(data stored in ACNUC7421 zone)

EMBL: CP000930

ID   CP000930; SV 2; circular; genomic DNA; STD; PRO; 3075407 BP.
XX
AC   CP000930;
XX
PR   Project:PRJNA13427;
XX
DT   13-FEB-2008 (Rel. 94, Created)
DT   31-MAY-2016 (Rel. 129, Last updated, Version 6)
XX
DE   Heliobacterium modesticaldum Ice1 strain Ice1, complete genome.
XX
KW   .
XX
OS   Heliobacterium modesticaldum Ice1
OC   Bacteria; Firmicutes; Clostridia; Clostridiales; Heliobacteriaceae;
OC   Heliobacterium.
XX
RN   [1]
RP   1-3075407
RX   DOI; 10.1128/JB.00299-08.
RX   PUBMED; 18441057.
RA   Sattley W.M., Madigan M.T., Swingley W.D., Cheung P.C., Clocksin K.M.,
RA   Conrad A.L., Dejesa L.C., Honchak B.M., Jung D.O., Karbach L.E.,
RA   Kurdoglu A., Lahiri S., Mastrian S.D., Page L.E., Taylor H.L., Wang Z.T.,
RA   Raymond J., Chen M., Blankenship R.E., Touchman J.W.;
RT   "The genome of Heliobacterium modesticaldum, a phototrophic representative
RT   of the Firmicutes containing the simplest photosynthetic apparatus";
RL   J. Bacteriol. 190(13):4687-4696(2008).
XX
RN   [2]
RP   1-3075407
RA   Touchman J.W.;
RT   ;
RL   Submitted (24-JAN-2008) to the INSDC.
RL   Pharmaceutical Genomics Division, Translational Genomics Research
RL   Institute, 13208 E Shea Blvd, Scottsdale, AZ 85004, USA
XX
RN   [3]
RC   Sequence update by submitter
RP   1-3075407
RA   Touchman J.W.;
RT   ;
RL   Submitted (01-APR-2008) to the INSDC.
RL   Pharmaceutical Genomics Division, Translational Genomics Research
RL   Institute, 13208 E Shea Blvd, Scottsdale, AZ 85004, USA
XX
DR   MD5; 6f66c211655f3ba33b50acb020fb78b1.
DR   BioSample; SAMN02602985.
DR   EnsemblGenomes-Gn; EBG00001207306.
DR   EnsemblGenomes-Gn; EBG00001207307.
DR   EnsemblGenomes-Gn; EBG00001207308.
DR   EnsemblGenomes-Gn; EBG00001207309.
DR   EnsemblGenomes-Gn; EBG00001207310.
DR   EnsemblGenomes-Gn; EBG00001207311.
DR   EnsemblGenomes-Gn; EBG00001207312.
DR   EnsemblGenomes-Gn; EBG00001207313.
DR   EnsemblGenomes-Gn; EBG00001207314.
DR   EnsemblGenomes-Gn; EBG00001207315.
DR   EnsemblGenomes-Gn; EBG00001207316.
DR   EnsemblGenomes-Gn; EBG00001207317.
DR   EnsemblGenomes-Gn; EBG00001207318.
DR   EnsemblGenomes-Gn; EBG00001207319.
DR   EnsemblGenomes-Gn; EBG00001207320.
DR   EnsemblGenomes-Gn; EBG00001207321.
DR   EnsemblGenomes-Gn; EBG00001207322.
DR   EnsemblGenomes-Gn; EBG00001207323.
DR   EnsemblGenomes-Gn; EBG00001207324.
DR   EnsemblGenomes-Gn; EBG00001207325.
DR   EnsemblGenomes-Gn; EBG00001207326.
DR   EnsemblGenomes-Gn; EBG00001207327.
DR   EnsemblGenomes-Gn; EBG00001207328.
DR   EnsemblGenomes-Gn; EBG00001207329.
DR   EnsemblGenomes-Gn; EBG00001207330.
DR   EnsemblGenomes-Gn; EBG00001207331.
DR   EnsemblGenomes-Gn; EBG00001207332.
DR   EnsemblGenomes-Gn; EBG00001207333.
DR   EnsemblGenomes-Gn; EBG00001207334.
DR   EnsemblGenomes-Gn; EBG00001207335.
DR   EnsemblGenomes-Gn; EBG00001207336.
DR   EnsemblGenomes-Gn; EBG00001207337.
DR   EnsemblGenomes-Gn; EBG00001207338.
DR   EnsemblGenomes-Gn; EBG00001207339.
DR   EnsemblGenomes-Gn; EBG00001207340.
DR   EnsemblGenomes-Gn; EBG00001207341.
DR   EnsemblGenomes-Gn; EBG00001207342.
DR   EnsemblGenomes-Gn; EBG00001207343.
DR   EnsemblGenomes-Gn; EBG00001207344.
DR   EnsemblGenomes-Gn; EBG00001207345.
DR   EnsemblGenomes-Gn; EBG00001207346.
DR   EnsemblGenomes-Gn; EBG00001207347.
DR   EnsemblGenomes-Gn; EBG00001207348.
DR   EnsemblGenomes-Gn; EBG00001207349.
DR   EnsemblGenomes-Gn; EBG00001207350.
DR   EnsemblGenomes-Gn; EBG00001207351.
DR   EnsemblGenomes-Gn; EBG00001207352.
DR   EnsemblGenomes-Gn; EBG00001207353.
DR   EnsemblGenomes-Gn; EBG00001207354.
DR   EnsemblGenomes-Gn; EBG00001207355.
DR   EnsemblGenomes-Gn; EBG00001207356.
DR   EnsemblGenomes-Gn; EBG00001207357.
DR   EnsemblGenomes-Gn; EBG00001207358.
DR   EnsemblGenomes-Gn; EBG00001207359.
DR   EnsemblGenomes-Gn; EBG00001207360.
DR   EnsemblGenomes-Gn; EBG00001207361.
DR   EnsemblGenomes-Gn; EBG00001207362.
DR   EnsemblGenomes-Gn; EBG00001207363.
DR   EnsemblGenomes-Gn; EBG00001207364.
DR   EnsemblGenomes-Gn; EBG00001207365.
DR   EnsemblGenomes-Gn; EBG00001207366.
DR   EnsemblGenomes-Gn; EBG00001207367.
DR   EnsemblGenomes-Gn; EBG00001207368.
DR   EnsemblGenomes-Gn; EBG00001207369.
DR   EnsemblGenomes-Gn; EBG00001207370.
DR   EnsemblGenomes-Gn; EBG00001207371.
DR   EnsemblGenomes-Gn; EBG00001207372.
DR   EnsemblGenomes-Gn; EBG00001207373.
DR   EnsemblGenomes-Gn; EBG00001207374.
DR   EnsemblGenomes-Gn; EBG00001207375.
DR   EnsemblGenomes-Gn; EBG00001207376.
DR   EnsemblGenomes-Gn; EBG00001207377.
DR   EnsemblGenomes-Gn; EBG00001207378.
DR   EnsemblGenomes-Gn; EBG00001207379.
DR   EnsemblGenomes-Gn; EBG00001207380.
DR   EnsemblGenomes-Gn; EBG00001207381.
DR   EnsemblGenomes-Gn; EBG00001207382.
DR   EnsemblGenomes-Gn; EBG00001207383.
DR   EnsemblGenomes-Gn; EBG00001207384.
DR   EnsemblGenomes-Gn; EBG00001207385.
DR   EnsemblGenomes-Gn; EBG00001207386.
DR   EnsemblGenomes-Gn; EBG00001207387.
DR   EnsemblGenomes-Gn; EBG00001207388.
DR   EnsemblGenomes-Gn; EBG00001207389.
DR   EnsemblGenomes-Gn; EBG00001207390.
DR   EnsemblGenomes-Gn; EBG00001207391.
DR   EnsemblGenomes-Gn; EBG00001207392.
DR   EnsemblGenomes-Gn; EBG00001207393.
DR   EnsemblGenomes-Gn; EBG00001207394.
DR   EnsemblGenomes-Gn; EBG00001207395.
DR   EnsemblGenomes-Gn; EBG00001207396.
DR   EnsemblGenomes-Gn; EBG00001207397.
DR   EnsemblGenomes-Gn; EBG00001207398.
DR   EnsemblGenomes-Gn; EBG00001207399.
DR   EnsemblGenomes-Gn; EBG00001207400.
DR   EnsemblGenomes-Gn; EBG00001207401.
DR   EnsemblGenomes-Gn; EBG00001207402.
DR   EnsemblGenomes-Gn; EBG00001207403.
DR   EnsemblGenomes-Gn; EBG00001207404.
DR   EnsemblGenomes-Gn; EBG00001207405.
DR   EnsemblGenomes-Gn; EBG00001207406.
DR   EnsemblGenomes-Gn; EBG00001207407.
DR   EnsemblGenomes-Gn; EBG00001207408.
DR   EnsemblGenomes-Gn; EBG00001207409.
DR   EnsemblGenomes-Gn; EBG00001207410.
DR   EnsemblGenomes-Gn; EBG00001207411.
DR   EnsemblGenomes-Gn; EBG00001207412.
DR   EnsemblGenomes-Gn; EBG00001207413.
DR   EnsemblGenomes-Gn; EBG00001207414.
DR   EnsemblGenomes-Gn; EBG00001207415.
DR   EnsemblGenomes-Gn; EBG00001207416.
DR   EnsemblGenomes-Gn; EBG00001207417.
DR   EnsemblGenomes-Gn; EBG00001207418.
DR   EnsemblGenomes-Gn; EBG00001207419.
DR   EnsemblGenomes-Gn; EBG00001207420.
DR   EnsemblGenomes-Gn; EBG00001207421.
DR   EnsemblGenomes-Gn; EBG00001207422.
DR   EnsemblGenomes-Gn; EBG00001207423.
DR   EnsemblGenomes-Gn; EBG00001207424.
DR   EnsemblGenomes-Gn; EBG00001207425.
DR   EnsemblGenomes-Gn; EBG00001207426.
DR   EnsemblGenomes-Gn; EBG00001207427.
DR   EnsemblGenomes-Gn; EBG00001207428.
DR   EnsemblGenomes-Gn; EBG00001207429.
DR   EnsemblGenomes-Gn; EBG00001207430.
DR   EnsemblGenomes-Gn; EBG00001207431.
DR   EnsemblGenomes-Gn; EBG00001207432.
DR   EnsemblGenomes-Gn; EBG00001207433.
DR   EnsemblGenomes-Gn; EBG00001207434.
DR   EnsemblGenomes-Gn; EBG00001207435.
DR   EnsemblGenomes-Gn; EBG00001207436.
DR   EnsemblGenomes-Gn; EBG00001207437.
DR   EnsemblGenomes-Gn; EBG00001207438.
DR   EnsemblGenomes-Gn; EBG00001207439.
DR   EnsemblGenomes-Gn; EBG00001207440.
DR   EnsemblGenomes-Gn; EBG00001207441.
DR   EnsemblGenomes-Gn; EBG00001207442.
DR   EnsemblGenomes-Gn; EBG00001207443.
DR   EnsemblGenomes-Gn; EBG00001207444.
DR   EnsemblGenomes-Gn; EBG00001207445.
DR   EnsemblGenomes-Gn; EBG00001207446.
DR   EnsemblGenomes-Gn; EBG00001207447.
DR   EnsemblGenomes-Gn; EBG00001207448.
DR   EnsemblGenomes-Gn; EBG00001207449.
DR   EnsemblGenomes-Gn; EBG00001207450.
DR   EnsemblGenomes-Gn; EBG00001207451.
DR   EnsemblGenomes-Gn; EBG00001207452.
DR   EnsemblGenomes-Gn; EBG00001207453.
DR   EnsemblGenomes-Gn; EBG00001207454.
DR   EnsemblGenomes-Gn; EBG00001207455.
DR   EnsemblGenomes-Gn; EBG00001207456.
DR   EnsemblGenomes-Gn; EBG00001207457.
DR   EnsemblGenomes-Gn; EBG00001207458.
DR   EnsemblGenomes-Gn; EBG00001207459.
DR   EnsemblGenomes-Gn; EBG00001207460.
DR   EnsemblGenomes-Gn; EBG00001207461.
DR   EnsemblGenomes-Gn; EBG00001207462.
DR   EnsemblGenomes-Gn; EBG00001207463.
DR   EnsemblGenomes-Gn; EBG00001207464.
DR   EnsemblGenomes-Gn; EBG00001207465.
DR   EnsemblGenomes-Gn; EBG00001207466.
DR   EnsemblGenomes-Gn; EBG00001207467.
DR   EnsemblGenomes-Gn; EBG00001207468.
DR   EnsemblGenomes-Gn; EBG00001207469.
DR   EnsemblGenomes-Gn; HM1_0121.
DR   EnsemblGenomes-Gn; HM1_0122.
DR   EnsemblGenomes-Gn; HM1_0124.
DR   EnsemblGenomes-Gn; HM1_0397.
DR   EnsemblGenomes-Gn; HM1_0398.
DR   EnsemblGenomes-Gn; HM1_0467.
DR   EnsemblGenomes-Gn; HM1_0468.
DR   EnsemblGenomes-Gn; HM1_0469.
DR   EnsemblGenomes-Gn; HM1_0562.
DR   EnsemblGenomes-Gn; HM1_0563.
DR   EnsemblGenomes-Gn; HM1_0564.
DR   EnsemblGenomes-Gn; HM1_0565.
DR   EnsemblGenomes-Gn; HM1_0566.
DR   EnsemblGenomes-Gn; HM1_0567.
DR   EnsemblGenomes-Gn; HM1_0568.
DR   EnsemblGenomes-Gn; HM1_0569.
DR   EnsemblGenomes-Gn; HM1_0570.
DR   EnsemblGenomes-Gn; HM1_0705.
DR   EnsemblGenomes-Gn; HM1_0707.
DR   EnsemblGenomes-Gn; HM1_0708.
DR   EnsemblGenomes-Gn; HM1_0801.
DR   EnsemblGenomes-Gn; HM1_0815.
DR   EnsemblGenomes-Gn; HM1_0825.
DR   EnsemblGenomes-Gn; HM1_0827.
DR   EnsemblGenomes-Gn; HM1_0828.
DR   EnsemblGenomes-Gn; HM1_0845.
DR   EnsemblGenomes-Gn; HM1_0873.
DR   EnsemblGenomes-Gn; HM1_0874.
DR   EnsemblGenomes-Gn; HM1_0875.
DR   EnsemblGenomes-Gn; HM1_0876.
DR   EnsemblGenomes-Gn; HM1_0934.
DR   EnsemblGenomes-Gn; HM1_0978.
DR   EnsemblGenomes-Gn; HM1_0979.
DR   EnsemblGenomes-Gn; HM1_1003.
DR   EnsemblGenomes-Gn; HM1_1004.
DR   EnsemblGenomes-Gn; HM1_1006.
DR   EnsemblGenomes-Gn; HM1_1007.
DR   EnsemblGenomes-Gn; HM1_1008.
DR   EnsemblGenomes-Gn; HM1_1009.
DR   EnsemblGenomes-Gn; HM1_1334.
DR   EnsemblGenomes-Gn; HM1_1496.
DR   EnsemblGenomes-Gn; HM1_1759.
DR   EnsemblGenomes-Gn; HM1_1760.
DR   EnsemblGenomes-Gn; HM1_1761.
DR   EnsemblGenomes-Gn; HM1_1763.
DR   EnsemblGenomes-Gn; HM1_1764.
DR   EnsemblGenomes-Gn; HM1_1815.
DR   EnsemblGenomes-Gn; HM1_1816.
DR   EnsemblGenomes-Gn; HM1_1817.
DR   EnsemblGenomes-Gn; HM1_1818.
DR   EnsemblGenomes-Gn; HM1_1819.
DR   EnsemblGenomes-Gn; HM1_1820.
DR   EnsemblGenomes-Gn; HM1_1821.
DR   EnsemblGenomes-Gn; HM1_1996.
DR   EnsemblGenomes-Gn; HM1_2286.
DR   EnsemblGenomes-Gn; HM1_2287.
DR   EnsemblGenomes-Gn; HM1_2288.
DR   EnsemblGenomes-Gn; HM1_2289.
DR   EnsemblGenomes-Gn; HM1_2290.
DR   EnsemblGenomes-Gn; HM1_2291.
DR   EnsemblGenomes-Gn; HM1_2292.
DR   EnsemblGenomes-Gn; HM1_2293.
DR   EnsemblGenomes-Gn; HM1_2294.
DR   EnsemblGenomes-Gn; HM1_2295.
DR   EnsemblGenomes-Gn; HM1_2296.
DR   EnsemblGenomes-Gn; HM1_2297.
DR   EnsemblGenomes-Gn; HM1_2298.
DR   EnsemblGenomes-Gn; HM1_2299.
DR   EnsemblGenomes-Gn; HM1_2300.
DR   EnsemblGenomes-Gn; HM1_2301.
DR   EnsemblGenomes-Gn; HM1_2302.
DR   EnsemblGenomes-Gn; HM1_2303.
DR   EnsemblGenomes-Gn; HM1_2304.
DR   EnsemblGenomes-Gn; HM1_2305.
DR   EnsemblGenomes-Gn; HM1_2306.
DR   EnsemblGenomes-Gn; HM1_2307.
DR   EnsemblGenomes-Gn; HM1_2308.
DR   EnsemblGenomes-Gn; HM1_2346.
DR   EnsemblGenomes-Gn; HM1_2347.
DR   EnsemblGenomes-Gn; HM1_2354.
DR   EnsemblGenomes-Gn; HM1_2355.
DR   EnsemblGenomes-Gn; HM1_2357.
DR   EnsemblGenomes-Gn; HM1_2358.
DR   EnsemblGenomes-Gn; HM1_2359.
DR   EnsemblGenomes-Gn; HM1_2479.
DR   EnsemblGenomes-Gn; HM1_2492.
DR   EnsemblGenomes-Gn; HM1_2518.
DR   EnsemblGenomes-Gn; HM1_2519.
DR   EnsemblGenomes-Gn; HM1_2522.
DR   EnsemblGenomes-Gn; HM1_2523.
DR   EnsemblGenomes-Gn; HM1_2524.
DR   EnsemblGenomes-Gn; HM1_2525.
DR   EnsemblGenomes-Gn; HM1_2526.
DR   EnsemblGenomes-Gn; HM1_2528.
DR   EnsemblGenomes-Gn; HM1_2529.
DR   EnsemblGenomes-Gn; HM1_2531.
DR   EnsemblGenomes-Gn; HM1_2589.
DR   EnsemblGenomes-Gn; HM1_2590.
DR   EnsemblGenomes-Gn; HM1_2591.
DR   EnsemblGenomes-Gn; HM1_2592.
DR   EnsemblGenomes-Gn; HM1_2593.
DR   EnsemblGenomes-Gn; HM1_2594.
DR   EnsemblGenomes-Gn; HM1_2595.
DR   EnsemblGenomes-Gn; HM1_2829.
DR   EnsemblGenomes-Gn; HM1_2830.
DR   EnsemblGenomes-Gn; HM1_2831.
DR   EnsemblGenomes-Gn; HM1_2832.
DR   EnsemblGenomes-Gn; HM1_2833.
DR   EnsemblGenomes-Gn; HM1_2835.
DR   EnsemblGenomes-Gn; HM1_2836.
DR   EnsemblGenomes-Gn; HM1_2837.
DR   EnsemblGenomes-Gn; HM1_2838.
DR   EnsemblGenomes-Gn; HM1_2839.
DR   EnsemblGenomes-Gn; HM1_2840.
DR   EnsemblGenomes-Gn; HM1_2841.
DR   EnsemblGenomes-Gn; HM1_2842.
DR   EnsemblGenomes-Gn; HM1_2843.
DR   EnsemblGenomes-Gn; HM1_2844.
DR   EnsemblGenomes-Gn; HM1_2845.
DR   EnsemblGenomes-Gn; HM1_2846.
DR   EnsemblGenomes-Gn; HM1_2847.
DR   EnsemblGenomes-Gn; HM1_2848.
DR   EnsemblGenomes-Gn; HM1_2849.
DR   EnsemblGenomes-Gn; HM1_3083.
DR   EnsemblGenomes-Gn; HM1_3084.
DR   EnsemblGenomes-Gn; HM1_3085.
DR   EnsemblGenomes-Gn; HM1_3087.
DR   EnsemblGenomes-Gn; HM1_3156.
DR   EnsemblGenomes-Tr; EBT00001776375.
DR   EnsemblGenomes-Tr; EBT00001776376.
DR   EnsemblGenomes-Tr; EBT00001776377.
DR   EnsemblGenomes-Tr; EBT00001776378.
DR   EnsemblGenomes-Tr; EBT00001776379.
DR   EnsemblGenomes-Tr; EBT00001776380.
DR   EnsemblGenomes-Tr; EBT00001776381.
DR   EnsemblGenomes-Tr; EBT00001776382.
DR   EnsemblGenomes-Tr; EBT00001776383.
DR   EnsemblGenomes-Tr; EBT00001776385.
DR   EnsemblGenomes-Tr; EBT00001776386.
DR   EnsemblGenomes-Tr; EBT00001776388.
DR   EnsemblGenomes-Tr; EBT00001776390.
DR   EnsemblGenomes-Tr; EBT00001776391.
DR   EnsemblGenomes-Tr; EBT00001776394.
DR   EnsemblGenomes-Tr; EBT00001776396.
DR   EnsemblGenomes-Tr; EBT00001776398.
DR   EnsemblGenomes-Tr; EBT00001776400.
DR   EnsemblGenomes-Tr; EBT00001776402.
DR   EnsemblGenomes-Tr; EBT00001776404.
DR   EnsemblGenomes-Tr; EBT00001776405.
DR   EnsemblGenomes-Tr; EBT00001776407.
DR   EnsemblGenomes-Tr; EBT00001776409.
DR   EnsemblGenomes-Tr; EBT00001776412.
DR   EnsemblGenomes-Tr; EBT00001776414.
DR   EnsemblGenomes-Tr; EBT00001776416.
DR   EnsemblGenomes-Tr; EBT00001776418.
DR   EnsemblGenomes-Tr; EBT00001776420.
DR   EnsemblGenomes-Tr; EBT00001776422.
DR   EnsemblGenomes-Tr; EBT00001776424.
DR   EnsemblGenomes-Tr; EBT00001776427.
DR   EnsemblGenomes-Tr; EBT00001776429.
DR   EnsemblGenomes-Tr; EBT00001776431.
DR   EnsemblGenomes-Tr; EBT00001776433.
DR   EnsemblGenomes-Tr; EBT00001776435.
DR   EnsemblGenomes-Tr; EBT00001776437.
DR   EnsemblGenomes-Tr; EBT00001776439.
DR   EnsemblGenomes-Tr; EBT00001776440.
DR   EnsemblGenomes-Tr; EBT00001776441.
DR   EnsemblGenomes-Tr; EBT00001776442.
DR   EnsemblGenomes-Tr; EBT00001776444.
DR   EnsemblGenomes-Tr; EBT00001776445.
DR   EnsemblGenomes-Tr; EBT00001776446.
DR   EnsemblGenomes-Tr; EBT00001776447.
DR   EnsemblGenomes-Tr; EBT00001776448.
