    101760
     ttttatgacg ccacctttgg tgtgctcggc gtaagcgcaa agggaccgtt ccgcgatgac    101820
     cccccggcat tcttgtatgg cgagccagaa acaggtttgt tcctggtgac caagcctcag    101880
     gacggcaagg aagcctgcca cgccaacggc ggcactgtca tgttcaaagc gaggtccaag    101940
     gccatggccg atgcatggta tgaagctggc ctggcaagcg gtggcagcga tgtcagcggg    102000
     ccgcctgcac ccggtgcatt gcccaatacc gtcatgggat atctgcgcga tccaaccggc    102060
     aacaaggttg ctgtcgtggc attcgtttga tggaccgacc tagcatggaa ttataggccg    102120
     agggcagcaa tggatttgaa taccgatttt tcgcaacgcg ttctgatcca tggagactcg    102180
     gttccttggg ttccatctcc cgccgccaat gttgatcgcc ggatgctgga tcggattggc    102240
     ggggaggtgg cacgcgccac ctccatcgtc cgttacgcac ccggaagtct gtttccgccc    102300
     cacacccatg gcggtggcga agagttcatc gttctcgacg gcgtctttca ggacgaacat    102360
     ggcgattatc ccgccggcac ttacgtccgc aatccgccaa catcccggca ccagccggcc    102420
     tcagcgaagg gctgcacgat ctttgtcaaa ctatggcaat ttgatcctac cgaccgaacc    102480
     ggtgtgaata tcaatatggc cgagcaagtc gcggtcgccg tacttggccg ccccggtgtt    102540
     gctgtaattc cccttttccg tgatttgcgc gaaactgtga gtctggagac gtggtcgccg    102600
     ggcgcggaga tttcggctga cgtacccggg ggagccgaac ttcttgtgct cgacggtacc    102660
     tgcctggaat ccggggagtc gatgcgcgct ctcacctggt tgcggattcc tgtcggtagc    102720
     cagatacagg ctgtcgcagg agatcaggga acgcgcgtct ggatcaagac tggcgggctc    102780
     cgatttacta acccgccagg ttcacagcca tgatgcctct ggccttatcc tttgacgtcc    102840
     ggctcggcag tgcggtttta gcggcaatgc cagaggcaaa ggatgaagat cgaatcatct    102900
     tcgattgcga agcgcgtttc ttaaatgcca ccgacggtga gggctaaacg cttgggtgtt    102960
     tccggagccg ttcaagcgta aggccgttga tcgggttggc aaccgtgggc tgacccgggg    103020
     ttgcggtggc aaagggtttg ggtcggcctg tgacggtgct gcgccgatgg acgacgaagt    103080
     tcgggaagcg ggctgcggcg acgtcacggc gatccgcaac gcactcgttg tcccgtcgcc    103140
     gtcggatctg gcggcggatg ctcatgccgc caaacttggc cttccaggcg tagatcgtgc    103200
     cttccgacac gccgtgcttg cgggccaact cacagccttc gccccggcct cgttctcctg    103260
     caggatcccg atgatctgct cttccgtaaa actcgctcgc ttcatgtccg tcctctcaat    103320
     tgacctgctc ctgaaaaact ggaccggttt gagctagagt tttctcgttt tgcggcaagg    103380
     gccacagggc gaggagcgac catgaagagg tcgaagttca gtgaggcgca ggtggcgttc    103440
     atcctgcgtc aggccgacga tgtcgcagcc ggtgtttgtc acggtgaccc tgtcgaggac    103500
     tggccgggca atgccctaga acagcgtttc gtcgaacagt tcttcatcgg atgccggtgc    103560
     ggcggaagcc ccggctgcgg cttggctgac ggcaggtgtc ggcgacgcgc cgaagaactt    103620
     cgcatgcagc tcccgttcgg cggccatggt gtagagccgc ccgatgccgg agccgacttc    103680
     gcccatcggc ccctgcaggt cggaggtatc aggcaggctg gcagacgcct gctcggcaac    103740
     aagctcggca cagtggtcga ggatgtcgcc cagttccgcc tggaaatcga gcttggcgat    103800
     ggtcgtttcc atctgctgga ccgcggcgcg gccctgctgt tcgaccgccg tcaggcttgc    103860
     ctccatccgg tccgccgcct gacggatgtc gtcgagcgcc accgccagct gctggtagag    103920
     gccgatctcg gtatctcccg tgacgtccgc tccccggcca gcggcttcgg cgcaaacgcc    103980
     gagttcctgc aggcgtccga gaatgctctc cgtgctgtcg gccatctggc cagcgaagac    104040
     gcgaagctcg gtggtcacga cattgatcgc ccggccttgc tcgccgatgc ggctgcagcg    104100
     caggttcatg ttgagcgcca tgtactggat gtcggtccgc accacccgga cgatctcgat    104160
     cccgtcgagc agttcgcgca cgatccgccc cgtgctgcgg ctcagcgtat cggattcggt    104220
     ggcggtcgcg gtcaccgtct gcaccacgcc ctgggcgctg gcgatattgc tttccatctg    104280
     gcggatcagg ctgttgccgg taccctcatc atcgttcatg ccttgccgca aagacaggat    104340
     tgccgaaata tccatgttga agctgccgac cgtggagacg atcttggccg tgtccctgcg    104400
     gaagtcggcg cgcgtctggt cgagctggcg gtggaccagc gtcagcacgc aggcgcgaag    104460
     acgcgagcgc tgcccagcgt cgagcgcccg gcctgcgacg ctgtcgagat attcgtcgat    104520
     gaggtaaagg ctcgactggc agtgctcgat gcgctggcgt gtgatgtcgc cgacctgcat    104580
     ggccgaaagc acggtcgcca gtttcgcctg gaccgcgtcg gcaagcttgc gcaccgactt    104640
     tgccgcaacg gcaagctggt tgtggtgttc ggtcagctga ccgaacaccc gcgcgagttc    104700
     tgcggcgatc ttcggcacga gctcgcggta gctggtgagg atctgctggc cgcgcgcggc    104760
     cgccggcttg agctgaaccg aaagctcgac gagctttgcg gcaaagctct tgacctgatc    104820
     gccgccatag ccgatgcgat cgatgatctc ctcggcaaaa ccggcaaatt cgctgacgcc    104880
     ggcaccggtg attttcgcgg tgagcgcgaa ggagtgcaga tagcgcagcg tctcgcgcat    104940
     gcgcacgacc tcctcgacaa gagagtgctc gatgtcggcg atcttcgaca ggctgtgctg    105000
     gcgatcttct tccaggcggg gcagctcggt cagcttcgcc atgatgcgcg caaggtcggc    105060
     ccgggtgcgc tctgccgctt cgccgttcag cgaaaccatc atggtatcca gggtatcgat    105120
     catcttcgaa acggaatcca ggacgccgag caggacggtg cccccctcaa ggaagcgcgt    105180
     ctcgatccgg gaccgggcat tctcaagccc ggcggcgaga ccgtctgcgg gttcgacgct    105240
     tgtggagaag gccgctattt gatttcttga cactttttct ccgttttcga gagtctcttt    105300
     atatttgcct aaatcatctt tattgaagcg aatttacttc cgattctcgg ggtattctga    105360
     atttgtccct caatattgaa gggacgtctg atccgccact cagcaatcgc attcgccgca    105420
     cacctatcgc atcgggcatt aacagaatga taaaaatgga aaaattgaca cgaaatcagt    105480
     taggtggcga tgagtacctt aactgcatcc gtcaccagca tagctcttgt ggcctcactg    105540
     ggcgggggaa cagcattcca tagcacgcgc tgatagacgt ccgatcgaca gagccccaaa    105600
     aaatggtcgg cgacgcgtgt ccgccgtcag cgccaatgag acagattgag ggttccgttt    105660
     agaggaggat tttggtctcg tcgaagtgac gaaggaacga agatgagacc aaaatccttg    105720
     gccgcgaagg cgacgcccgg tgagcgggtg gtgaaggata tccggcgggc gacgcgccgg    105780
     catttctcgg cggaagacaa gatccggatc gtactggacg gactgcgcgg ggaggacagc    105840
     atcgctgagc tttgccgcaa ggagggcatc gcccagagcc tgtactacgt gtggtccaaa    105900
     gagttcatgg aggcgggcaa gcgccgcctg gcgggcgata cggcccgggc agcaaccacg    105960
     gacgaggtca gggacctgcg gcgggaatcg acggcttttt gaaagaggta gttgccgaac    106020
     aggcgcttga gatccgcctg ctcaaaaaaa gcatgatcgc cgatgggggc gacggggaat    106080
     gagatatccc gcttgcgaaa agatcgagat agtccgcctg gtcgagcaat cgagcctgcc    106140
     cgtgcgcagg acgctggcgt tacggggatt ttgggctcga tggtgtgtcc gtagcgcggg    106200
     aacctggccc gcctatcggt ttgggtggtc gcccgcgctt gcgttgcagg atcatctgag    106260
     gcgcgggagg gggcaccgga gggtcgtgag cggggagttg cagcgttgct ggcgatggcc    106320
     aggctacgcc tttgccctgg cgcgcacagg acctgcggcg actgcggtgg acgccgggac    106380
     gaatggtctg agcgtgtcgg cgtgatgcgt gtcatgaggt gtctggccag gtcagggtct    106440
     tgcgcgggat tgggccgagc gaggctatgg cgccgccaca ccttggatag atgtccaggc    106500
     agcgccctgt gagacagtga tagcgctggc gacagtcgcg ggtcatgtcc aacgtcggcg    106560
     gcgtgggcgc cgccagcaag acggctctag cttgatccta tccgatatgc agagccttat    106620
     ccgccagcga gactaggccg aggcattcgc caatcaactt ctgagggagt gcttgcccgc    106680
     tcgccctggt cagcagcttc gctccacgct tcctccccac ggtcggtcgc ccttccgcag    106740
     ttgcgcttca cttcgctcct atgatcaact gacgatggga cttgcaccta caagaaagcg    106800
     cccatgctgg gcgcacaaac aaaaagggcg acccggttgc ccggatcgct cttccttcat    106860
     ccgaaagcca aaggccctgc tcgctttgga gagcggacct tcggatcccc cccggttaga    106920
     acttagccct cagcgtcacg ccgtaggtgc gcggcgcgcc gaggaaggcg tcataggtaa    106980
     tcgtgtcatt ggccggcaca taagttgcct gggtggcact gagccccgac gagccttgca    107040
     ggaaggcgtt gaagcccacc tgggtatatt cctcgtcgaa caggttttgg ccccagagtt    107100
     cgacggtcca ggcgtcatcc gcagtgccga cgccgatgcg ggcgttcacg accgtgtagg    107160
     actcttgcaa cttcggcggg aacaggtcgg aaccgctgtt gtattccgac gagtacttgg    107220
     cgccgacatt gaagcgggcc ttgtagctgt cgcccaccgg acgctcatag gtcagcgaac    107280
     ccgaggccga atattccggc gccagcgaca gacgttgacc aggcagcagg gccagggcgt    107340
     tggtcgaatc gttggggatc ttctggttgc cgtattcggt cttggcgtag gtgaagccgc    107400
     tctggacggt caggccgcgc accggggtga accacaggaa gtcggcgtcg acgccctgcg    107460
     aggttacttc cgggatcgaa gccacggcga acgaggtgcc caggaaggtg ttcagctgga    107520
     agtcggtgaa cttctgatag aagcccgtca ggttcagcag gaccgagcgg ttgaacaggg    107580
     tgttcttgag gccgatttcg tagctgtcga caaactcgcc ctcgaacgag gtgtcgtaga    107640
     tcggcacgac gcccagaccg ccgctttgca ggccgttcga cgactgggtg cggtccaggt    107700
     tgaaaccgcc acccttgtag ccgcgcgcat aagaggcgta gctgaacact tccggcgaga    107760
     agcgataggc ggccttgatg gtgcccgacc attccttgtc ggtgcgcttc tggtgggtgc    107820
     cgcgaccgtt gaacagcggg ttggcccagg gaaggcagag gttgccgacc acggtcgggg    107880
     tggccgctgc gcccacgatg ccggcgatgc gggcctgacc agcggtggac aggccgatgc    107940
     cgcagccgac gccgccatcg gacgtggtct ggtaggtgtc caagtccttc ttgtcgatgc    108000
     tgtagcgcag accggcggtg atgctgaagg cgtcggtgaa ctggtaggtg ttgctggtga    108060
     acagcgcgat ggtcttggcg cgctgattgt acttgtcgta caggccctgg cctggcgtga    108120
     aggtggtgtt cggcgcgcga ccggtcagca gcgagatgaa gttaccgatg ccggcagggt    108180
     tggccgccga gcgcgacagc aggcggccca gatactgctc gtagtcattg ccatagagga    108240
     agttggcctt gttatccagt cgctcgtccg ccaggaacgt gccgaccagc caatccagat    108300
     tgccggtctt gccagccagg cgcagttcct gggtgtaggt cgtgaactcg ctgtagttgg    108360
     tgccgtcctt gttgcgatag gcaaggtcag ccgtcgagaa atcgctgtcc tgaccgttgt    108420
     cggtgcgcca gttgcggatg gcggtgatcg aagtcagttc gccgatcggc agttcgatat    108480
     tgccttccag cgagatgccc ttgtcctcga tggacgaggg cgcgccacgg ttggaatagg    108540
     cgacgcgatc atagggcttg gcggtcgggg ccaaggcgac gccgccggcc agggcgttca    108600
     ggatcggcgc ggtcgggccg gtgcggatct gcacggcgcc gcagcagttc tcgtcgcgct    108660
     tggtgtagtc gccgataagc ttgaaggtgg cttcatcatt gggcacgaac aggagctggc    108720
     cacggatcgt gtagaagccc tggtcctggt cctggtcgcg cttgctggga cccttgccgg    108780
     tcagaacatc attgtagccg tcgcgctctc gggcggcaac atagaggcgg ccggccaggg    108840
     tctcggtgcc aaacagcgga ccggtcaccg aggccgacag gccgtgggcg ttgaagttgc    108900
     cgagggtggc ttcagcggcg gcgccgaagc cgaactcggg ctccttggtc acgatgttga    108960
     tgacgccggc cgaggtgttc ttgccaaaca gagtgccttg cggacccttc aggacttcga    109020
     tgcggtccat ttcgcccagg tcgccgaacg agacgccgtt gcggggacga tagacgccgt    109080
     cgatcacgac accgaccgag ctttccagac cggggttgtc gccgaccgtg ccgacgccgc    109140
     gcacgcgggc ggtggtcgag gcttccgacg tggtcgaggt gacggtcaga ccgggggtca    109200
     ggatcgtcag atccttgatg tccttgacgc cggtgtcttg cagcagcttg gcgccgacgg    109260
     cggtgaccac gaccggcacg tcctgcaggt tctgctcgcg cttctgggcg gtgacgacga    109320
     tgctgtcgac ggtcatcgtt tcggtttgtt gggcctgcgc gacactcgcg acggacagac    109380
     cggcgagcac ggctgcggac gccgtgccgc aaagcacctg ggtaaagcgc atttcccacc    109440
     tcgtttgtta tgccgcgagc ggttgatcgc ccccagctac tttttagatg cattcgaacg    109500
     actgttcgaa atgacatccc acgactaagg gcctctggtg ggcagggcaa gaaaaaaccc    109560
     ttacacgtaa aaagatcgaa aaggtctgtt gcgctgaagc gacacgcgcc attctcgatc    109620
     atgcaagatg tcgccgggga ccttgccaga ctgattttcg atccatgaca atctcaccca    109680
     ctatcgcctc catccgaatt taatggtcct gcgtcggcgt ttaagtcgtc agattgcgca    109740
     tgacgcacgc gtcgctggga ccgttgccgc tcccccccat atggcccatc ggacggctcg    109800
     cccggcaccc ggttccagta gacgagcgcc ggagaggcct tctcgccgtt ggttgacctg    109860
     ctcctgaaaa actggaccgg tttgagctag agttttctcg ttttgcggca agggccacag    109920
     ggcgaggagc gaccatgaag aggtcgaagt tcagtgaggc gcaggtggcg ttcatcctgc    109980
     gtcaggcctg agggcgccac ggttggcgag gtctgccgca aggcgggatt tccgaggcga    110040
     cgttctacgt ctggcgcaag aaatacgcca gcttgatgcc atctgagatg aagcggctgc    110100
     gccagcttaa ggacgagaac gcccgtctca agcggatcgt gacggacctg tcgctcgaca    110160
     aggagatgct gcaggacgtt atccacgcac gcgcttgcta agacggggag agaggcgttg    110220
     cgggcactga agggctcgcc gttggcccgt aagggcatcc tgggatccgg cgctgccatg    110280
     actggtttgg ggccacggcg ggacaccctt ctcgatgcag gcgatgacgg cttggatccg    110340
     cccccgcccg caaccgttct ctacgcgcca tgaatttgcc gccatccggc gcgcaatctc    110400
     cggctgaagt ggtttgagga gtttattatg ataggcgacg tctcgttaaa attgggcaga    110460
     aggacatttt ccgcgcggct ggaatacgac agcctgattg gccgcggcct tcgcagcgtt    110520
     ggacgcaggc tagaggccaa gcgcggtttt ccatcggccg aggctacgac tgagaaggct    110580
     ccgactttta cggtcgcgga gacgattgag gacgtaacca tcgaggtcga cgtccctggg    110640
     catgccctcc aggatttgcg cttggatgtt accccaaggc gtttgcgctt gcgggccggg    110700
     ggccgtcagg gacggtccgg gggtatcggg ggtcccattg actcatcttt cgatcttcca    110760
     gagccggtcg acccggacaa ggtgacagcg acgcttgagg acggcattct aactgtcagc    110820
     ttggtcaaga tcgcctgggt gcatggcgaa gcaaagcccg tccccgtgcg tgaggcgtca    110880
     gtcacgccta agcaagcgga ccacgaaagc caccaaacca acccctgaaa cgacaaggat    110940
     cgcggttcgt ccgggcgcgg cgacttggcc gccgttcgcg accgttacga tggcggcggc    111000
     gacgacgagc gccgcgacga ctaccgcgag agaaaggctt tcgccggccc gcttcacggc    111060
     aagaggcaag tccgctaatt ctgaacttga gacgcgtatg gcgaggccgt ctcggctgag    111120
     gcggccgatg ccgcgtctta tcgcttctgg cccggtcgcc agaatctgat cgagttcctt    111180
     gaatgcacgg aaggcgcggg tggctagggc tttgggcgca aaccttgacg cgaaggcctt    111240
     gaccaccacc ggcgcaatcg cgtcgacaac atccagctcg gggtcgagcg tcctcgccag    111300
     tccctccgcg atgccgagag cccgcaacag gagtaacagg tcaggcggca aggtcagcgc    111360
     gttgtcgcgg gcgatggaga ggaattcgcc aatagcctcc gcaagccgga tcggccgccc    111420
     ggagtcggct gcatagcgca gaaagaagcg ctcgacacct tgctcaaggc cggtcggagg    111480
     cggtccggag cggccagccc attccattaa tacatcggac actgcggcga catcggcatc    111540
     caccagggag ccgaggacca ctagcacctg ctctcgccgc ttgaccgaga ggcgtccgac    111600
     cgagccgaaa tccaatagcg ccagacgacc gtctggcgtc accagaacat ttccgggatg    111660
     agggtcagcg tggaacaccc cgtccaacag gatcatgccc agtaggcccc gggccgcttc    111720
     gggcgccaac gcacgcgcca acgcaggctc ctcgttgcga aacattgcgt tagggctgcg    111780
     accgcggatg cgggtgctga ccatggtcct ttcagtggta aaccgctcat ggactatggg    111840
     cacatggaag accgtcgctc gtttgcgcac ctcagactga ttacgcgcct cgattcgaaa    111900
     atcgatctcc tccaggagag cttcactcag ttcggagacg acacgtacgg gctgatggcg    111960
     acgaagcgcc ggcgcgcgcc gctcgacgac acgcgctgcg gccgcgagca gccgcaggtc    112020
     cgcgcgcatg atagccccga taccgggtct gcgaactttc aagacgactt cttcaccagt    112080
     cgtgagccgc gcggcgtaga cctgcgctat tgaagcggcg gcgattgggg tggggaaaaa    112140
     ttcagcgaag atatcttcgg gcgttccgcc aagatcgatt gccagctgtt cacgtatctg    112200
     ttcgaaggga accggagcga cgctatcgtg cagcctgccg agcctttcgg tcaactcggg    112260
     ggggagcaga tccgagcggg tcgccatgat ctgcccaagc ttaacaaatg tgggcccgag    112320
     cgcctcaagc gccgtaacaa agccctcata tgtcgcgtcg ctcgtgtcgt cggtaacccc    112380
     tccgcgcaac aaccctagct ttctgagacc gggccgggcg gcagaagggg ccaacgtacg    112440
     gagcaccgta gcaaggcggc gaaagtcgtt ctgcgagagt gtcaggggcg gcatcggatc    112500
     tgcatgcccg catcgtttcc gctacgcaag gccagcgagc tcatgaaccg atcattctgg    112560
     acggcgttat ctagccacgc gagaaggagt ggaggatatg atcagcttta ttgttggctg    112620
     cgtgggcgct gtaatgatta ttgcgggcgc cgcaggcctc cgtatagcgg tccgacggct    112680
     taacgaatag cgcggcagcg ggcactcggc caggacgaga cttaatgaca agcggcccct    112740
     tccacttcat cctgcggggc tctccctcgc gcttcagtta gaacccacaa gtggtctcgg    112800
     caaggattcg gttcaggcgt tattcagctg agaccgtctt cgcctgtgac aagttatctc    112860
     ggcctgagcc cttcgaggct cagcatgccc atggcggcca tgagacgctc tggggtgtca    112920
     aacggcacgc aatagggacc ccctatcggc gcccaatagg gacccccttt ccgagttcga    112980
     gcggcgatgc gcgtagctct cagccagcgc agagcatcgc cgcggggtga gccactgatc    113040
     gatcagctgc ccggaggggg gtctgggggg aggttgaaca agttgtggat gaagcggggc    113100
     gtgccggtca ggcccggttc ctgagccgcc agctgtcgtt gcccgtctcg acgatgtcgc    113160
     agtgatgggt caggcggtcg agcagcgccg tggtcatctt ggcgtcgccg aagacggtgg    113220
     gccattctgc gaaggtcagg ttggtggtga tgatcaccga ggtgcgctcg tagagcttgc    113280
     tgaccaggtg gaacaggcgc tggccgccag actgggcgaa cggcaggtag cccagctcgt    113340
     cgagcaccac gaggtccagg cgcgagagct gggcggctaa agcgccggcc ttgccgcgcc    113400
     gggcctcgtc ctcaagccgg ttcaccagat cgacggtgtt gaagtagcgg ccacgagcgc    113460
     cagagcgcac gacgttggcg gtgatggcga tggccaggtg ggtcttgccg gtgccggtgc    113520
     cgccgaccag gacgatgttg cgatggttgg ccaggaaggc gccgtcgtat agcgaacgga    113580
     ccaagccctc attgatcggc gagccctcga agctgaacgc cgccaggtcc ttcatcaccg    113640
     gcagcttggc ggcggtcagg cgataacgga tggaggcggc ctggcgatgg ttggtctcgg    113700
     ccttgagcag gtcggccagg atctccatgg ccgtgcggtt gcgctgaagg cccgtggtga    113760
     cggtctcgtc gaaggccccg gccatgccct tcagacccag ttggcccagg gcctcgatca    113820
     tctcatgccg ctgcacgggg gcctcgcagc aggtcgtagc gggcgcagtc tgcgatgggc    113880
     ggatggcgca ggaccagcgc ctcgcaggtg gtgatcggct gtggcgctgg cggctcgcgt    113940
     cgccgggcca ggatgttgag gatgacctca tcgctagccg cgccggcgtc cagggcctcg    114000
     cggacggcgt catcgaccac atccaggcca tcgatcagca ccgccgccag cacgcgaacg    114060
     aaccggcggt cggcctcgtc gccacgcccc agcttcttgc tgagccgcgt cagggccggc    114120
     ggcagggacc aatcctggaa cggcgcgccg ttgcgtagag cgcccggctt gcgggccagg    114180
     accggcaggt agtgccaggg atcatagatc gtccggcccc ggccgaagga ccgggcatgc    114240
     tcggcgacga cttcgccggc gcagcgtacg acgatcttgt cggcataagc gcgcacctgc    114300
     accgtgcgct tggcggcctt ggccatcacc gagtagcggt tgcggtcgaa ggtgatcagg    114360
     caggtgccgg tcaccgcgtg ctcgacctcg tggaagccgt cgaacggcgc caggatcgcc    114420
     tgcagcgccg gccgctcggc ctccaaggcc tgggccaagg tgatctcgcg ctgctcggga    114480
     tgggggtgta ggcgcgccca gcggcggcac tcggcctcca gccagccgtt cagctcttcg    114540
     aggctggcga accgcaagcg cggtttgaag aaccgctccc ggctggtctg cacctggttc    114600
     tcgacctggc ccttctccca gcccgcggcg ggcgtgcaag cagtcggttc gaacatgtaa    114660
     tgatcggcca tcagcaggaa gcgacggttg aagacccgct gtttgcccaa gaacaccgcg    114720
     tcaacggcgg tcttcatgtt gtcgtagatg ccccgcgtcg ggaccccgcc gaagaaggcg    114780
     aacgcccggg catgggcgtc gaacaccatc tcctgggtct cacgcggata aaccctgacg    114840
     tagaccgcac gcgacgcgca aagccgaaca tgggccgcct tcacccgcat cggctggccg    114900
     gcgacctcca cgtcctcatg actgaagtcg aactggaacg cctcgcccgg cgcgaacatc    114960
     agcggcacga acgctgtccc gccatcgcct ggggccgtct tggtctcctc gcgccagcgg    115020
     gccgcgtaac gacggaccga gtcataggag ccgtcgtagc cttcctggac caacaggtcc    115080
     cagacccgcg tcagtcgcaa acggtcccgc cggggccgcg cctcgttctc cgtcagaagt    115140
     tgcacaagcc gatcacgcac cggcccgatc ttcggaaacg gctgcgtcgt ccgctgatag    115200
     ctgaacgcgc cttcctctgc ccggatcgcc ttgcgcacga ccttccgcga cagtctcaaa    115260
     tcccggcaga tcgccttgat cgctttgccc gccgcatact cgcggcgaat ccgcaccaca    115320
     gtctccacca ccaacatccc gatctcgacc gcccggttga accaagccgc cgtgcctaaa    115380
     ccatcggaat gaggggtccc ttttaggcgc ctatcacccc gctaaggggg tccttcttcc    115440
     acgccgctgc acagttccag acgaagaaac tcggctatgg ccactcaaga cgaagtctac    115500
     tcgctcgcac gaagcacgtc acacaagacg accgagacgt gccgtttatg cggtcattca    115560
     ttcgtaatct agaagcaacc tatgcaaaag cccgacccgt ctatcgtaaa atctgcagct    115620
     cggacgctgg aaatctttga gtatttcgac gaggttcgcc gtcctgcgca tatccaggac    115680
     gtcgccttat ctctgggcta tcctcattcc agcaccggcg ctctactacg cagcctcacc    115740
     gaccttggct acctagaata ttccatagaa gacaagactt tcttcccgtc catccgggtt    115800
     tcactcctcg gtaactgggt gggggatgag actctgtcgt tacgacttat ccaacaacag    115860
     atgcgcgaaa ttgccgaggc aactcaaatg acagttgtgc tgggcgctcg tagcggcggc    115920
     tattgccatt atgtgcgcgc gatccaaggc acaactccgg tccggtacca ccttaaggcg    115980
     ggaactcgac tatgccttgc aagatcgacc gtgggaagtg cgctgctttc gatggagacc    116040
     acggatcgcc aaccgcggtt aatagctcag gcgctttcgg tctgggacag cgacgagggc    116100
     gcaccccgtc cggagaaact cgcagcagat ctggccctcg tcgccgcgcg cgggtacgct    116160
     ttcaactccg gactggtcaa cgcccaagcg gcgatgttgg cgatccctct cgctatcagg    116220
     actcaaacgc ggcctttagc gataggctta gccgccccaa agaacctctt ccgcggccgc    116280
     cgccccgaac tgatccggat tttgcgagaa gccctcggcc gccttgccga ccagacccat    116340
     caccaaatag ataaatccag gtaacgtttc cgaaaatcct ttttgcagaa ttccaattcc    116400
     gactaaaata ttagtaaaac tacaaattta tgctctaagt gtatgaaaac aggtcaactt    116460
     ggcgaagctc gctcctggcc caggcccaag cgtcctattt gtcgcgccac cgcgccaaca    116520
     ccgccggatc gcccggcgaa gatacccctg ccgcaaagca ccgccttaca ccgaaatcac    116580
     ctaacctgca cccgcagcgt cacggattcc ggcggtcggg aggtcgaatg ggcggcggat    116640
     gtagcggctg taaacgcggt gactcacggc accgcagctg ggacatcgac ttgtcgaggc    116700
     cccgcccagg atgagcgcat gggcggagaa agggccgacg acagcaaaag ccgacgagga    116760
     aaaaagactg gattgcgaaa aggcgcttgg ccatggccct gatcggagcg tgaacctaaa    116820
     gcagtccccc agcatacttg acgaaaatga ttgatatcca atatggacgc gggatccgac    116880
     ataatctttg aacgccgctt aacattcaaa gcccacatag tcggtactcg gtgggattga    116940
     aaatactgag actatctcac aaatatagag caatgtaaca tatttaccgg cccggcttac    117000
     cagattgaac ccactataag gtggatagtt acctacgccg attttgtcag taaaggcccc    117060
     gctcgcgcgg gcttccaacc gaacctagct cgcaacggat tgcaccacga accccgccgg    117120
     cccacaaaat tcttgccggg cttttcaaca catatgtgtt tttatattct atatacatgc    117180
     tacgcatgaa gggtgaagtc gtgggaacca catatgaata gacctacccc agtcgctttc    117240
     aaaacaagcg acggcatagt cctcgctgcc gaccgttatg gtgcgcgagg ccgcggctct    117300
     gtgatcctag cgcacggcgg cggccagacc cgccatgcgt gggcaaagac cgcgtcggcg    117360
     ctcgcggatc gagagtggga agttatcgcg ctcgatctgc gcggccacgg tgacagtggc    117420
     tggtcgccaa caggcgatta taggattcac cgcttcgctg aggatctcgt agatgtagtg    117480
     gggacgatgc ctgggcgtgc ggcgattatc ggcgcatctc tcgggggcct tgccggactc    117540
     tacgcggagg ccgaggtcgc gcctgggagt ttcagctcaa tcactcttgt cgacatcgtt    117600
     ccgagcatgg actcggacgg agccgccaaa gtcatggagt tcatgggagc acatgtcgcg    117660
     caaggttttg gcagccttga agaagccgct gcggttatcg cggcttatct gcctcaccgt    117720
     ccgcgaccaa aggatctatc tggacttgcc aaaaacctgc ggcaatgtga tgatggacgt    117780
     ctgcgctggc actgggatcc cggctttgta tccggcgtcc atcgcggacg aaccgcgcag    117840
     gatatcgacg cattccaagc ccggctaccc gggttaacgc ctccggtgca ccttatcagg    117900
     ggccggctga gcgaattggt atctctcgaa gcggcggaaa acttcgtagc cctactgccg    117960
     aatgcaaagt tcaccgatgt cgcaggcgcg tcccacatgg tggcggggga ccgcaacgac    118020
     gcgtttctca acgctgctgt cgagtttcta gaaagcctgg accaccaacc ctagaacgga    118080
     atttataatt ccggagatag tccaaactaa acatcttcaa ccccagaaat cgaaatataa    118140
     cttttaataa aacacttgct aaatcaatct taactaaccc tgccgagata attcccgccg    118200
     atcattttgt gatcgtgacc cgttgctatg cattttaggc attgcgggaa atagatgtac    118260
     cgccataata ttatatatgg gaaaatatcg atcgtttaag cgaatgcata gttgatatgc    118320
     gcgatatttt attttatcct ggggaagagg cgcaaggcac aaccttcccg cctccctcgg    118380
     ccgtacccta gtgcttacct cctgggcgcg gtatacttag gcggcgcagc aaccaactgc    118440
     gccgcctttt tacacttaat gcagcaagcg ttagaatgtt ggattgattc cattttttgg    118500
     tggacattgc ggcgggtacg atggccttgt ctgcggcgct caagacgaaa ggtttgcgct    118560
     actggttgtg atcggcgaca aggcgattga tggagcgccg ccgatcccta cggcgcgctg    118620
     acggtcggag gggtcgccca acagatccag cggtttgatc cggccgagcg acaccttcgg    118680
     gttcggccgg ttcatgaggt cgatgactgc cgagaggatt gcctcgcgct tggcgccgat    118740
     catctagccg caaccgggct tataccttcg tcgcccgcga ggcctcgccc cccgaagccg    118800
     aaccggatcc tgtcagggat cgccccgcga cgcggctcaa agcacgatga agaacgaacg    118860
     tcggcgcgag ggccgcagcg aagaccatag ccgtgatcag gaacccgtct cggtaggcgg    118920
     ccgccgccgc ctggtagtaa actccttgcc ccagcaacca gccggcggcc gggagttgct    118980
     ccaaaggccc gagtcccatc gcgtggacgg ttcgcgcggc ttccatgaga tagttgcctg    119040
     tagtcgaatt atccgacgtt tgggtcgcgg cgagggcgtc gccgtggaac gcggttcgtc    119100
     gctcaatgat aacgcccaga atactcgtgc caagcgctcc gcccaattgc cgggtgaagt    119160
     tcatcgagcc tgagccctgg gataacagtt ccagcggcag caccttgaga gctgcagaac    119220
     tcagcgaggg gaacacaaag cccatgccaa tgcggccaat caccgtccac caagcgagcg    119280
     tccagaaggc tgtgtcggcg ctcacgtggg ccgttagcca cgacgaatag gcaaaaatcg    119340
     ccatgcccgc cccgatcagc aatcctggcg acagccggtc gctcatcatg cccgcggcgg    119400
     gaaagacgat gaccaggacg aagccggccg gcatcagcag cagacccgct tgggttgggg    119460
     tgaagttttg aatctgctgg acgaagaccg ggagcagata ggtcgtgccg tacagtccgg    119520
     cccccagcac aaagctgacc gctgcggccg cagcgaaggg gggactggcg aacacccgca    119580
     ggtcgagcag cggatgcgga atccgacttt cgcggacaag aaaggccgcc gcgcaggtca    119640
     tcgtgatcgc aaaccccgcg aggacgggcg tggaggccca gccctggcgc tgtccactgg    119700
     acatggtttc cagcaacgcg agcagcgcca cgctgagcca caccagggcc ggccagtcca    119760
     gtcgggcctt cgcagccgca ggatcgcgat cgggcaggaa aaggttcgcc agcgtgatgc    119820
     cgccgaggcc gaagggaatc cccaaataga aaaggaaccg ccagtcgaag ctatccatca    119880
     gcagtccgcc gacccacggc cccagcgccg gggcgagcac cacgccaatc ccgaagatgc    119940
     ccatagccgc gccgcgcttg tcggggggaa acacctggaa catcacgacc atcgccagcg    120000
     gctggatgac acccgctgca gcgccctgga tcacccggga gactatgagc accgtatcat    120060
     ccggggccag cccgccaagg accgatccga acaggaacac gcccagggcc accatcatgg    120120
     tttgccgctg accgaaggtg cgctcgcacc atgcagagag cagcatggtg accgtcatcg    120180
     cggcgaggaa accagtcgcg agccactgca cccgggtctg atcgatgccg aactgcccca    120240
     tgatcgccgg gacagccacg ttcacaatgg tggatgacaa caccacggcg atcgctgaaa    120300
     ccatggccgc cgccgtcgcg agccagcggt acatcgaccc atagcgagca aagagggcct    120360
     cagtctgtgg catcgatcgt gacctcggcc atcatccccg gccggaggag attctgctgt    120420
     tggatgatgg ccagcctcac gggcagccgt tgggtgacct tggtgaagtt gccgctcgga    120480
     ttggggttgg gcagtagcgc gaactggctc gtagcggcgc cccccaggcg ctgaaccctc    120540
     gccgcgaacg tgcggccggg ataggcgtca accttcacct tggccggcgc gccaaccctc    120600
     agtttacgga actccgtctc cttgacgttc acatcgaccc agacgctatg cgggtcgtga    120660
     tagagcagga tccgcgagcc cggcgagacg tactcgcccg catcgacaac ggtctgatcg    120720
     atgaccccat tgaaggccgc ggcgatctgt cgccgtccga gatcgagccg ttgctgctca    120780