DR   EnsemblGenomes-Tr; EBT00001776449.
DR   EnsemblGenomes-Tr; EBT00001776452.
DR   EnsemblGenomes-Tr; EBT00001776454.
DR   EnsemblGenomes-Tr; EBT00001776456.
DR   EnsemblGenomes-Tr; EBT00001776457.
DR   EnsemblGenomes-Tr; EBT00001776459.
DR   EnsemblGenomes-Tr; EBT00001776460.
DR   EnsemblGenomes-Tr; EBT00001776461.
DR   EnsemblGenomes-Tr; EBT00001776462.
DR   EnsemblGenomes-Tr; EBT00001776463.
DR   EnsemblGenomes-Tr; EBT00001776464.
DR   EnsemblGenomes-Tr; EBT00001776465.
DR   EnsemblGenomes-Tr; EBT00001776466.
DR   EnsemblGenomes-Tr; EBT00001776467.
DR   EnsemblGenomes-Tr; EBT00001776468.
DR   EnsemblGenomes-Tr; EBT00001776469.
DR   EnsemblGenomes-Tr; EBT00001776470.
DR   EnsemblGenomes-Tr; EBT00001776471.
DR   EnsemblGenomes-Tr; EBT00001776472.
DR   EnsemblGenomes-Tr; EBT00001776473.
DR   EnsemblGenomes-Tr; EBT00001776474.
DR   EnsemblGenomes-Tr; EBT00001776475.
DR   EnsemblGenomes-Tr; EBT00001776476.
DR   EnsemblGenomes-Tr; EBT00001776477.
DR   EnsemblGenomes-Tr; EBT00001776478.
DR   EnsemblGenomes-Tr; EBT00001776479.
DR   EnsemblGenomes-Tr; EBT00001776480.
DR   EnsemblGenomes-Tr; EBT00001776481.
DR   EnsemblGenomes-Tr; EBT00001776482.
DR   EnsemblGenomes-Tr; EBT00001776483.
DR   EnsemblGenomes-Tr; EBT00001776484.
DR   EnsemblGenomes-Tr; EBT00001776485.
DR   EnsemblGenomes-Tr; EBT00001776486.
DR   EnsemblGenomes-Tr; EBT00001776487.
DR   EnsemblGenomes-Tr; EBT00001776488.
DR   EnsemblGenomes-Tr; EBT00001776489.
DR   EnsemblGenomes-Tr; EBT00001776490.
DR   EnsemblGenomes-Tr; EBT00001776491.
DR   EnsemblGenomes-Tr; EBT00001776492.
DR   EnsemblGenomes-Tr; EBT00001776493.
DR   EnsemblGenomes-Tr; EBT00001776494.
DR   EnsemblGenomes-Tr; EBT00001776495.
DR   EnsemblGenomes-Tr; EBT00001776496.
DR   EnsemblGenomes-Tr; EBT00001776497.
DR   EnsemblGenomes-Tr; EBT00001776498.
DR   EnsemblGenomes-Tr; EBT00001776499.
DR   EnsemblGenomes-Tr; EBT00001776500.
DR   EnsemblGenomes-Tr; EBT00001776501.
DR   EnsemblGenomes-Tr; EBT00001776502.
DR   EnsemblGenomes-Tr; EBT00001776503.
DR   EnsemblGenomes-Tr; EBT00001776504.
DR   EnsemblGenomes-Tr; EBT00001776505.
DR   EnsemblGenomes-Tr; EBT00001776506.
DR   EnsemblGenomes-Tr; EBT00001776507.
DR   EnsemblGenomes-Tr; EBT00001776508.
DR   EnsemblGenomes-Tr; EBT00001776509.
DR   EnsemblGenomes-Tr; EBT00001776510.
DR   EnsemblGenomes-Tr; EBT00001776511.
DR   EnsemblGenomes-Tr; EBT00001776512.
DR   EnsemblGenomes-Tr; EBT00001776513.
DR   EnsemblGenomes-Tr; EBT00001776514.
DR   EnsemblGenomes-Tr; EBT00001776515.
DR   EnsemblGenomes-Tr; EBT00001776516.
DR   EnsemblGenomes-Tr; EBT00001776517.
DR   EnsemblGenomes-Tr; EBT00001776518.
DR   EnsemblGenomes-Tr; EBT00001776519.
DR   EnsemblGenomes-Tr; EBT00001776520.
DR   EnsemblGenomes-Tr; EBT00001776521.
DR   EnsemblGenomes-Tr; EBT00001776522.
DR   EnsemblGenomes-Tr; EBT00001776523.
DR   EnsemblGenomes-Tr; EBT00001776524.
DR   EnsemblGenomes-Tr; EBT00001776525.
DR   EnsemblGenomes-Tr; EBT00001776526.
DR   EnsemblGenomes-Tr; EBT00001776527.
DR   EnsemblGenomes-Tr; EBT00001776528.
DR   EnsemblGenomes-Tr; EBT00001776529.
DR   EnsemblGenomes-Tr; EBT00001776530.
DR   EnsemblGenomes-Tr; EBT00001776531.
DR   EnsemblGenomes-Tr; EBT00001776532.
DR   EnsemblGenomes-Tr; EBT00001776533.
DR   EnsemblGenomes-Tr; EBT00001776534.
DR   EnsemblGenomes-Tr; EBT00001776535.
DR   EnsemblGenomes-Tr; EBT00001776536.
DR   EnsemblGenomes-Tr; EBT00001776537.
DR   EnsemblGenomes-Tr; EBT00001776538.
DR   EnsemblGenomes-Tr; EBT00001776539.
DR   EnsemblGenomes-Tr; EBT00001776540.
DR   EnsemblGenomes-Tr; EBT00001776541.
DR   EnsemblGenomes-Tr; EBT00001776542.
DR   EnsemblGenomes-Tr; EBT00001776543.
DR   EnsemblGenomes-Tr; EBT00001776544.
DR   EnsemblGenomes-Tr; EBT00001776545.
DR   EnsemblGenomes-Tr; EBT00001776546.
DR   EnsemblGenomes-Tr; EBT00001776547.
DR   EnsemblGenomes-Tr; EBT00001776548.
DR   EnsemblGenomes-Tr; EBT00001776549.
DR   EnsemblGenomes-Tr; EBT00001776550.
DR   EnsemblGenomes-Tr; EBT00001776551.
DR   EnsemblGenomes-Tr; EBT00001776552.
DR   EnsemblGenomes-Tr; EBT00001776553.
DR   EnsemblGenomes-Tr; EBT00001776554.
DR   EnsemblGenomes-Tr; EBT00001776555.
DR   EnsemblGenomes-Tr; EBT00001776556.
DR   EnsemblGenomes-Tr; EBT00001776557.
DR   EnsemblGenomes-Tr; EBT00001776558.
DR   EnsemblGenomes-Tr; EBT00001776559.
DR   EnsemblGenomes-Tr; EBT00001776560.
DR   EnsemblGenomes-Tr; EBT00001776561.
DR   EnsemblGenomes-Tr; EBT00001776562.
DR   EnsemblGenomes-Tr; EBT00001776563.
DR   EnsemblGenomes-Tr; EBT00001776564.
DR   EnsemblGenomes-Tr; EBT00001776565.
DR   EnsemblGenomes-Tr; EBT00001776566.
DR   EnsemblGenomes-Tr; EBT00001776567.
DR   EnsemblGenomes-Tr; EBT00001776568.
DR   EnsemblGenomes-Tr; EBT00001776569.
DR   EnsemblGenomes-Tr; EBT00001776570.
DR   EnsemblGenomes-Tr; EBT00001776571.
DR   EnsemblGenomes-Tr; EBT00001776572.
DR   EnsemblGenomes-Tr; HM1_0121-1.
DR   EnsemblGenomes-Tr; HM1_0122-1.
DR   EnsemblGenomes-Tr; HM1_0124-1.
DR   EnsemblGenomes-Tr; HM1_0397-1.
DR   EnsemblGenomes-Tr; HM1_0398-1.
DR   EnsemblGenomes-Tr; HM1_0467-1.
DR   EnsemblGenomes-Tr; HM1_0468-1.
DR   EnsemblGenomes-Tr; HM1_0469-1.
DR   EnsemblGenomes-Tr; HM1_0562-1.
DR   EnsemblGenomes-Tr; HM1_0563-1.
DR   EnsemblGenomes-Tr; HM1_0564-1.
DR   EnsemblGenomes-Tr; HM1_0565-1.
DR   EnsemblGenomes-Tr; HM1_0566-1.
DR   EnsemblGenomes-Tr; HM1_0567-1.
DR   EnsemblGenomes-Tr; HM1_0568-1.
DR   EnsemblGenomes-Tr; HM1_0569-1.
DR   EnsemblGenomes-Tr; HM1_0570-1.
DR   EnsemblGenomes-Tr; HM1_0705-1.
DR   EnsemblGenomes-Tr; HM1_0707-1.
DR   EnsemblGenomes-Tr; HM1_0708-1.
DR   EnsemblGenomes-Tr; HM1_0801-1.
DR   EnsemblGenomes-Tr; HM1_0815-1.
DR   EnsemblGenomes-Tr; HM1_0825-1.
DR   EnsemblGenomes-Tr; HM1_0827-1.
DR   EnsemblGenomes-Tr; HM1_0828-1.
DR   EnsemblGenomes-Tr; HM1_0845-1.
DR   EnsemblGenomes-Tr; HM1_0873-1.
DR   EnsemblGenomes-Tr; HM1_0874-1.
DR   EnsemblGenomes-Tr; HM1_0875-1.
DR   EnsemblGenomes-Tr; HM1_0876-1.
DR   EnsemblGenomes-Tr; HM1_0934-1.
DR   EnsemblGenomes-Tr; HM1_0978-1.
DR   EnsemblGenomes-Tr; HM1_0979-1.
DR   EnsemblGenomes-Tr; HM1_1003-1.
DR   EnsemblGenomes-Tr; HM1_1004-1.
DR   EnsemblGenomes-Tr; HM1_1006-1.
DR   EnsemblGenomes-Tr; HM1_1007-1.
DR   EnsemblGenomes-Tr; HM1_1008-1.
DR   EnsemblGenomes-Tr; HM1_1009-1.
DR   EnsemblGenomes-Tr; HM1_1334-1.
DR   EnsemblGenomes-Tr; HM1_1496-1.
DR   EnsemblGenomes-Tr; HM1_1759-1.
DR   EnsemblGenomes-Tr; HM1_1760-1.
DR   EnsemblGenomes-Tr; HM1_1761-1.
DR   EnsemblGenomes-Tr; HM1_1763-1.
DR   EnsemblGenomes-Tr; HM1_1764-1.
DR   EnsemblGenomes-Tr; HM1_1815-1.
DR   EnsemblGenomes-Tr; HM1_1816-1.
DR   EnsemblGenomes-Tr; HM1_1817-1.
DR   EnsemblGenomes-Tr; HM1_1818-1.
DR   EnsemblGenomes-Tr; HM1_1819-1.
DR   EnsemblGenomes-Tr; HM1_1820-1.
DR   EnsemblGenomes-Tr; HM1_1821-1.
DR   EnsemblGenomes-Tr; HM1_1996-1.
DR   EnsemblGenomes-Tr; HM1_2135-1.
DR   EnsemblGenomes-Tr; HM1_2286-1.
DR   EnsemblGenomes-Tr; HM1_2287-1.
DR   EnsemblGenomes-Tr; HM1_2288-1.
DR   EnsemblGenomes-Tr; HM1_2289-1.
DR   EnsemblGenomes-Tr; HM1_2290-1.
DR   EnsemblGenomes-Tr; HM1_2291-1.
DR   EnsemblGenomes-Tr; HM1_2292-1.
DR   EnsemblGenomes-Tr; HM1_2293-1.
DR   EnsemblGenomes-Tr; HM1_2294-1.
DR   EnsemblGenomes-Tr; HM1_2295-1.
DR   EnsemblGenomes-Tr; HM1_2296-1.
DR   EnsemblGenomes-Tr; HM1_2297-1.
DR   EnsemblGenomes-Tr; HM1_2298-1.
DR   EnsemblGenomes-Tr; HM1_2299-1.
DR   EnsemblGenomes-Tr; HM1_2300-1.
DR   EnsemblGenomes-Tr; HM1_2301-1.
DR   EnsemblGenomes-Tr; HM1_2302-1.
DR   EnsemblGenomes-Tr; HM1_2303-1.
DR   EnsemblGenomes-Tr; HM1_2304-1.
DR   EnsemblGenomes-Tr; HM1_2305-1.
DR   EnsemblGenomes-Tr; HM1_2306-1.
DR   EnsemblGenomes-Tr; HM1_2307-1.
DR   EnsemblGenomes-Tr; HM1_2308-1.
DR   EnsemblGenomes-Tr; HM1_2346-1.
DR   EnsemblGenomes-Tr; HM1_2347-1.
DR   EnsemblGenomes-Tr; HM1_2354-1.
DR   EnsemblGenomes-Tr; HM1_2355-1.
DR   EnsemblGenomes-Tr; HM1_2357-1.
DR   EnsemblGenomes-Tr; HM1_2358-1.
DR   EnsemblGenomes-Tr; HM1_2359-1.
DR   EnsemblGenomes-Tr; HM1_2479-1.
DR   EnsemblGenomes-Tr; HM1_2492-1.
DR   EnsemblGenomes-Tr; HM1_2518-1.
DR   EnsemblGenomes-Tr; HM1_2519-1.
DR   EnsemblGenomes-Tr; HM1_2522-1.
DR   EnsemblGenomes-Tr; HM1_2523-1.
DR   EnsemblGenomes-Tr; HM1_2524-1.
DR   EnsemblGenomes-Tr; HM1_2525-1.
DR   EnsemblGenomes-Tr; HM1_2526-1.
DR   EnsemblGenomes-Tr; HM1_2528-1.
DR   EnsemblGenomes-Tr; HM1_2529-1.
DR   EnsemblGenomes-Tr; HM1_2531-1.
DR   EnsemblGenomes-Tr; HM1_2586-1.
DR   EnsemblGenomes-Tr; HM1_2589-1.
DR   EnsemblGenomes-Tr; HM1_2590-1.
DR   EnsemblGenomes-Tr; HM1_2591-1.
DR   EnsemblGenomes-Tr; HM1_2592-1.
DR   EnsemblGenomes-Tr; HM1_2593-1.
DR   EnsemblGenomes-Tr; HM1_2594-1.
DR   EnsemblGenomes-Tr; HM1_2595-1.
DR   EnsemblGenomes-Tr; HM1_2829-1.
DR   EnsemblGenomes-Tr; HM1_2830-1.
DR   EnsemblGenomes-Tr; HM1_2831-1.
DR   EnsemblGenomes-Tr; HM1_2832-1.
DR   EnsemblGenomes-Tr; HM1_2833-1.
DR   EnsemblGenomes-Tr; HM1_2835-1.
DR   EnsemblGenomes-Tr; HM1_2836-1.
DR   EnsemblGenomes-Tr; HM1_2837-1.
DR   EnsemblGenomes-Tr; HM1_2838-1.
DR   EnsemblGenomes-Tr; HM1_2839-1.
DR   EnsemblGenomes-Tr; HM1_2840-1.
DR   EnsemblGenomes-Tr; HM1_2841-1.
DR   EnsemblGenomes-Tr; HM1_2842-1.
DR   EnsemblGenomes-Tr; HM1_2843-1.
DR   EnsemblGenomes-Tr; HM1_2844-1.
DR   EnsemblGenomes-Tr; HM1_2845-1.
DR   EnsemblGenomes-Tr; HM1_2846-1.
DR   EnsemblGenomes-Tr; HM1_2847-1.
DR   EnsemblGenomes-Tr; HM1_2848-1.
DR   EnsemblGenomes-Tr; HM1_2849-1.
DR   EnsemblGenomes-Tr; HM1_3083-1.
DR   EnsemblGenomes-Tr; HM1_3084-1.
DR   EnsemblGenomes-Tr; HM1_3085-1.
DR   EnsemblGenomes-Tr; HM1_3087-1.
DR   EnsemblGenomes-Tr; HM1_3156-1.
DR   EuropePMC; PMC2446807; 18441057.
DR   EuropePMC; PMC3150298; 21714912.
DR   EuropePMC; PMC4040607; 24821787.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00106; RNAI.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01998; group-II-D1D4-1.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   SILVA-LSU; CP000930.
DR   SILVA-SSU; CP000930.
DR   StrainInfo; 121638; 1.
XX
CC   On Apr 1, 2008 this sequence version replaced gi:167590877.