     cgccgcgcag ccaacgcatc gatctgggcg tcgacgcccg caatctgctc ggcgatcacc    120840
     tgtacctgct ggaggcccgt ctgggtaacc tcggcgcccg cctttgcgcc ggagatggcg    120900
     gcgcgggcgc ggacggcggt ttgctcggcg gcccgaagcc gcgcctgatc ctcctcgaac    120960
     cggctcttgg cgaccagccc tttcccataa aggatctcgg tgcgctgaaa ggcggctctt    121020
     gccacggtca gctcagcctg cctggtcaga tagtcggcct gggcgctgtc gacggtcgcg    121080
     gaggacaccc cagcctgatt gccgacggtg ttgcgcacca agctttgctg ggccaacagc    121140
     tgcgcgcgct gcgcgcgcag attggcgatg ttggcgtcga tctccgccaa gctgtattga    121200
     gcgtcacggg gttctatact gaccagaagt tgaccccttt tgacttggtc accggccttg    121260
     acatcgagct gaacaatccg gccggccagc ctcgctggaa accgcaatga catctgcggc    121320
     aatgcgggcg tcattggtcg atacccggcc agccctcgcg tgcagccaaa ccgcgccagc    121380
     cgcaatgagg gccacgatca cggcggcgac gagaaacagg cgccgcgagg gttttcgcct    121440
     gatgcgcatg cttttcacgc tcacggcggg gttgtcatct gcggcgctca tctttggtcc    121500
     agccgtcggt tgactcgccc caagacggac agacaggtgg cgagatcggc gtcagaaata    121560
     tccgctagca actcgtcgcg aagcgtggcc gcaatgcacg tgatgtgatc gaggacgggc    121620
     tcggccgcag gtgtgagggt gacgcatttg gctcgccgat cattcggcgc ctcccgccgc    121680
     gcaatcaggg cgcgcctttc aaggtcatcc aactggcgca cgatcgtcgg cgcctcgatt    121740
     ccgagccgat ccgccaaatc ccgctgcgtc agccctccat ccgaactcga aagttccaac    121800
     aacgccagcc accgtgcctg cgacagaccc gtgtccttca accgctcgtc caggcgcgcc    121860
     cgccaacgac ggctcatcag gttcgccgcc tgtccaaagg cctgcctggc gctcatcggc    121920
     tacacatcca aatcgatagg tagctaataa ttagcatccc aggtgcggtt gcatcaatac    121980
     gattctaggt gttgaatgat agcagcctaa ccgttaacct gcgaaggttt gttgagtgct    122040
     tttcgacgcc tgaagatgtc gctgctacac ttggtctcaa acagggttta tagatgtatc    122100
     gtaaccggtg cgagcacccc acggtgcccg gggccggcta ttcgcctact tggtggcgag    122160
     ggtccccatg cttgcggcgc ggcgcggagc gcattgctcg cggatgacgc tgacagcctc    122220
     agggatgatg cgccaggtct cacccagctc cagggcgggg atggcgggcg acatgccgtc    122280
     atagatcgga gcgccgtccg gcttggtgca gttgaccaag atcgccgtga ggggcgcggc    122340
     gctctcgaag gtctcaaaca gcggctgcca agccgccatg ttcaggcgca tggcgccgta    122400
     aaacccgttg gcccagtcct cgaccagtac ttcgccctcg tcggtcctca tgtagatggg    122460
     cgcgtaggcg tggggagcgt tggccaggac gtcgctgatc ttgttgtagt gggcgacgat    122520
     ggcctggacc gcggcatcgg ccttggtccc cgcataagcc cgcttctcat ggtcgccgat    122580
     aaggtgccag agccaggttt ccggatggat gaaggccggg ctgatgacga cgccagccag    122640
     gaagccgtcc atcatcgaca cgcctgcggt gtggaccggt ggcttggctc tctcaaacca    122700
     gtcttccaga gcctccagcg tcatcggctg ggatcgacgc ggcgccctca cgcggccgat    122760
     ttcaacggga ccgagcgcga cgccttccag ttccaggcga gcagctgatc aagttcgttg    122820
     ttcttcacgt cgccgctgac gatctgctcc agtacgtcgt tcagccaggt aaacggatca    122880
     aggccgttga gcttggcggt attgagcagc gaggccagga tcgcccagct ttccgcgccg    122940
     tcgtcactgc cggcgaagag gctgttcttc cggccaagcg ctatggctct catgctgcgc    123000
     tccacggcgt tgttgtccac ctccaggcgg ccatcggtga ggaacagatt taggcctgcc    123060
     cagtggctca gagcgtagcg gatggcgtcg gccaaggccg acttgctggc gatctgagcc    123120
     aagccttcct caagcatcgc tttcagggtc tccatcagag gggcggtttt ggcccgacga    123180
     gcctcgagcc gatgatcggc gctcgttcct cggatcagcg cttcttgcgc atagaccaag    123240
     gcgatctgct cgatcacccc cttggcgatc ggcgaggccg tcttcttgtg gacatcggta    123300
     aatttgcgcc gcgcatgggc caaacagaag gccagctgga tagtgcgatt tccctgacgt    123360
     tccttggcca gggccttgta ggcgccatag ccgtcgacct gcagcatgcc atgatagtcg    123420
     gcaagctgat gcttgatgac gccaagtccg cggccttggg catagatgta agcgaccgca    123480
     ggcggcgcag gaccattcca tggtcggtca tcgatcgcat gcgcccagaa ccagccggtc    123540
     ttggttcgct tgcggccctt ttcgagcacc ggcatccggg tctcgtcaca gaagatccgc    123600
     tcatgggcgt ggatcatttc aagctgacgc cgatagagcc ctgacagcca ccatgccgtc    123660
     cgcttgatcc acagcgccaa ggtcgagcgg tccagaacaa cgccctgtcc gatcagcatc    123720
     tgcgattgcc ggttcaaggg catgtaccag gcaaatttcc agcacacgac attggcgatc    123780
     agcgccgtcg tcgccatgcc gccttcaaac actctgcgct tggccggcgc ttgcacgata    123840
     gcgccctcac aagcccggca ggcgtatttc ggccgcacgg tgcgcaggac ccgcaaggtg    123900
     gccggcacac cgtccaacgc ctcggcgacg tcctcaccga tcttgtgcaa ccgcccagcg    123960
     caacaggggc attgggtcga cgccggctcg atgacctcaa ccagccgcgg aagatgcttt    124020
     ggcaaggcgc caatgttgcg ccgggaaggt cggcgcgcgt cgcgccgcaa tccagcaggt    124080
     tgcgccggct catcgttgag ccgccatggg cgtcacatct gtcgccagat cgccaagatc    124140
     gagcccgatc tgaccgtcca tgatcgcgct cgagcgttcc gacttcggac caaagagcat    124200
     cgcctgtgcg gtcttcagcg catcgcgcaa tttatcgatt tccaggtcgc gcgccaacac    124260
     catgccgatc agcagatcgg gatcgcgtgg gaagttttcg ccgcctggaa gcatggctaa    124320
     atctactgca aaatcccgtc atttcctagc aaatacagct gcttcagcct gctttcgtcg    124380
     gccgattcac cggccgttca atcactcgcc gccagtccat tccggccagt aacatagcca    124440
     tctgggagct gttcagacgg acaacgccgt tgacgaccgg tggccagaag aaagccccgc    124500
     tctccaagac cttgctcacc aggagcacgc cggttccatc ccaggcgatc agcttaagtc    124560
     ggtctgctcg cttggacctg aagacgaaga tgtcgccgca atatggatcg gcgtggagcg    124620
     cttgggtcac caacgccacc agaccattga cccctttcct aaaatcaatg ggctgggcgg    124680
     cgaccacgat cttcaattca ggcccaaagg cgatcacgcg ccggttctca aggccgcaaa    124740
     caccacgcgc agcgtcgcgg cgtccaccgc gctggtcacc cagatcctgg cgccggccag    124800
     ctcaatctcg atccgccctt cggagcgcgc gaccggcgcc acctcatcgc tggcgagcct    124860
     gacgggcaca aacatcggct cggctggcgc gccatgctgc cggaccttgc gtcgccagtg    124920
     atgcaggagg cccaggctta cgtcgtagcg ccgagccacg tcggacacgc gtgcgccagg    124980
     ctcaaagctt tccgccgtga tcagcgcctt gtcctgtgcc gaccagcttt tgcggcggta    125040
     gaccccgctg atcacctcga cccggccccg tccaccagga ggtccgccag atcgatgatc    125100
     aggatgatgc tgatgatcgt cctgatcact ccttgcgccg ccggtgtccc gagaccctcg    125160
     ccaagttgtc gatccagcct gcgcattcca gcgatcatgg gcgcccattc cacgcgatgg    125220
     tgggcgccga ttccacgtga tcgtgggcgg tctggaggct gaccgacggc ggctatggag    125280
     tcaggggttg aggccggcgt caaggtcgcg gcgagcggtg atcctgcgca tgctttctcc    125340
     ggtcatgttg aggcggtgtg cgttatggac gaggcgatca agaatggcgt cggccagggt    125400
     gggatcgccg atcacctcgt gccactgatc ggccgggatc tggctggtga cgatggtgga    125460
     tcctcgcccg tttcggtcct caaggatctc cagcagatcg atgcgctggc tctggccgag    125520
     caccgacagt ccccagtcat cgaggataag caggtcgatg cggccaaggg ttttgagcag    125580
     gcgaccgtga cgtccgtcgc cgcgggccag cgccagggcc tcgaagaggc gcgggaccct    125640
     ttgatagaag accgatcggc catcgcgaca ggccttgtgg ccaagcgcac aggccagcca    125700
     gctcttaccc acgccggtgg ggccggtgat gaggcagttc tggcgtcggt cgatccagtc    125760
     gccggcgacc aacctggcca ggagcgtgcg atccaggccg cgaggcgtgc gcaggtcgat    125820
     gtcctccaca caggcgtcct ggcgaagggc ggcaaacttg agccgggcgc tcatgcgttt    125880
     ggtgtcgcgc tcggcggcct cgcgatcagc catgatcccg acccgctcct caaaggatag    125940
     ggcggcgagg tcgggggaag atcgctgttc ctcgaaggcc ttggccattc cggccaagcc    126000
     caggccgatc aggcgatcat gggtggggtg tgcgagcatg ggatctccag aagctggggt    126060
     cagtggaagt aggcccggcc acggatgttg ccgtggctga ggggttgagg atcgggctcg    126120
     ggctccagga aggcgcgatc cagtccggtc ttgaggatcg agcggatgga actgacggag    126180
     cgcgccttga tctgatcgcc gcgctggcag gccgcttcca gacgcgctgg gccgtaggtc    126240
     ttctccagag ccagtatccc cagacaggtg cggaagccct gctcgggatg gggcctgtcg    126300
     gtcatgatgg cctgggacag ggcggcggtg gccgggccga tcttctcggc cgcggccagg    126360
     atcctggctg gcgtccaggc ggcatggcgc cggttgcgca gacgcgccaa cacccagcgc    126420
     tcgaccagca gcaccgattg ttcgaccttg gccttgtccc gtggcttgta gggccgggcc    126480
     ggcatgaccg tggtcccgta atggcgggcc atgtcctgat aggtgcggtt gatcccgggt    126540
     tcgtagcggt cgggcttggt cacccccgat ttgaggttgt cgcagacgat gatcgccgtc    126600
     acgccgccga agaaggcgaa catgccaaca tggcagccga tccagtcggc gagcccctcg    126660
     ctgggtcggg cctcgcaata gacgtaactg gaggccccca gtgcggcgac gaacagcttc    126720
     atggcctggg cgacgccggt cagcgggtcg atgacatcga tggtgtcgcc ggcgaagtcg    126780
     acgaacacct tctccccggc ggcatggttc tggcgcatgg tcggcgacac ccggcgcttc    126840
     caggcgtcgt aatgttggca gaaccaggca tagccatagc cgtcgggatg atcggcccgg    126900
     tactcttgcc agagcaggga ccgcgtcaca ccggggcggc gaagctcctg atcgacctgg    126960
     gcccagttgg gctcgcaacg tggaacaacc gacggcgctg gcgggcctgg gaacagccgc    127020
     cgctccaggg ctgtgtcggt catgtcgtct ggcagcggcc agctcagtcc cgccacttgg    127080
     gcccgctgca ggtaatcgcc aaccgacccc ttgctgatcc ccagcgaggt cgcgatcaac    127140
     cggctgctca ggccgttctc gaacttcaat ctcagtaagt cgcgtatgcg gcgcatcgac    127200
     aatctctcgg tcggcatcag gtcccctcgc tcgataaaac gagggtctcc ctagcccggt    127260
     cagactgtcg gtcgaggctc catcacccct tcagcagagg cgcccacgat gccgtggaat    127320
     cggtgcccac cttcccgtgg aaatcgtgcc catcatcccg tggaattcgc gcccatgatc    127380
     gcgtggaata cgcatccagc ctcgcccaac tcaatcctcc ccgacaacca tcaggcaggg    127440
     ttatcgcccg tcatgcgacg cagcggtatg tggggtgctc gcgccggcta ccatacatct    127500
     gacgtttgac gagctttagc ttggtgatct ggccctcggt ttgtccgttc gaccagcccg    127560
     aggtgatggc ggcgcgaacg gcgctgatgt cccgatcgac gccgtttgcg aacgacgcca    127620
     caaggctggc ccggccgcgc tcgatccagg cgcaaaggtc gccctcggtt ttgcggcgga    127680
     tcatcacgtg gaaggccgct atgatctcgc gagcttcgat cagcgctggc acgccagttt    127740
     caacggcggc gacggtgacc gtctcggcct tggagagcgt gtcgcgcgat gtggtcatca    127800
     gtctgctgat ggtacgcgct gaagggatgt ggctcagggt gtcggcgttg acctggtcag    127860
     cgcgccggcg tcgggtggcc cactccgtca ccacgcgaag tgatcctcgg aagccctgtg    127920
     ccctaagctg ccgccaaagc tcggcgccgt tgcgacgtcc ggccgaccat tgggcatcga    127980
     gccacggcag atagccttcc agcgagctct cgcgcagccg gaacacgtcg ctgcgttggc    128040
     cgcgaaggat ctgccgcacc aagccacgac tatggccggt gcggcggacg atttccttga    128100
     tcgcaacgcc gttcttggcc aaggccaaga ccgcggcgtt ggcttcctcg cgtctgagtg    128160
     tggcgcgaca atctggatga gaggcgtgtt gtcagtcgca gcgggataat gattgtcgcg    128220
     gcgcgacacg agcgcaagcc ctttaatgcg ccggagcgac gatcaggctg aggtcttgat    128280
     tgtcgcgcgg atgagcggtc gtcctggccc gcgctttcgc tcgatggcgg ttcgccggcg    128340
     gtagctctcg acattcatct cgaagatggt ggcgtggtgg acgaggcggt cgaccgcggc    128400
     gagggtcatg gcctggtcgg ggaagatccg cccccattcg ccgaagggct ggttggcggt    128460
     gatcagcagg gatcggcgct cgtagcgggc gctgatgagc tcgaacagga cgctggtttc    128520
     ggcctgatcc ttggtgacgt aggccaggtc gtcgaggatc agcagatggt atttgtcgag    128580
     cttggcgatg gccgcttcga gctgcaggtc ccggcgggcg gtctggagcc gctggaccag    128640
     atcggtcgtg cgggtgaaga acacgcgcca gccgttttcc acgagcgcca ggccaagggc    128700
     cgccgccaga tgcgacttgc cgccgcccgg cgggccgaac atcagcagat tggcgccgtt    128760
     gtcgagccag ctgtcgccgg cggcgagcgc catgacctgg gccttgctga ccgttggcac    128820
     ggcgtcgaag tcgaagccgt cgagggtctt gccgggcggc agtcgggctt cgtcgagatg    128880
     gcgctggatg cgccggctgg cacgctcggc cagctcgtgc tcggtgagcg cggccaggaa    128940
     gcgcgccgcc ggccatcctt ccttgtcggc gcgcacggcg aagtcgggcc agatggtctt    129000
     gatggccggc agccgcagct cgttgagcgc caaggtcagc cggccggcgt cgatgggatc    129060
     ggcgggcttc atgcggccac tcccgtgaac acggtggcca gctcgtcgta gagactgagc    129120
     gaggtgtagg agacgatgat ctcgggcagg gccgcgatgt cgggcatgaa cagcgcccgc    129180
     aggaccttca tgtccggcaa gcgtccaccg tcgagatcca gcgtgatgcg ctcggcaagc    129240
     tcgccttcgc aggcgcggtc gtgggccagg gccagggcca ggagatcgac catgttgcgg    129300
     caggcggtgc gggcgggaag cttggcgacc atggcttcga acgctcggct gtaggcttgg    129360
     cgggggaaca gcttgtcgcg gtagaccaac cccaggagcg ccatgggttt gcgcttgagg    129420
     gaatggatca cgtgccggta gtcgacgacg tggccatgct tgccattggg gcgggcgcgg    129480
     ccgcgcggca tggtcatctg gaggctggcg ccgagataga cgtcgaggcg atcgtcatag    129540
     aggcgcacgc gcagccggtg accgatcagg cgcgacggcg tgctgtagag ctctacggcc    129600
     cggccatctg gcccatagac gtagcgatag atggtctcgt ggtaggcgta ggcggagttg    129660
     gcgggtcgcc ttgagatgac ccgcgatctg ttctggcgac taactaggtc tctcgcagac    129720
     gctccgtgac gaagcgggcc agttctggat catgatgcag cttgccgaca cgcctgcgtc    129780
     gcgatgaggc gcgctcgtcg gcggcgatgg cgaagtagcc gcgcagccac gggccgtcat    129840
     cgaaccaatt gcgccggatc tcgcgatgga tacccctcgg taagaaaggc tgtgtgcgcg    129900
     acattcagta tcgcttccct gcgcgtggcg tgccgatcgc tctccgatgg atcgctgttg    129960
     gaagccatag tatcactcgt ccgggccagc ctgccgaccg ccgcgggacc aaccgccgcc    130020
     aagcgcttgg taaagagtga gggagttgct gagctgggct tcctgcaact gcacaaccgc    130080
     aagttcggcg cttagcaggc cccgttgcgc gtctagttgc tcaaggtatg acgcgtagcc    130140
     tgcgcgatag cgactggtcg cgtgatgcag cgcttcgcgc agggcgacgc gttggcgttc    130200
     agccgccgta cgctgctcgg tgagatcgct gacgccttcc agtgcgtttt cagcttcgga    130260
     gaaggcattg agaaccgtgt ggcggtaggc ataggcgctg gcgtcgcggc gggcttccgc    130320