CC   Protein correction made by GenBank staff.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3075407
FT                   /organism="Heliobacterium modesticaldum Ice1"
FT                   /strain="Ice1; ATCC 51547"
FT                   /mol_type="genomic DNA"
FT                   /note="type strain of Heliobacterium modesticaldum"
FT                   /db_xref="taxon:498761"
FT   gene            complement(437..1408)
FT                   /locus_tag="HM1_0001"
FT   CDS_pept        complement(437..1408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0001"
FT                   /product="pas"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82626"
FT                   /db_xref="GOA:B0THV3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B0THV3"
FT                   /protein_id="ABZ82626.1"
FT                   /translation="MAGERPAGAPKQVRKSCRKEDCLKVLGRAFDLSPSIMALKDLQRL
FT                   RYVHVNESFLRVIGYRREEIIGRTAEELGIWSGQSKVIDILLKKDAAKSMEIIFRTRSG
FT                   EERSGLMSMERMQLDGREYILTVTNDITEQRRLEKELQRLDRLNLVGQLASAFGHEIRN
FT                   PLQTVRGFLQILQRKAQYRDDDEYFALMISELDRANQIITEYLTLSRKKADCFARNNVN
FT                   EVVQKLAPLLEALAINVNKQIRFDLAPVPDIWMDEKQIRQLILNLLNNGLEAMAPRQVI
FT                   TIRTGVTGNRVILSVEDEFHHSGDDIRSAGLLAVVLHFDKPG"
FT   gene            1421..1567
FT                   /locus_tag="HM1_0002"
FT   CDS_pept        1421..1567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0002"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82627"
FT                   /db_xref="UniProtKB/TrEMBL:B0THV4"
FT                   /protein_id="ABZ82627.1"
FT                   /translation="MKTAVQGLITSGYEQLVPHHLTPQKNNQLFMEKLDTSTIIMQFLL
FT                   HKS"
FT   gene            complement(1583..1762)
FT                   /locus_tag="HM1_0003"
FT   CDS_pept        complement(1583..1762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0003"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82628"
FT                   /db_xref="UniProtKB/TrEMBL:B0THV5"
FT                   /protein_id="ABZ82628.1"
FT                   /translation="MRRAKGEATRRFSPGFFPFTKNRLLEDMFCNEALVSKPALFICSN
FT                   NLTGRANLLFANER"
FT   gene            complement(1759..2199)
FT                   /locus_tag="HM1_0004"
FT   CDS_pept        complement(1759..2199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0004"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82629"
FT                   /db_xref="UniProtKB/TrEMBL:B0THV6"
FT                   /protein_id="ABZ82629.1"
FT                   /translation="MKKIYFYLDGGDAMYEQQAIPMVVTVPSVSHPPIPYGLVEAAAWG
FT                   PDTGASSPTNPVLQWGLHTYWVYNLVDRYGIGIVAYDEAGNIVGQWEKTGVSHIWQITV
FT                   EADTQRVVFWGQSNYRIVMRWHELFIPSLTVSPPEQAFLSAS"
FT   gene            complement(2251..2943)
FT                   /locus_tag="HM1_0005"
FT   CDS_pept        complement(2251..2943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0005"
FT                   /product="transcriptional regulator, crp/fnr family"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82630"
FT                   /db_xref="GOA:B0THV7"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0THV7"
FT                   /protein_id="ABZ82630.1"
FT                   /translation="MDREGKRLLPACPLFDGLEPAVVKEMLVCLEPRMNQYKKSDTIAF
FT                   AGEAFDSIGILLKGEARVIKETAAGHRSMMAVVRPGGLFGEIVVFSSNAVWPATVIAQE
FT                   ECQVLFIPRRKLVEQCERSCAWHRVLIQNMLRIISEKAMMLNKKVEYLSIKSMRGKLST
FT                   FFLEQHKKSGAATFRLPMKRNELADFLNVSRPSMSREMARMRDEGLIDFHLETVRIIDV
FT                   ERLMETAE"
FT   gene            3054..3986
FT                   /locus_tag="HM1_0006"
FT   CDS_pept        3054..3986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0006"
FT                   /product="4fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82631"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:B0THV8"
FT                   /protein_id="ABZ82631.1"
FT                   /translation="MKRKIVTINEEKCNGCGLCISACHEGALQLINGKAKLVSDAYCDG
FT                   LGDCLPECPTDAITLVERDAAPFDEAAVKKRIEELKHGAAAAPAVYAHAGTSAAAASAA
FT                   SAASAASAASAASAAPAAPAAPAASATPAAPAASAAPAASFGCPGMRARVFERSSSAES
FT                   TSPGAAPVAASAGTNAGIGSGAVAESQLGQWPCQLKLVSPRAPYFDNCRLLIAADCTAF
FT                   AYAGIHQDFMKNKITLIGCPKLDDIDYAEKLTEILATHEIESLTVLRMEVPCCGGIVNA
FT                   VKKALAASGKIIPWQIVIIGTDGRLVQGV"
FT   gene            complement(4112..4228)
FT                   /locus_tag="HM1_0007"
FT   CDS_pept        complement(4112..4228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0007"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82632"
FT                   /db_xref="UniProtKB/TrEMBL:B0THV9"
FT                   /protein_id="ABZ82632.1"
FT                   /translation="MKCPDCGYDGFRRVVNVGFRFSVYRCSACLYTLMKPGE"
FT   gene            complement(4429..5628)
FT                   /locus_tag="HM1_0008"
FT   CDS_pept        complement(4429..5628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0008"
FT                   /product="toxic ion resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82633"
FT                   /db_xref="InterPro:IPR008863"
FT                   /db_xref="UniProtKB/TrEMBL:B0THW0"
FT                   /protein_id="ABZ82633.1"
FT                   /translation="MTTANQTDPFDIPGPFDRIQAPVTPTPVVSPQSPAAPSLAESRPE
FT                   PAVTLAALPADQQQKALALAKQIDVKNPQTLLQYGLPVQSELSRFADNILDHVRAKDSG
FT                   TVGEVLGNLMQKLKEANPDDLLESKDSFFNKFFSSAKRSAEKVLARYQTLGSEIDQISL
FT                   QLDKARLQLLRDITLLETLFHKNREYFNELNVYIAAAQHKLEELRNQTIPQLQQRAAAT
FT                   NDTALVQELNDHLQFVDRLEKKVHDLLISRTVTLQTAPQIRLIQNNDHVLVEKIQSSIL
FT                   TTIPLWKNQIVLALTLQRQQAALAMQRQVADTTNELLLRNSEMLKTNTIGVARENERAI
FT                   VDMATLKKTQENLMNTLEETLKIQQEGRVRRREAEAELARLEQELKNRMAAMVIGGEYR
FT                   "
FT   gene            complement(5625..6254)
FT                   /locus_tag="HM1_0009"
FT   CDS_pept        complement(5625..6254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0009"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82634"
FT                   /db_xref="GOA:B0THW1"
FT                   /db_xref="InterPro:IPR018770"
FT                   /db_xref="UniProtKB/TrEMBL:B0THW1"
FT                   /protein_id="ABZ82634.1"
FT                   /translation="MKEIVISGLRIFFSGSIAVTTFLVTYLLGGIEIVPALVLGGVAYF
FT                   VTSKGIQRRFALPPARHSLIDGTDPHYLEKTHKEARRKWKVIGRYRFKVRSLSIWLKVT
FT                   RLYKIAEQILDITEKDLRQISKVQSFFNHYLDATVTILDKYSLLSSQPISNDEIRNALE
FT                   KTHAGLQDLIHAYEEQLNKLLAKDLLELEVEVNVLKQTLDSKGEKK"
FT   gene            complement(6338..6517)
FT                   /locus_tag="HM1_0010"
FT   CDS_pept        complement(6338..6517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82635"
FT                   /db_xref="UniProtKB/TrEMBL:B0THW2"
FT                   /protein_id="ABZ82635.1"
FT                   /translation="MLTVIHWAIIDFNHRESSFCDDYSGRMPPFPITNRGEKQGLRLSP
FT                   RGRQVNPCFVDPFF"
FT   gene            6476..7291
FT                   /locus_tag="HM1_0011"
FT   CDS_pept        6476..7291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0011"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82636"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:B0THW3"
FT                   /protein_id="ABZ82636.1"
FT                   /translation="MVEINDRPVNDRQHNRLHHHGNDRLHHQSIEDFVGELTAFASPQV
FT                   FNPWRDYHPDTDISPDAPEIRRVHLKQYLRLRKEAKFLFVAEAAGYQGGHFSGVALTSE
FT                   RMLLGNHTDISPAMILGGHMAGRTSSPASPHLKPAQRASGFAEPTATVVWKEILHNGLS
FT                   PFEVILWNIFPFHPYNAKKGLLSNRTPTKKELAVGATFLGKLLTVAPGAEDLLVIAIGG
FT                   HAAETLAKMGVPHRHVPHPSNGGTPGFRRGMRGILQLEGLKSQLRRSFP"
FT   gene            7433..7561
FT                   /locus_tag="HM1_0012"
FT   CDS_pept        7433..7561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0012"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82637"
FT                   /db_xref="UniProtKB/TrEMBL:B0THW4"
FT                   /protein_id="ABZ82637.1"
FT                   /translation="MLLLTLVQFRNHAFNEIDIFSGSSMCKKGTGQTQKGKPPAQR"
FT   gene            7836..9458
FT                   /locus_tag="HM1_0013"
FT   CDS_pept        7836..9458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0013"
FT                   /product="transposase, is4 family"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82638"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B0TAA0"
FT                   /protein_id="ABZ82638.1"
FT                   /translation="MFRFDVDPQVSFYDFAALWDQLVPADSVFRLFRELAPLLIQPEDF
FT                   TGLYCLDNGRPSHAARQMTMACMLQEMLGETDRGMEAQTRVNIEVKFALGMALDEPGID
FT                   HANFGVHRQRLIQKELDKVYLDRFIRLMYYLGVLTGKEPWITDTTHVIAPISAPTTIEL
FT                   IRQAMRLLVRLLAKQYSVPWHAIPHAPRAVRYLETVTEVKEHNLDDKAKMERLVEVVSE
FT                   ADELLAYVESSEASWKKKPDVIHYALLLCRILRERIIRKDDGTLEIAPGGSVKDMIVSA
FT                   VDSEARFGCKGKTKWRGYKMAIVEVGNSGFIAAAEAMKANDYDGSSLVPLADQLPTDCV
FT                   ENPTIIGDTHYGAGDDRVTLKEKGIDVVAPLSPKTKCDILAGEGFQVSEDQTQLICPRG
FT                   KVITTYSEVADGKNFVLRAKDHDCKHCPRYTTCFKEKKHRRTIFIHNAYGVMLEAAKHS
FT                   QTKIYKEQMRLRSRIEAKQNELVNRYGLRRVRRIGKRNLAYAARLSALAANFQKLNRLR
FT                   NDKNATMVLEVSALRGVAFKKAA"
FT   gene            complement(9497..9826)
FT                   /locus_tag="HM1_0014"
FT   CDS_pept        complement(9497..9826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0014"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82639"
FT                   /db_xref="GOA:B0THW6"
FT                   /db_xref="UniProtKB/TrEMBL:B0THW6"
FT                   /protein_id="ABZ82639.1"
FT                   /translation="MSSITNQTTVDPIHAKAKADGSAVSKVKGIISVTLALLGLVVAVT
FT                   GLGLFIAPHGPSAAKGWTFLGMTVSTMRGRLENKQIPSQPLQKHDFLIQTAKNQSLFIG
FT                   LSSPF"
FT   gene            complement(10109..11989)
FT                   /gene="htpG"
FT                   /locus_tag="HM1_0015"
FT   CDS_pept        complement(10109..11989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htpG"
FT                   /locus_tag="HM1_0015"
FT                   /product="heat shock protein htpg"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82640"
FT                   /db_xref="GOA:B0THW7"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR019805"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037196"
FT                   /db_xref="UniProtKB/TrEMBL:B0THW7"
FT                   /protein_id="ABZ82640.1"
FT                   /translation="MTVKQFQAESKRLLDLMVNSIYTHKEIFLRELISNASDAIDKIYY
FT                   KALTDESLHFNKEDYFIRVEVDKPNRLLKIIDTGIGMTSTEMEENLGVIAKSGSFAFKK
FT                   ENELKDGFDIIGQFGVGFYSAFMVADVVTVISRALGSDRAYKWESKGAEGYTIEPWTKA
FT                   TVGTEVILKIKANTDDENYDEFLEEYRIKSIIKKYSDFIRYPIKMDVTKSRLKAGSDKE
FT                   YEQYTEEQTLNSMVPIWKKNKNELTKEDYENFYAEKHFGFDKPIRYIHINAEGTISYKA
FT                   VLFIPEKMPFDFYTKDYEKGLELYANGVLIMNKCADLLPDYFSFVKGMVDSEDLSLNIS
FT                   RELLQHDRQLKLIAKNIKAKIKSELEDLLQNDRDQYVEFFKSFGKQLKYGLYSDFGAHK
FT                   DVLQDLLLFYSSKEKKLVTLSEYVSRMPEKQKYIYYAAGDSIERIDKLPQTELVADKGY
FT                   EILYFTDDVDEFAIRMLRTYKEKEFKSVSSSDLGIEAEENKEASEADKQENQALFAEMK
FT                   TLLADKVKAVKASKRLKQHPVCLSNEGDLTIEMEKILKTMPNNPDIKADKVLEINVNHA
FT                   VFQALKAARQEDPEKFKLYTDLLYNQALLIEGLPVEDPVAFSNNICKIMA"
FT   gene            complement(12387..12509)
FT                   /locus_tag="HM1_0016"
FT   CDS_pept        complement(12387..12509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0016"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82641"
FT                   /db_xref="UniProtKB/TrEMBL:B0THW8"
FT                   /protein_id="ABZ82641.1"
FT                   /translation="MPSEKKLRRTINSRGSKMATKIFLNQKNTDKINNTGNRNN"
FT   gene            complement(12861..14204)
FT                   /locus_tag="HM1_0017"
FT   CDS_pept        complement(12861..14204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0017"
FT                   /product="transposase, is4 family"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82642"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B0TCH3"
FT                   /protein_id="ABZ82642.1"
FT                   /translation="MTMKKFIIEQSNEELTPVTGLALVGALLRKTSLKLRLDKSTVPTC
FT                   LTPDISHGTVALSYLGLLCQGKNDFDAIELARGDDFFRYAMGVDIVPSSPTLRQRFEKV
FT                   VETDLKWNDIIMEESARLIKKAKAPLTPVRVGATDYLTVDVDVTPLDNSGSKKEGVTRT
FT                   YKGHDGFAPILAYLGQEGYCINVELRPGKDHSQKGTPQFLTKSINYARQCGAEKLLVRM
FT                   DSGFDSVDNIRVLRAENVDYIIKRNLRQETPEMWRDIALKNGQARIVREGKVEYMGSVM
FT                   WKVGNMEQRERVVFHVVERTILSNGQQLLLPELEVATYWTSLPVSPEELIHLQRDHGTS
FT                   EQFHSELKTDLDLERLPSGKFKVNDLVFHFGALAYNLLRIVGQMSLHHPDSPLKRKAHT
FT                   QRRRIRTVLQNVITIASRLVRHARQVKLRLGAHSPWYATFKDLYLAFS"
FT   gene            14437..14802
FT                   /locus_tag="HM1_0018"
FT   CDS_pept        14437..14802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0018"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82643"
FT                   /db_xref="UniProtKB/TrEMBL:B0THX0"
FT                   /protein_id="ABZ82643.1"
FT                   /translation="MWKEVIKNKALYAESKKQKLDVSLDEAKQFALESAKAFETIEPSP
FT                   SKAEAEAYLAGLELTPREYFEKVAPSEYQIGMSIGRLKAKLYEEKKVDPSSPIDVLDKV
FT                   FDEYTNTIVRNAKVVRN"
FT   gene            complement(14976..15302)
FT                   /locus_tag="HM1_0019"
FT   CDS_pept        complement(14976..15302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0019"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82644"
FT                   /db_xref="GOA:B0THX1"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B0THX1"
FT                   /protein_id="ABZ82644.1"
FT                   /translation="MRRNRYPKELKEQLIQEAMEAGNATQVARRHGIDPKRLYYWIRES
FT                   QHKGFQEAPAEAKQIAPYVPSAQEFKRLESENIALKKLLGEKTLEIQILQDLIKKKNPS
FT                   YRKN"
FT   gene            15385..15579
FT                   /locus_tag="HM1_0020"
FT   CDS_pept        15385..15579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0020"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82645"
FT                   /db_xref="GOA:B0THX2"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="UniProtKB/TrEMBL:B0THX2"
FT                   /protein_id="ABZ82645.1"
FT                   /translation="MKRHEKGILRWFVSNITNGLQEGINSLIQAVKRKARGYRSVRNFI
FT                   SIIYLVAGGLDISVAPANT"
FT   gene            15598..16254
FT                   /locus_tag="HM1_0021"
FT   CDS_pept        15598..16254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0021"
FT                   /product="udp-glucuronosyltransferase family, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82646"
FT                   /db_xref="GOA:B0THX3"
FT                   /db_xref="InterPro:IPR002213"
FT                   /db_xref="UniProtKB/TrEMBL:B0THX3"
FT                   /protein_id="ABZ82646.1"
FT                   /translation="MFTHTKQRRANYVFPRPGDWNSHIHQSGYWFVEEPTDYQPSEALI
FT                   RFLQAGEKPVYIGFGSVFDTDEKDAMSTRVIEALAKSGRRGILCGMGEWRDLPDHVFAV
FT                   DSIPHSWLFERVSAVCHHGGAGTTVAGFKAGVPSIIVPFANDQFAWAHRAHDLGVGAKP
FT                   IPVKKLTADNLAEAIRFVHNDHVVASAKMLATHMASENGARDCAKVIVDCLEGKA"
FT   gene            16272..16406
FT                   /locus_tag="HM1_0022"
FT   CDS_pept        16272..16406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0022"
FT                   /product="macrolide-efflux protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82647"
FT                   /db_xref="GOA:B0THX4"
FT                   /db_xref="UniProtKB/TrEMBL:B0THX4"
FT                   /protein_id="ABZ82647.1"
FT                   /translation="MEKAFFTMYAGQAISILSSQAVQFLILWWITVQTGSALLPWPSR"
FT   gene            16530..16670
FT                   /locus_tag="HM1_0023"
FT   CDS_pept        16530..16670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0023"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82648"
FT                   /db_xref="UniProtKB/TrEMBL:B0THX5"
FT                   /protein_id="ABZ82648.1"
FT                   /translation="MVITVTGGLQRQFLMISLDALESGLLTESPPQIRNDIVVVSGKTM
FT                   R"
FT   gene            16982..17491
FT                   /locus_tag="HM1_0024"
FT   CDS_pept        16982..17491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0024"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82649"
FT                   /db_xref="UniProtKB/TrEMBL:B0THX6"
FT                   /protein_id="ABZ82649.1"
FT                   /translation="MVVVAEKEVKKVADLTIPAPVGVGLDPHTGQLTASVELEPFGEPQ
FT                   LQPKIINNMVINEGIICVKLIVKDNDPAPCPDVRKGFEKKICIPVQTVLECKGIQPDDD
FT                   IQEKVCISALSVFAVPANSTTGTAGNVVNLILKAILDVKMVIAREEVITIPVHQESDPD
FT                   CGQWHD"
FT   gene            17577..18086
FT                   /locus_tag="HM1_0025"
FT   CDS_pept        17577..18086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0025"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82650"
FT                   /db_xref="UniProtKB/TrEMBL:B0THX7"
FT                   /protein_id="ABZ82650.1"
FT                   /translation="MSHSFDFIDDRFFDQRIKVPKVICQKFVQEIGDLMVPAPAGVTLD
FT                   VQTGKLNQMVRLEWVGPPQLRAVTVLPNKVINQGVVPVRLLVDNIVAIQLLEIPFQGVI
FT                   DCPGASPGDIVQKHDVQIEGFSINPVQILTEGVLTLHLILKVALHLCLVVASERILKVN
FT                   AAETFC"
FT   gene            18270..18794
FT                   /locus_tag="HM1_0026"
FT   CDS_pept        18270..18794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82651"
FT                   /db_xref="UniProtKB/TrEMBL:B0THX8"
FT                   /protein_id="ABZ82651.1"
FT                   /translation="MAFVNQIQQATFFPQNLKSLRVLCQQCVQETGDVIIPLPTVPALA
FT                   DIVNVTVVPTGNPEIRTTTVLPGKVVNMGVVPVSVTITILGVVLPITIPLIEIPFEGIV
FT                   ECPGAQPGDIVQKHDIALEAVVSQPVQLLPVVGEALVVGLELQAIVKACIVVGREEVLT
FT                   VNAANPFCNCP"
FT   gene            complement(18927..19403)
FT                   /locus_tag="HM1_0027"
FT   CDS_pept        complement(18927..19403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0027"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82652"
FT                   /db_xref="UniProtKB/TrEMBL:B0THX9"
FT                   /protein_id="ABZ82652.1"
FT                   /translation="MRIVSVSNLKSGDVLAKNIYASDRRVLLSQGVALTSGYIARMVNL
FT                   GVSKVYIQDKRLEDVTIDEPLTEKTRNAAIQIIEDITDTIPVKKDGLLTLNDDELNRIS
FT                   NKFNSGRFIGVVKDIISELIGKMDIMVHLADDKVAFKEYDMTKDLTLFIKEVID"
FT   gene            complement(19756..21378)
FT                   /locus_tag="HM1_0028"
FT   CDS_pept        complement(19756..21378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0028"
FT                   /product="transposase, is4 family"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82653"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B0THY0"
FT                   /protein_id="ABZ82653.1"
FT                   /translation="MFRFDVDPQVSFYDFAALWDQLVPADSVFRLFRELAPLLIQPEDF
FT                   TGLYCLDNGRPSHAARQMTMACMLQEMLGETDRGMEAQTRVNIEVKFALGMALDEPGID
FT                   HANFGVHRQRLIQKELDKVYLDRFIRLMYYLGVLTGKEPWITDTTHVIAPISAPTTIEP
FT                   IRQAMRLLVRLLAKQYSVPWHAIPHAPRAVRYLETVTEVKEHNLDDKAKMERLVEVVSE
FT                   ADELLAYVESSEASWKKKPDVIHYALLLCRILRERIIRKDDGTLEIAPGGSVKDMIVSA
FT                   VDSEARFGCKGKTKWRGYKMAIVEVGNSGFIAAAEAMKANDYDGSSLVPLADQLPTDCV
FT                   ENPTIIGDTHYGAGDDRVTLKEKGIDVVAPLSPKTKCDILAGEGFQVSEDQTQLICPRG
FT                   KVITTYSEVADGKNFVLRAKDHDCKHCPRYTTCFKEKKHRRTIFIHNAYGVMLEAAKHS
FT                   QTKIYKEQMRLRSRIEAKQNELVNRYGLRRVRRIGKRNLAYAARLSALAANFQKLNRLR
FT                   NDKNATMVLEVSALRGVAFKKAA"
FT   gene            complement(21854..22075)
FT                   /locus_tag="HM1_0029"
FT   CDS_pept        complement(21854..22075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0029"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82654"
FT                   /db_xref="UniProtKB/TrEMBL:B0TA91"
FT                   /protein_id="ABZ82654.1"
FT                   /translation="MVPRQASPGKNVAFPSIYPPHLLSAAFGDKDFALFGKLIQLPLAS
FT                   PGVRGPRAGGLPLASFRFRLAADTLALS"
FT   gene            22176..23603
FT                   /locus_tag="HM1_0030"
FT   CDS_pept        22176..23603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0030"
FT                   /product="reverse transcriptase (RNA-dependent DNA
FT                   polymerase)"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82655"
FT                   /db_xref="GOA:B0TA92"
FT                   /db_xref="InterPro:IPR000123"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:B0TA92"
FT                   /protein_id="ABZ82655.1"
FT                   /translation="MMEGEATMRSRDAQRQPNIPKGNCQREEAVNPQGTGGVPSALPAQ
FT                   EAKQPREETYDLMEKVVERGNMTEAYKRVMANKGAAGIDGMGLESLRPYLKEEWSRIKQ
FT                   ELLEGTYRPQPVRRVEIPKPQGGTRKLGIPTVVDRLIQQALNQILMPIFDPDFSTNSYG
FT                   FRPGKSAHQAVKKAKEYIADGYRWVVDMDLAQFFDRVNHDILMARVARKVKDKRILKLI
FT                   REYLKAGVMLNGIRVKSEEGTPQGGPLSPLLANIILDDLDKALESRGHRFCRYADDCNV
FT                   YVRSRRAGQRVMEGMAKFLEGRLKLQVNWEKSAVDRPWNRKFLGFSFTWHKAAKIRLAP
FT                   QTVKRVKEKIRQFTGRNRSIAMEDRLVTLNQYLKGWMGYFRLIDTPSVLKELDEWLRRR
FT                   LRMCLLKQWKRPKTRRRNLVALGIPEEWACNISGSRKGYWRLSLTPQMNKALGLAYWRE
FT                   QGLVSLVETYQSHRQPA"
FT   gene            complement(23655..24968)
FT                   /locus_tag="HM1_0031"
FT   CDS_pept        complement(23655..24968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0031"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82656"
FT                   /db_xref="GOA:B0THY3"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:B0THY3"
FT                   /protein_id="ABZ82656.1"
FT                   /translation="MQSVAQPLEEVQKIFCRTPGGKKAGRLIQHFTQYASKVYGFSQMV
FT                   RQAKDGRKQPRIKAPAIFTVAFFGAFFCMESMERMDRWRKTGVFRQLVPKNIRLPSHDT
FT                   VRQALMKWDLREQRKQHNCVIQRYKEQRGPQKESINGWRVTAIDGVELFHTKAYRCPEC
FT                   LTREHRDKTTDYYHAVVVAQQVGGSANLIYDWEMRKPQDGVDKDEGETTVAQRLIRRMA
FT                   ETYGKITDVYTLDALFAKAPVIHAALDAGAHVVVRMKEERRRIMKEANACFANRLPDST
FT                   WEERDGKGNTVYVQAWDEEGLAQWPQVRVPMRIVKIIRHTNKTVIEANKEVFVTDVVER
FT                   WIATTCSSEKADTQTIAQIAAARWDIENIGFRNLKTFNALDHCFVHDSVAIKAMIGFQV
FT                   LAFNLKRLFSFHHLPASSRNRDVPLRYLIDEMRSSRRG"
FT   gene            25203..25607
FT                   /locus_tag="HM1_0032"
FT   CDS_pept        25203..25607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0032"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82657"
FT                   /db_xref="GOA:B0THY4"
FT                   /db_xref="UniProtKB/TrEMBL:B0THY4"
FT                   /protein_id="ABZ82657.1"
FT                   /translation="MVKPNFIYIAAIVAIIGALPFYFSIKNSSSAPTAEYISITYSDYN
FT                   TDNTSDKITTQILTLDCPSKEIKKVFEFDYTSQYPLGYCDKKDQLVYFTKRIGDDQNYG
FT                   DQIFVSNLLDKKETQLTYNLFAVNYIILNP"
FT   gene            complement(25836..27179)
FT                   /locus_tag="HM1_0033"
FT   CDS_pept        complement(25836..27179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0033"
FT                   /product="transposase, is4 family"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82658"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B0TA31"
FT                   /protein_id="ABZ82658.1"
FT                   /translation="MTMKKFIIEQSNEELTPVTGLALVGALLRKTSLKLRLDKFTVPTC
FT                   LTPDISHGTVALSYLGLLCQGKNDFDAIELARGDDFFRYAMGVDIVPSSPTLRQRFEKV
FT                   VETDLKWNDIIMEESARLIKKAKAPLTPVRVGATDYLTVDVDVTPLDNSGSKKEGVTRT
FT                   YKGHDGFAPILAYLGQEGYCINVELRPGKDHSQKGTPQFLTKSINYARQCGAEKLLVRM
FT                   DSGFDSVDNIRVLRAENVDYIIKRNLRQETPEMWRDIALKNGQARIVREGKVEYMGSVM
FT                   WKVGNMEQRERVVFHVVERTILSNGQQLLLPELEVATYWTSLPVSPEELIHLQRDHGTS
FT                   EQFHSELKTDLDLERLPSGKFKVNDLVFHFGALAYNLLRIVGQMSLHHPDSPLKRKAHT
FT                   QRRRIRTVLQNVITIASRLVRHARQVKLRLGAHSPWYATFKDLYLAFS"
FT   gene            complement(27273..27626)
FT                   /locus_tag="HM1_0034"
FT   CDS_pept        complement(27273..27626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82659"
FT                   /db_xref="UniProtKB/TrEMBL:B0THY6"
FT                   /protein_id="ABZ82659.1"
FT                   /translation="MEDLKTKVLSNVKEAVNGKFDSEKKPAVIFDPFSGIVSIEARAAD
FT                   NFTKSWIRKGIAYDIANTLQAISLDEKGFNYVSDRKSAPVYGIEKVIFVITFPMIDAYG
FT                   KESEGTIPESVTG"
FT   gene            complement(28264..28413)
FT                   /locus_tag="HM1_0035"
FT   CDS_pept        complement(28264..28413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82660"
FT                   /db_xref="UniProtKB/TrEMBL:B0THY7"
FT                   /protein_id="ABZ82660.1"
FT                   /translation="MPGEWRFDVLTIEEFRREHYKMVGGGEILAAKIKTTDDLHEWYRK
FT                   EFGF"
FT   gene            complement(28781..29125)
FT                   /locus_tag="HM1_0036"
FT   CDS_pept        complement(28781..29125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0036"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82661"
FT                   /db_xref="UniProtKB/TrEMBL:B0THY8"
FT                   /protein_id="ABZ82661.1"
FT                   /translation="MNTARISPTFTKEMEQIRSMKPQFFDRESLGYLPPLARLLFLGLY
FT                   CRVDKEGRLQDKPRTIKKAILGYDDVTAGQVDGMLQELHNAGLIIRYQAKGSSFIQVVD
FT                   FGAASNQFTD"
FT   gene            complement(29138..29446)
FT                   /locus_tag="HM1_0037"
FT   CDS_pept        complement(29138..29446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0037"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82662"
FT                   /db_xref="UniProtKB/TrEMBL:B0THY9"
FT                   /protein_id="ABZ82662.1"
FT                   /translation="MKKTIYQLACFLQEENDTYAISTEDFKEDTELAQEEILNLLTVKI
FT                   GKSAAEDKLNIFKTAMYDQGYIDGLRVGAQLARMLAGETDTIKITEKHDPTTNQLQR"
FT   gene            complement(29468..30442)
FT                   /locus_tag="HM1_0038"
FT   CDS_pept        complement(29468..30442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0038"
FT                   /product="phage gp37/gp68, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82663"
FT                   /db_xref="InterPro:IPR011101"
FT                   /db_xref="UniProtKB/TrEMBL:B0THZ0"
FT                   /protein_id="ABZ82663.1"
FT                   /translation="MMNKSEIEYCDFSWNPVTGCRTGCEYCYAAKQAKRFSGDVRINRG
FT                   SGQLQRDENGLYILEKPFKNQSGKVIPCPVGFVPTLHRYRLASPKQKKKAANILTCSLS
FT                   DLMAPWIPEKWIIEVFEACEAAPWHNYLFLTRYPERYEQMSSAGQLPRSRNFWYGTTVT
FT                   RSADLDRIVYLPRKQHNQFISIEPVMEAIDIEDLTFMDWIIVGAETGSRRGKVKPKREW
FT                   IEAIVQTARAAGIPVMMKHSKEMEEIWGEELIQELPAALSRPEDKPIPHCSDCEHHRAT
FT                   ERHYDSVKATMMMNHTCEHGKTPQRVPGRYARTSPPWCPLRSE"
FT   gene            complement(30759..30914)
FT                   /locus_tag="HM1_0039"
FT   CDS_pept        complement(30759..30914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0039"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82664"
FT                   /db_xref="UniProtKB/TrEMBL:B0THZ1"
FT                   /protein_id="ABZ82664.1"
FT                   /translation="MTNGAAIGYMIRAAKKAALDEKTIRLLEALMLEQMDFHTEEEAEQ
FT                   TYRSFY"
FT   gene            complement(30925..31248)
FT                   /locus_tag="HM1_0040"
FT   CDS_pept        complement(30925..31248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82665"
FT                   /db_xref="UniProtKB/TrEMBL:B0THZ2"
FT                   /protein_id="ABZ82665.1"
FT                   /translation="MKSIEERHQEDLAHGRMVWVRFPDRPMCRHLTMTEFEEAKKEFNR
FT                   KAIEVQKETGADCVIYATKTYNEDGSIRTAGLDIIPLDREEYDRRVQSLGSKDEMVYTV
FT                   YKR"
FT   gene            complement(31738..32148)
FT                   /locus_tag="HM1_0041"
FT   CDS_pept        complement(31738..32148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0041"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82666"
FT                   /db_xref="UniProtKB/TrEMBL:B0THZ3"
FT                   /protein_id="ABZ82666.1"
FT                   /translation="MIATKEQERKTLEKIKQMVDELGENSYLAAAFTGAFELAEQNIEN
FT                   DWGITTQEYIDRAIKADENENRAKKELAAVKAELEGVRSAHRGTTKALEETCERAKRYA
FT                   YEIDSLKEAMKAAKLEITTLKAKLYDYMTAAS"
FT   gene            complement(32145..32339)
FT                   /locus_tag="HM1_0042"
FT   CDS_pept        complement(32145..32339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0042"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82667"
FT                   /db_xref="InterPro:IPR024356"
FT                   /db_xref="UniProtKB/TrEMBL:B0THZ4"
FT                   /protein_id="ABZ82667.1"
FT                   /translation="MLNPRNLANGQEQYETFKSNITRKTAVQYDYRHTDGELFSCVKPT
FT                   LEACRQAKENWIAKKEAQQ"
FT   gene            32501..32716
FT                   /locus_tag="HM1_0043"
FT   CDS_pept        32501..32716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0043"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82668"
FT                   /db_xref="GOA:B0THZ5"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B0THZ5"
FT                   /protein_id="ABZ82668.1"
FT                   /translation="MSVSEQLKILCVKLGISVSELGRISGKSPQAFSQKMKRESFTVDE
FT                   LKQIAEAAGCRYEGAFITPSGEKVTY"
FT   gene            32925..33680
FT                   /locus_tag="HM1_0044"
FT   CDS_pept        32925..33680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0044"
FT                   /product="fic family protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82669"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:B0THZ6"
FT                   /protein_id="ABZ82669.1"
FT                   /translation="MTIYEKIDRCHKAISEVRPFEGHMLKQLKDYYRIGLTWSSNAIEG
FT                   NTLTISETKVVLEDGLTIGGRPLRDFYETVGHGQAYDFMFTLIGERRITVEDIKTMHRL
FT                   FYKSIDEANAGTWRKESVIVSGTEYVFPRPQEIDGQMRKLEKWVKAERKNYHPVTFAAL
FT                   LHLKFVSIHPFIDGNGRTSRLIMNLALIQDGYQLAIIPPVLRPEYNDTIRQYQNKGKSE
FT                   PFCEFIAERVYETQKEIMRLLHIPFPELS"
FT   gene            complement(33810..34079)
FT                   /locus_tag="HM1_0045"
FT   CDS_pept        complement(33810..34079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0045"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82670"
FT                   /db_xref="UniProtKB/TrEMBL:B0THZ7"
FT                   /protein_id="ABZ82670.1"
FT                   /translation="MKYGRLVATRGIAEEMESDLAFAREIAAAFGRYQRHDWGDLCQED
FT                   KTLNDQAVESGDRVMAAYLTSKGKIWIITEWDRSATTILFPSEY"
FT   gene            34239..34574
FT                   /locus_tag="HM1_0046"
FT   CDS_pept        34239..34574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0046"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82671"
FT                   /db_xref="UniProtKB/TrEMBL:B0THZ8"
FT                   /protein_id="ABZ82671.1"
FT                   /translation="MITATRYTVEYDEARSVYRIRNMEAPVCPQCGLLLSGYDTKKRHV
FT                   IDSSGAVRWFLLRRLRCPGCGKLHIELPDFMQPKKHYEAQLIMDVLAGHSDSCPADDST
FT                   IRRWKKK"
FT   gene            34660..35136
FT                   /locus_tag="HM1_0047"
FT   CDS_pept        34660..35136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0047"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82672"
FT                   /db_xref="GOA:B0THZ9"
FT                   /db_xref="UniProtKB/TrEMBL:B0THZ9"
FT                   /protein_id="ABZ82672.1"
FT                   /translation="MKNNIITMAAVSLITAVIALSGVLIGTNLAGRDSMPDTGARNSTA
FT                   ATVETTPVEIPKTIAIPGYAQLVMKAGDIVQNVELHNPAGNPCYFVISIILPDGTEVYR
FT                   SGLIEPGQKTDAIRLSQPLKAGTYKGAVLRYSCYSTKDKAPMNGADTKFTLEVV"
FT   gene            complement(36580..39891)
FT                   /locus_tag="HM1_0048"
FT   CDS_pept        complement(36580..39891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0048"
FT                   /product="tape measure protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82673"
FT                   /db_xref="InterPro:IPR013491"
FT                   /db_xref="UniProtKB/TrEMBL:B0TI00"
FT                   /protein_id="ABZ82673.1"
FT                   /translation="MGETFRVEIPINVRDNTDPGISQATRKVSAFDRANQKTQERLEKM
FT                   NRSRYQVILEALDRASSIIGHVSTKARSIAGRTYSFTMKVVDMATAPLKSIWNFATSLQ
FT                   GVILGGSLTAVGFKGLQLSGEMDRAKKSIDFFTGSAEEGTKAFQELVNQAIKSPLYEVP
FT                   FVVQTAGQLLAAGKNIEFVKRALKDFEQTAYYTGASMSQIELAFYGFKQISAVGTLQME
FT                   ELRQVTENLNLPLQWVIEELGLTGKAAKNLGDAAIPANEAMEAILKTMEKRFPAKDMQD
FT                   DLLALESALKETGRMFLWAFGRGMSGPVMRIMQDLSAQLDPTGKKFNSFAGSLEYAGKV
FT                   VGEKLEQIYKDVKEFLDKFNQGELKNMGLGDKLIYGIEYGLDEASKWLQGAGGKKVEKV
FT                   FVEMAEIAGRAWMTALGATLKGAGNAAREGNWSGAAALGGMAWMLGAGTLLGIVGKGGK
FT                   AAIAGGKGLWKTGKWLFGKGSKAADAAADAAKVAGAAAGAADDVADIAKTTKNLKDAAE
FT                   SFRAAANASKEAEKAVKTAEALKTAKQADLEKSARLLKELKKEAAKFGDDIPKGLSGKI
FT                   MAAEKAVAKGRVDVKKAASHLDDMVNLKNLKAIDYANAREGFVVAKDVANAAKVADKAG
FT                   DVAGKTGIFSKIAGWFGKSGDDVLKAGSKAAGKGIKGIPVLGTLLGLAASGAVVASAAP
FT                   ENRGRETAGEVGSWLGAIGAGAGAGALVGTLGGGPIGTAVGGIVGGIGGAIGGEAFTEW
FT                   LYDQKDAIASMGGKVKTAISEFGTKAGESISRFFTETIPNFVTEQIPYAIGYATGSIGK
FT                   FFTVTLPQVWNDLWTAVGNFFTETIPAWANGAYNTAVNFFTVSVPTFFTNLWNSVYGFF
FT                   TETLPTWATGAFNKANEFFTQKVPEFFTDLWSSVSTFVTEKIPEYAKALKDSVIGWFGS
FT                   FRDWASNIWDKVKSSFSAGYEAGSSGGSNVAKHAWGGIMTKPHMGIVAEDGAEGIIPLS
FT                   PSKRARGLDLWWRTGELLGVRPYGNGGIAGDIPTASAVPVSVGTGNVTQYIQARVEKVE
FT                   VHPAFHIEGDNLDEENVVTIIKGRIREMADDIGDELAERLARIFANMPVKGGAGA"
FT   gene            complement(39977..41374)
FT                   /locus_tag="HM1_0049"
FT   CDS_pept        complement(39977..41374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0049"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82674"
FT                   /db_xref="UniProtKB/TrEMBL:B0TI01"
FT                   /protein_id="ABZ82674.1"
FT                   /translation="MQSNSLKELGRIGQRRYGGFFYEEFLKDLQGRKGIEVYKEMSEND
FT                   DVIGAILYAIEMLIRQASWSVQPGGPTAKDQEAADFIYSCMDDMSDTWTDTISEILSFL
FT                   TFGWSAHELVYKRRLGRNSDPRLKSKYTDGLIGWQKLPIRAQDTLWEWLYDDNDNLLGM
FT                   AQMPPPTFEIIQIPIEKLLLFRTKSRKGNPEGRSILRNAYRSWYFKRRIQEIEGIGIER
FT                   DLAGFPVLKAPEGMNIWDEDDPDMTAIRLLTEKIVQNIRRDSMEGLSLPAGWELQLLST
FT                   GGRRQFDTNAIIERYDTRIAMTVLADFVLLGHQQVGSFALSSDKTELFSMAVGAYLDII
FT                   CEVFNNQAIPTLIDLNGEHFSGITDYPTLEHGDIESADIQALAAYIKDMTGVGVLVPDD
FT                   HLEDYVREAAGLPERLDEGTDPNPRQPKRQSSNVKPGKGTYSDIPEELEDDEEAVKKAK
FT                   ERLGRYG"
FT   gene            complement(41408..41701)
FT                   /locus_tag="HM1_0050"
FT   CDS_pept        complement(41408..41701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82675"
FT                   /db_xref="UniProtKB/TrEMBL:B0TI02"
FT                   /protein_id="ABZ82675.1"
FT                   /translation="MSSLYNGKSLTDVIERQKAEDRELYQRRQELQRQADERAAAAREA
FT                   NEKSSFEKILDKQELARQLVDSIQSGNPRNEEYMTQALKQMCDVLDFLLKSR"
FT   gene            complement(41729..42682)
FT                   /locus_tag="HM1_0051"
FT   CDS_pept        complement(41729..42682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0051"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82676"
FT                   /db_xref="UniProtKB/TrEMBL:B0TI03"
FT                   /protein_id="ABZ82676.1"
FT                   /translation="MEISIQDLIEAEECSKIPIKKRYQTIKRALNRYKCGKSRPEEREI
FT                   LVEAMRSYRRLAFKENQTRAYNVLLYSYFSSRTLTPEQIMRLFNINKRTVFKDIGTGVR
FT                   DLTFLLYGIDGFDWRMKEERIMEEKMKEQITKRLTVELEQEVRNECRAFFEECQLMNIT
FT                   CEGRADLQERLQALIKRQLTEEFAQDIVEREECSDLEIKARQQQVREALRRYKKGKSTP
FT                   GERKELIQAMERYRTTAINEKQDKAYNILFYFYFADYPLKTIQISDRFRIARRTIFKYI
FT                   TRGVEDLTDIMYGTGGICLNPDDVNKAALSNTQTAN"
FT   gene            complement(42697..43413)
FT                   /locus_tag="HM1_0052"
FT   CDS_pept        complement(42697..43413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0052"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82677"
FT                   /db_xref="GOA:B0TI04"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="UniProtKB/TrEMBL:B0TI04"
FT                   /protein_id="ABZ82677.1"
FT                   /translation="MTNEELAIMAAQGDTESLHKLYFAVAPLIYKITSRYFKYCETNRK
FT                   GVRPEDLTQCGYFAYLSALKQYSPERELKFTSYLDFCVARECWRELGISFQTGGKVLNR
FT                   EVETISLETPISDDEEGLTLEDIISDPDADTYSFCELNDMRLIVRREIERLSPREQCVI
FT                   YGIFYNNKTIEGLAQEFGCELGTVLSVRDTAFNSLRRSKGIRELRKAYNWNNKRPSYLD
FT                   PEKIKGLLGDSGLEPI"
FT   gene            complement(43530..44546)
FT                   /locus_tag="HM1_0053"
FT   CDS_pept        complement(43530..44546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0053"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82678"
FT                   /db_xref="InterPro:IPR025400"
FT                   /db_xref="UniProtKB/TrEMBL:B0TI05"
FT                   /protein_id="ABZ82678.1"
FT                   /translation="MARPRKTGLDYFPHDVDVTTDPKIEPAIMRYGAAAYAFYFVHLEY
FT                   CYRSDDLTVDISATETGAEMREVIQRKLHIDEQQYDNILQSFLRHGAFDADFYAKTGKL
FT                   TSHGIQKRARKVFEKREREAERYESKISAPISAAETGAEMTQSIAKKSIENKSTEKKSI
FT                   ATTPLTPAGGSAAPVINIQEKRFEEFWAAYPKKTGKQAAFKSWQRVKPTAELHAKIIKA
FT                   VATAKRTEQWQRENGRFIPNPATWLNQGRWDDEYEEVTQPYGSNSQHSRFKLAWEEDDN
FT                   DTVINKQHTGPNKAGGFALSGFHRAEDAEWCKDDDADEPKKQDGGALAGFKQSDDSG"
FT   gene            complement(44609..44836)
FT                   /locus_tag="HM1_0054"
FT   CDS_pept        complement(44609..44836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0054"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82679"
FT                   /db_xref="UniProtKB/TrEMBL:B0TI06"
FT                   /protein_id="ABZ82679.1"
FT                   /translation="MSNANIDIRKEAKQANVAHWQIAKRLGYAESTFCRKLRDELTPEE
FT                   KAKVRQAIRELVAMKRGGGSDGNMREAYGI"
FT   gene            45075..45656
FT                   /locus_tag="HM1_0055"
FT   CDS_pept        45075..45656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0055"
FT                   /product="helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82680"
FT                   /db_xref="GOA:B0TI07"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B0TI07"
FT                   /protein_id="ABZ82680.1"
FT                   /translation="MRECFSERLRGLRKGRKLSQNELGAALGLSRGSISYYEKQSRTAP
FT                   IDVLYVVADYFNVSADFLLGLKEEPDPDIAQLKPGPHRSSLYPPPLAAKEAAALVSQQS
FT                   ELWSAFARSSLSLPAASGLRDSLFTAVMGTMDAYMVAAQFLKSGKPITELVLALRSAGV
FT                   SAELSMSLLAQVSELQGKVSGAGQDGGEKE"
FT   gene            45710..46816
FT                   /locus_tag="HM1_0056"
FT   CDS_pept        45710..46816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0056"
FT                   /product="phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82681"
FT                   /db_xref="GOA:B0TI08"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR028259"
FT                   /db_xref="UniProtKB/TrEMBL:B0TI08"
FT                   /protein_id="ABZ82681.1"