     ccctgcaacc tgactggaga gtcgaccggc gtcaaagatc gtcgcgaggg cgcttccacc    130380
     tacactccaa acgcttaccg gatccagatg ctgaacgaag agctcgccca ccgagcctgt    130440
     cagacgcact tgcggcagaa gagccgcctt cgaagcggca agcgcggcgt ctgccgcacg    130500
     gacctgggct tctgcctgac tgatgtcagg tctacgttgc agcagttcgg acggcaggcc    130560
     cggcgcgacg gtcggcaagg tgaggctcga aatggctccc cggggaacag gtccggggag    130620
     cccccccagc agcaggcgca gaccattctc ttgacgctcg acggccaaca caagcgccgg    130680
     gacgcgctgg gccgcccctt ctcgctcgga tcgggcttgg gtcagttcga gacgggaagt    130740
     aacaccgttg tcggcgcgac gcgtagccag tctcaaggct tcatcccgcg aagcgagcgt    130800
     ctcgcgagcg atctgaagtt gggcgtcgag cgacgccaaa ccgatatacc cacgagcggt    130860
     tgctccggcg atggagaggg cgacagcagc cctgccatat tggctggcct gaagcaaagc    130920
     ccgggcgctt gcatcggctt ggcgcaatcg gcgccagagg tcgacttcgt aggcgatttg    130980
     caattgcggc tgggccgtcg cagaatcgct cgctcggccg aggctgttca acgcctgcgc    131040
     gtcctgaacc gccacggaag cggtaagggt tggcacgagc gccgagtggg cctggacgaa    131100
     aagcgcgtcc gcctctcgca cccgcgtttc ggccgccgcg atgtcgaggt tgtgcaagag    131160
     ggctgcttcg acagcgtggc gaagctccgg gtccccgaag gcgtcccacc atgtcgggct    131220
     gacggcaggc tgccccccgg ccgctggcgc gcgccaagcg atgggcgcgg tcacgcgggc    131280
     ggcgggcggg gctggggtga tccccacggc gcacccctga acagcgaggc cgcagagcac    131340
     tatggaaaac agccggcgca tcatcaccgc tcacccggtg tgtcgacgta ggcgaccacg    131400
     gacatgcccg ggcggattcg ttctaggccc tgctggccgg ggtcgagagc gatgcggacg    131460
     ggtagacgct gagcgatttt ggtgaagttg ccagtggcgt tctgcgccgg gagaactgcg    131520
     aactccgaac ccgtcgcagg cgaaatctgc tctatgcggc ccgcaaggtg ccgatcgccg    131580
     agtgcgtcaa cgctcacatg gactttctgg ccgacggcca tgcgactggt ctgacgctct    131640
     ttgaagttgg cgatcaccca gtatgatggg ggcactaggg acacgagctg agagccggcg    131700
     gtcacgtact gcccaagccg ggctcccact tggccaagct gcccgttttc tgtgaccgtg    131760
     atgacagtat ttgagagatc gatctccgct agccgaacag cggcgcgcgc accctcaacc    131820
     gccgcaacga gcgcctcacg attgacgcca accgcgacga cgtcctgttc ggccacgtcc    131880
     cgtcccgccg cggcttgacg gacggtcgcc tcggccgcgc ggaggcccgc taacgattga    131940
     tcgcgctcgc gcagtgagac cgaaccatca agtgcgagtt cgctgacacg cgccatatcg    132000
     gcctgggccc tcaccaactg ggcctcggcg gagccgacct ccgccacgcg ggcaccgagt    132060
     gtcgctcggc gggacgcgcc ggtttgggtg gcgttatcca agtccgcttg gcgggcagcc    132120
     aaagtcgcct ttgcctgatc gagccgctgc cgatagatgc gatcatcgac gcgaaacagg    132180
     gcctgccccg cctcgacatt gtcgaagtcc ttgacgcgaa cctccgccac atagccgctg    132240
     acctgtggcg acacgatggt gacgcgtccg cgaatgtagg cgttgtctgt cctctcgccc    132300
     gcgcctgaga atggcggaag tttccaagcg aaaagaatga gcaggattgc gacaagccca    132360
     aggcacacag ccacaagcgt cgggactggc gaacgcgcct tgacgggggg agcggccggc    132420
     gcaggcgtct cggtccgagg tgcgttattc gccggactca cgtcctccgg ctggggcgcg    132480
     gtgttgggat gatgcggatt gtcactgttc ggggcggaca tggctttacg gcatctgcag    132540
     gacggaggtc agactacggc gccagcggtg cggacatcgt ccggcggcgc cgttgcggaa    132600
     gcggtcgctt gtcggcgcgc ctgccacaag ctgcgcccgg tgaaggccgc agtgagcaca    132660
     agctgcgcta aagcgatcca gaagatcagg aaaaagacgt cgttgaaggc caagatgtta    132720
     gcctgttgca ggacctgttg agcgactact gaaaggccct gagtcgtccg cgccgccgga    132780
     tcggcgatgg tcgaggcgta ggccccaacg taggtctgga tcgtcatcgc cgcctgagga    132840
     ttggtcgctg tcagggcttc cgccagatat gcagcgtgat gcgctgagcg caaagtttgg    132900
     aaggtgctca ggatcgcccc ccccagcagt ccgccaagca cctgggtcaa gctaaaggtt    132960
     accacgaatg tgatgatcga cccaaagccg cggcgcatga ggtgatcgag gccctgcatg    133020
     actaccaccc ccatgaacat cgcggccgca aagctcacca gagcttggct gagaaaaagg    133080
     ttggccggat gtgtctggac ggtggcgtgc gcgtccatcc aggaaccgag ggcaataaga    133140
     gtgagtgtcg caaacgattg cgccaggacc agtttgggcg agatcatcag agagaaggcg    133200
     ccgactaggg tgccggccaa ggtcgcgacc gccacggtgg cgtagaggtg gcgcaactgc    133260
     tccggggcca tgttaagcgc ctgaagcaac ccggtggtgc cgaccggctg ctctgacagc    133320
     agcattcgga cgaatagaat agacacagca aaacgcacat aggacgcgct cgtgaaccac    133380
     catgtgtcga taagcggatt ggctcggcga tgctcatgga tccaacctat ggtgacgaga    133440
     gccacgcccg aagctgccgc aatgccgagc catgggcgct caaaccacca ttcaagtctg    133500
     ccaagactta gaacggcgac gaacagcgca aggccgctcg ccagcaggag aaaactcagg    133560
     atgtcggcag gctcaaaggc atggatacgc atgccatgcg gaatagccac aaggtgcacg    133620
     gctacgacgc tcgcaagcgc gagcgccgct tcgagcgcgc cgagcgtttg ccaccccccc    133680
     agatcgatca tcatcggcga gatcacgcgc gcgatcggaa tgccaagctg ggtaataccg    133740
     atgcctatca ataggctctg aattttcatc ttcgccggca gagtctgcat ggcgtaaaag    133800
     acggtcattc cgctgagagc ggcgccggcg acgccagaaa aggcgcgcac ggcgacgccc    133860
     gttgggaagc tatgaaccaa aagctcagct actgcggcca aggcatagag gctgaggaac    133920
     accttaacga acgaactgac gccaaattgc tggcggtact tcaccagcag gaggttcatg    133980
     gcgatgtttg tcatcagata ggcgctggtc aaccaggcgc cttctacagg cgtgaggccg    134040
     agctcgccct gaatctggaa cagattgacg gtgaccagcg cggtgccaag cgaccctgtt    134100
     aggccaagca gcacggagac aagtccgaaa agaacccgcc gacgcacggg catgtcagga    134160
     gtggacggag aaccgggaat catcggcagc tcgtgcggct tccattcagg aacctcgccg    134220
     atcggttggc ctagcttagc ccgcggtgcg aaaaatggac tatgtgtcat gatggcgaag    134280
     ccagcagtcc atgaagcacg accgcgagcg cagtctgctc aagcttgcca tctgcaactg    134340
     gcgccctaac cccggcgccg atcatccgcg cgacgaggat caaggtatcg ggtgtcgtgg    134400
     tcgcgcggag ccggcccgta tcgatggccg cctgcagagg cctcttaaga agatctttta    134460
     agcgctcgcg ggacgcgcgc atctccacat ggtcgggggg cagggcgcgc caggcttccg    134520
     agagcgctgg cgagcgttcg ccgttcgtcg caacgtgggt gaggaagacc tcgatctgac    134580
     gctcgacagg gtgtggcgct agaccattca tgatccgctc aacctctgca tcgaagagcg    134640
     caaccaggag cgccgtacgg tccgcgaagt gtcggtacag ggtgccgcgg cctacccccg    134700
     aggcctcaac gatcagctct agcggagcct gcacacctac tgtcgagaaa acatgatgcg    134760
     cggccgccaa gatggcggcg cgattgcggg tgatgagttc gcctcggggg gacatgcaat    134820
     cactgatgga caatcatgtc cgctatgtaa acagctcaca cgcctgttat cgctgattct    134880
     tttgtttgac ttttcccgcg ggtcgctcgc gtgcggacac ctacgtccgc ctcgtcccgc    134940
     cacaaataat gtccgaacga agcagccagg cctgcaagct tgccgaagaa gcgaagttcc    135000
     ccagtctcga aggcatcctg cagatgctcc aggaacagcc gcctgaacag gcgcgacaga    135060
     acccggaccg gcaggaagaa gcctgggcgg caggcgaccc agcgctggtt gtcgggcgac    135120
     aggccgccgc ccggcacgac gcagtggata tgcggatgat ggtggaggtt ttggccccag    135180
     gtgtgaagca cggcgaccac gccgatctcc gcgcccagat gccgaggatc ggcggcgggc    135240
     agtctggagg ctgaccgacg gcggctacgg agtcaggggt tgaggccggc gtcaaggtcg    135300
     cggcgggcag tgatccttcg catgctttct ccggtcatgt tgaggcggtg tgcgttgtgt    135360
     acgaggcgat caagaatgcg gattccgacg atgccgccca cctattccga gatgatcgcg    135420
     cccaccattc cgagatgatg ccgcccatcc gaagggtctt cgttgtgatt tgatataggg    135480
     gctggtctgg ggttttggtc aagcctagtg gattgattcc aacgtttggt gcccacggtt    135540
     cgctgcggcg atgattttgt ctggatcggc ggtccagacg aagggctttg gatgctgatt    135600
     gtactcggcg acgaagcggt tgatggctgc ctgcagatcg acgacgccct tgaagacgcc    135660
     gcgcttgagg cggcgcttgg tgaggacggc gaagaagccc tcgacggcgt tgatccagct    135720
     ggccgaggtg ggcgtgaagt ggaacgtcca gcgcggatgt cggcccagcc atgcgatcac    135780
     cttggggtgt ttgtgggtgg cgtagttgtc gaggatggcg tggacggtct ttccggccgg    135840
     gacctcgcgc tcgacggcgt tcagaaagtg gatgaactcc tgatgccggt ggcgctgcac    135900
     gcagcggccg atgaccttgc cttccagcac gtcgaaggcg gcgaacaggg tggtcgtgcc    135960
     gtgtcgcttg taatcatggg tcatggttcc agcccgcccc ttcttcagcg gcagccccgg    136020
     ctgggtgcgg tccagcgcct gaatctgcga cttctcatcg acgctgagca ccacggcgtg    136080
     ggcgggggga tcgacataca ggccgacgat gtcgcggacc ttggcggcga acctgggatc    136140
     attggagagc ttgaaggtgc ggatgcgatg cggggccagg ccatgggcct tccagatacg    136200
     ctgcaccgag gtcaggctga cgccggcgac ccccgccatc acccggccgg tccagtgggt    136260
     ggtctcgccg ggcggttcgc ccagggtcag ggcgacgata cgctcggcga cctcgtcggc    136320
     cagcttctga acccgcgcgg ggcgggtctt gtcgcgcagc aggccatcga cgccttcatc    136380
     catgaagcgt tcctgccagc gccagacggc ggtcttgctg acccctgccg cgcgcatgat    136440
     cgccgccgtg ccaagcccgt cggccgtgca cagcacgatc ctggcgcgcc agacatgctt    136500
     ctgggggctg ttgccgtcat cgacgatcac ccgcaggcgc ttgcgatcgg tcgggctcag    136560
     gtggacggtg acgccagtac gcatccgcag actcgcacga cccaaaagac atgggaatcc    136620
     cacaatggac tcttatgtcg gcatcaatcc actaggatgg cggagcggcg cagggactcg    136680
     cccctgagtt cgaggcggtg agcgttgtgg acgaggccac ctatgccgac gccagccgaa    136740
     ggccgccgcg agccatcctg agactgccag ccccgtcatg atccccgcca tggcgccggc    136800
     cgtttcgatc ccgatcgcga accctcggcg atgaggcgga aaataatccg ccagcaggga    136860
     gtgtgcggtc ggggtgaacg acgattcccc gacggcgaca ccgatccggg acagcgccag    136920
     ctgggcgaaa ttctgggtga cggcggcgaa ggcggtcatc aggctccaaa gcgccaaggc    136980
     agccgagagg agtttgatgc ggttggtgcg gtccgacagc cagccgaggg gaatggccat    137040
     ggtcgcgtag gtgagtccga aggccgtgcc ggacaataag cccagttggg tgtcggagag    137100
     accgaactcc tccttgatgg gctgggcgag cccggaaatc tgcacgcggt cgtacaggca    137160
     aacgaaattg atcgcggtca gagaaatcaa ggccgtcacc gcgccaccct tcttcatggg    137220
     ggccttcatc ttaagatgct ccagccgctc tttggcattc tatgctcctc gcctgaacag    137280
     cggcgccagc cctctcagat cacgcctttc gcgcgcgcca aggcgatttc ctcgtcggac    137340
     aggccgatgc ctctcagaac ctcatgggtg tgctcgccaa gcccccgcga cagggtgcgg    137400
     gtcagttccg ttgtcagatt gcgcccacgc tcaagccccg agccgatggc aaggcccagg    137460
     tcccggcgcc ggccatcgag cagggcgtag agctccgcgt cacggccgag gccctgagcc    137520
     atcgtcttca tacggctttc cacggccttg cgggcctcag tgtgctccca ccccttcaat    137580
     gcgtcgcgct gggcgcccag ggtcttccag tcacccacga accggtcggc gcgcaagctg    137640
     gggtccgccc gcacccgccc ctcgtaggtc atcgccttga gcgcctggtc cagcccgccg    137700
     gggcgctcca cgccccgggc gagatcgggg ttgcgcgaca gggccgtgtg cagatcccgc    137760
     gcgccctctg ggctgatctt ggccaggtcc tgggctgcgc gcttcagagc cgcatcttgg    137820
     tgcggtagga ccgggaggcg cttgtcgtgc atccgcacaa cgtcctcgaa ggcccgcgtg    137880
     taatcccgca cgccccggac cagcgcctcc cgtcccggcc tgtccaattg gatcggcttt    137940
     ggcgcggcgc gctcggtcgc cgcagcgggc gcccgcggct tgaagttggc gaaggtcccg    138000
     cgctccggcc ccggccggag cttgaagttg gcgaacgcgc gccggtcgga agaacctggg    138060
     ccgggccgct ccaccacgat ctcggagccg atcgggaccg ccggctcggt gccccggcgc    138120
     tcggcgaacg tccggtcata ctgcctgggg tagtcgagcg tggtgtcctt ggcccgctcc    138180
     cggccgagag tgcggaccag ctggtcccgg tccttgaagt cgtcgccgcc gtaatgcacc    138240
     gccaacgtct cccgatgccg gctcatcccg acataggccg cgtggcgatc caggccctcc    138300
     gtggccagga cgtgcgcccg atcgaccgtc acgccctggc tcttgtggat cgtcgaagca    138360
     tagccgtgat cgatctgggc gtagtccttc aggtcgaacc ggacctcgcg ccgctccgcg    138420
     ccatcgaggc gcaccgtaag ggccgccccg tcgatccgct ccagcgttcc gagcgaacgt    138480
     ttttcacgcc catggaccgc tcgtttcgca ggaacatcac tcgatcgccg acggcgaacc    138540
     tgcgctcgcc gcgctcggtc gccagggcga gatcctcgcc ctggccgtcc tgggcggtgc    138600
     ggcggccgtc ggtcagcatc agggcgacct tctcgccgtc cggctcggcc accagcgacg    138660
     cggagctggc ggcgatgact tcctcacgct tgttggcgtc ggggcgcttg atgaagatgc    138720
     ccatgagcgc ttgtccggcg gcgacggact cgtcggccgt gatcagttgc tcgccgtcct    138780
     cgacaaaggc ccgccccggc aatcgcccgt tccacccggc cgtgatggcc gcgtgcatga    138840
     ccgagcggaa ggcgtagcgg ctgtagggct gcaggtagcc gaacacgatg acgctgaaga    138900
     ggcccagcag caccccgatc accacgaacg gcgcgacgat tcgggtcagc gatcggccgc    138960
     cggccagcag ggcgtcgatc tccgaactgt cgctcagcgt ggtgatgacg atgaacaggg    139020
     cgatgaagaa ggcaaccggc agggccagac ccagatagtg cggcagcagg ttggcggcca    139080
     attgcgcgac atagccgaac cgggcgttgc tgttgcctaa gaggtcgagc agccgcagta    139140
     cgcgtccagg atcagggccg cgatggtgac gcccaggcag ccgagcagag gtctggtgag    139200
     catccgcagc agtagcggtc gatcagcccg aaacagaagg tgcctgtgcg cctggtcacg    139260
     ccgcagccca gacctgcgcc ggcgatcgag ccaggccctg cgcctggtcc ggtgacagtt    139320
     cgacggcggc gccgaggtcc ggggcgccgg gccagcccgc gtcgggatgg ccacgccgtc    139380
     atgctcccgc gtcccggcgt aacgcgggat gacatggaaa tgcacgtcgg gatcgaccat    139440
     catcagcatc agatatttga tctttacata ggcgacgacc tgtctcagaa cccgttcgac    139500
     accggccacc acgggatcca ggtcggagaa ggcctgcggg ctcagcgccg agaaggcgtt    139560
     ggccgattcc ttgcaaatca gaaccaatga ccaacatgtt cgctgtttgg ggcggattaa    139620
     cactaatcaa aagtcggttt gggcgaccaa ggtgtgccga tagtcgaact tccgcgctgt    139680
     cgggttggtc atcaatccgc tttcagaggt taggtcgcgc tgcgacacac tggggacggc    139740
     gcgttttcga tgaaagctcc aaccgcgatc cttacgacga tcctgggtct tctggccctg    139800
     agcctttccg cagtgcccgc cctggccgat gccggttgcg aaggcgccga cagcgccacc    139860
     agcctgaccg tgcaggtcag cggcatgacc tccgcccgcg gcgagattgc catcaccgtc    139920
     tatggatccg attccaagaa attcctcgcg cccaagggca agctgctacg cgtgcgcccc    139980
     aagaccgtcg ccccgacgac ccacgcctgc ttcaacctgc cgggccccgg gacctacgcg    140040
     gtggcggtct atcatgacgc caacgctaat gaggatttcg accgcagcgt gctgggcatg    140100
     cccgccgagg gttttggctt ctccaacgac gccccgaccc ggttcggcct cccggcgttc    140160
     gaggcggtgc gtttttcagt cgagacgggc ctcaacctga tccctatcaa gctgcgctac    140220
     ctcaaataga tcattggctg tagcgtgcca cagcgccgcc ggatgccggc gctcgccccg    140280
     cgccggggcg gacaaatgcc caggacttga atcgacgcgc ggtgcgggcc gggaaccgcg    140340
     ccggccgagc tcgcgccgcc ctcgcgcgtc agcaaggcgc gaaacgggcg tggtcggcga    140400
     cgcctacggg cgcgtcgaga ttgccggagc tgaccgtgaa ccgcgcggcg cgccacctcg    140460
     acgagcgcgg cgatattggt cagatcgccg gtgatggcga tgtgtccggt cgcccgtcgc    140520
     gtgcacattg gcgatctggg ccgatagcat cgtcggatcg tgcttatggt gtttgccggg    140580
     ccaggcgatg cggctaagcg tcctcgctat aagatatcga gccatccaca cgcgccgtcg    140640
     ggtatcggca ggtggggatc tgacaggcgc ggcaggcgaa ggtaaggcag agagagcggt    140700
     ttcccattct ggtcagaaga ggtcgaaacc gtgtatcaat gggcgcggcg ttcaagggga    140760
     tagtcgcata ttgacccgcc aaaacgtgat ccatgaccat gcaggcccga ccggcgcgat    140820
     cgccggcgac gagtcggtgc gtctctgggg catgacctcg gtgcagcggc tagagcgtat    140880
     cttcgcccgc gtcgggttga gaaccggcac gttcgggcgg tccgtagtga tcgtcaacgc    140940
     cggctgggta ttcgaccaat cgttgatcgg cgccctggcg gggaaactca acaccttgct    141000
     ggtcgatgac ggcggaagaa gcgtcgccct gcacgtgccc gttgtccggg cggcggcggc    141060
     catcgaggcg ttcgatgccg ttcggccgcc ggccttgacc gcactgactg tcctcaacgc    141120
     ccaggagctg ggaggcaact gggaccgcgc cgggcgcagg cgcgacccgc cggtgctgga    141180
     gcgacttaac gccgcccacg tcggcgccat tgaaaagcgc ctgttcgagg gcagttacaa    141240
     aggtgtcact gatctggtca ccaagtacga ctggcccacg ccggcccgcg ttgtgacgcg    141300
     ctggtgcgcc ccggcgaaga tcacgcccaa ccaggtaatc tttcgccggg ctgctgctga    141360
     ccctcgccgc cttgtggctg ttctggcgcg gccagttcgg gctggggctc gtgtcggcct    141420
     ggatgatgac cttcctcgac accgtcgacg gcaagctggc gcgcgtcacc ctgacgtcgt    141480
     cgccgatcgg catcgcgttc gaccacggca tcgacctgat ccacccgccg ttccggtggt    141540
     gggcgtggct ggtcggcgtc ggggcgctgg gcctcgcggt gtcgcatgcc ggtctgctgc    141600
     tggccgttat cggcggcggc tatgtgctgc aacgggtcga ggagggcatc ttcctgggcc    141660
     ttttcaaggt cgaggtgcac gcctggcggt cattcgacag cttcttccgg ctgatcaccg    141720
     cccgccgcaa tcccaaccta atcctactca ccctgagcgc cctggccggc cgcccctccg    141780
     gcgagcatcc cgacgtgcgg tggaacgaaa ccgacagcat ggaggacctc agccgccacc    141840
     tagccgcgtt cgcggacgcc ggggtccacc tgctgatcgt cgacggcggc gacggcacgg    141900
     tgcgtgacgt gatcagccgg aagaagctgt tcggaaggcc gcgctacggg ctgcgcttcc    141960
     tcgacatcga cgcgctgccg cgccggttgc tgcgcgcctt aactgtgctg ttgaacggcc    142020
     gccacaccaa gcgcctgcgt gcggtcggct atcggcgcgg cgacgcggcc agcctgcgca    142080
     tcgagacgca ggagccgttt gtcctcgatg gcgaggtatt ccgcacgggc ggcgcggtga    142140
     cgctgcgcgc cggcgcgcag ctggggttcg gatgaccacc gtgctcgacc tagtcggggc    142200
     ggaactggac gcgccggtgc cgccggccgc gacagccttc gcgcacgtgc tgacgcagcg    142260
     gttcgaggcc ccggctgcgg tgctgttcta cggctcgatc ctgcgcaccg gcgatctgga    142320
     cggcgtgctg gatttctacg tgctgacgca caaaccgccg cgcggagccc gcggcgtggc    142380
     cagccggctc ttgtggcccg acgtcggcta ttacgagatc gagcacgagg gtcgcactct    142440
     gcgcgccaag gtcgcggcca tgacgctggc gcagttttcc cgcgccgtga ccggcgccgg    142500
     cgccgacacc acgatctgga cccggttcgt gcagcccagc gccctgctct ggagcgacag    142560
     ccccgccacg acgcagacgg tgcgtcaagc catcgccacg gcgtcggtca ccgccgcgcg    142620
     attcgcggcc gcgctagggc ctgcgcaggg ggcgtcggcc gactactgga ccgccctgtt    142680
     ccggcagacc tatgcggcgg agtttcgggt cgagaagggt gggcgcgagc agtcgatcct    142740
     ggccgtcgat cccgcgcgct gggatgcgct gctggccacg gcctggcgtg aggcgggcct    142800
     tggcgacgtc tcggccaatg gaaccgccgc gcccgcactg gatgcgcgcg aacaacggcg    142860
     cgtcaacgcc gcctggacgc gccggcggcg tctgggcaag ccgttgaaca tcgcgcgtct    142920
     gctcaaggcg accttcacgt tcgaaggcgc ggcgcgttac ggggcgtgga agatcgagcg    142980
     ccatacaggc gtggccgtgc cgcttactcc atggcgcgag cggcatccga tcctggcggc    143040
     gccgggggta ctgtggcggc tgcggaaagc ccgcaggcag agctagccgc aggccgaggc    143100
     tcgttgcttg ggcgcttcga tgacgtcgag ctgggcaccg acctgggcga aggcttccag    143160
     cacgcggtcg atctgcgctt cgctatgcgc ggcgctgacg ctggtgcgca gcagcggccg    143220
     gctgtccggc gtggcgggcg gcagggcgag gttcagatag acgccgttgg ccagcagcat    143280
     gttccacatg gcgatggcgc gttcctggtc cggcatgacc acggccacga tcgggctggc    143340
     ggccggtccc gtcacgaagc cgagtgcgct gaggccctcg tacaggcggc gggcgttggc    143400
     cataagctta tggcgcagct gcggttgctc ttccaggcgg cgcagggccg tcacggtcga    143460
     gctgaccacg gccggcggca gggaggcggt gaacatgtag ggccggcaga tgacgcgcat    143520
     gacgtcgaag tcatccatgt cggagacaca gaagccgccg atggccccca ggctcttgga    143580
     gaaggtgccg acgatgaagt ccacatcggc ctcgacgccc tcgagctcgg ccaggccgcg    143640
     cccggtctcg cccagcacgc ccatggaatg ggcctcgtcg acgagcagat agccgcccat    143700
     ctcgcgcttg atagcggcga tttccttgag cggcgcggtg tcgcccatca tcgaataaat    143760
     gccttcgacg acgatcaggc gctcgcccgg gacgtctttc agacggcgca ggcgcttgta    143820
     gaggtcttcg ggatcgttgt ggcggaagcg gatgacctcg gcgtggccga ggcgcgcgcc    143880
     gtcatagatc gaggcatggc tgtcggcatc gaggatcagg tggtcgccgc ggccgacgag    143940
     ggtcgacagc acgcccagat tggcctggta accggtggtg aacaccatgg tgctcttgcg    144000
     gccgtagaac ttggccaggg attcctcgag ctcgacatgc gcctcgaagc tgccgtttgc    144060
     gatgcgcgag ccggtggtgc cggtgccgcg ctcctgcacc gacttgaccg aggaggcgat    144120
     ggcctctggg tcgaaggtta ggcccagata gttgttcgtg cccagcagaa tgaccgaaag    144180
     cccgtcgatc gtgccttccg tcggcgaaac gaccgagtcg aaccgcacgt tgaacgggtc    144240
     agcacccgcc tgccgaatag cttgataagc ctcgcgatag gcgaggtgtt tatcgaacag    144300
     tcccatagtc acgccctgtt ccgaagatcg gtgaccaggt tcgacaggtc cccgccggtc    144360
     tcaaccgaag cgagacggtc cagcgggatc gagatgtcga agtggccttc cagttccaac    144420
     atgatgttca tcaaggccag cgagtccacg gctaagtcac gaccgatatg ggtgtcgtcc    144480
     gtcacttcga cagcgcgtcc caacacccgg ctggcggcca ggcctatttc gtgcaaggtc    144540
     agatcagtca cgacgtccat gcccaacgcg gcccccaaag ccgtacacag tcgaaattta    144600
     acaagaatgc cgtgcgtttg tcgtcacacc ggcacctgta gatcgtttgc tcattaacca    144660
     accattgccg cgaatgccac tcgatgttcg ccgtaaagag tagagatatg acgtgatggt    144720
     gtggacgatc tcacccctac agggttttct ggtgtgatcg tcacttggga cgtcatgtgt    144780
     ggacgacctc aagaacgcaa ggtgttttag acgttcggcg ctcggtcgag tgcagtcatg    144840
     tgttcggcct gttgatgcaa ctggccctgc tggccctgat gaagtccgcg gctcagctcc    144900
     ctaatcacgt caacgcgctc gaagcgctct gaccccctgg gttttgccgg tccccggctg    144960
     cggccggttc gtcatcacgt ctcaccactc tcgcgtccac gaaggcgatc ctactttgac    145020
     cgccgccgat ctcttatgcc ggcgcgggca cataactctc ctgccgagcc atccgtatga    145080
     cggcggtagc gcccacgacg agtaagcgcc tgagatagcc atcgcccatc ttgctgatgc    145140
     cgcccaagcg ctctttgccg ccgctgctgt tggcgcgcgg ggtcaggccg agccaagcgg    145200
     cgaactggcg cccagagcgg aacagcgtgt gatcgggggc gctgagggcg tatttgattg    145260
     gctcctcgtc gatgacgtcg ggatcatagt catccagcca ttcggcggct tgggcatggt    145320
     ttgggtgatc cgggtcgcct cgggcttcga gcatttcata gaagccgggg acgccgccgc    145380
     agtcctcggg cggtccactc ccttcgccgc cgatatagcg cgggtaggcg gtttgggggt    145440
     cgccgacgcg aacatcggtg acggtgatcc gatgctccca gttgtcgccg aagtcgttga    145500
     cgtagtcgat gacggtggtc ttgggttcga ggacgtcgcg cagtcggacc ttggcggcct    145560
     ccttgcgcgg ggtggtcccc cagtcctcat ccatgggcag gccgtatctt cgcttgccga    145620
     tggtgaactc ccacaggtga tagtcgaacc agccgatggt ctgctggatg atgtcgtgca    145680
     ggaccttgag cgtgatggag gtcggtgcct cgacctggcg ccagatcacc gggtcggggg    145740
     actgtcagga attttgtgtg aggggcgggc gattgaacat gtttaggcag cggctcgatt    145800
     gaagcgctgc ccgaagagga cggcgaactg agccttggcc atgtgccact cacgagctgg    145860
     catggtccat tctttctcgg atcggttcaa gaccaggaac agcagcttga gagcggcctc    145920
     gtcggtcggg aagtggcccc tggcccggac ggcgcggcga agctttgagt tgagggcctc    145980
     gatggcgttg gtggtgtaga tcaggcgccg aacgtcatgc gggaaggcga agaacggaat    146040
     gacctcgttc caggcccgcc gccaggacag gccgatggcg ggatatttcc gcccccaatc    146100
     gccggcctcg aaggcgtcca gcgccgcctg ggccgcgacc gcgtccacgg cccggtagat    146160
     tcccggtgtc cttcagttcg atacgcaggg tggcgatctc acccaggctg tcggcggcgg    146220
     gcgtggtctt ggcggggctc atgccgccag tctgccagcc tgggctcgcc agttccaggg    146280
     caacagatcg tcaagccgct gggcgggatg ggcggcgatg cgggcgatgt cggcgagctc    146340
     ctaccctgga actggaagac cctgcgccag gaggccctgg ccgcagaggc ggcatgacga    146400
     cgcaacgcaa caaggtctac gccgtaaccg tcatcaccgc cgtcgcccag caactcgggc    146460
     tcggcgagga cagcatcaag gcgttcaccg acgaaggcgt cgaggagctc caagccctgc    146520
     tcgaagccta caggcaggat ccgaacctgt tccgctgaac cgccactgcc tgcggcctac    146580
     gctggatggt tacgatccgc tggaccatgc gcagggcgat cggcgagatc accatcggcg    146640
     tcgcgccgcg cgccttgcgg cgcgcattct gctccaggtc ggccaacacg aagaacggcc    146700
     ggcgcgcatg ggcccaacag gccgcgtcaa ggaggggccc cggtgttcgc cccggctcat    146760
     agagcttgcc atagccgcca taggcgtcgg cctggaacag gccggcatag ccagacagat    146820
     gtttccgcgg atgctcgccg ctgcgatcgc gcgagtagta gaagaccgcg cccggcggcg    146880
     ccgatcccga tcaagcaggg cgaaagtcca gcgaagaagg gcagcacctg gccgcgacga    146940
     agctgtttgc ggacgacaaa acttccattg gccgcgacgc cgtgaacttg aaatagtgtc    147000
     ttcgccagat ctaatccgac gactgcaatc ccttccatga tccgctccta gacgtgacgt    147060
     cccaagtgac gatcacacca gaagaccctg taggggtgag gtcatccacg tcatcacgtc    147120
     atcacgtcag cacccaagcg caatcgtaag gtccagcgca tcatcgacgg ccacatctac    147180
     gccctgcgca atctggtcga acggtgcttc tcaaagctct agcacagtcg cagactggcc    147240
     acccgatacg acaagatcgc cgacagctac atcggcttca tcctcgtcgc atctgccaga    147300
     ctttggttcc ggcacttcgt caacagaacc tagagcgcgg atggtgaaag atcggcaggt    147360
     ttaatgtaaa attccaatcc tctccgattc cattagcgcc tgaattctat tcttgacttt    147420
     caatttagcg aatagattgc ggatgtgcca ttttacggtg tcctcactta tgcgatgctt    147480
     gatcgcgata tcacgatttg agagcccttc tcttatccgt tgaagcattg ccagttcttt    147540
     tctcgtgagc acaacggaag tctcgcttct cagcgatcgg atgagatggt caacgggcgc    147600
     ggggcgacgc cccaattctt cctcactcgg aatgaggttc agcagcggcg tcgagatgga    147660
     tccaagcgct tccagatgcc accgttcatc gaggagtgtg cgataacacc caaatcgcga    147720
     agcaatatcg atcgcgtcgg ctacacgttg ttcagagagg gccaattttc ctgtccccgc    147780
     aaaagcaacg gcgttgcaga gtaacgccgc aacctccaaa ctgccaagtc ctagtcggcg    147840
     cgcatggtct agagcgacgt ttgcaaagcg gttggaaagg tgaaatttcc cttgtcgcgc    147900
     cgcaatacgc gcttcggtca gcgattgacg tgcgcggaga taaggcccgt gagtcgtgaa    147960
     aaagatagag tggctgcggc tcggcaaaat ggaggtcgcc tgctcaacgc tctctgcaat    148020
     gaacatgtcc gcgagcgtca atcgcgcaag gacctcaagc cggaagaggc cagattctcc    148080
     cgctatgacg cgcagttctt gaagaagctc ggcagcacgc aatggattgc cactgcggcg    148140
     ggcaattgct gcagcagtgc gataggccga aaatgtaaga tcgacgacgc catgctgccg    148200
     cacaaaatca agactttcat cgacgcgtga ctctatgtcg tcaagttgat tggcctcata    148260
     ttgaatttca agtgccagcg tgtttaaaag attcacggaa aatggggtca gtttgatttg    148320
     agcattattg tcgtctcgag ctttttggat taatgcggtg cctgcacgca tatctcccct    148380
     tgagagctcg gcgagaacca tagcgctgtg aagccagccc agcgcgtagc ggtgagcggc    148440
     gatgttgttt accgatgacg ctaccaagaa caacgccctt aggtcatcaa atcggtgctc    148500
     gctggacgca atgaagcaaa gacatgtgag cacagcgcct ttactgacga gatccgcctc    148560
     gtcatagatt ttcatccagg cttcgcactg acgccgactt tccgacagat tgtcgcgggt    148620
     agcttcgccg atagctgcta taaggtcgca ccaacactct atttttcggc gtatttgttg    148680
     atcaagaccg ccaaggtcag cggcgcgcaa gtctaccaac aatccctccg cccgccggtg    148740
     gtcgtgacta aaaatctggg cccaggccag gccaagggcg attgttggag agcccgaaat    148800
     gacggcagcg gaaaagctgc cttgccaaaa ttggatttga tctatctcgc cttcccgtag    148860
     ggcaatatcc atcatgtttt cagatgcgac atcagcggcc gatccgtgct cacccgcgcg    148920
     taaggaaaga ttgatgcttt cgcgactgtt gttgttttgt ctttgccatt gggcagcgcg    148980
     ggcgagcagg ttcggcttca agccgccata ctccaccgag aatctatgct ccagaaattc    149040
     gcgaagcaac gggtggaact cataagctgt ctgtgatcgg tcgcgtggct ggaaaagcat    149100
     ccgctcggtg gagagcttgt caataaagta ggccccatcg ttccgaagga acacatggtt    149160
     gaaatattct gccgataccg atccaagaat tgatgcgcag acacaaaagc tcaaagtgtc    149220
     gtcaggcagt gagtgtagta ttgtgctacg gaaatattta tccaaatcaa tgtcgacgcc    149280
     cgtgatgtgg tcggctataa ggcggtcggt tgagcgcctt tccgatgctg cttgcattaa    149340
     aaggcagaag atttctggcc agccttcggt gcgcttccaa agcgaatgaa tttcagcttc    149400