FT                   /translation="MPVYKDEKRKTWYCAFRYKDWTGTTRQHKKRGFAKKSDAVQYERD
FT                   FIKKQSGGCDMAFGSMVELYMEDCKTRLRPTTYEGKKYLIDSKILPVFKDMPVNAITPA
FT                   TVRKWQNGLLDDESDYSPTYLKTINNQLSAIFNYARRYYGLQTNPAAVCGSIGKKNAES
FT                   MQFWTTDEFRLFAAAISDKPASYAIFNTLFWTGMRSGELLALTLNDIDFESKKISITKS
FT                   YARVGNEDVISPPKTPKSRRVITASEFLLEILKDYAGRLVDYEPSDRLFDYTKHFLASE
FT                   MARGCKLSGVKKIRIHDIRHSHASLLIELGFSPLLISERLGHESVETTLQTYAHLYPNK
FT                   HGEVADKLDALNSPENGSKSDKNPEKPE"
FT   gene            complement(46895..48436)
FT                   /gene="guaA"
FT                   /locus_tag="HM1_0057"
FT   CDS_pept        complement(46895..48436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaA"
FT                   /locus_tag="HM1_0057"
FT                   /product="gmp synthase (glutamine-hydrolyzing)"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82682"
FT                   /db_xref="GOA:B0TI09"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TI09"
FT                   /protein_id="ABZ82682.1"
FT                   /translation="MAKPHETILVLDFGGQYNQLIARRVRELHVYCEMHPYTISVDAIR
FT                   EMNPKGIIFTGGPASVYEEKAPAVDPAIYDLGIPILGICYGMQLMVNQLGGKVGRAESR
FT                   EYGKASLTITASEGPFAGMEGDVQCWMSHGDKVEVLPHGFVGSGKTDHAPFAAMADPVR
FT                   RFYGVQFHPEVRHTPQGMDMMRNFLFGVCGCTGEWTMENFIEEQVAAIRARVGSGKVLC
FT                   ALSGGVDSSVAALLVHRAVGEQLTCVYVDHGFMRLNESERIIKTFRDELGMNLIAVEAS
FT                   ERFMAKVAGVSDPETKRKSIGNEFIRVFEEEAAKLGQVDFLVQGTLYPDVVESGTSTAE
FT                   TIKTHHNVGGLPEDMKFELIEPLRTLFKDEVREVGQRLGLPEDIVWRQPFPGPGLAIRV
FT                   LGEITKESLDILRHADDIVFQEIKKAGLYRQIWQSFVVLPTTVRSVGVMGDGRTYEYPA
FT                   ILRAVTSDDAMTADWARLPYELLEKISNRIVNEVKGVNRVVYDITSKPPGTIEWE"
FT   gene            complement(48539..49078)
FT                   /gene="hpt"
FT                   /locus_tag="HM1_0058"
FT   CDS_pept        complement(48539..49078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpt"
FT                   /locus_tag="HM1_0058"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82683"
FT                   /db_xref="GOA:B0TI10"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B0TI10"
FT                   /protein_id="ABZ82683.1"
FT                   /translation="MDKVIDRVLVSEEDIRVKVKELGERISKDYQDKDLLVVGILKGAL
FT                   VFMADLIRAIHIPIEIDFMAVSSYGAGAKSSGAVRILKDLDRAIENRHILIVEDIVDTG
FT                   LTLNYLMDNLKSRGAASVKVCTALDKPSRRKTLVTPDYNGFTIPDEFVIGYGLDYAEQY
FT                   RHFPFVAVLKREVYEK"
FT   gene            49339..49569
FT                   /locus_tag="HM1_0059"
FT   CDS_pept        49339..49569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0059"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82684"
FT                   /db_xref="UniProtKB/TrEMBL:B0TI11"
FT                   /protein_id="ABZ82684.1"
FT                   /translation="MPAVKKKKVAFVEAVHASGSWSAQQGIIIPVEADADRLVDAIRWV
FT                   EEQQISCQRIYFSPKEKAWVAIVPVELAQPS"
FT   gene            complement(49671..50378)
FT                   /locus_tag="HM1_0060"
FT   CDS_pept        complement(49671..50378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82685"
FT                   /db_xref="UniProtKB/TrEMBL:B0TI12"
FT                   /protein_id="ABZ82685.1"
FT                   /translation="MRRWWRWIAGVTILFLLLSAGGGYLMWKAHEELWNPKDPVTVVKR
FT                   AVAGTLQSPSFSFESTFLIRVDGREEVISRFSGDRAEGEKFHLKGTLLQSPAEIYTVGN
FT                   LFYLWDPVKKSWYTIEKNRFGPQDLLLSEISPLTALDIKTIEGVTVAGIDSVDEDKCLL
FT                   MECRTEVSNRLLATLWKDFYYRIWVDPKKNLIRKVVVEATSRNAPRDRLILTLRFWDYS
FT                   GKQTITLPPVATR"
FT   gene            complement(50565..51059)
FT                   /locus_tag="HM1_0061"
FT   CDS_pept        complement(50565..51059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0061"
FT                   /product="molybdenum cofactor biosynthesis protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82686"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:B0TI13"
FT                   /protein_id="ABZ82686.1"
FT                   /translation="MIRVGILTASDKGSRGEREDRSGRLIGEAIQTIGGAMVAYKVVPD
FT                   ERDQIAAALREMADDLGLDLIFTTGGTGLSPRDVTPEATLDVVDRMVPGIAEAMRAESM
FT                   KITPRAMLTRGVAAIRGRTLIVNLPGSPKAVQECLDIILPALPHGIEILKGEAGECARK
FT                   S"
FT   gene            complement(51056..51628)
FT                   /locus_tag="HM1_0062"
FT   CDS_pept        complement(51056..51628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0062"
FT                   /product="mosc domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82687"
FT                   /db_xref="GOA:B0TI14"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:B0TI14"
FT                   /protein_id="ABZ82687.1"
FT                   /translation="MATIVAVCSSEEKGMPKKNAGSGMLKADFGLVGDAHGGPWHRQVS
FT                   LLAIESIQKMRGLGLDVHPGDFAENITTEGIDLLALPIGARLKLGPEAVGEVTQIGKEC
FT                   HSRCAIYYQAGDCVMPKEGIFIRVLTGGPVQVGDAIEVIATGEAAPDKMASGEAEDGTS
FT                   PQETAQEAITPEEPKGGAKAAGQEVAL"
FT   gene            complement(51631..52110)
FT                   /gene="moaC"
FT                   /locus_tag="HM1_0063"
FT   CDS_pept        complement(51631..52110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moaC"
FT                   /locus_tag="HM1_0063"
FT                   /product="molybdenum cofactor biosynthesis protein c"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82688"
FT                   /db_xref="GOA:B0TI15"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TI15"
FT                   /protein_id="ABZ82688.1"
FT                   /translation="MDPLTHFDEKGGARMVDVSLKGDTRREAVARGRVLMHRDTFRRVR
FT                   DGQIAKGDVLAVARLAGIMAAKRTSDLIPLCHPLSLTGVDLHFTLDELHSTVEIESRVK
FT                   TTGKTGVEMEALTAVSVAALTIYDMCKAMDKNMVVSDIRLVEKTGGKSGHYIREE"
FT   gene            complement(52251..53234)
FT                   /gene="moaA"
FT                   /locus_tag="HM1_0064"
FT   CDS_pept        complement(52251..53234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moaA"
FT                   /locus_tag="HM1_0064"
FT                   /product="molybdenum cofactor biosynthesis protein a"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82689"
FT                   /db_xref="GOA:B0TI16"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013483"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TI16"
FT                   /protein_id="ABZ82689.1"
FT                   /translation="MIDAFARDIHYLRVSVTDRCNLRCIYCMPEAGLPLVDHREVLRFE
FT                   EFERLIAIAASQGIRRVRITGGEPLVRKGIVPFVARVKTMTGIEDVALTTNGLLLPRFA
FT                   SELKAAGLDRVNISLDTLRPERFRAVTRVGRIDDVWTGIEAALAADLHPVKLNVVVMGG
FT                   VNDDEVADFARLTLQWPIHVRFIELMPIGEGDSRFRGQYVTIEQMKAKMAEQGLRLGDH
FT                   PGIRGGGPARYHTLAGALGTVGFISAISKHFCGTCNRLRLTAEGKLRPCLHSRQEIDLR
FT                   TPLRRGASDNLLARIFQKAVEAKPYQHHMLDEGWGDRPRLMSQIGG"
FT   gene            complement(53314..53505)
FT                   /locus_tag="HM1_0065"
FT   CDS_pept        complement(53314..53505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0065"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82690"
FT                   /db_xref="UniProtKB/TrEMBL:B0TI17"
FT                   /protein_id="ABZ82690.1"
FT                   /translation="MMTDRDASIDAIKKAMTDSVIDNRLTCTDARAIAESFGVPYSLVG
FT                   RLANEMKIKIRHCELGCF"
FT   gene            53534..53653
FT                   /locus_tag="HM1_0066"
FT   CDS_pept        53534..53653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0066"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82691"
FT                   /db_xref="UniProtKB/TrEMBL:B0TI18"
FT                   /protein_id="ABZ82691.1"
FT                   /translation="MKNKKTARKVPESIVPARPSPFRNHGIRRKKFQYSEALL"
FT   gene            53789..54784
FT                   /locus_tag="HM1_0067"
FT   CDS_pept        53789..54784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0067"
FT                   /product="patatin-like phospholipase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82692"
FT                   /db_xref="GOA:B0TI19"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:B0TI19"
FT                   /protein_id="ABZ82692.1"
FT                   /translation="MAMDWALVLSGGGSRGAAHIGVIQALEEAGLRPSLVVGVSAGSIA
FT                   GALYGTGHSAADMLAIAKEASKHFFFDFDWRWITGALLGLFRLIQGRPNAALWPGLPTG
FT                   LLLGNQLEKLFCQIWGQRTFDGTEPPVVVTAADLITGASICFLPKGLEPRDPLPYRRFV
FT                   TGVPIARAVRASSSIPGVFHPVRLKEFCLVDGAVRANLPTDLARSLGAKVVICVSLRDP
FT                   DTPAFPPDNLIGTVLRSIDIMGYEIDLCTILGGADLVIEPNLGPMGVFDFNNIDEAARA
FT                   GHAAAMAAMPSIRRILQVPPIQPKEPSVTEHRTSQGIVIRIGREKQGSVP"
FT   gene            complement(55058..55396)
FT                   /locus_tag="HM1_0068"
FT   CDS_pept        complement(55058..55396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0068"
FT                   /product="nitrogen regulatory protein p-ii"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82693"
FT                   /db_xref="GOA:B0TI20"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:B0TI20"
FT                   /protein_id="ABZ82693.1"
FT                   /translation="MKKIEAVFRPERLDLVKQRLEAIGIRGMTLTQVMGCGRQKGETGV
FT                   YRGQEYAITLRTKVKLELAVADGEVESVVQAIIEAARTGNVGDGKIFVLPIEEAVRIRT
FT                   GERGAIAL"
FT   gene            complement(55424..55999)
FT                   /locus_tag="HM1_0069"
FT   CDS_pept        complement(55424..55999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0069"
FT                   /product="response regulator receiver with antar domain"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82694"
FT                   /db_xref="GOA:B0TI21"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR008327"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B0TI21"
FT                   /protein_id="ABZ82694.1"
FT                   /translation="MQGLRVILGDPNETQRAELKKLLHALGQLVVGEAEDGLGTIKLIR
FT                   RLTPDLVFISVQPAMKDGESVAHLIEDERLCPVVLLVERGRENQRSRETDTLLPYLIKP
FT                   VQEMSLQPIIDLAVSRFREVSRLEKEIRQLKNTIETRKLVEKAKGLLMRNLGINESEAF
FT                   RRIQKQSMNKRMSLKAVAEAIIVAYDMQ"
FT   gene            56270..57070
FT                   /locus_tag="HM1_0070"
FT   CDS_pept        56270..57070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0070"
FT                   /product="unknown yune-like protein, putative permease"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82695"
FT                   /db_xref="GOA:B0TI22"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:B0TI22"
FT                   /protein_id="ABZ82695.1"
FT                   /translation="MDFALLIATGLVVGTLGSLVGVGGGFIVVPVLLLVFAYPHLWTVS
FT                   TSLFFIFINSLVSSYNYSRQKRVDFATGIPFALSTIPGALVGAHLVPHLSGKAFDSAFA
FT                   MLLLLVSLFMLFKPQGPPKDRTPNWMGKKTTRQFTDAHGIAHEYSFSLPFGVLISFFVG
FT                   FLSSIFGIGGGIIHVPVMTLIMGIPPHIATATSMFILTISSFAGTVPHLVAGDVQLVAS
FT                   VALSIGAIVGAHIGTRLAPQVNSRRLMQLFSIIMLVLALRLLLR"
FT   gene            complement(57227..58972)
FT                   /locus_tag="HM1_0071"
FT   CDS_pept        complement(57227..58972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0071"
FT                   /product="acyl-coa dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82696"
FT                   /db_xref="GOA:B0TI23"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B0TI23"
FT                   /protein_id="ABZ82696.1"
FT                   /translation="MGDFIRGGHFLTESLSVEQIFTPEDFTEEQRTIAQTTADFIAGNV
FT                   APHLEAIEKLDYELTRSLLKEAGEIGLLAADIPEAYDGVALDKISSTLITEHMARGGSF
FT                   GLSHGAHVGIGTLPIVFFGNEEQKQRYLPALGSGEKIAAYCLTEPGSGSDALGAKTKAI
FT                   RSEDGRHYILNGTKQYITNAGFADVFIVYAKVDGDKFTAFIVDRDTPGLSIGPEEKKMG
FT                   IKGSSTCPVILEDAKVPAKNLLGEIGKGHHIAFNILNIGRFKLGAGCIGSAKWALHLSA
FT                   KYANARVQFNSPIAHFPLIQEKIANMAIELYGAESVIYRTAGLIEKALEVKEPLQATAE
FT                   YAVECSICKILASEMLDLVADEGVQIHGGYGYTQEYEIERIYRDARINRIFEGTNEINR
FT                   LLIPDTLLKRAMKGEIPLLAAAQRLQSELFSLGIHADNGMPLNIEEDLIERSKKIVLFV
FT                   AGIAVQKYQKALAQEQELLRNIADLVIAVFAMESALLRAKKKLVQSGPEKAAMAIQLAT
FT                   AYIYQRITAIEVIAKKSLAAMEEGDALRAQLSILKKLTRHVPVNEKALTRAIAQPIIEM
FT                   EKYSI"
FT   gene            complement(59027..60205)
FT                   /locus_tag="HM1_0072"
FT   CDS_pept        complement(59027..60205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0072"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82697"
FT                   /db_xref="GOA:B0TI24"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:B0TI24"
FT                   /protein_id="ABZ82697.1"
FT                   /translation="MREAVIVSAVRTPVGKAPKGVLKDVRPEDLAAIAVRGALARVPAI
FT                   APEEVEDVILGCAFPEAEQGMNLGRIVAQRAGLPYSVCGMTVNRFCSSGLQAIAIAAER
FT                   VMAGFAEVMLAGGVESMSTIPMGGTKIAPNPYLMEHMPEAYMTMGITAENVAARFGVSR
FT                   EAQDRFALASQQKAARAQAEGRFNEELIPVTVSKRWVDADGKLQEQEVLFDKDEGIRPD
FT                   TSLDALAKLRPVFRENGTVTAGNASQTSDGAAALLVTSREKAEQLGLPVLGAFRSFAVG
FT                   GVPAEIMGIGPVVAIPKALKLAGIDQDDVDLFELNEAFAAQALYVMNHLGLDPERVNVN
FT                   GGAIALGHPLGCTGSKLTTTLLYEMKRRQARYGVVSMCIGGGMGAAAVFERF"
FT   gene            complement(60226..62625)
FT                   /locus_tag="HM1_0073"
FT   CDS_pept        complement(60226..62625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0073"
FT                   /product="3-hydroxyacyl-coa dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82698"
FT                   /db_xref="GOA:B0TI25"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0TI25"
FT                   /protein_id="ABZ82698.1"
FT                   /translation="MIPSIQTVLVLGAGVMGSAIAAHLANAGRDVLLLDIVPKELTPEE
FT                   AKQGLTLQDRAVRDRIAAKAKANLLKQKPSPLFVPEVLERIAVGNLEDDLPRVATADWV
FT                   IEAIVERLDVKQALWKRVESYWQPGTIVSSNTSGVSINQIVADCSHPFRRHFMGTHFFN
FT                   PPRYMKLLELIPCRETDEELIGFMKSFCEKQLGKGVVLAKDTPNFIANRIGTYGLLVTL
FT                   QAMEKYGLTVDEVDALTGPVIGRPKSATFRTLDLVGLDVFVHVANNVFESTTDPEEKAA
FT                   FAIPAPLRQMLEKGWLGDKSGQGFYRKEKGPQGSAIGVLDLNTFTYRPRKKIAMPSLET
FT                   AKLGKGTAEKITTLVSGKDPAAQFSWEILKKVLLYSARKLPEIADDIVSVDEAMRWGFN
FT                   WSLGPFETWDAIGLKESVARMRAEGDPIPPWVAQMLEDGRERFYEEREHKRFYVQVSGE
FT                   LAEVSRSSAPLQVADLRKHPPIRSNAGASLYDIGDDVAFLDFHSPKHAIGPDFLQMIRW
FT                   SLEEVERNFKGLVIGNDGAHYCVGANLMLILLEAEDENWDEIDGMVRQFQQAAMAIKYS
FT                   RRPVVVAPHGLTLGGGCELTMPAAAIQAAAETYIGLVEVGVGLIPGGTGHKELLLRAMD
FT                   AAGVTEKDDLQPIVNRVFETIAMAKVSTSAMEAKQLGYIRHSDAITMNKDRQLFDAKQK
FT                   VSALWEQGYMPPMPRKLPVVGEPGLALMKLGVYTLLQAGRISEHDAKIASKIAHVLSGG
FT                   AIPAKSLVPEQYILDLEREAFLSLVGEPKSQERMRYMLAKGKPLRN"
FT   gene            complement(62732..63265)
FT                   /locus_tag="HM1_0074"
FT   CDS_pept        complement(62732..63265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0074"
FT                   /product="transcriptional regulator, tetr family"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82699"
FT                   /db_xref="GOA:B0TI26"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013570"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B0TI26"
FT                   /protein_id="ABZ82699.1"
FT                   /translation="MIFASNGFHNSQIAKIAKQAGIAEGTIYLYVRSKEELMIRLFEQQ
FT                   VGSFITVLQEQLRSMEDARDQIACIIHQHLSRLEEDPELARVIQFELRQPNPTIRDGIA
FT                   PVLRSYFQVIEQTILLGQEQGHFDPTLSPKLARQLIFGGINEVATSWVFSQKAYALRAQ
FT                   GEPLLRMIFRGITK"
FT   gene            complement(63352..65055)
FT                   /gene="lcfA"
FT                   /locus_tag="HM1_0075"
FT   CDS_pept        complement(63352..65055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lcfA"
FT                   /locus_tag="HM1_0075"
FT                   /product="long-chain-fatty-acid-coa ligase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82700"
FT                   /db_xref="GOA:B0TI27"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B0TI27"
FT                   /protein_id="ABZ82700.1"
FT                   /translation="MERTSCPDFNEWNVGKDWLRSYPSEVPHRLTYSRETVPEMLKSTV
FT                   DAFPHHGAISYLGVRITYQQLWTDVTRFADALVRMGLCPGDAVCIMLPNCPQAVIAFYG
FT                   ILHAGAVVVMANPLYVERELQYQLQDSGAKIIVALDQLQERVMGAIEKTKIEQVIFTGA
FT                   HDYLTTAQSPACSSTSPVIGDTRLHRWLDVLGAEREKVDFSSRRTDDVALIQYTGGTTG
FT                   TPKGVMLTHGNINANTQQIRAWFYRFEPGKERVLCVLPFFHVYGLTMGMHLGVAIGAEL
FT                   ILLPRFDSDRILEIIAKERPTMFPGTPTMYIALINHPKVRQYNLSSIKGCISGAAGLPV
FT                   EVQQRFEELTGGRVVEGYGLTEASPVTHCIPLWHKRKAGSIGLPLPDTEAKIVDPETAA
FT                   VIAGGEVGELVVKGPQVMKGYWNRPDETSAVLRDGWLFTGDLAYMDEDGFFHIVGRKKD
FT                   IIIAGGYNIYPREVEEVLFEHPGIQEAVVVGVPDPYRGETVKAYIVRKAGIDVSVAEIE
FT                   QFCRSNLASYKVPRAIEFRTALPKTLSGKILRRQLLEEEKEVAAKNIKNS"
FT   gene            complement(65427..67217)
FT                   /gene="pykA"
FT                   /locus_tag="HM1_0076"
FT   CDS_pept        complement(65427..67217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pykA"
FT                   /locus_tag="HM1_0076"
FT                   /product="pyruvate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82701"
FT                   /db_xref="GOA:B0TI28"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B0TI28"
FT                   /protein_id="ABZ82701.1"
FT                   /translation="MHAYIQKASLSGTPRTKIVCTVGPASSDPTILMEMIRAGMRVARL
FT                   NFSHGTYEEHAARIAAVRQAADALGQPIAILLDTKGPEIRLGQVSGGKITLDEGAEVTL
FT                   FPDDGTLGTKERLPISYAGLVEDVRPGVRVLIDDGNIEMEVTAVEAGEIRCRIKNGGDV
FT                   SSRKGVSVPGVALRMPAISEKEVKDLEFGIAQDMDFVAISFVRDASDVLGIRKILEDRG
FT                   ASMQLIAKIENHQGVDNIDEILAVSDGIMVARGDLGVAIPTEDVPLVQKMIIEKCNIAG
FT                   KPVITATQMLDSMIRNPRPTRAEATDVANAILDGTDAIMLSGETAAGKYPVEAVTMMAR
FT                   IAIRTEQALRHDEELDRRRKAGLGSVTDSISHATCSIAADLKAKAIITLTKAGSTARMV
FT                   SRYRPDCPIIAATPETKVMRQMAVVWGAEPMKVRETAGTDEMLGDAIDCALKEGRIESG
FT                   DLVVVTAGVPVGVSGTTNLLKVHVAGRVLAHGMGISRKKAVGKVRLCRSAADAARLERG
FT                   EILVAYGTDRDYVPALERCAGIITVEGGLTSHAAIVGLQFGIPVIVGVDNAFEVLPDGA
FT                   VVTIDATERGMIYEGTARVL"
FT   gene            complement(67379..67555)
FT                   /locus_tag="HM1_0077"
FT   CDS_pept        complement(67379..67555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0077"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82702"
FT                   /db_xref="GOA:B0TI29"
FT                   /db_xref="UniProtKB/TrEMBL:B0TI29"
FT                   /protein_id="ABZ82702.1"
FT                   /translation="MSEVPSDQNWTKVRGGLYGAAVIVLLLGALLYGYHSRLGSLLLIG
FT                   GGAWLVYLLVTGR"
FT   gene            complement(67582..68544)
FT                   /gene="pfkA"
FT                   /locus_tag="HM1_0078"
FT   CDS_pept        complement(67582..68544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfkA"
FT                   /locus_tag="HM1_0078"
FT                   /product="6-phosphofructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82703"
FT                   /db_xref="GOA:B0TI30"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012003"
FT                   /db_xref="InterPro:IPR012828"
FT                   /db_xref="InterPro:IPR015912"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:B0TI30"
FT                   /protein_id="ABZ82703.1"
FT                   /translation="MVKHIGVLTSGGDAPGMNACLRAVVRMAIYRGIQVSGILRGYAGL
FT                   LAGEMRAMDVGSVGDIIHRGGTVLRTARCKEFFEPENQALAAGKLKDAGIDALVVIGGD
FT                   GSFRGAQALMRHGIRIVGIPGTIDNDIPGTDYTIGFDTAVNTVLDAINKIRDTATSHDR