     tgagactgct tgcctttccc ccgcgagcgt gactgctttt gcttcgtcta aagtgaaggc    149460
     gagcgcacca tgcctcagct catgggtgtc tcgtcgagct ttcatgcgcg caaagccgat    149520
     gtctgccgag cttgccgcga tgaattccac ttcggcgggc gtcgcgagca taaaggcttc    149580
     gatctggtgt atcgaatgca gatcaaattc gagatcatcg atacagataa gaaccttcga    149640
     tccgagccga tccctggtct cccagagcca agcggcgagg tcgtggaggt tgcgaaggct    149700
     ttctgtcggc ggaggtgacc tgtcttggcc gctggcctcg tgggtagcag aaatctgcgc    149760
     gcagatacgg tccgcgagga gctgcaggtc gcggcggcat tcctttacgg aaacccatgc    149820
     cgtcgcagca aaggcttggc gatgctctgc ccaatactgt gccatcgcaa cagtttttcc    149880
     gtagccctga ggggcgcgaa ggagatggca gcgtatcgat ttatccacag cgaaaaggcg    149940
     agggcgcgaa agacacctgg aggctaacga cgccactcgc tcattggtgg agcctgtggg    150000
     cggctgtgcg ctttgtcggg ggctagtgtc ggtcacacga ggccgccttt caaactcgcg    150060
     cggatgcctt gacgctggct catcgaatgc ctctcacttt cgtagatgct ttatctgttt    150120
     tacatgcgcc atgtgggcga acttagcggc gaaccgatga cgtgcaaact agtggattga    150180
     atccaacact tggtgcccgc gagcggcggc cgaggtgggc gtgaaatgga atgtccatcg    150240
     cggatggcgg cccagccagg cgatcacctt ggggtgcttg tgggtggcat agttgtcgag    150300
     gatggcgtgg acggtcttgc cggccgggac ctcgcgctcg acggcgttga gaaagcggat    150360
     gaactcctga tgccggtggc gctgcatgca gcggccgatg accttgcctt ccagaacgtc    150420
     gaaggcggcg aagagggtgg tcgtaccgtg gcgcttgtaa tcatgggtca tggtcccggc    150480
     tcgccgcttc ttcagcggca ggccgggctg ggtgcggtca agcgcctgga tctgcgattt    150540
     ctcatcgacg ctgagcacca cggcgtgggc cggcggatcg acatagaggc cgacgatgtc    150600
     gcggaccttg gcggcgaact tgggatcatt ggacagcttg aaggtgcgaa taccgtgcgg    150660
     cgccgggccg tgggcccgcc agatgcgcag gaccgaggtc aggctgacgc cggcgacctg    150720
     ggccatgacc cggccggtcc agtgggtggt ctcgccgggc ggctcgccca gggtcagggc    150780
     gacgatccga tcggccacct cgtcggccag cttgggtatc cgcggcggcc gtgtcttgtc    150840
     gcgcagcagg ccctcgacgc cctcagccat gaagcggtcc tgccagcgcc agacggccgg    150900
     cttgctgacg ccggccgtgc gcatgatctc caccgtgccc aggccatcgg ctgtggccag    150960
     cacgatctgg gcgcgccaga catgcttctg cgagttggtg cggtcatcga cgatcgcccg    151020
     caggcgcttg cgatcggttg ggctcaggtg gacggtgacg ccattactca tcccccagac    151080
     tcgcagggcc gaaaagccat gggaatccca acaagcactc ttacgtcagc atcaatccac    151140
     taggaccact ctctattgtg agctttgagc cggttggact tgtcgaccgc gggccctcac    151200
     tcgccgctcg tcggcgttcg aggacagcgt ccgtgatcag cagcgtttag tctccggcta    151260
     ccagttaggc tgcgatctcc acgatctcct tcagggggat ggccgagttg ccgagcttgc    151320
     cgaggtcgac cgacttgcga cttgcgatca attgtttgcc gaagatgaaa tcctgcggcg    151380
     agttgagcgc ctcgacgcat tggacctgat cgcccttcaa atggaagacg gcaaacctgg    151440
     cgctagcgcg ttccccgcgc agaatgacgc ggtcgacgtc gaaggcgtag ccggcaatct    151500
     gcagcttcag atcatactgg tctgaccact gccacggcac ctcacttggc ggtggcgcgc    151560
     gaccgacgat ggcgctggcg gcctgcttgg cctgctcaag cgcattgggt acgctctcca    151620
     tgcgaaacac gcggtcgaaa atgggcatcg gccggagagc cacgtcgccg atggcgaaga    151680
     tggccggatc cccggtacgg gcttccaaat cgacgatgac gccgcgagcc gtgtccagcc    151740
     cggcgtcccg cgcgatctcg tcatttgggg ttgcgccgat accgatcagg gcggcggcgc    151800
     aggcgatcgt gcggccgtcg tcgagcttga cgccgctcac gcgcccatcc tgtccctcga    151860
     acccagacac tgtcgttccc agttcgaagc taacgccccg ctcccgatga tagtcgagga    151920
     agaaggcaga tagatcctgg ccggcgacgc gggcgagcag ccgcgtctcg cgctcgatca    151980
     ccaccacctc agcgccgagc gcgcgcgcgg acgcggcgac ttccaaaccg atgtaaccgc    152040
     cgccgatgac agccagccgc tgacctgact gtatgactgc tctcagccgt tcggcgtggt    152100
     cggccgtgcg caactccagc accccagcta gatccgatcc cggaacgggc agtttgatcg    152160
     ggcgggcgcc ggtggcgatg atcaggaagt cataggtcag gacttcgcct gtcgagaaat    152220
     gaaccgcctt ggtttgacgc gtcagctttt ccgcacggac accaagtcgg atgtcaattc    152280
     cgtgtccggc gtagaactcc accggcttca aagcgagcga tgcggcgctg tgatcgcttc    152340
     gcagcccagc tttggacagg ggagggcggt ggtatggcgc catgagttcc tcgccaacca    152400
     gcgttacgct cccctcaaat ccatattggc gaagcagggc ggcagccgtt ccaccggcat    152460
     ggcccgcgcc aaggatcaac acatgctcgt ccgatcggtt catagaagcc ccctctccaa    152520
     aaccgagcgc ctcgtgtgga actcagacac cagccatggc tgcgattccg ctccagatag    152580
     ggggctcaaa ggagattgaa aaccacactt tagtggggtt gttccgcagc ctcagtgata    152640
     cctacttgct gggaccggtc agttagaacc gattttagaa cacagtgaat gtgtcttcat    152700
     taggatgagg agaacccggg atgagcagca tcgcacgaaa tccgtccgcc aataccgcgc    152760
     cagatcgcta tgtggacagg aaacgctatc tatggatgtt gtcggtcgtc tggccggcag    152820
     cgccgttgat cggcctctac ctcgtgagca tgacgggtct gggcgtgttt tacgccttta    152880
     cgctagtcgt ttggtatgtt gcgattcccg ctttggacat tttgtttggg aatgatccga    152940
     acaatcctcc tgaggcagct gtcgcgcgcc ttgaggcgga tcgatattat cgagttctca    153000
     cctatcttac cgtccccgtg cattatgcct cgctcatcgt ctcggcgtgg tgggtagcga    153060
     cccagccgat ggcctggtgg gaagttgtcg cgcttgcctt gtccctgggc atcgtcaacg    153120
     gcttggcgct gaacaccggc catgagttgg gacacaagaa ggaagccttc gaccgctgga    153180
     tggccaagat cgttctggcc gtggtcggct atggccactt cttcatcgag cacaacaaag    153240
     gccaccatcg cgacgttgcg acccccgaag atcccgctac gtccaagatg ggggagagta    153300
     tctataaatt ttcgctgcgc gagattccgg gtgccttcaa gcgggcttgg agtctggaga    153360
     gggtgcggct ggagcgccta ggcaaggggg tctggcgcct ggacaacgaa atcatcccgc    153420
     cgctgctgat caccgtagtt ctctacacat cccttttgct ggcgttcggc cccaacccca    153480
     agttgttagt gttcttgccc atccagatcg ccttcggatg gtggcagctg accagcgcca    153540
     attatatcga gcactatggg ttgcttcgcg agaaaatggc ggacgggcgt tatgagcgcg    153600
     cccagccccg gcattcctgg aacagcaatc acatcgcctc gaatctgatc ctgttccatc    153660
     ttcaaaggca ttccgatcac catgcccacc cgacccgcag ctatcagtcg ctccgtgact    153720
     ttaaagacct gccggagttg ccgagcggtt accccggcat gttcttcatg gcgatgattc    153780
     cgcccgtgtt ccggtcggtg atggaccgcc gggtcgtgga atgggcgggc ggcgatcttg    153840
     gcaagattca gatcgacggt gcgcgcagga agcagatcga acggaagttc ggtgcggctt    153900
     cgcgccagca ggcgcgggcg gcggccgagt agacgccact gctagccgag gaggctcgtt    153960
     ccgagctctc ggctagcagt ggggcgggcc gggatagcgt ccgaaaagag gatgccgggt    154020
     gatcgtatcc tcgcgagggc ttcgcctaga aattttcaaa gactcaagtc gacaaaggaa    154080
     caccatggca cggtatcagt gtcctgattg cagctacgtc tatgatgaag ttagggggga    154140
     ggcccacgag gggttcccgc ccaatacgtc gtgggcgcaa attcccgagg attgggcctg    154200
     ccccgattgt gcggtgcgcg acaaacttga tttcattcct ctgggctcgg gcgaggtcgg    154260
     agaaaaggcc gggcccctat ctagccccgg agccgaacga tgatcggggg cggccagggg    154320
     gcggaaccgt cgggggctgc cgtggaaacc gagccattcg cgaaatggca ctgcgtgacc    154380
     tgcggccaca tctacgatga ggccctcggt gatcccgatg ccggcgtcga gcccggcacc    154440
     cgttgggcgg acgtccccgc cgactggtac tgcccggact gcggcgcgac caaggaagat    154500
     tacgaacctt atgggtgatc cattcgaggg gacaaccgtc ttccgcctcg gcaatcttgc    154560
     gaaatttctg gaggagggcg gaatgaactt ttatgcaatc actgcgacca ctgaagcacc    154620
     ggttcatccc tgcggcgagg gggcgatccg atccctgttc gcgtcgcagc gccgatcagc    154680
     cttggagaac aggacgaaat tcacgctgaa ggcgcgactg gctatgttgt cgcgactaaa    154740
     ggcgacgatg aagagccggg aagacgagat tatccgagct ctctgcacgg atttcaggaa    154800
     gcctgaatcc gaggtgcgcc tgaccgaact gttcccggtc tatcaggaga tatcgcatgc    154860
     ccggcgccac ctccgatcct ggctgagacc gcaccgggtt cacgactctt tggggatgtt    154920
     cggaatcgct gcggaggtcc gctatcaggc caagggcgtc tgcctgataa tttccccgtg    154980
     gaactatccg gtcaatctca gtttcgggcc actggtgtcc gcgctggcag ccggaaacac    155040
     cgtcatcatc aagccttccg aactgacgcc ggcgacgtcc gccctggtca gggacatcgt    155100
     cgagcagacc ttcccccggg atctcgtcgc cgtctgcgaa ggcgacgccg aggtttcgca    155160
     ggccctgctg gatctaccct tcgaccacat cttcttcacg ggcagtcccc aggtcggcaa    155220
     gatcgtgatg gcggccgcag cgaaacattt aacatccgtg acgcttgaac tcgggggcaa    155280
     gtccccgacc atcgtcgatt cgaccgcgaa tatcgagcaa gccgcctgca agatcgtctg    155340
     gggcaagttc gccaataacg gccagacctg cattgctccg gatcatgtct atgttgctcg    155400
     cgaccaggcc tcggcgctgg tcgatgcgct gcggcatgag atcaggcggg tctacgggca    155460
     gacggacggc gagcagaaag ccgggccgga ctattgccgg atcgtgaacc ggcggcattt    155520
     cgatcgtctg accgccctgg ccgacgacgc cacatcgcgc ggtgcgaccc tcctggaagg    155580
     tggggcgcga gattcagacc agaactattt cgcgccgacc atactcggcg gaacgacgcc    155640
     gcagatggcg atttcccagg aagaaatatt cggtccgctt cttccgatca tcgaatatga    155700
     cgacatcagc gtcgtcatcg acgcgatcaa cgcgggccca aagccgcttg ccatgtatgt    155760
     cttcagcaac gacgccgccg cccgcgagga tatcatcctt aggacgagtt ccggtggtgt    155820
     ctgcgtcaac aacaatgtcg tccaattctt gcatccaaac ctgccgtttg gcggagtcaa    155880
     caacagcggc attggcgctg cacacggttt ctatggcttt aaagccttct cccatgaacg    155940
     tgcgattcta agagacaaat tctccgtcct gcgtcttctt ttcccgccgt acaccccgac    156000
     cgtaaagaaa ctcatcaatc taatcgtccg tcttttgggt tgatcataga aacaagagag    156060
     cggcgtcgct agctgccgtc cggagactaa aatgtttgac tatattattg ttggagcggg    156120
     gtctgccgga tgcttgttgg cggagcgctt gtcagccaat cccaggacgc gggtctgtct    156180
     gcttgaggcg ggcccgcccg accgcagccc gctgatccac atgcccattg ggatagcgct    156240
     tctgtcaaag agcaaaattc tcaattgggc attcgagacg cagccacagg ccaatctcga    156300
     tggtcgacgg ctgttttggc cgcgcggcaa aacccttggc ggatcgagtt cgatcaatgc    156360
     gatggtctat atccgcgggc accgggatga ctatgactcc tggggcgagg cagccgatcc    156420
     gatctggtcc tatgacaatg tgctcccgct gttcaaggcg atggagtcca acgagagatt    156480
     tggaaccgac gcgtttcatg gcggcgatgg tgagcttcac gtcagcgacc tgcgaacccg    156540
     caaccccttg agcgatgcct tcgtcgaggc cggacaacag gcccagtttc cgcatgccgt    156600
     cgatttcaat gggaagatgc aggacggcgt cggcctgtac caggtcaccc agcacaaagg    156660
     ccggcgctgg agttccgcgc gcgcctttct ttccaaggcc aagggccggc ccaatctacg    156720
     gatagtcacg ggcgcgcggg ctacccggat cattctggag ggccgcaaag cggtcggcgt    156780
     gacctatgcc gcaggcggca agctggtcga tgtgcgaacc aggggcggcg aggtcattct    156840
     ttcgggcggc gccgtcaatt ccccgcaact gctgctgctt tccggcatcg gcggcgcggc    156900
     cgagctgaac gcactcggca ttccggtggt cgtcgacctt ccggcagttg gaaaaaatct    156960
     gcaggatcac ctcgatatca caatcatgca tgaggcgaac gatcgtacac cgatcggcat    157020
     cgcaccgtca ttcatcccgc gggcgctgtc cggagcgcta tcctacgcct tccttcgaaa    157080
     gggtttcttg acgagcaacg tcgccgaggc gggcggcttc gtcaaaagca caccttcgcg    157140
     gagtcggccg aatctacagt ttcatttcct ccccacgctt ttgaaggacc atgggcgcga    157200
     aatggcgttc gggtatggct atacattgca tgtctgcgat cttctgccca agagccgagg    157260
     ccgcatcggg ctcacaagcc ccgacccgct cgacgatccg ctgatcgatc caaactatct    157320
     ctcggccccc gaagacattg agaccatggt cgcggcggtg aagatcggcc ggcaaattct    157380
     gtcggcgccg tcaatggcgg ccttctcgaa aaccgaactg gtccctgggc catcggtcca    157440
     gagcaaggcg gatatcatgg cggatatccg tcggcgagcg gagacgatct atcatccggt    157500
     gggaacatgc cggatgggac gagaccctca gtcggttgtc gatccgtcac tccgagtgcg    157560
     tggcgtgcaa ggccttcgcg tcgtcgacgc ctcggtcatg ccgacgctgg tcgccggaaa    157620
     caccaacgcc ccgacgatga tgattgcgga aagagctgcc gagctcattc ttgggaagac    157680
     gaaactcgca ctcagcgcca acattgaggc attccgctaa ctcgtcgcag aaataagacg    157740
     aggcttatag ccgtacagac cataaaaagc cgatccaaga atattggcgg cgcataggga    157800
     ggatcatttc atgagaaaaa atggagcata tatgtatgca aggcttgcgc aatacgccac    157860
     cgcgctcgcc gtcttgagcg tcttccccca ggctgcattg gcccagaatt cggaaggatt    157920
     caagctgtgg gccgtaagtc tgaatgcaac tagggtcttc gtggatgagg atgcgcccga    157980
     catcaccttg gctggagggc ctgttccggg ctcgaatgtg aggatcgggg atgccacgtc    158040
     ggcgaccatt gatatcggat atttcttcac gcccaatgtt gctggtaatt tgtttctcgg    158100
     cgtgccggcg accgcgcaaa ttgacggcgc tgggtcactt gagccgctcg gaactctagc    158160
     caaggtcaac tatggaccca tcatcttgtc ggcccagtac catttcaaca atcttggcaa    158220
     ggttcatccc tatctgggag tgggcgtcgg gcggatcgtc tttctgaatg agcgtgacag    158280
     agctttgctt aatttcagta tcgacgacag ttgggcgcct gcggctcagg tgggtgttcg    158340
     gtacgagctt ggcgcagaat ggatgctgaa cgctgacgtt cgatacgttc ccttctccac    158400
     gcacgctacc ggttcactgg gtggagcgcc tgtccggaca cgtttggaca tcgacccgat    158460
     cctgacgagc gccggagtga cttaccggtt ttaggttcaa tcgggcgctt ctgaacggac    158520
     gatataaata tcaaggagga atgcgagtgt tgggtttgat gatggaccgg ccgttgatga    158580
     tatcgcagct tatcgagcat gcggctgaat atcatggcga caacgagatc gtgtctaggt    158640
     cggtcgaggg cccgatccat cgtcatacct atgccgacgc ggcccggcgc tcacgccagc    158700
     tcgctaaagc gcttgaggcg ctgggcgtcg cgccgggtga cccgatagga accctggcgt    158760
     ggaacggcta tcggcatttc gagatttact ttgcggtatc cgggatcggc gccatctgcc    158820
     atacgattaa cccgcgcctc ttcccagagc agatcgctta tatcatcaac catgcaaatg    158880
     atcggttcat cttcgccgac ctgaacgtac ttgccatcct tgaagggctc gagaagagtt    158940
     tggcaggcgt gcggggagtc attgtgatga ctgatcgcgc tcacatgccg gccagcagcg    159000
     ccctacccaa tatgctgtgt tacgaggatc ttgtcgccgc tcaagacgag gcgtttgact    159060
     ggcccgagtt cgatgagaat agcgctgcgt cgctctgcta cacctccggc accacgggca    159120
     acccgaaggg cgttctttac agtcatcgtt cgaccatcct ccatgcttat gccatcaaca    159180
     gcgcgaatgc tctgggcctt acggtcgatg acgcgatact cccggtcgtg ccgatgttcc    159240
     acgccaatgc ctggggcatc ccttacgcgg ctccgatggt cggcgccaag cttgtgttac    159300
     cgggcttcaa gatggatggc gccagtctgt tcgaattatt cgatagcgag gatgtcaccg    159360
     tagcggccgg cgtgcctacg gtgtggcagg aactgttgcg cttttgcgaa gccggcggcc    159420
     gatccttagg caaactgcag cgtacgctga tcggcggctc ggcgccgccg cgcgccatga    159480
     tcgaacgttt tgacagggag catggggtgc gggtcatgca gggctggggc atgacagaga    159540
     tgagcccact gggcacgatc acctcgatgc ggcgcggcga gcgcgatcta ccggctgaga    159600
     cgcaatacga cctcatcgcc aagcagggtc gacctatctt cggtgtcagt ttgaagatcg    159660
     tcgatgacgc cggtcgcgag ttgcccaagg acggggttgc gttcggaaac ctgctggtcc    159720
     gaggtccttg ggtcgcaagg tcttaccttc atggcgagga cccttcagcg ttcaccgacg    159780
     atggctggtt tcatactggc gacgtctgca cgatcgatcc gcacgggtat atgacgatca    159840
     ccgaccgctc caaggacgtt attaaatcag gcggcgagtg gatcagttcg atcgacctgg    159900
     agaatgtcgc gatggatcat tccggggtcc aagaggctgc agtgattggc atcgtccatc    159960
     cccagtggga cgagcgaccg ctgctcgttg ttgtgagacg atctgaatcg aaggtaacgc    160020
     gcgaggaatt gctgaactcg ttcgagggga aggtcgcaaa gtggtggatt ccggatgatg    160080
     tcgtctttgt cgatagtttg cctcacaccg cgacgggaaa gttgcttaag gcaaagctgc    160140
     gggaagattt tcgtggatac aaagcgccct cgactgctgg ctgagaacgt atggctcgcc    160200
     tgtccgccaa cccttttgac agcagcaccc cagatggccg agatggtcat ggctgagagc    160260
     gcggccttca cgtgccgcgt ctccagaagc acgacctcga agccctctgc gaccagcccg    160320
     cgatgtagcc actggggcaa cggcccggcc tcgagtccga cccttccaat cgtcaagccg    160380
     gaccgacgga gacaggcgct caaaggctca ggctcgctgc tgaccttgat ctccagaacg    160440
     atcttgcctg ttgggcgctg acggcggaca ctcccgcgtt atcaagggag ggtgacatct    160500
     ctatctggca cgggggtgac attactatcc ggcggtgtgg gctctaactg aagtgcgacg    160560
     gagagcctgg gcaggatgac gggggagggg acctcctgtc acgtcagggt tagggcattg    160620
     gcagtcgggc gacgggcggg cgcggagcca tcacgtagcg cagagcccgt tcgtcgcccg    160680
     tgtcccagcc gtagccgcta tctgctcacc cagcacatcc tccggcgtgc gatatccaag    160740
     acacttgcgc gggatccgat tgagccgcgt ggtcagctcc agcagcttct ctggcgggat    160800
     caacgcgatg tccgtgtcgc tgggtaggaa gcgtcgcagg cggccattgg tgttctcgac    160860
     agtacccttt tgccaaggcg cctgtggctt gcagaagtag ctctcgatct ccagcgagcg    160920
     cttcaaggtc gcaaagaaag caaactcagt gccgcgatca aaggtaatgg attgccgcat    160980
     cggcggagga agcggctcca gacgctcggc caagccggcc atgatgcccg tcgagctgcg    161040
     gctcgggttt ttgatcatga tcagataccg gcttcgacgc tcgaccaacg tcgtgatgtt    161100
     gtgacgcccg tattcctgcc ggaaagcgat cagatcgcac tcccaatggc cgtaaccctg    161160
     gcgttcgccg atgtgggcgg ggcgctgtgc aatggtgttc tgtagcggaa tatgcaggcc    161220
     gccgcgcggc cttcgagcat agcgcgcgcg ccggcgccga cgcatcctgg ggagcagctt    161280
     gtagagctcc gcggcccggc catctgggcc gtaaacgtag cggtagatgg tctcgtggca    161340
     ggcataggct tggagctgcc gggtcgcttt gagatgaccg gcgatctgtt ctggcgacca    161400
     ggtctctcgc aagcgctgtg tgacgaagtg ggccagttca ggatcgcgat gcagcttgcc    161460
     aacacgcctg cgtcgcgacg aggcgcgctg gtcggcggcg atggcgaagt agccgcgcag    161520
     ccagggccca tcgtcaaacc aattgcgtcg gatctcgcga tggacagtcg atggatggcg    161580
     gccgaggcgc tcggagatga cccgcacagg caccttggcg tcacgccaac gacagatcag    161640
     gtggcgttct tcaagcgtga tatgatcgta gcgcgatccc atgtgaaaat ctccgtggac    161700
     gtaagtccat aaaaaccctc acaaatcgca tttcaaaata gaatccgcca aagactgaac    161760
     attggcgtct aatgaacatt atcggaaatc ccgactgaat gtcgcttgtc gatttgtcag    161820
     atttcgaaat agccgcgact ggtgcgcttg cttcggattt gaacccaaag accgcgcgac    161880
     tattcgattt tccgttcgaa ataggcgcga ctgccgtgac cgacgcatcc atccttggcg    161940
     tttcctacga ccaggcctgt gaggggctat gctcaccgcc gcttggcacg aggtggatat    162000
     cgagccggcg tccgatggcg gctgcgtagc gagctatcat ttcgaaggtc ggcatgtgac    162060
     gggcgttctc caggcgcgcg acgacagatt gggaggttcc catgcggctc gcgatttccg    162120
     cttgcgtcag gccggccgct tggcgcgcct cgatcatctc cccgacaaca gcgaagatgg    162180
     gtccgagtcg ctcatactcg gccttgacct cgggatcagt cagcagtttc tgccggagct    162240
     tcgcaagact ggtcatggct tgatctcctt tgcccgccgt tccgccaatt caagggcggc    162300
     ccgcggcgtt ttctgggtct ttttcacgaa agcatgcacc acaataaccc gacgaccgat    162360
     cgcggtgacg tagatggccc gggcgatgcc gtcacgtccg ccgaaccaca tctcccaaag    162420
     cttgtcgtgc agatgcttga catgaggctg gccgatccgt tccagaccca cggcttcgat    162480
     acgctccgcc agacgcagga acgacgcctg catgtccttt ggcagcgcgg cgatctcggt    162540
     atcgacgacg gctcccaggg tctcgacggt ccatgtcatg cggcgcccag aatcgcgtga    162600
     gccagccagc ttaggctgag cactgggcta attatagcat acttgctata atcgtcaacc    162660
     cgcgagacta tcggtcgaac aatccaggcc tctggacggt cgtatagccg atccccgaat    162720
     accctgtggc gcgtctggcc gccatacggg cgagcaccgg gacgtcgcgg tcgacgtagt    162780
     catagatgac cacttcccgc ttggggtcat gaagccggtg aagacgaccg gcatactgcg    162840
     ccaaggttcc cctccatgcg atcggcatgg tgaggaagag cgtgtccagg cgctggtcat    162900
     caaagccctc cccgaggtag cgaccggtcg ccacgatcac ccgctcgtcc tgctccggaa    162960
     tcgccgcgag gcgctccatc gcctctcgcc gtttccgctc gctttggctg ccacgtaaaa    163020
     cgataacgtt cttggcgaag cgcgaaagcc gatcggccag cgcttccaga tgatccgtcc    163080
     gctcagtgat gacgaccggt gagcgcccag cttccaacgc agccaacacg tcattgaaga    163140
     tcagttcgtt gcggccctcg tcgccggcga gcgcccgata gacgtcctgg atcggaaccg    163200
     ccgccgcgtt cgcctcgctg tctggcagcc gaaacgccgt ctgccgaatc cggacgtgat    163260
     gatcgaacgg acgtctcgcc gcctcggcgc gcgcatcgac acgttttcga accggcccgc    163320
     actgcatgaa gatgatcgga tggtggccgt ctttccgggt caccgtcgcc gatagcccaa    163380
     ggacgtagcg ggcctttgtc cgcctggcga cctgctcgaa gctaacggcc gaaagatggt    163440
     gacattcatc gacgatgagg tggccatagt cgcccacgat atcgtccacc tccccttttc    163500
     tgaccaggct ctggataagg gcgatgtcga tgaggcccga gggcttgcgt ttgccgccac    163560
     cgattttgcc gatcatccct ggcgcggtgt tgagaaacgc gccgaggcgc tccacccact    163620
     ggtccatcag ctggcgacga tggaccagaa cgagcacgtt gaccccgcgc tccgcgatca    163680
     tccgcgccgc caccacggtc ttcccgaaag ccgtcgtcgc ggcgagcacg ccgatgtcgt    163740
     gcggcagcag cgcatcgacc gccagctcct ggtccggtcg caatacgcca ctgaatgaaa    163800
     tgttgatcgc cgcgccacga cggcgctgat cctcgatttc caccgcgacg cccagcgacg    163860
     cgaacaggtc catcgccaca tcaaagcagc cccgcggcag accgatgtgg ttcacggtca    163920
     gctccgcgca cgatacgatc cgtggcttgt cgtgggtcgc aaaccgcatc gcctgggcgg    163980
     cgtagaactc aggattttga aacgccgcca gccgtatcag gcgcgcgacc aggccagacg    164040
     gcagaccact gcgcggaata tagagctggt ctgcgacgac catcgtgaga ttgctcggcc    164100
     ggggcccggc aatcgccggc ggcgttcgcc ggcgcgaggg cggggccagc cacggctcct    164160
     catcatcgtc atcgacaggg atcctgaccc caagaatccg accggctgcg ctggcggcat    164220
     caaccagggc ctccagggtg tcgcgtttga gacgccggac gccagccagg cacctccatt    164280
     ggtcgtcgta gggatcgagg tcatcgtcca ggaacacgct attgccggcc tggcgcgcca    164340
     agccctgcaa cggcagggca atgaggttgc caaagccgcc gcttgggacg gtatcctggc    164400
     tgggaaacaa gcgatcatag gacgcaaacc cgatgtcggg cgtccggtcc aaggtctcgg    164460
     tgatcagagc cgatcccaag cgtcgggcca gcgaggccga aatcggctcg ctgaagaaga    164520
     tccacgcatg ggcgccgttg ccggagcgtg atcgttcaat ggcgacaggc acatcccagg    164580
     cgcggcaggt ttcggcgaag gctttcacat cccgtcgcca ttccgcctca tcaaagtcgg    164640
     ccgccaagaa ccaacaggtg tcgtccggta gaaccgggta gacgcccgcg acgaacgcgg    164700
     cgccgcccgg gccttgcccc ctcaggtggt gggtgatcac ctggtcgctg acttcaatga    164760
     aagcctgatt tgcgcacaca gagcacttga tccgcggctt ctcgcacaga ccccgcttcc    164820
     actcgttggc gcaggccggc gcgtagccgc tcttacctgt cttcaggttt tcccaacgca    164880
     gcgggaatac gtcgcttcgc ccccgaaaca ggcttcgaaa aagttcaacc ttggcgcgat    164940
     tgtcaaaggc ttgatcctgc cgcggctgtt gcaacgccat tgccgggggg cgcgaagtct    165000
     cgcgagcggc ggccatgacc attcccgcga gttcgtcctc gatcgccgcc cgctcttgct    165060
     ccaactggcg aagacgttcc tggagccgcc gttgtcgatc ttcccgatca gacatgcaga    165120
     tcagctctcc gcagccggga tccgcccgat ggtggccttg ctgacgccca ggacgcgagc    165180
     cagatggcgg acgctttccc ccttggcgcg ttccgcagcg acgaaccgcc gctgatcgac    165240
     cgacagcttt ggtcggcggc caagttggac gccccgggcc ttagcgcggg cccggccttc    165300
     gccggtccgc gcccggatca gctctcgctc gaattccgcc aagccgccca gcaccgtcag    165360
     catcagccgg ccatgcgctg tcgtcgtgtc ggcccaaaca tcacgcaggg atcggaacaa    165420
     cgccttcttc tcggagacag cggccagaac gttaagaaga tcccgtgttg agcgggccaa    165480
     ccgatccaga cgggtgacga ccagcacgtc cccctccccc agagcagcga tcgatcgctt    165540
     gagctgggac cgatcggtcc gcgcgccaga ggccgtttcg ctgaagactt tggcgcagcc    165600
     ggcctcggtg agctcggcga cctgcgccgc gacactctgc ccgtccgtcg aaacccgcgc    165660
     gtagccgaaa atcatgcgat aattctgaga ctataatatg agacaggcaa gccgttgatg    165720
     ttgttggctc gacgaaacgt ctcacaattc acgattgatg aagcgcctcg cgggcgggcg    165780
     tcgcaatgca atcgggccag gccttgagtc gatcggcgac gaccgctcgc aaccgatcgt    165840
     cgaattcgtc gaagacgtag gcaaacgggt ctgggctgtt cgggtcgttc catcgcatga    165900
     gagttgcgaa cggatgactc cgtgcgtgcg gccgggccag cagcgtcgcc acggcggcgc    165960
     aggcattcat gcgatcgcgc ggaccttgat cggcaagcaa cgccgtgccg tgccgccggt    166020
     cggtggaacc gatggaaaac gtcgcgctac cgttccgaat ctcgtcgaac tggtgagcga    166080
     atgtggtcgt gctccctgga cgccggagta cgacctcgat cagcgcagtc gcactggcga    166140
     ggaaggttgc gggtgtgcga ggtagccatt cggaaccggg cggttgtccg ctcagcgccc    166200
     ttatgaccgc atcttcgaac gccagggtga attcagcggg tcggccggcg aggcgggttg    166260
     cgccgatgct gatacgcgag ccttcatggg cgaagcgcac ggtgccgtcc tgcaagatga    166320
     gtccgtagcc gtcgaggccg gccaagcgga cccggtgctc gggacagctg acgcgccaca    166380
     agccggcgct cgacgccgag acgaagtgat cgccacgttt gtcagcggcg tcacggcaac    166440
     aagctgggca agccgcgcca cggatgaaag caggccggct cagcaccagc ggagccccga    166500
     tcgtcgccag gtccggtgcg aagaaacggc gcagctcatt cgcatccagg cgcgtggcct    166560
     ccgacaactg gtcgaaaagg ccgtgagatg gagcaaggtc ttgaggatcg tcgcagccga    166620
     gcccggacca gaagtcagcc tgcgtattcc acgcgatcgt gggcgcggat tccacggcat    166680
     catgggcacg gattccacgg gatcgtgggc gcctcttctg aaggggtgat ggagcctcga    166740
     ccgacagtct gaccgggcta gggagaccct cgatttatcg agcgagggga cccgatgccg    166800
     accgagagat tgtcgatgcg ccgcatacgc gacttactga gattgaagtt cgagaacggc    166860
     ctgagcagcc ggctgatcgc gacctcgctg gggatcagca aggggtcggt tggcgattac    166920
     ctgcagcggg cccaagtggc cgggctgagc tggccgctgc cagaggacat gaccgacaca    166980
     gccttggaac ggcggctgta tccagggccg ccgaagggat cgattgtccc gcgatccgag    167040
     cccaactggg cccatgtcga tcaggagctt cgccgcaccg gtgtgacgcg gtccctgctc    167100
     tggcaagaat accgggccga tcatcccgac ggctatggct atgcctggtt ctgccagcat    167160
     tacgacgcct ggaagcgccg ggtgtcgccg accatgcgcc agagccatgc cgccggggag    167220
     aaggtgttcg tcgacttcgc cggcgacacc atcgacgtca tcgatccgct gaccggcgtc    167280
     gcccaggcga tgaagctgtt cgtcgccgcg ctcggggcct ccagttacgt ctattgcgag    167340
     gcccggccga gcgaggggct tgccgactgg atcggctgcc acgttggcat gttcgccttc    167400
     ttcggcggcg tgacggcgat catcgtctgc gacaacctca aggccgccgt cactaacccg    167460
     gaccgctacg acccagggat caaccgcacc tatcaggaca tggcccgcca ttacgggacc    167520
     acggtcatgc cggcccggcc ctacaagccg cgagacaagg ccaaggtcga acaatcggtg    167580
     ctgctggtcg aacgttgggt gctggcgcgg ctgcgcaatc ggcgcttctt cagcctggcc    167640
     gaactgaacc tggcgatcgt cgatctggtc ggcgagctaa acgcccgcgt catgcgcgcc    167700
     tatggcgcca gccgcgcgga actgttcgcc acggtggacg ccccggcgct caaggctttg    167760
     cccgcagccc cctatgcctt cgccatctgg aagcgctgcc gggtggcgcc cgactaccat    167820
     gtcgaggtcg agggctgctg gtactcggtt ccctaccgcc tgatccgcga gttggtcgat    167880
     gttcgcatcg ccgacagaac cgttgaggcc ttccacaagg gtgagcgcgt cgccagccac    167940
     gccaagtccc ccggccgccg cggccacacc accatcgccg atcatatgcc cagcgcccat    168000
     cgccgccatg cctcctggac gccggcccgg atcatggctg tcgccgagag ggtcgggccg    168060
     gccaccgccg ccctgaccct caacccctca gccacggcaa tatccgtggc cgagcctact    168120
     tccactgacc ccagcatctg gagatcccat gcttgcacac cccacccatg atcgcctgat    168180
     cggcctgggt ctggccggaa tggccaaggc cttcgaggaa cagcgatctt cccccgacct    168240
     cgccgcccta tccttcgagg agcgggtcgg gatcatggcc gatcgtgaag ccgccgagcg    168300
     cgacaccaaa cgcatgagcg cccggctcaa gtttgctgcg ctacgccagg acgcctgcgt    168360
     tgaggacatc gacctgcgca cgcctcgagg cctggaccgc gcacttctgg ccaggctggt    168420