FT                   TNVIEVMGRRAGHIALLAGLGGGAESILVPEVPFDLDEVCARLLRGHDRGKLHSIILVA
FT                   EGAGSAVEIGKRIEEKTGLETRVTILGHIQRGGNPTATDRIWASRMGAQAVEALLRGQS
FT                   NIMLGVRKGELVEENLDKALTERNGLDEPLYRLAGVLSI"
FT   gene            complement(68711..68842)
FT                   /locus_tag="HM1_0079"
FT   CDS_pept        complement(68711..68842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0079"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82704"
FT                   /db_xref="UniProtKB/TrEMBL:B0TI31"
FT                   /protein_id="ABZ82704.1"
FT                   /translation="MKPRRPTHQAPEKVGWKQRLPGSFFENAHKDAAGAGTGGVFIR"
FT   gene            complement(68808..69815)
FT                   /gene="accA"
FT                   /locus_tag="HM1_0080"
FT   CDS_pept        complement(68808..69815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accA"
FT                   /locus_tag="HM1_0080"
FT                   /product="acetyl-CoA carboxylase, carboxyl transferase,
FT                   alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82705"
FT                   /db_xref="GOA:B0TI32"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TI32"
FT                   /protein_id="ABZ82705.1"
FT                   /translation="MALPLDFEKPLFELETKIDELRTFSQEKDLDFSSEIATLEQKAEE
FT                   LRKKIYRDLTPWQQAQLARHPDRPNTIEYIRLLFEEFYEMKGDRLYGDDPAIVGGIARF
FT                   QGRPVTVIGHVKGKDTKENIYRNFGMPHPEGYRKALRLMRQAAKFSRPIICFIDTPGAY
FT                   CGIGAEERGQAEAIARNLLEMAALPVPIISVIIGEGGSGGALALGVADRLLMLEHAVYS
FT                   VASPESAASILFKDASLAPQAAAAMGITAERLKDLKLIDRIVPEPSGGAHRNPIGTAKE
FT                   LATALSEEIENLLALSAQELVDSRYAKYRNLGLHCIEDASCGTFEAEATDASGT"
FT   gene            complement(69815..70609)
FT                   /gene="accD"
FT                   /locus_tag="HM1_0081"
FT   CDS_pept        complement(69815..70609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accD"
FT                   /locus_tag="HM1_0081"
FT                   /product="acetyl-CoA carboxylase, carboxyl transferase,
FT                   beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82706"
FT                   /db_xref="GOA:B0TI33"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="InterPro:IPR041010"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TI33"
FT                   /protein_id="ABZ82706.1"
FT                   /translation="MDGLWVKCKQCQQILLTKELEKNLKVCRCGYHFRMTAQERIVMLV
FT                   DENSFIEWDRELVSKDPLQFPGYAQKIQKCQIETSMSEAITTGQGRICDIPVVLGVMDP
FT                   RFIMASMGAVVGEKIVRAAERALKLRLPLVLFSASGGARMQEGVLSLMQMARTSAALTR
FT                   LSKAGLPFFSVLTDPTTGGVTASFAMLGDLIIAEPGALIGFTGPRVIEQTIRQKLPEGF
FT                   QRSEFLQKHGMVDIIIERPKMREQLAALLALHCGNSLEGVES"
FT   gene            complement(70718..70918)
FT                   /locus_tag="HM1_0082"
FT   CDS_pept        complement(70718..70918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0082"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82707"
FT                   /db_xref="InterPro:IPR018551"
FT                   /db_xref="UniProtKB/TrEMBL:B0TI34"
FT                   /protein_id="ABZ82707.1"
FT                   /translation="MWTVVYIAPNRTTAEMLKNVLTNEGLLVMLRPVGVPHLGDSGSVE
FT                   ILVPESEAEEAHEILSGALGG"
FT   gene            complement(70945..71178)
FT                   /gene="mtrB"
FT                   /locus_tag="HM1_0083"
FT   CDS_pept        complement(70945..71178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtrB"
FT                   /locus_tag="HM1_0083"
FT                   /product="transcription attenuation protein mtrb"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82708"
FT                   /db_xref="GOA:B0TI35"
FT                   /db_xref="InterPro:IPR000824"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="InterPro:IPR023558"
FT                   /db_xref="UniProtKB/TrEMBL:B0TI35"
FT                   /protein_id="ABZ82708.1"
FT                   /translation="MLEKETAIGGEYIVIKALENGVTIIGLTRGKDTRFHHSEKLDKGE
FT                   VMVAQFTEHTSAMKIRGRATIFTKHGEIEAGI"
FT   gene            complement(71308..74934)
FT                   /gene="dnaE"
FT                   /locus_tag="HM1_0084"
FT   CDS_pept        complement(71308..74934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaE"
FT                   /locus_tag="HM1_0084"
FT                   /product="DNA polymerase iii alpha subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82709"
FT                   /db_xref="GOA:B0TI36"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/TrEMBL:B0TI36"
FT                   /protein_id="ABZ82709.1"
FT                   /translation="MNSQNHTRAKANRRFVHLHVHSEYSLLDGAARIDKLVDRAAELDM
FT                   PALAITDHGVMYGVIEFYKKAKARGVKPIIGCEVYVASRTMLDRDPQKDSDQHHLVLLA
FT                   KDIEGYRNLTALVSQAHTEGFYYKPRVDHDRLARHSKGLIALSACLAGEIPRLLLNSQE
FT                   RQARERAAFYRDIFGCDNYYIELQDHDIPAQKQVNRSLIRLAGELGLGLVATNDVHYVE
FT                   RKDAYIQDVLLCIQMGKTLQDTERMKFDGAEFYLKSAREMAMLFGEVPEALFNSLAIAE
FT                   ACDLQFDFSKQHLPAYPIPDEPAFIQWRREHERAPWPGLPWGDAEQYLTYLCSQGMTWR
FT                   GCAKRDDYRRRLAFELQTICRMGFAGYFLIVQDFCAFARREGILVGPGRGSAAGSLVAY
FT                   VLGITDIDPIEYNLLFERFLNPERISMPDIDIDFDFVRRSEVIDYVVHKYGSDRVAQII
FT                   TFGTMAARAAVRDVGRVLNLPLADVDKVAKAIPAELGMTIEKAIEISPELRALCQDQRI
FT                   SHLVETARAIEGMPRHASTHAAGVVIAPSPLIDYLPVQRGADGGVTTQFPKDTVEEIGL
FT                   LKMDLLGLKTLTLIGDVIDKIRRSRGLQLKLKDLPLDDPKTFQLLSRADSLGVFQLESS
FT                   GLRAILRELKPNSFDDIIALVALYRPGPLQSGMVDDFIRRKHGQTTVQYLHPALEPILK
FT                   DTYGVILYQEQVMRIASELAGFTLGEADMLRRAMGKKKPDVIAGLRQQFVEGCAAHHIS
FT                   EKTAGDIFDLMEFFAGYGFNKSHSAAYALIAYQTAYLKANYPVEFMAGLLTSVADSSEK
FT                   VAQYVDECQRLGIRVLPPDVNASEIDFSVVADPLTGGLQIRFGLAAVKNVGRGAIDAIL
FT                   LARETGGPFTSLDDFCTRIDNRQANRRVLESLIKAGALSSLGKRRPLLQILDKCMEVAA
FT                   RRQRDLATGQMNLFDFGGFGGEGGRGEPFEAGALSDFSGFSSGLSAETAVPLPEIADFP
FT                   HREILAMEKELLGIYFSGHPLEELRPWLEQQISMTIARIQPDNDQQKVKLGGVIHALRR
FT                   TTTKKGQLMAYFTLEDWSGGVDVLVFPRTFEKCAEKIQDDAAVIVEGKIHYEEENKRIF
FT                   CENLWAIDPALREKKVVEGKPNGETRQPVLHLWIPEASTDMAAREKLDAICRAHAGSTP
FT                   VQLNFLVDRKVVPKAVGVTLSPALRSALKAHFREIRMKIVWE"
FT   gene            74917..75078
FT                   /locus_tag="HM1_0085"
FT   CDS_pept        74917..75078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0085"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82710"
FT                   /db_xref="UniProtKB/TrEMBL:B0TI37"
FT                   /protein_id="ABZ82710.1"
FT                   /translation="MVLTVHRFFPTPCSRRLSPYYKRRSLGGDHEGTKDMTNRPLRQRP
FT                   QGRSPLPA"
FT   gene            complement(75135..75671)
FT                   /gene="ybaK"
FT                   /locus_tag="HM1_0086"
FT   CDS_pept        complement(75135..75671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaK"
FT                   /locus_tag="HM1_0086"
FT                   /product="ybak/prolyl-tRNA synthetase associated region"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82711"
FT                   /db_xref="GOA:B0TI38"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:B0TI38"
FT                   /protein_id="ABZ82711.1"
FT                   /translation="MSVVAPKSLSQEPLSSESQSDALERVCRYLDTFQLGLKPMLFDVS
FT                   TSSAQLAAEAVGVEVGAIAKTICFRIKDDPLLVVTSGDARVDVKKLKSLVGGKPKFVDP
FT                   DEAFALTGYRAGGVCPFALPKPMRIFIDESLRRFPVVYIAAGTANSALPITVDQLVVTT
FT                   GGEVADLAEYRDCGC"
FT   gene            75921..76157
FT                   /gene="feoA"
FT                   /locus_tag="HM1_0087"
FT   CDS_pept        75921..76157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="feoA"
FT                   /locus_tag="HM1_0087"
FT                   /product="ferrous iron uptake protein feoa"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82712"
FT                   /db_xref="GOA:B0TI39"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:B0TI39"
FT                   /protein_id="ABZ82712.1"
FT                   /translation="MGDRFPLCNTPVGHQVRVKDLQLVGFQRRRMLDIGLVPGTAVKVI
FT                   RRSPIGDPTAYLIRGAVIGLRKNEASKILVEEE"
FT   gene            76177..76983
FT                   /locus_tag="HM1_0088"
FT   CDS_pept        76177..76983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0088"
FT                   /product="ferrous iron transport protein b, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82713"
FT                   /db_xref="GOA:B0TI40"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="InterPro:IPR041069"
FT                   /db_xref="UniProtKB/TrEMBL:B0TI40"
FT                   /protein_id="ABZ82713.1"
FT                   /translation="MMKNQCRSCASGALSVARSRYNVRQNTEREKVIALAGNPNVGKTT
FT                   LFNSLTGLRQHTGNWPGKTVTQAQGRFLHRNQPFLLVDLPGTYSLLAHSADEQVARDFI
FT                   CFGRPDATIVVVDATCLARNLNLALQVLEITGKVVLCVNLIDEAECKGIRIDVDALSQK
FT                   LGVPVIGTAARSGRGLSELKEALYGVAMGQIEPAPPPVKYDEEVQSAVDQLLPQLRPLL
FT                   QGLPHLNPRWVAMRLLDGDDPFLDSLTACHRAYEMAAKGEMALCAP"
FT   gene            76971..78398
FT                   /locus_tag="HM1_0089"
FT   CDS_pept        76971..78398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0089"
FT                   /product="ferrous iron transport protein b, putative"
FT                   /note="Shows two nucleoside-recognition domains"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82714"
FT                   /db_xref="GOA:B0TI41"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:B0TI41"
FT                   /protein_id="ABZ82714.1"
FT                   /translation="MRPVISPVASPATPPKDHSRIRSLAEEARQRFGTSMADRIVSNIY
FT                   RQAESLAADVVQLAPEAGRSWDRRLDNLLTSRWFGYPAMLALLMLLFWLTIEGANIPST
FT                   ILASILFTGQEWLAELFVWLQAPLWLKGLLVDGVYRCLAWVISVMLPPMAIFFPLFTLL
FT                   EDLGYLPRVAFNMDRLFQWAGAHGKQSLTMSMGFGCNAAGVVACRIIDSPREKIIAALT
FT                   NNFVPCNGRFPTLIALSTILTGGYLGVTLGQGLASLIIAGLVVLGVAVTLVVSWLLSKT
FT                   LLKGEASSFSLELPPFRKPQVGRIIITSIIDRTLFVLWRAVKVAAPAGALIWLLANISV
FT                   GNLSLLAALAGLLDPLGRSLGMDGFILLAFFLGLPANEIVLPILIMGYLAQGRLVEIEE
FT                   VGELARLFVDHGWTWLTAVNVMLFSLLHFPCATTLLTMGKETGSWRWPALSFFLNTALA
FT                   MAVCFIVALTARGLHLV"
FT   gene            complement(78482..79474)
FT                   /locus_tag="HM1_0090"
FT   CDS_pept        complement(78482..79474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0090"
FT                   /product="metallo-beta-lactamase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82715"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B0TI42"
FT                   /protein_id="ABZ82715.1"
FT                   /translation="MAQIIPIALPTPYMVGDVNVFFIDDERPMLIDAGPPTCEAYRILT
FT                   ERLQALGCPVTALKEIVVTHFHPDHVGLAQVLAKEAGIPVRLHPLDLYTLRLGSEKASG
FT                   FFDGWNLPPNWDPKQFDTRHWIPEKYRPAGVTFQPLEDGETIVTGSLRFDVLDTPGHSL
FT                   GHVALWEQKNRWLFTGDTVIPGLAPNPFIYHVEGERVPTLPMYLKSLDRLRHLDAAILY
FT                   PGHGDPVTDLAAELNATVDHYRQKALEVHAIVREQGPSPLHEIAARLYPRQIESQPYMV
FT                   MSKTLGCLDLLERAGLVRSQGANGFYQAAGESEKKNPAEALDPWLTSTR"
FT   gene            79640..80134
FT                   /locus_tag="HM1_0092"
FT   CDS_pept        79640..80134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0092"
FT                   /product="phosphinothricin n-acetyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82716"
FT                   /db_xref="GOA:B0TI43"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B0TI43"
FT                   /protein_id="ABZ82716.1"
FT                   /translation="MLLRNAVESDLPAIVAIYNSTIASRMVTADTTPISVESRLPWFHD
FT                   HNPDGRPLWVLEMDGVIAGWLSFQSFYGRPAYDGTVEVSIYIAESFRGQGIGRFLLQRA
FT                   IEAAPAMGVHTLLGFIFAHNLPSLGLFEALGFARWGHLPRVALLDGVERDLVICGRRVT
FT                   G"
FT   gene            complement(80124..80303)
FT                   /locus_tag="HM1_0091"
FT   CDS_pept        complement(80124..80303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0091"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82717"
FT                   /db_xref="UniProtKB/TrEMBL:B0TI44"
FT                   /protein_id="ABZ82717.1"
FT                   /translation="MTHWAVEGGACLLIINAELTPLADRADWVIRTPAAEALDRIAAEV
FT                   LGEGRQSLPKLTSP"
FT   gene            complement(80390..82066)
FT                   /gene="lcfA"
FT                   /locus_tag="HM1_0093"
FT   CDS_pept        complement(80390..82066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lcfA"
FT                   /locus_tag="HM1_0093"
FT                   /product="long chain fatty acid acyl-coa ligase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82718"
FT                   /db_xref="GOA:B0TI45"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B0TI45"
FT                   /protein_id="ABZ82718.1"
FT                   /translation="MSELLQITIGDLLDQTAARYPEKEALVYTDDRNLRLTYAQFRQKA
FT                   DEVAKGLMALGVQKGEHIALWATNYPEWLYTQFGSAKMGAVLVTVNTNYRSFELEYLLR
FT                   QSDATTLFLIDGFRDNNFVEIINELCPGLGDSEPGRLSLRRLPKLKNIIFIGRDPQAKH
FT                   PGMYSWQELIDMGRSVSDAELAERQRSLHFDEVINMQYTSGTTGFPKGVMLSHANIINN
FT                   ANMVADCQKWTHEDRLCFPVPLFHCFGCVMSSLACVCKGATMVPLEYFTAKGVLEAVQR
FT                   ERCTVLYGVPTMFIAELDHPDFDKYDLSSLRTGIMAGSPCPIEVMRKVIDRMGIGEITI
FT                   AYGQTEFSPVITQTRTDDSLERRVCTVGKALPHVEVKIVHPDTGLEIPRGTQGELCARG
FT                   FGTMKGYYNNPEATEAAIDAEGWLHTGDLATMDEEGYCRITGRAKDMIIRGGENIYPRE
FT                   VEEFLFTHPKVKDVQVVGVPDPKYGEEALACIILKDGEEATEEEIRYFCRGKISRYKIP
FT                   KYVRFVDHFPMTASGKIQKFKLREIFIKELGLEDAAKIETA"
FT   gene            complement(82274..82570)
FT                   /locus_tag="HM1_0094"
FT   CDS_pept        complement(82274..82570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0094"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82719"
FT                   /db_xref="GOA:B0TI46"
FT                   /db_xref="InterPro:IPR017259"
FT                   /db_xref="UniProtKB/TrEMBL:B0TI46"
FT                   /protein_id="ABZ82719.1"
FT                   /translation="MKVNILLPLFNMVFFLAWGFALKKGKTVEWLAGYDAAKDKEGLVR
FT                   WVANQFIAIGAVSLLLILAGPAIPERFAYVYFFGYLLLLALWLSRVSDIARKY"
FT   gene            complement(82741..83916)
FT                   /gene="metX"
FT                   /locus_tag="HM1_0095"
FT   CDS_pept        complement(82741..83916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metX"
FT                   /locus_tag="HM1_0095"
FT                   /product="homoserine o-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82720"
FT                   /db_xref="GOA:B0TI47"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B0TI47"
FT                   /protein_id="ABZ82720.1"
FT                   /translation="MSTGAVANWGTMESREGIVQPQTFTFAEGSDAFVLESGSRLGPIT
FT                   VVYETYGVLNRERSNAILIAHALTGDHHAAGKNHPSEKTPGWWDDLIGPGKPFDTNRFF
FT                   IICSNVLGGCRGTTGPASINPATGRPYGMNFPVYTIRDMVRVQKALIDHLGIERLLLVA
FT                   GGSMGGMQVLEWGVTYPDMMDGLLPIATAGRMTAMGIAFNEIMRQTIMLDPAWNGGDYA
FT                   PGKGPAQGLAIARMLGMVTYRSDELFTARFGRRMTNNQPKAYFDFNNRFEIESYLHYQG
FT                   DKLVRRFDANTYIYLCKAMDLLDVGRGRGGYEKALASITARTLFIGVDSDWLYPPVYMI
FT                   EMAEIMKKAGCDARYWELKSPHGHDAFLIEFERMRPLVASFVNELADMRQL"
FT   gene            complement(83932..85227)
FT                   /gene="cysD"
FT                   /locus_tag="HM1_0096"
FT   CDS_pept        complement(83932..85227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysD"
FT                   /locus_tag="HM1_0096"
FT                   /product="o-acetylhomoserine sulfhydrylase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82721"
FT                   /db_xref="GOA:B0TI48"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B0TI48"
FT                   /protein_id="ABZ82721.1"
FT                   /translation="MTEKKWRFDTIALHEGHVPDQDTLSRAVPIYQTTSYVFRDVDHAA
FT                   NLFALKEPGHIYTRIDNPTTDVLEKRLAALDGGVGALALSSGQSAITLSILNICAAGDE
FT                   IVAATSLYGGTYNLFTHTLPRLGVKIRFVDPSNPDNFRAAINEKTKAIYGETIGNPKCD
FT                   VLDIEAVAAVAHEAGIPLIVDNTFGTPALCRPIDFGADIVVYSATKFIGGHGIAIGGVI
FT                   VDSGKFDWTQNDKFPGFINPDPSYHGIVYAKDIGPAAFVVKARVQLLRDMGNCISPFNA
FT                   FLLLLGVETLSLRMERHVSNTRRVVDFLRNHPLVSWVSYPECSDHASCDLAKKYLPKGA
FT                   GAILTFGIKGGVEAGRRFIDSLQIFSHLANVGDAKSLVIHPASTTHSQLSEEALRAAGV
FT                   SPDLVRLSIGLEDPDDLIEDLAQALRAAEGRA"
FT   gene            85755..86651
FT                   /locus_tag="HM1_0097"
FT   CDS_pept        85755..86651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0097"
FT                   /product="metallo beta-lactamase domain protein"
FT                   /note="Member of the metallo-beta-lactamase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82722"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR035681"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B0TI49"
FT                   /protein_id="ABZ82722.1"
FT                   /translation="MKPLFLCLLVFTLALTGCSKPSPSAKIPGSGEAPSTATTQATSVQ
FT                   EVLRVHFIDVGQADSILIQSPAGRFVLVDGGNIDDGQQVVDYLKRQGVKELAAIVATHP
FT                   HEDHIGGLDKVLRSFPVGQVYMPKATTTTKTFAYFLNAVKSSGAKRVEAKGGVKLDVPD
FT                   MDGTFLAPNGTDYEEMNDYSAVLKVTYGKISFLLMGDAEAKSEAEMLARGYDLKADVLK
FT                   VGHHGSSSSTTSPFLKAVSPRYAFIPVGDGNDYGHPHKKTLDKLAKAGVEVFRADKNGT
FT                   VVATCDGNKVSFEPEKR"
FT   gene            complement(86940..87191)
FT                   /locus_tag="HM1_0098"
FT   CDS_pept        complement(86940..87191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0098"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82723"
FT                   /db_xref="UniProtKB/TrEMBL:B0TI50"
FT                   /protein_id="ABZ82723.1"
FT                   /translation="MGKVTLEGVDAAGVVDPAAKEAAVDEVFPGGVAPVEVGIAGVKPE
FT                   GEEAVVAPGKRAASAAGGGIDGGALCEGSASASLQAKT"
FT   gene            87259..88038
FT                   /locus_tag="HM1_0099"
FT   CDS_pept        87259..88038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0099"
FT                   /product="conserved vancomycin b-type resistance domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82724"
FT                   /db_xref="InterPro:IPR007391"
FT                   /db_xref="UniProtKB/TrEMBL:B0TI51"
FT                   /protein_id="ABZ82724.1"
FT                   /translation="MVEPVPAHPATSNPPAANPVAPLLTGGTITLYIGEETFVFLPNKK
FT                   IGAVDGSNWTYIPSKDPKEARLAAVRFADSLPSHIRLREGAVDMITDALTAAIDTEVAV
FT                   PSWRLASDVLLSMAQVSAAGGKNASVALDHIDGLVLQPHEVFSFNKAVGPRNAHNGFGP
FT                   GKVLVGNRYITEMGGGICFSSTIVHQAVVHADEQSGLKVIERHRHSRPAPYVEAGGDAT
FT                   VYYGVMDYKFRNGAYMIAIEKQKTDDGMGLRFWRAVN"
FT   gene            complement(88173..89087)
FT                   /gene="pnp"
FT                   /locus_tag="HM1_0100"
FT   CDS_pept        complement(88173..89087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pnp"
FT                   /locus_tag="HM1_0100"
FT                   /product="purine nucleoside phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82725"
FT                   /db_xref="GOA:B0TI52"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010044"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:B0TI52"
FT                   /protein_id="ABZ82725.1"
FT                   /translation="MGHDREMNEKSQMPMEVMAMLSSASIPAAPFAIIGGSSTNSLRFP
FT                   EALNVPGLTVLETYPGWETPFGPSPAFVYFELKGRRALTCVMHGWRPGVKRADASRQIF
FT                   WVFQQAGVKQILSEGGVGAINELLRPRDLVIPHDYIDFSMRKDVDLGTPTLCIMRQPFC
FT                   PLLRRAFIDASEALPGKGRVFDRSNYVVTDGRHFESPAEVRFFRMAGGDVIGQSVAPEV