     cgccggcgac tggatcgacc ggcgccagaa ctgcctcatc accggcccca ccgggatcgg    168480
     caaaagttgg ctagggtgcg cgcttgggca caaggcttgc cgcgatggcc gatcggtctt    168540
     ctatcagcgc gtgccgcgtc tgtttgaagc cctggccctc gcccgcggcg atggccgcca    168600
     tgcccgcatg ctcaaaagcc tggctcgcgt cgaactgctt atcctcgacg actggggttt    168660
     gtcggtcctc acccagggtc agcgcatcga tctcctggag atcctcgaag accgcaacgg    168720
     gcgaggatcc accatcgtca ccagccaggt tcccgccgac cagtggcacg aggtcatcgg    168780
     cgatccgacc ctggccgacg ccattctcga ccgcctcgtc cacaacgctc accgtctcaa    168840
     catgaccgga gaaagcatgc gcaaaatcac cggtcgccgc gctcttgacg ccggcctcaa    168900
     cccctgactc catagccgcc gtcggtcagc ctccagactg cccacgatca cgtggaatcg    168960
     gcgcccacca tcgcgtggaa tcggcgccca tgatcgctgg aatgcgcagt cagccgcagt    169020
     gacgaaattg tgggtcgcca gccgcgccac ccacgatgat agaccctcgc cagccaaggg    169080
     ccttggcgcg aacggcagcg acggcatctc agcccgccgc cgccctgccc ctgcgccgca    169140
     tggtggccgc cgtgcggaca tggcgggtga cgtcgtcaag acgcagggtc ttcgatgcga    169200
     tctgttcctc gcccgtgtcg atggcgtgca cggcggccgc gttgagcaaa cggaaggtct    169260
     tgccgggact gccggcggtg aggtcatgaa cggcgttgat gagcggctga tctacaaccg    169320
     agctctgacg cagcggatag aaggcgatca cggaccgcac gatcatcgca tagtccgcgt    169380
     cgttgcgaag ccgcgtcaac tgaaagggtt gcacgcgtcc ttccacctgg ggatcggagg    169440
     tcaaggcgtg gagggcttcc atggtgccaa aacaggcgag cgacagctcc agccggtttg    169500
     atagccgtcg aagcgccgcc aaagtcttgc gctgggccga acccgtgccg atcaccagat    169560
     tattggtctc gtcgatgatc agcaggcgag caccaaggcg ccggagctgc aagtgcacga    169620
     tccgctccat atcaatgagc cgccgccttc gggcgcgcca atggcctgca agatcgcgga    169680
     atatagccgc gcttcgtcag cttccggcgg tgcctccatc gcgacgacct cgctcgaggt    169740
     ccggccggtc tctgcgtcaa agatcggcgc gtgggcgtgc atgaatttct tcaggatcgt    169800
     ggtcttgccg acgtcgggtt caccgacgac cagcagagag ggcatgcgga tgcggcgtgc    169860
     gccgcgcagc aattcggcca tccgggtcag cgcggcctcg ccttgcgggt agtgaaccca    169920
     gcggtcggcc aggatcttgg cgactcgcgt ctcgtcgtcg agatcggcgt cggcttcgct    169980
     caccactgct caatctcccc gactcgaccg ctgatgggac ccagcgacgc gaccggctcc    170040
     ggatcgggct gtggcgggtc aggagccaac gccgccgcat agccgcggtc gcggcgttcg    170100
     gcgtcacggc gctgacggcg ggtctcgctc ttcgcccgtc cgaccaactc gacattgcgt    170160
     cgtcgcgcct cgaacagcgc gtcttcgtta acatgggccg cgccctcggc agcgaggcgt    170220
     cgtctggccg cccggagttc ccataagctc atgggtgggc gcgcgaggtt gcggtagcga    170280
     atggattgaa caccctgcgc cgtggccagg tagagacggg acagatcgcg cgggtcgtag    170340
     cggaccagca gcctacgatc cccagtgtcg aacagcggct ccaggaacgg ctcatagtaa    170400
     tgtatgcggt tgaagacgac gccctggcgg gtgatggcgc gcggtaccga aggcaggaat    170460
     tcgaaggcta gacgctccgg atcgctcggc ctccgcggag caaagccctg gccatcgacg    170520
     ccgcagcgcc aggccactag cggcggccga cccgtgacgg agtggatccg catattgtag    170580
     tcgctagcga tgaaccgcca aagccaggtc tcaaactcgt ccagtgtgag cgcggcggac    170640
     ccgtcgctgt catagtcacc gcgctgtgag acgttggaga aggttgtacc cggcagcagg    170700
     tgcatctcct gctgcgcggt cccaatcagg cgctcaatat gaccgccata gcgcggcgcg    170760
     cccaggggcc gatagtcgat ctcgataccg aggttggcgc aggcccgctg gaacgtcgcg    170820
     cttcgaaaat cggagccgtt gtcgctgtgg acgccatccg gcaaaccgaa ggctggccag    170880
     tccgcagcca cctcccgttc cctcagggcg tcggccttat ccaggatggc gtggcgcaag    170940
     gccagtccga ctgagatcac cgacggatct tcgagtgaga catgcaggcc ggcgatgaca    171000
     cgcgaggcca cgtcgatcac tagcgtcacc cacggccgtc cgatcggcgc ccgtgtctcg    171060
     acgtccacaa tcacgacatc ggctggggag tggtcgatct gccagagcat attgggtcgg    171120
     tcgatctgca aggcgccggg ccgcatagtc tgagcctcgg ctgcacctct cccctcgcgg    171180
     cgccccgcga ccgtcttacg gccgagcttg cgcagccgcc gatggacggt cgagattgca    171240
     ggtgttgcca atccagtagc ccggcagcgc aactcgatct ctcgatgcaa cgctgcggcg    171300
     gacggagcct gcttggtaag gaagaagtct tggatcgccg cgtcgatcac ggtctcgatc    171360
     aaggccggga cgcggctgcg tcccgggcac catccccgcg ctctacccgt gatcgcctcc    171420
     gcagtccgat cgacctcaaa gcggcgcagc agccggtaaa gcgtcgagat atgcaagcca    171480
     agtcgggtgg cggcggtttc cacgtccgct cggcttcggc tgggagcctc aaccaacttt    171540
     cgtagctctg gttggcgctc aagcgccctg cgccagcgtt cttcagcgcc tccagttgga    171600
     cgcatatccg ggtcatcgac catcgatgat ttcctggcga gcggaggtct cagcagaagg    171660
     atgcctgagt cgatgttgac gcgcaggatc gaatttgatg cgaatgcgcg tcatcggcgc    171720
     gcgacgtggt tcaggcgcgc gactattcga tcggtcgcag ctattacgaa atggcggcct    171780
     gttgaaagat cggggaaata tgtcccgcct cagtcgcgtc tattccgctg tatgacacca    171840
     ttgtcaatgt tcgcattcga tgcgagtcgc atttctgaga cgcggcttcg ttcgaattgg    171900
     ttgcgactag caccttcact ttaattgaaa cctatggcgc gggcgtgtcg tggagggcga    171960
     ctccctaaag cggccagtcc gaattaccgg gttgggtggg gagcggacaa tcggccggga    172020
     ccggaaccta acaaggggcg acgtgtttgt ggcagatcaa ggatgccggg gacaggtcgg    172080
     tgaatactgc gctgatcgga tttgcctgat ccagaaagcc aaacgccatg cccatgtcct    172140
     tcaagtccct gctgctcgcc gccgccctcg ggttgggcgc cccggcctac gccgccgaac    172200
     agcccgcgcc accccacgac cacagccacg cgcctgacca ggccgccgcg cccgccacgc    172260
     ccgccgcgaa gggcggcatg atggccaaag gcgggatgaa ggggggcatg atggagatgg    172320
     cgcctatgca ttgcatgggc ctgtccgagc cgcgtctgtc aggtctgaag gccgagctca    172380
     acatcaccga gcggcagctc agagcgtgga acacctttgc ggaggccgcg agggccgatc    172440
     cccgcccaat gcccgccggc atgaccatgc cgatggccaa gaagcccggc gacatgccga    172500
     tgcctatgaa gtccgacgcc aagccgggcg gcgacggcat gatggcgatg atgatggcca    172560
     agccgctccc cgaacgcctc gcacaccacg aaacgatgat gaaggcgcac ctcaaggcgc    172620
     tccacaagtc tcggacggcg gtcctgggcc tctaccgcgt cctgactccc gagcagcgcc    172680
     tcatggccga caaaagcctt tgcggtatgc cgtgaccggc gaagcctcgg cctgattcag    172740
     acacagctcc gtcgggcagc tgttcatggg atattccacc gcgcaaccgt cttgcggatc    172800
     attgaggagt tggcggctgg gagatcgagc gtgaaacggg tgccgattgt ctatttctcc    172860
     gatctgctgt gcctttgggc gcatatttcg gagctgcgcg tggacgcggc cagggcgacc    172920
     tacggcgaac aggtccggtt cgaataccgg ttctgctcgg tgttcggcga caccgcccgc    172980
     aagatcgccg atggctgggg cggatacgcg ggcttcaatg aacatctgcg gcgcgccgcc    173040
     tcagactatc ccgaggttca ggtgaacccg gacatctggc tgaccgtgcg gcccgcctcc    173100
     tccacaggcg cacatctgct cctcaaggcg gttcatctgg acgaggccgc cgggggctgt    173160
     gcgccgcaaa cctatgagag aaccgtccgc ggactgcgta gggcgttttt cgaggcggcg    173220
     caggatatcg cgcgctggga ggtccagtgc gcggtcggcc ggagctgcgg cgtcgacgtc    173280
     ggccgtatcg aggcgttgat tgacgatgga gccgccttcg cggccctggc ctcggactat    173340
     aaggacgccg ccgccatggg catccagggc agcccaagct tcgtgctcaa cgagggtcgg    173400
     cagaagctgt ttggcaacgt cggcttcagg atcctcgacg ccaacatcca ggaacttctg    173460
     cgcgcgcccc agacggaaca ggccagctgg tgctgaccgc tacgacgggc cgtattgaag    173520
     gtccgcatgg tcggcattgg gtcgattcta ccaattggtt cccaggcgga aactcaccgg    173580
     tgtccgtcgg gcgacaaatt ctcgaacatt ggttaggcag ccgtcgattg ccgcccagcg    173640
     gaaacgatcc ggctgatcgt cgcctcgctg accttgtaga gccgggccat ttcggccgcg    173700
     gctttgcggc cagacaggac gttctccagc acgtcagcgc gctgcgcggc ggagagcttt    173760
     gcgcgccttc cgccgatacg tccggccgcc cgcgcctcgg ctagtccggc gctggtgcgc    173820
     tcgcggatca tggcgcgttc gaactcggcg aagctgccga ccatctgcat catcatccgg    173880
     cccgccggcg aggtggtgtc gatgctctcg gtcagcgacc gaaatccggc gcctgccgcc    173940
     tcaagctttt ccaggatgtg cagcatgtcc ttcagcgagc gcgacagtcg atcgagtttc    174000
     cagaccacga cgatgtcgtc aggccgcagc tgatccagca tccgatgaag ctgcggacga    174060
     tcccagcggc cgccgctggc ggcctcctcg aacaatcgat cacagccagc gcccttcagg    174120
     gcacgcatct gagccgccgt ggactggtcg tcgcccttgg agacccgggc gtagccgatc    174180
     agcatttctc gccctttcac aaacgctcgt ttttgcaagg tgcggcagca ccctcgcggg    174240
     ccgagatgtc tcgcctttca caaacctctt tcataatcat tgcgaaaggc aagtggtttg    174300
     tgcaagccgt tgccgccgat accggcctcg tctgccagcg ccgcgactgc aggaagagca    174360
     attgcgttcg gaaggtgctg gagggccgcc tccaggcggc gccttccgtc gcggccgata    174420
     tgatcgacga gagttcgata gggtccctgg tgatccggcg ctgtgcgcca ggacaggatc    174480
     tctgcgatct ccccttcaag ccgcgccggt cggctgagca gtgcggcaag cgccgacagg    174540
     acattgcggc gagaccggac gctctgcccc tgcagggcgt ccagcccctt gatcggctcg    174600
     gaggcttgca ggctgagtat gaacggtccg ccgatgcgtt cgggctcgaa aagccacgcg    174660
     aagggcgtct gaccggtctc tttatagagg accaggtcga tcaagatctc tgtcgcctgc    174720
     aataggctcc gagcggatcg cacccgccac cctggtccaa tgggcaaggc tgccagggcg    174780
     ttcgcgaggg acgcctccag agccagcgtg cgctcgctca gcacgcgtga ggtccgcgga    174840
     gcgccgagcg ccccgccgtc ctgaagggtc agtttcaaca cgccgcccgt cgacacgaac    174900
     gccaggccgt cgagatctac gagggtgcag cgatggacgg gacagctcac ccagagcaac    174960
     atcacgctct gcgccggcca ccagtgatcg cgcccctgca cgcctgcttc gcggcagcag    175020
     acggggcagg cgccgccgcg acggccatcc gggtcaagcg cgaccgccca ggcaggccgg    175080
     cgcgattggg ggatgcagag atcagcgatc gtcgccgttg gcacaccggt gacctcggcc    175140
     agccggtcga ccgtgctcgg tgagggtcgc agatcgtcga taggatcgat ggccaaccac    175200
     gtccaaaacg tggggagatc gacataattg tgcgccgcga gccgggcggt ccacgatgac    175260
     agcccctccc cggccaccgg gcgcggcgcg tagggcaacc tcattctgcc gcggcccggg    175320
     cccgcgcgcc ccggcgcatc gccattgcgg ttcgcacgtg gcgaaccacc tcctcggcgt    175380
     gcagtctttc caccgtgatc tgttcccggc cactatcgat ggcggcgacg gcggcggcgt    175440
     tcagcaggcg aaatgtcttg cccggacttc ccccgctgat ctcgtggaca gtgccaacga    175500
     aggcgccatc gacttcgctt ttcatgcgca gcggaaaatg actgaccaca gccgccacta    175560
     tggcggcgta ggtctcgtcc ttggcgaggc gcgcgagccg gaacggctgg gcgcggcctt    175620
     cgatctgggg gtcggaggtc agggcgttca gcgcctccag cgtgccgaaa taggccatcg    175680
     agagcgacag catgttagac aaccggcgca aggcggccag cgtcttgcgc tgggccgcgc    175740
     ccgtgccgat catcaggttg ttggtttcat cgatgaccag cagcctggtc cgcaagcgtt    175800
     gcagctggcc gtggacggct cgctcggcct ccatcgcccg cctcgccggc acaggcgccc    175860
     cgatcgcatc cagaatggcc ccgtagagcc gcaactcatc ggcctcgggc ggagcttcga    175920
     tcgccacgac ttccatctgg gaccgtccgg tctcagggtc gaaggtcggc gagcggcctc    175980
     tcatgaattt tcgcaggatc gtcgtcttgc ccatgtcggg gtcgccgacg atgagcaacg    176040
     agggcatacg cgtccgctga gcgccacgca gcaattccgc gaggcgctgc aacgctgcct    176100
     gcccctgtgg ataggcgacc cagcggtcgg agagcaccgt gtcgatgcgc gccgcgtccg    176160
     ccaggcccga ggtgtcggtt atcgcgctca ccatggctcg atctccacga caaaccccga    176220
     ggtcgggttt gtcggcgcgc ccacatcgat cggctctggc gggatctcgt cctcggcggt    176280
     tggagcgggc ttcacttcgg cccggtgacg ctcacgcctc acggactcgc gtcgaatccg    176340
     gcgactttcc cgcgccgccg tggccaccag ggctccgttc gcttcgcggg ccgcaaacag    176400
     ggccgcctcg tcgacctggg cccgcccctc ggcgcggagc cggcggcgcg ccgcccgcaa    176460
     ctcccacagg ctcatgggcg ggcgggtgag gttgcgatag cgaagggctc gcacgccctg    176520
     cggcgtctcg acgagcagtc gcgagaggtc ccgcggatcg taggcgagtt cgatgcggcg    176580
     caggccactg tcgaacaacg gcgccagaaa gggctcgtag tagcgcacgt gatggaagct    176640
     gacgccctga cgggtgatgg tgcgcgagat ccgcgggaga aaggcgaccg ccagaccttc    176700
     ggggtcgagg ggttggcggg gcgtgacagc ctgttcggag catagacggc gccaggtctc    176760
     cagcggcggg gctgagaggc tcgcgtggat ccggcgattg tagtcgccgg cgacgaaccg    176820
     ccggagccac acctcgaact cgtcgatcgt catgatcgcc gccgcatcgc tggcgtagtc    176880
     gccgcgggcg gccacgttgg agaaggtggc gcccggcagc aggtgcatct cgctcatcac    176940
     cgatccgatc aggcgctcga tgtggccgcc gtagcggggc gcgccgacgg gccggcgatc    177000
     ggtctcgatg ccgagattgc tgcacgcgtg ggagaacgat cggctccgaa aatccgaacc    177060
     gttatcggtg tgaaccagct caggcaggcc aaaggccggc cactcggccg agatcccgcg    177120
     ctctgccagg gcctcatcct tcggcaggat ggcgtgttgc agcgccatgc cgaccgaaac    177180
     gacggacgga ggatccaacg agacgtagag ccccgtgacc accctggacg ccacgtcgat    177240
     gaccagcgtc acccaaggcc ggccgatcgg cgcgcgcgag tccgcgtcca cgaggatgac    177300
     gtcggccggg gaatgatcga tttgccaaac cgcgttcggc tgggtcacgg tcaaactccc    177360
     cggtcgcatc gtcacggcct cggccgcgcc ggggcccttg cggcgccgga cctgctcccg    177420
     ctcgccgatc cgttgcagcc ggcggctgat caccgaacgc gagggcatcg ccatggactc    177480
     cgacgcgcag cgccgggcga tttcgcgccc cagctgggct ttgctaatcg cctggcggtc    177540
     gaggaacagc cgttcgacgg ccatgtcgat gagctcaatg acgcgggcgt gtagccgtgg    177600
     ccgcccgcct ttccatcccc ctaccccggt cacgaccgcc tgcgcggtct cgccgaccgc    177660
     ataacgggcg agtagccggt agactgtcgc ggtgtggacg ttcaggcgct gtgcggcggc    177720
     ctcgacctcg gcgcgtgtgc ggttgggatt gtccaacagc gggcgcagct ctcgctggcg    177780
     cgcgaccgcc aggtcccagc gccgctcctc actctgtggt tcgtggctgg ccccggttct    177840
     ggccatcgcc gtgcgctccc atacgagctg ctcccgcc                            177878
//

If you have problems or comments...

PBIL Back to PBIL home page