FT                   YLAREIGACYARLELVVNYAEGVITDWSHQELKDIFYEESEPAGRRLLMALESLPEKQG
FT                   DGHPGCECATLRKRTLLRDRNDG"
FT   gene            88942..89055
FT                   /locus_tag="HM1_0101"
FT   CDS_pept        88942..89055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0101"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82726"
FT                   /db_xref="UniProtKB/TrEMBL:B0TD28"
FT                   /protein_id="ABZ82726.1"
FT                   /translation="MRASGKRSELVLDPPMIAKGAAGIDAEESMAITSIGI"
FT   gene            complement(89127..89267)
FT                   /locus_tag="HM1_0102"
FT   CDS_pept        complement(89127..89267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0102"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82727"
FT                   /db_xref="UniProtKB/TrEMBL:B0TD29"
FT                   /protein_id="ABZ82727.1"
FT                   /translation="MIEDAVKGECLTHNGFLDKDMVSGKQRKPGFCPALALPPHSSTVS
FT                   R"
FT   gene            complement(89260..90360)
FT                   /gene="pfk"
FT                   /locus_tag="HM1_0103"
FT   CDS_pept        complement(89260..90360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfk"
FT                   /locus_tag="HM1_0103"
FT                   /product="6-phosphofructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82728"
FT                   /db_xref="GOA:B0TD30"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012003"
FT                   /db_xref="InterPro:IPR012829"
FT                   /db_xref="InterPro:IPR015912"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:B0TD30"
FT                   /protein_id="ABZ82728.1"
FT                   /translation="MWMQGQIKRIGVLTGGGDCPGLNAVIRAVVKTAIRRYDLEVVGII
FT                   DGFYGLVNDVMEPLTESSVSGILHRGGTILGTTNRDNPFRYAVEKDGQLTFEDRSEQCI
FT                   VNMKKRGIDALVIIGGDGSLSIALEFHKKGIPVVGVPKTIDNDLSATDVTFGFDSAVTT
FT                   ATEAIDKLHTTAESHHRIMILEVMGRYAGWIALYSGLAGGADVILIPEIPFDLGKVCDH
FT                   IRARAERGRKFSIVVIAEGAKEIGGELVVQKLVAQSHDPVRLGGVGHVVAQKLEMCTGM
FT                   ETRVTVLGHVQRGGSPTAEDRILSTRYGSAAVDAIMSGQFGKMVALRTPKILPVPLEEA
FT                   VGTAKQVNPDGQIVQAAKSVGISFGD"
FT   gene            complement(90516..90977)
FT                   /locus_tag="HM1_0104"
FT   CDS_pept        complement(90516..90977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0104"
FT                   /product="RNA methyltransferase, trmh family, group 2"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82729"
FT                   /db_xref="GOA:B0TD31"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:B0TD31"
FT                   /protein_id="ABZ82729.1"
FT                   /translation="MFHIVLVEPEIPPNTGNVARLCAGTGCELHLIKPLGFSIDDKQLK
FT                   RAGLDYWHLVKVHVHDNWAAFLEKHGQANLLLLSTKGKKAYHEFAYRPGDFFVFGKETK
FT                   GLSEEILSEWPERVARIPLVADARSLNLSNAVAVVVFEGLRQNGFAGLV"
FT   gene            91288..93213
FT                   /gene="aco"
FT                   /locus_tag="HM1_0105"
FT   CDS_pept        91288..93213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aco"
FT                   /locus_tag="HM1_0105"
FT                   /product="aconitate hydratase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82730"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006250"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:B0TD32"
FT                   /protein_id="ABZ82730.1"
FT                   /translation="MGKNLVQKILAAHLIEGELVPGKEIAIRIDQTLTQDATGTMAYLQ
FT                   FEAMGVPRVKTELSVSYVDHNTLQSGFENADDHRFLQTVAAKHGIRFSRPGNGICHQVH
FT                   LERFGVPGKTLLGSDSHTPTGGGIGMIAIGAGGLDVAVAMAGGPFYLTCPRVVGINLVG
FT                   RLSPWVSAKDVILEVLRRLSVKGGVGRIIEYCGPGVATLSVPERATITNMGAELGATTS
FT                   IFPSDEVTKAFLKAQGREDAWVELGPDADATYEETLTIDLSALEPAVACPHMPDLVKTV
FT                   REVGPIKVDQVLIGSCTNSSYTDLMRVASILKGKTVHPTVSLGIAPGSRQVFEMLARNG
FT                   ALGDLIAAGARILESACGPCIGMGQSPNSGGVSVRTFNRNFEGRSGTKDASIYLSSPEV
FT                   AAATALTGVLSDPRDLGEAIDVPMPERFIIDDRMILEPAADPSTVEVLRGPNIKPLPIN
FT                   RPLPDTLRAGVILKVGDNITTDHIMPAGAKILPLRSNIPAISQYVFAGVDATFAERAKA
FT                   AGQGFIVGGQNYGQGSSREHAALAPMYLGIKAVITQSFARIHRANLINFGILPLTFADE
FT                   GDIAKVNRGDVLEIADVAAKLGTCETLEVRNVTTGETFLVRPDLTPRQVAIIKAGGLLN
FT                   YTKEQA"
FT   gene            complement(93355..93636)
FT                   /locus_tag="HM1_0106"
FT   CDS_pept        complement(93355..93636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0106"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82731"
FT                   /db_xref="InterPro:IPR007546"
FT                   /db_xref="InterPro:IPR036746"
FT                   /db_xref="UniProtKB/TrEMBL:B0TD33"
FT                   /protein_id="ABZ82731.1"
FT                   /translation="MSVGYSEVSLRIHGVDSLKGKRRVLKSIVERLRGKFNISVAEVDQ
FT                   HDLWQASVIGLAVVSNDRTHIRQVLDAAVRQIEGSGEVDVVAVDTEVF"
FT   gene            complement(93742..94893)
FT                   /locus_tag="HM1_0107"
FT   CDS_pept        complement(93742..94893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0107"
FT                   /product="prc-barrel, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82732"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:B0TD34"
FT                   /protein_id="ABZ82732.1"
FT                   /translation="MTKSQNIVGLAIISISDGRELGLVRDLIINPDQGAVEYLMVENET
FT                   WYLGAQVIPFERLQGVGEYAVTIESEEALQRLIDLPDVLGLIQRQVKVKGTKVLTKGGR
FT                   LIGLVSEYFVDVASGKIAGCLLLPSRETLGARIIPAESVVTFGRDVLIVAEDLDEASLE
FT                   EYDGSIAANAVATVRSVAVIDAPKPPLAAPASVPASAAQVPASAAQVPASAAQVPASAA
FT                   QVPASAAPVPSAATMTSSSAARPTEVPPTIHPIKEPSVEKASVLPVLEDLSVNSLPVED
FT                   IDPGSPRSQQEDKPNEAEPFIFPSLEKSEDAEAKPEGGDGQERGPLFGQMQHKYYVGKV
FT                   LTKTLTNNLGETVAEKGDVITEELIEKVRQSGKYLEMIMNVRE"
FT   gene            complement(94890..95993)
FT                   /locus_tag="HM1_0108"
FT   CDS_pept        complement(94890..95993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0108"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82733"
FT                   /db_xref="GOA:B0TD35"
FT                   /db_xref="UniProtKB/TrEMBL:B0TD35"
FT                   /protein_id="ABZ82733.1"
FT                   /translation="MKNLTMLAIIGFVLIVNALLLGLWWFLLQKTPFGQLPLMVAGCAL
FT                   MWLIALSFPQITLLPNPYLFLIGGGLLIASVGLARTYVQEQNHEPVSPPAEGEAEVPAL
FT                   ASPADGDEEVVAMTFGKEKEAEALPLEVPEIEAVEMLSSEEREAEAITLTVSVELEEQV
FT                   DSQTAADLKKEARNIKDMGEEKETDETEACILDNDTEPVLGVIEGSKLTSTEEKLERAL
FT                   EEIDVNSPEEDPFDSSAESPPLTERAACAAVSSPKGQPAPELSRLLDDAFRHKARGDLW
FT                   GALESFREATRFGISMEDEMFIVLEICAIYELMDKHDEAYHQITRYWGKYRGDLPAPIL
FT                   AEIENYLKAYRAPRTAADRNVTRRTAV"
FT   gene            complement(96112..96834)
FT                   /locus_tag="HM1_0109"
FT   CDS_pept        complement(96112..96834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0109"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82734"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="InterPro:IPR036983"
FT                   /db_xref="UniProtKB/TrEMBL:B0TD36"
FT                   /protein_id="ABZ82734.1"
FT                   /translation="MRYQVLGTTMQALNIDLEPGERIYTESGAMTWMSSNVRMDTNFKG
FT                   GLLKSLGRALSGESLTYTFFEAVGGPANIGFTPSAPGKVLPVEVERGYELICQRDSFLC
FT                   AQESVEMSIFFQRKLGAGFFGGEGFIMQKLSGRGMAFVEIDGEVIEKKLAPGERLMVDT
FT                   GHVAMIESTVSMDIQMVKGMKNAIFGGEGLFLTSLTGPGRVWIQTLTLANLAGRILAHA
FT                   GKRESSGGIGSLTDFFDD"
FT   gene            complement(96916..98370)
FT                   /gene="glgA"
FT                   /locus_tag="HM1_0110"
FT   CDS_pept        complement(96916..98370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgA"
FT                   /locus_tag="HM1_0110"
FT                   /product="glycogen synthase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82735"
FT                   /db_xref="GOA:B0TD37"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TD37"
FT                   /protein_id="ABZ82735.1"
FT                   /translation="MTEQPLKVLFVSAEVVPFAKAGGLADVAGSLPRALASSGVDVRVA
FT                   MPRHGQIPRGAYVTDYMVEVDARKETAVIREGRIEALPGGKSVPVYFIDNYQYFGRENI
FT                   YGYSDDGERWGFFSRALLEMLEPIDFIPDILHFNDWQCGPAIALLKEEYRHHPAYRRIA
FT                   SVLTVHNLEYQGHFGRDILQFIGLRQDLFRPDALEFYGQVNFMKAGLVFADLINTVSRT
FT                   YAEEIQTSEYGWGLDGLLRLRHSDLFGIVNGIDVEVYDPATDPHIPHHYSADNIEGKKR
FT                   NKAELQRQFGLPVSEAPLLGLVHRLVDQKGIDLFEGIEEALFREDLQLVVVGQGDPRYE
FT                   GLFRRLKQHFPEKVGLFIGFDTPLAQRVYGGSDFFLMPSRFEPCGLGQLIAFRYGAIPI
FT                   VRSTGGLADTVTDVRFPNGNGVVFEAYQPDRFLEAIRRGLHLYRQKDRWQQLIAKVMRL
FT                   DHSWRRSADEYMQLYGRARRKVNPEL"
FT   gene            complement(98492..98947)
FT                   /locus_tag="HM1_0111"
FT   CDS_pept        complement(98492..98947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0111"
FT                   /product="acetyltransferase, gnat family"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82736"
FT                   /db_xref="GOA:B0TD38"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR010167"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B0TD38"
FT                   /protein_id="ABZ82736.1"
FT                   /translation="MILRKAKMNDVEDIHALISESAAEGLMLARSRSLLYEGLRDITVA
FT                   EEAGRIVGTGSLHILWEDLAEIRALAIIKDARGKGIGRAIVDMLIKEAKDLGIDRVFAL
FT                   TYQEGFFSKCGFSVVPKELLPHKVWKECIDCPKFPNCDEVAMLLQVK"
FT   gene            complement(98974..99804)
FT                   /locus_tag="HM1_0112"
FT   CDS_pept        complement(98974..99804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0112"
FT                   /product="ap endonuclease, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82737"
FT                   /db_xref="GOA:B0TD39"
FT                   /db_xref="InterPro:IPR001719"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR018246"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TD39"
FT                   /protein_id="ABZ82737.1"
FT                   /translation="MYLGAHLSISKGFESAVREALSIGATTFQFFTRNPRGGAAKALDP
FT                   DDIARSIWLREEHGFGPLVAHAPYTINLAAPKEETWAFAKMTLAADIVRMATAQVPYMV
FT                   VHPGSHVGQGIEAGIERITQALNEILRPDQGVMVLLEGMSGAGTEVGGRFEELRAIIDG
FT                   LQVPEVVGVNLDSCHLFGAGYDVKSDFAAVLDAFDRIIGLERLKAMHINDSQQPLGSHK
FT                   DRHALLGQGLIGSDALAALLNHPALVGLPLNLETPGEIADYRREIAWMRSALKQ"
FT   gene            complement(100079..101443)
FT                   /locus_tag="HM1_0113"
FT   CDS_pept        complement(100079..101443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0113"
FT                   /product="thiamine monophosphate synthase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82738"
FT                   /db_xref="GOA:B0TD40"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:B0TD40"
FT                   /protein_id="ABZ82738.1"
FT                   /translation="MLVTHRRLCPSDKSLLDVIAGAIEGGIGAVILREKDLTGRELLDL
FT                   AQSVLALTRPAGVPLIVNGNPAVAIAAGADGVHLGAEDLPPSKVRSIIGPGMLLGRSIH
FT                   SSEEAQALAESGDGAVLDYFLFGNVFETACKPGKAAVGLDVLSQIVRRSPVPVIAIGGI
FT                   TADKVPLIGRSGAAGVAIMSAIMTAADPVAAARAITVPAAKAVAGVTEAGEDAGILYGI
FT                   IGREQASDAATLAAMADGAYAGGCDIIQLREKNMPTGEFLRRAQILREKASRWGKLFIV
FT                   NDRIDIAIAAGADGVHLGAEDLPPEIARQMWPKGIIGVTVRNLAQAQAAVAAGADYVGA
FT                   GPVFPTTSKRLDAPPLGFAGLQAICDAIDIPVVAIGGLNAGTMNGIRKTGCSGVSVISA
FT                   LFQLRDAKGHPDRGAAAPCRLTALQEEGTSDGPGAPADFVRAAVEEAARRLKAQL"
FT   gene            complement(101538..102233)
FT                   /locus_tag="HM1_0114"
FT   CDS_pept        complement(101538..102233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0114"
FT                   /product="base excision repair protein, hhh-gpd family"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82739"
FT                   /db_xref="GOA:B0TD41"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:B0TD41"
FT                   /protein_id="ABZ82739.1"
FT                   /translation="MDDQRAELLRLYRRLLDHFGPRHWWPADTTLEMVVGAILTQNVAW
FT                   KNVVTAIEQLKQAGLLDISALAEAPREQVARLVRSTRYYNQKAERLQGFARRIVDEYGG
FT                   RLENLLSLEAGELRKRLLDIKGIGKETADCIILYGAQQPIFVVDAYTRRIFSRLGYFSE
FT                   KVGYDEMQAFFAERLEPDLYLFQEYHAQIDGLGNRYCLAKGPSCAECPLGDCCTYYRTE
FT                   GKGNDSDVP"
FT   gene            complement(102369..103571)
FT                   /locus_tag="HM1_0115"
FT   CDS_pept        complement(102369..103571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0115"
FT                   /product="branched chain amino acid abc transporter, amino
FT                   acid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82740"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B0TD42"
FT                   /protein_id="ABZ82740.1"
FT                   /translation="MASQHKRWALPLALLVSVGMLASSVLTGCSSGKGAQNTPEAKEII
FT                   IGGNYELSGGNATYGTAAVNGIKLYIDDLNEKGGLLGKKVKFVSLDNKSEAGEASNVAA
FT                   RLINQEKVVAILGGAASSSTVGFVKLANDKKIPVISSSAVAQEVTVDETGKTRDYVFRA
FT                   CFTAPFQGEVMAQYALDSLKLKKAAILVDNQSPYSKGSGKAFKDYFVKNGGQVVAEEGY
FT                   VTGDKDFRSVLTRIKGRDAELIYVPGYYEEAGFIVKQASELVMTLPILGGDGWDSPTLA
FT                   KIAGAENLNNTFFSTHYSEEEKSARVQDFIAAYKAKYGENPEALGALGYDAAAILVDAI
FT                   KRANSTDPEKVREALSATKDLQAVTGTISFDAQHNPVKSAVVVEVKNGKFTFKDKITPK
FT                   S"
FT   gene            103699..104088
FT                   /locus_tag="HM1_0116"
FT   CDS_pept        103699..104088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0116"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82741"
FT                   /db_xref="InterPro:IPR011437"
FT                   /db_xref="UniProtKB/TrEMBL:B0TD43"
FT                   /protein_id="ABZ82741.1"
FT                   /translation="MERPDVVCEVSTCNHWLPGKICGAANIDILNEQGDMPKDSKGTKC
FT                   KTFSKRGLGTMVASLDNTNWSGVLTEAFKSGKQAVPTITCTVQNCNFWDAGNRCNATGI
FT                   YVTGNGANTDAETDCHTFVQRGSNR"
FT   gene            104190..104381
FT                   /locus_tag="HM1_0117"
FT   CDS_pept        104190..104381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0117"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82742"
FT                   /db_xref="UniProtKB/TrEMBL:B0TD44"
FT                   /protein_id="ABZ82742.1"
FT                   /translation="MAIIIPFPRPHPEGRCEDCAMASWCYADPSDRTFVSQVHTEEMTR
FT                   ALEECLERVWVRENPNLE"
FT   gene            104469..105695
FT                   /pseudo
FT                   /locus_tag="HM1_0118"
FT                   /note="transposase, putative"
FT   gene            complement(105882..105956)
FT                   /locus_tag="HM1_0121"
FT   tRNA            complement(105882..105956)
FT                   /locus_tag="HM1_0121"
FT                   /product="tRNA-Gly"
FT   gene            complement(105958..106044)
FT                   /locus_tag="HM1_0122"
FT   tRNA            complement(105958..106044)
FT                   /locus_tag="HM1_0122"
FT                   /product="tRNA-Leu"
FT   gene            complement(106366..106929)
FT                   /locus_tag="HM1_0123"
FT   CDS_pept        complement(106366..106929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0123"
FT                   /product="rubrerythrin"
FT                   /note="The structure is a tetramer of two-domain subunits.
FT                   In each monomer, the N-terminus forms a 4-alpha-helix
FT                   bundle containing the diiron-oxo site (centre I). The
FT                   C-terminus forms a rubredoxin-like FeS4 domain"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82743"
FT                   /db_xref="GOA:B0TD45"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="UniProtKB/TrEMBL:B0TD45"
FT                   /protein_id="ABZ82743.1"
FT                   /translation="MSPTRTITNVPGLKGTETEKNLLAAFAGECQARTKYDFFAAIAAR
FT                   EGYQQISGFFSETAENEKEHAKRFYMALSALGATTDHLEQSAAGENREWADLYQRFAET
FT                   ARQEGFSDIADLFEEIAEVEERHEKRFLALLDNIKNGRVFKRDTVVEWKCRNCGYIHKG
FT                   TEAPEVCPACQHPQAFYEIHIPNY"
FT   gene            complement(107171..107246)
FT                   /locus_tag="HM1_0124"
FT   tRNA            complement(107171..107246)
FT                   /locus_tag="HM1_0124"
FT                   /product="tRNA-Thr"
FT   gene            complement(107449..108192)
FT                   /locus_tag="HM1_0125"
FT   CDS_pept        complement(107449..108192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0125"
FT                   /product="tatd deoxyribonuclease family"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82744"
FT                   /db_xref="GOA:B0TD46"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B0TD46"
FT                   /protein_id="ABZ82744.1"
FT                   /translation="MNALRYIDSHCHLDLFDNMNKFLDDTKNYKNSIITMTTTPRAYQK
FT                   NRELCSRYSHVFVALGLHPQLIAEREKELDILFKYIEEAKFIGEIGIDQGPRYYKTIDA
FT                   QIRIFNDIIDKCDWYGNKIISIHSLRSADIILEILRSNVRNKSNKFIMHWFTGDIKTLQ
FT                   DAIKLGCFFSINSQMINSDRGKKIVSILPKEKILVESDAPFVIKFESGKEHNQYMNETV
FT                   RLINEIRKEDISQQISLNGIELLSQ"
FT   gene            complement(108189..109550)
FT                   /locus_tag="HM1_0126"
FT   CDS_pept        complement(108189..109550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0126"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82745"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B0TD47"
FT                   /protein_id="ABZ82745.1"
FT                   /translation="MRRYTFYGFYNYDESLFKDYSKSGREIICVPFLDKTTYLRYGIQK
FT                   TFKYLLKLNVVPSELGFDILTLATLVYLADTRVSRDIDSQDSWTREFSLVVPVSNPDVW
FT                   IPTKDHFEKMLRFLTGDIWDINYCSRNFNVNEITPKVKIISLYDYDTVSLFSGGMDSLI
FT                   FAINSLEEKKTPLFISHAGDGYTKNYQKEIINTLSNNYADISFSQLNLWMSFNKHIVSQ
FT                   SCKENTTRSRSFLYISLALFALSGLPKVDILDVPENGLIAINVPLDDLRVGSHSTRTTH
FT                   PYYFKLWNEILGIVNLGKSIRNPYWNKTKGEMARDCLNKELLLDLLPISMSCSAPTKYR
FT                   YRGSTHMHCGHCVPCIIRRAAINFAFGQENDKTQYYIEDLDILKQLHNTETGAQLRSFE
FT                   VAIQKLTKKPSISEFLIHKSGPLDHEPEYLHELCDVYTRGLFEVASLLNLNKKD"
FT   gene            complement(109551..109892)
FT                   /locus_tag="HM1_0127"
FT   CDS_pept        complement(109551..109892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0127"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82746"
FT                   /db_xref="UniProtKB/TrEMBL:B0TD48"
FT                   /protein_id="ABZ82746.1"
FT                   /translation="MLPLIKEMGIEENSGINETQLRAIMEVYFSNVIMQRLINDIGKNT
FT                   FRLPDDIDEINFIESQLSEFIKGTVSDAITGLGIDFQEISDERAREVVDGVYLTAYTIL
FT                   ENLAEEGEE"
FT   gene            complement(110379..112298)
FT                   /locus_tag="HM1_0128"
FT   CDS_pept        complement(110379..112298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0128"
FT                   /product="kap p-loop"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82747"
FT                   /db_xref="InterPro:IPR011646"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0TD49"
FT                   /protein_id="ABZ82747.1"
FT                   /translation="MILSDNETCIDMINSKPIAKSIVKLIVDNKDEPITIGVHGDWGAG
FT                   KSSVLEMIKEELASQESIACIKFNGWKYQGFEDAKIALMESVVTTLIEERSLKEKAKDI
FT                   IEKIKKNIDWLKVAKGAGSIAVTALTGVPPVTLITDAITALKDGVKDPEKVSGIIEKLG
FT                   KFSNDSKLFSKESTSIAFQEFQKSFDDLMKKAGISKLVVLIDDLDRCLPEVAIETLEAV
FT                   RLFMFSKSTAFVIAADEAMIEYAVKKHFPDLPENEISKEFSRRYLEKLVQVPFKIPALG
FT                   EVEAKTYITLLMISSSLDAADSESITRLIGHALEKIKRPWIGEGITVSEIQSILGDDKY
FT                   QSVAEQIRISNQISSILSKRSSGNPRQIKRFINTLLLRYDIAHARGYGEDIKLSCLAKL
FT                   MLLERFIPNIYESIASNLSPDGTSPFIAYLESKKESGQEIPEDKKTEGLDAKAPNISAI
FT                   ESQLKEWENNEELLEWLKIEPLIGEEDLRPYYFASKERKDFFLTQVQSEQIRELVQKLM
FT                   GSRMLIASLTKEISALSQSNAEMIFDLICSKVQENTDYSNIPQGIDGIRALVELHPKLQ
FT                   QKLIEFIKTFPVATVGAWICSGWEKSITDDNYKRQLSEYIQEIAKNGNTTVKMIAQAVQ
FT                   KKYK"
FT   gene            complement(112845..113210)
FT                   /locus_tag="HM1_0129"
FT   CDS_pept        complement(112845..113210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0129"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82748"
FT                   /db_xref="GOA:B0TD50"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="UniProtKB/TrEMBL:B0TD50"
FT                   /protein_id="ABZ82748.1"
FT                   /translation="MEQLFEHNYPLLRSYVFYISCRSFLTKEDKEDVIQNAALKSIQYI
FT                   ASYNSNYRFWAWLKEIAYHEFCRVIKNIKRYSCEILVDDFEQKQYTNRDEFAEWESNQI
FT                   VSFLLSIVAKGKRQIIF"
FT   gene            complement(113289..113795)
FT                   /locus_tag="HM1_0130"
FT   CDS_pept        complement(113289..113795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82749"
FT                   /db_xref="UniProtKB/TrEMBL:B0TD51"
FT                   /protein_id="ABZ82749.1"
FT                   /translation="MITQPDQGIKMKYELCAADKNEAALFFSSNSDDDIQRGCIGHFRC
FT                   DFGHKGKEFWHTWFDHLAELITPAFKEDFQTVIDELRRCGPLENLNAMAKWCHDHEDAR
FT                   FTDQYCSNSYGFKLETEAYSYYIRCFPQQGNYNAYIYCYDRQQIAESMKQTEQEQGGMQ
FT                   LEQGM"
FT   gene            complement(114095..115744)
FT                   /locus_tag="HM1_0131"
FT   CDS_pept        complement(114095..115744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0131"
FT                   /product="resolvase, n-terminal:recombinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82750"
FT                   /db_xref="GOA:B0TD52"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:B0TD52"
FT                   /protein_id="ABZ82750.1"
FT                   /translation="MLTAQSDLQPQEKQIIIIPANPLVAQNRTFPRQLRAAAYCRVSTD
FT                   QEEQLTSYEAQVAYYTDKIMSNPEWTLAGIFADEGITGTSVKKRTNFLRMIRLCRKGKI
FT                   DIILTKSISRFARNTVDCLNYIRELKELGIAVIFENENINTMKADTEIIITMLAGFAQA
FT                   QSESISQNVRWGKRQAFKSGKVSFQYSRIYGYERGENDKPRVVPEQAAVVRRIFQSYLA
FT                   GSSVPDIKRMLEAEGIAAAGGKPQWSVGALQYMLRNEKYCGDALLQKTFVENCISKKTR
FT                   KNNGELPKYLVQNHHEAIIDRTLFEKVQAEIARRAGKRKVSDKTSKTGQSKYSGRYALT
FT                   ELLICGNCGTPYKRVTWSKRGKKKIVWRCISRLDYGTKYCKSSPTVDEERLQAAVLKAI
FT                   NAMMSNRERLIGILKTNLKITLSEKSSGATNPYAIENRIRELQDSMMELVAVAAKAGNA
FT                   ESYEDKFREISEEIKSLQKTLEQYQAEQNGPDKLARQMDDICKALEDAPFEITEYSNNI
FT                   VRQFIDTIKVVNEDKLLFIFKGGITMEQPLTI"
FT   gene            complement(115738..116616)
FT                   /locus_tag="HM1_0132"
FT   CDS_pept        complement(115738..116616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0132"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82751"
FT                   /db_xref="GOA:B0TD53"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:B0TD53"
FT                   /protein_id="ABZ82751.1"
FT                   /translation="MKNRYIPFGYRLSEGVIVPHDREAEMVRLIFRQYISGESYGRIAA
FT                   MLEKAGQPYSEGSSRWNKNMVGRILQNRKYTGQDGYPKLVTEDEFRQSALLQQAKYTRK
FT                   DIHTAPEITALKRKVFCRECGSPYERILDNRTGEKWKCKNTGCRRTAKITDTLLTGQII
FT                   SLLNLAVENPQRIEIPDIVSRCHDLEITRLTNEINRELDKTDCDEEYARILIMARAAAQ
FT                   YESCPDGLLPQKAREIKAAFESRKLLTQFDAELFECAVDAVVVQPDGTVSLKLKNGQSL
FT                   ENRPERRAMPC"
FT   gene            complement(116618..118228)
FT                   /locus_tag="HM1_0133"
FT   CDS_pept        complement(116618..118228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0133"
FT                   /product="resolvase, n-terminal:recombinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82752"
FT                   /db_xref="GOA:B0TD54"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:B0TD54"
FT                   /protein_id="ABZ82752.1"
FT                   /translation="MKTSQNTVGGALAGELQPEAPRVIVINPAVQAQKDKLRIAAYARV
FT                   SSDSDDQLNSFAAQVSHYTTLIRENENWELVDIYADEGVTGLRMDKREDFQRLLRDCRK
FT                   GKIDRILTKSISRFSRNTRECLETIRELKSLGVTIYFEKEHIDTGEISNEMLLTFFSGN
FT                   AQQESMSISGNMRWSYQHRMKNGKFITCKAPLGYRLQSGTLQIHEQEAEIVRYVFNSYL
FT                   NGKSKDEIAAELTAQGVPTRDGKDRWHYSTIDYLLKNERYAGDALLQKRYTTAVLPFQK
FT                   KRNKGEKDKYYVKYSHPAIISRDIFERAQELNQSRNIPTMSKRSMYPLSKRIRCGECGS
FT                   LFKRKTCNGKTYWVCRNHNKGKSNCTVTQIPEPEIYGAFLRLYHKLKLNYDKILSPMLD
FT                   QLQALKRHRNLSNLQVVELNRQIAELTERNHVLNGLKSKGIIDSALFISQTDELSRKIR
FT                   ALKAEKNKLMEKDEDDSAITETRSLIEILEDGPERLSGFDETLFDSIVELVTAESGERL
FT                   KFKLINGLELAEPIERTVR"
FT   gene            complement(118301..118462)
FT                   /locus_tag="HM1_0134"
FT   CDS_pept        complement(118301..118462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0134"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82753"
FT                   /db_xref="UniProtKB/TrEMBL:B0TD55"
FT                   /protein_id="ABZ82753.1"
FT                   /translation="MNESAERISANADYIGILNALNWLVSTGKITAEDGRKTALRIAEQ
FT                   LGASIFIV"
FT   gene            complement(118476..118865)
FT                   /locus_tag="HM1_0135"
FT   CDS_pept        complement(118476..118865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0135"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82754"
FT                   /db_xref="GOA:B0TD56"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:B0TD56"
FT                   /protein_id="ABZ82754.1"
FT                   /translation="MDEKKRAWLYCRIDAPEDEHGRLKGQQKELADYAGQMGFEVVGVS
FT                   QDTGSGLNFARSGLAEVIEAAAEGKLDVLLIVNLSRLGRDTVKTMDFIRGLDQLGIGLY
FT                   SPLEGEIKLTRLEEMYGGLAAMRME"
FT   gene            complement(119439..119855)
FT                   /locus_tag="HM1_0136"
FT   CDS_pept        complement(119439..119855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0136"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82755"
FT                   /db_xref="GOA:B0TD57"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B0TD57"
FT                   /protein_id="ABZ82755.1"
FT                   /translation="MEEQESKYTLLINKKRVAVGREVYKAYYRQKEREAYLDKLAGKHN
FT                   ISFEECEEKGIQVDYLLSRAEESIEDSVIKKEMLKKLALCLETLSEQERLLIYALFFQG
FT                   KSERQLSAETGTPQRTINDRKRRILLKLKKLLEK"
FT   gene            complement(120568..129390)
FT                   /locus_tag="HM1_0137"
FT   CDS_pept        complement(120568..129390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0137"
FT                   /product="multidomain protein with s-layer homology region,
FT                   glug motif, ig motif, i-set domain, pkd domain"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82756"
FT                   /db_xref="GOA:B0TD58"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003343"
FT                   /db_xref="InterPro:IPR003598"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR011493"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="InterPro:IPR013098"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="UniProtKB/TrEMBL:B0TD58"
FT                   /protein_id="ABZ82756.1"
FT                   /translation="MKTIVKTLLLAAVMAVFIMLPMKVQAATHDVSTLEELKTVVASVY
FT                   SGDTINITGDITLDSDLTITNPNAFAITSSGSTITCGSYKIVIGAGADVTVGGDLAITG
FT                   AATSTISVQSGGRFTLAGGTVSNSALYAIESSGNAVISGGTINAAGTGGVGVRALGGGV
FT                   TISGGAINATGVSGIGVQAVNSASVTIGGGTVSASGTGVRVGNSASVTIDSGTVSASGA
FT                   GVLLAGSTSSASATINGGTVSASGGAGTGVQVTLGTAHINGGTISGDDKGVNLASGQVN
FT                   ITVSGGLTVSGGVFASTGPSFLSALPSPVTVTAGQTGQVALAGVDESITFAIDPATAGE
FT                   LAASIASNTVTLQPAPATPAGGYDLVLTAQSGSGNLKLTVPVSVENLDISGDFTDPNFK
FT                   QAVWEWLGNSGAPGSFTKQDLIARMPDQGYTLYIDSKNIASLAGLEHFQGTGIQELDCG
FT                   YNQLTSLPALPDSLIGLYCYNNQLTGLPSLPGGLQTLNCNYNQLTQLPALPASLNTLRC
FT                   ASNRLTALPALGANVSVVECGYNQLTGLPQLPSGLTVLTCNNNQLEALPELPPNLQWLF
FT                   CDENRLTSLPDLPGTLTILKCDRNFINVFSGPEKDKLDACPAGTKTVTPQFRYAYTGTG
FT                   LVFTRAGETLGIQAADVKKEQSADGNTWTDTYVQTDFGLFAFASSDENVAAVDSQGVVT
FT                   ATGNGSCVIYARFAGIASAYTQIEVPISIMVPPSITTQPESQTVTAGQTATFTVEAAGD
FT                   TPLSYQWQKDGVNLSDGGNISGAATNTLTISNAQLSDAGSYTVVVTNAAGDATSNPVTL
FT                   TVNAPPFITSHPDSQIVAPGQTATFSVAATGTEPISYKWKKDGADLSDGGNISGAATDT
FT                   LTISNVQLSDAGSYAVMVWNTLGDATSNEAILTVNTAPKRKSDVPATATASVTVYDAYT
FT                   LDLSTIFEDADGDNLTYKVSVNGATYAAADKNYSYTPAVTGTATLIFKAYDGTEDSSDT
FT                   YTVSLNVEGIPVSIQDIPGVTPPERGATPVTVITETDQYTGTVSWSPNHNPFASSTVYT
FT                   ATIILTPKGNYTLTGVAENYFKVAGAVSVSNEADSGVVTAEFPATAPPNSKPVAKSPAP
FT                   VMGVTASGTTEFNAYDIAEDADGDPLTITAIMTFPNSNVATASLDSGTVTLAGKAAGET
FT                   SFTVKVSDGEDFAYITVQISVTEFAGGDGTEANPYQIADAYQLNNVRKHLDKHFILISD
FT                   IDLDVSPFNIWNGWEPIGNSSSPFCGSFNGGNHTISNLKIRQTVKSYVGLFGYIGVNAN
FT                   VRNVKLKLVDIVVEPPVDITVFYAGGLAGYNEGSISKCHVSGSVSGDFNVGGLVGQNDG
FT                   LVSESSSTSVVSGDRYVGGLVGSCEQESNTVNCYSAGRVQGSGNVGGLVGYRSSNSTVT
FT                   GSFWDTQTSCQVSSQGGTGKTTAEMKRKSTFMEANWDFDSTWNIVENSTYPYFKWQTDD
FT                   FDFAPPVFAENYPQTGDVTHESAELQVQMDEAGTVYYVVLESAAGTISAAQIKEGTDSV
FT                   GNALNENRKGSLEIAGGGVLAETVINGLDPETEYYVYMTAEDAAGNLQPDACISSVQVA
FT                   TSELTPVYITKQPLSQTVTAGQAVTFTVEAAGTEPLNYRWKKGGADLTDNGSISGAATA
FT                   TLTISNVQAADAGSYTCHVSNAAGSATSNAATLTVNTAPPANNPPTAKNPVPTQSVTAG
FT                   GTATFTASDIAEDTDNDPLTITAIVTGPDTAKATVSLNSGTVTLTGVAAGDTSVVVTVY
FT                   DGTDTVNVTVPVSVTAAPAAPAITTASLPDGTVNTAYSQALTATGDAPITWSLESGSLP
FT                   TGLTLSGDGNISGTPTAAGTFNFTVKADNSAGSDTKALSITINPAPVAPAITAQPTNQT
FT                   VTAGETATFTVTATGDAPLSYLWKKDGNNLSDGGNISGAATDTLTISNVQASDAGSYTV
FT                   VVTNAAGSATSNAATLTVNTAPPANNPPMAKNPVPTQSVTAGGTATFTASDIAEDADSD
FT                   PLTITAIVTGPDTAKATASLNSGTVTLTGVAAGDTSVVVTVYDGTDTADVTVPVSVTAA
FT                   PPTLVTSITVKGAGDATTVVNGGTLQMTAEVLPSDATDKSVTWSVYSGTGTAGINASTG
FT                   LLTGTGEGTVTVRATANDGSGVYGEATITVTAAPLPVMGGSVTISGSAKYGETLTADIS
FT                   GITYTPDTSDDVPTYQWKRGGADIPGATASAYILAQADIGQTITVTVTADGIHATSSVT
FT                   SAPTAVVDKADGPAAPGAPSLASKTHNSVTLAANAAYEFRVNGGLWQDSNIFTGLSPET
FT                   SYTFTARVKETATHKASSESAGLTVSTDAAPAQPDTTPPAVADGTITAGGLTHNGVTLS
FT                   WSKATDDVSPQGALRYRVYYSDSDNIASVTDAVYNGTAAGDYATDIGTKEITGLNSNTT
FT                   YYFNVIVMDEAGNKTAYTMTSVTTAAAPPVNTAPKRKSGVPATATAVVTVNNAYTLDLS
FT                   TIFEDADGDNLTYKVSVNGAAAVAANKDYSYTPAAVGTTTLIFTANDGTVDSADTYTVT
FT                   LTASSAGGGGGGGGGGGSSSSTPATPTYKAEVSGISTAETSLPVSVNTNAGNAATDLGT
FT                   LAKDIFTGAGTAVLTVPSISGVNSYTVGIPAASLSGSQGEGALTFSTGAGSITIPSGML
FT                   AGIPETEGKKAGITIARGDRTSLPEDVKTAIGDRPIVQLTLTLDGKQTNWSNPDAPVTV
FT                   SIPYTPTAAELANPEHIVVWYIDGSGNVVSVPNGRYDPATGTVTFTTTHFSYYAVAYVH
FT                   KTFGDLGGAEWARKPVEVMASKGIISGTGKGTFSPAANITRADYLVLLIRTLGLMAEFD
FT                   GNFDDVEPGAYYYEALGIAKKLGIAAGSGNNRFNPKESISRQDMMVLTARALEKFRGLK
FT                   AVDANGLLDKYSDKGDIAGYAANSLATLVKEGLIKGSGDRLNPRANATRAEAAVFLYRI
FT                   YNKY"
FT   gene            complement(129409..138339)
FT                   /locus_tag="HM1_0138"
FT   CDS_pept        complement(129409..138339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0138"
FT                   /product="multidomain protein with s-layer homology region,
FT                   glug motif, ig motif, i-set domain"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82757"
FT                   /db_xref="GOA:B0TD59"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR003343"
FT                   /db_xref="InterPro:IPR003598"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR006558"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR011493"
FT                   /db_xref="InterPro:IPR013098"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR013378"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="InterPro:IPR042229"
FT                   /db_xref="UniProtKB/TrEMBL:B0TD59"
FT                   /protein_id="ABZ82757.1"
FT                   /translation="MKKLLSILRTRLILTGFLLAVAFLATPVTAQAAGFSGSGSGTAGD
FT                   PYVITTPEQLNEVRNNLSAHYRLGADIDLSGYMSWQPIGSQSAPFTGSLDGGGFSIRNL
FT                   SIDRSNEDIIGLFGSVNGASFQNVIIKNGLVRGRYETGGLVGRASNASINGCSFSGSVF
FT                   GYHTVGGLVGKSDGSNIQDSWASGYVTGDGFCIGGLIGACTINGGTIRNSHAQSQVTGG
FT                   ANAGGLIGDAQNNVNIINCYAVTSTKGPYKIGGLVGSKYGGLVENCFSSGDVRTTTTYN
FT                   DGAGGGLIGINYGASIKFSYSSCTVSTIGRLGYAGGLIGVNDGGSITDCYAVGDVTSRY
FT                   IGGGLVGHNTGSVVKCYTSNHLSEEEYRCGALIGRNEGSISTSFWNKDKFGWPIWVPSD
FT                   KSGTTGLTESQMKIQASFAGLDFDNVWNIETGGYPYLRWQIPAPDLAPPGFETGYPAYD
FT                   EATPQGFRLKVKTDEDADVYFVVLDKGVSLSQLFTENLYYSMTTGRAENGLDALPANRK
FT                   GWIGTAAGVEASVEISGLVSGTDYDIYLFAEDRVGNYTHSLTKLTARTEWSGDENGITG
FT                   FTVAGQVGMSKIDAAAHTVTFYMPEGADVTSLAPAITLTGSATVSPSSGQTQDFTNPVI
FT                   YTVTAQHGQTQDWTVVCAFVDPSLVLHLKFEDNPEDSTPYGNNGTAGGNVEYVPGIMGK
FT                   AALFRGVDAPGHIMIANSDSLRFTDGLTVSFFARVDSERGMDGNSNAVEKGRQCFFAKD
FT                   GDQSNLIYSLIYGNTNTNTIKGGGSSASVSPFYTLGKWMHITYVISASGAVIYKDGAKV
FT                   AEQALSGTLDFSGSNAKDFYVGRLGTFWYPFYGAIDDFKVFNRPLTEQEVRELVFGSGD
FT                   AVSFAVSAPAEVRAGETFSVVLTALDQSGQTLADYGGIHNINWNWTASPSPNGTAPVKP
FT                   ADGMAMFSNGVATVSGFRLTNAETITITAAEDDGSFGESAPVTVRPGSPETLTVETPGT
FT                   VEAGKPFQIRVTAGGGDIYGNTGGVFTGTIGFACDDSQAQLPGRYTFVETDNNVKVFDN
FT                   LALNRLGDTTLWVSRLSGGDPEGYWRFDEGKGSLAVDFSGNRYNGTLINTDAGAWVNGA
FT                   PDISFTNHGGLMFDGSNDYVDAGNGVNLADKSFTIAFWARCIKYGENWIISQGTTANNQ
FT                   GLHVGFRNATTFSIAFWYNDLDVNVSGDTGWHHWTVTYDSGTKLQRIYQDGAMLGSRTS
FT                   SSNLQSSGNLYIGKRFNNTGFFGGYLDDLRVYYRVLADEEIAELAGGGGSIPFWDKVIT
FT                   VHPQRPIVDRVAFGASGGTPPYSWSATGLPSGLSMSSDGVISGVPTATETSTATITVTD
FT                   GAGSTASMSLVLAVDLGSLDLNINDCRLAVNYSAQALNIASLALRAAGGTPPYSWNAAG
FT                   LPSGLSMSSDGVISGTPASAGTSPATITLTDNAGNTTVKSFDLEIDFVMPPSITTQPSS
FT                   QTVTAGQTATFTVAATGTGPLSYQWKKDGNNLSDGGNISGAATATLTISNVQAADAGSY
FT                   TCYVSNAAGGVTSDAATLTVNPAVIDIAAIPGVTPPARGAAPVTAITETAQYTGTVSWS
FT                   PADNPFRGGTVYTATITLTPKAGYTLTGVAENFFTVAGATSATNAAGSGVVTAVFPATE
FT                   ADPPSNSPPTAKNPVPTQSVTAGGTATFTASDIAEDTDNDPLTITAIVTGPDTAKATAS
FT                   LNSGTVTLTGVAAGDTSVVVTVYDGTDTADVTVPVSVTAAPAAPAITTASLPDGTVNTA
FT                   YSQALTATGDAPITWSLDSGSLPTGLTLSGDGNISGTPTAAGTFNFTVKADNSAGSDTK
FT                   ALSITINPAPVPPAITAQPTNQTVTAGQTATFTVAATGTEPLSYQWKKDGADLTDGGNI
FT                   SGAATATLTISNAQAADAGSYTCYVSNAAGSATSNAATLTVNTAPPANNPPTAKNPVPT
FT                   QSVTAGGTATFTASDIAEDTDNDPLTITAIVTGPDTAKATASLNSGTVTLTGVAAGDTS
FT                   VVVTVYDGTDTADVTVPVSVTAAPPTLVTSITVKGAGDATTVVNGGTLQMTAEVLPSDA
FT                   TDKTVTWSVYSGTGTAGINASTGLLTGTGEGTVTVRATANDGSGVYGEATITVTAAPLP
FT                   VMGGSVTISGNAKYGETLTADTSGITYTPDTSDDVPTYQWKRGGADIPGATASTYTLAQ
FT                   ADIGQTITVTVTADGIHATSSVTSAPTAVVDKADGPAAPGAPSLASKTHNSVTLAANAA
FT                   YEFRVNGGLWQDSNIFTGLSPETSYTFTARVKETATHKASSESAGLTVSTDAAPAQPDT
FT                   TPPAVADGTITAGGLTHNGVTLSWSKATDDVSPQGALRYRVYYSDSDNIASVTDAVYNG
FT                   TAAGDYATDIGTKEITGLNSNTTYYFNVIVMDEAGNKTAYTMTSVTTAAAPPVNTAPKR
FT                   KSGVPATATAVVTVNNAYTLDLSTIFEDADGDNLTYKVSVNGAAAVAANKDYSYTPAAV
FT                   GITTLVFTANDGTTDSLDTYTVTLTAGAAVTCTVTFDSQGGSAVASITGVAPGSVITAP
FT                   SAPTRTGYTFGGWYKEASCVNAWNFSVDTVTANITLYAKWIYNGGGGGGGGSGSSSSTP
FT                   ATPTYKATVSGSNISETKLPVSVNTNTDSAATDLGTLAKDIFAGAGTAVLTVPSIPGVN
FT                   SYTVGIPAASLSGSQGECVLTFSTGAGSVTLPSGMLAGIPGTEESSAGITIGQGDKSGL
FT                   PEEVKAAVGDRPIVQLTLTLDGKQTEWNNPSAPVTVSIPYTPTAAELENPEHIVVWYID
FT                   GSGSVVSVPNGRYDPDTGTVTFTTTHFSYYAVSYKQVSFKDVAKDAWYSKAVSFIAARE
FT                   ITTGTGGGNFSPEAKLTRGQFIVMLLKAYGITPDANPQDNFADAGSTWYTGYLAAAKRT
FT                   GISAGVGGNMFAPEKEITRQEMFTLLHNALKAINRLPRGSSSRPLSDFSDADDIAPWAK
FT                   EAMKLLVETGTIGGSGGKLLPQDTTTRAQMAQVLYNLLTK"
FT   gene            complement(138639..139319)
FT                   /locus_tag="HM1_0139"
FT   CDS_pept        complement(138639..139319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0139"
FT                   /product="hpt domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82758"
FT                   /db_xref="GOA:B0TD60"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="UniProtKB/TrEMBL:B0TD60"
FT                   /protein_id="ABZ82758.1"
FT                   /translation="MQIRHSYAGSAAKANTEDKVKERPETELYQHEAAAAIRRLEAGKN
FT                   RHTPIIAVTAGDTPEEKEMSLAAGMDDYIKKPVLLDALSGTLARWLPGAVKNGRQVLGG
FT                   AFAETAASRVILPSFVPEGKKAELLQTVGADPALLSRVLAAFLRDMPEKLAALEAALKE
FT                   KDAPRARLLSHGMKSSGQFVGAASFAALCGEMEEKAVAGALEGAGELAEKIRRELVKIQ
FT                   KELA"
FT   gene            complement(139356..146714)
FT                   /locus_tag="HM1_0140"
FT   CDS_pept        complement(139356..146714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0140"
FT                   /product="multidomain protein with s-layer homology region,
FT                   hyr domain"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82759"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR003410"
FT                   /db_xref="InterPro:IPR005102"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR025883"
FT                   /db_xref="UniProtKB/TrEMBL:B0TD61"
FT                   /protein_id="ABZ82759.1"
FT                   /translation="MNSRRSRKRRASSFLVLFLVLLLTVNPVMPAKAYALPSIEDLVNE
FT                   ALEQTGMKDLADDVAETLEDTVNGTLPVLEKVPEMVMDDTKAKAEEAAAQLSVIMPVLR
FT                   EIAETGNVVTEILGAVPIDFDVDVAVPMPGDLGNDMGAKAWAKKQGDYISLCIWVDGPG
FT                   RSQAVFGIANDDPLGGGNAPHFENSGHITTAFYDMTPNGRDYVHARLPLGMDMPTVYAR
FT                   GYIPWGSKDEQYIKVEIGGMTDTQVNLNFEVSLKGTADAEVSIEGEAKASFSVGVSPQE
FT                   AQKVANRTMITMNRALIAEAEKGELGPEAAARVIKAAIGQLKACSAENPGAIGSVTLGV
FT                   DIAGLVGLGVADSVWPGISASGGLYLELPLDAAANIGLDALDGLLENTELMANDIHRIA
FT                   SCVLSGDLSSETLNEVTARLRNSWENGAKPVFENIVNDTVGAVAQTSVGISLSLDLAGE
FT                   GSTSGGGDGGTESSFNLFAADASIPGGEALVAAANGEFISDTVEGLALFLGNMLSGNVD
FT                   RDVPDQLDRLDEVVDNLAEGTVLRLDICTPLYVQLTAELSARPLVEASKTSIECLRGLN
FT                   RAMLHAAREGSLEPLRNIENYIQGGKEHLLEFIKSISGSMFGLDLGIGASADLGAEATV
FT                   TVDGGASVYMKANPEMIFFVTSLGELQFDDVTGLAQAGIDISVGASGGVNLGEGVELGV
FT                   QGGASVDTSLLKLLLEEHHGPIDDLYTVKGSSNANLGELTVTVGGKQRNLIPELNDTDT
FT                   SYTAYVPYNTNLVTIEAKPQSPGAKVRFWGLDTNRYTEDLNGYNMLVPITVWAEDGTMK
FT                   EYQLSVLQGPSIKLRSLSSPNDSLYFSPDQFSPDQNNYVINVPLYRTDIEFVPVLDHIG
FT                   ATLKVNGVPWSSGQTFKAPLNVGENIITFEVGDYMDTNTYTVKVNRAPSSDATLAYLSV
FT                   NQGTLDPAFDKNTTSYTVSVGEDVASIAIYADVNEPHATATLYKVDGNQREELQSQLYG
FT                   IRKTVEIQPGENSFEIVVTAQDGTTRETYSLNVFRTNVPLKRLAVRIGDGAGAQNIELT
FT                   PSSLGHGLDLNSDSNVYITAEPISENVKVYIGNAVVTKEDGWTANLGQIREDQQVSIPV
FT                   TVRTLADLKRTDYVIRFNLSNQDMGLESVRFVYKDQSGNDQTVVPSSGTDGFHAEVPSY
FT                   VDHIKVYATPEYTTGNNPAYTFVNHMIDYAGSTVFVDHSVPGVTVSLGVEMNTIPITVV
FT                   AANGNTSTYNLYVTRPTPPEMIADLTSISANCGSFDHAFDPRITSYFLTIPYQPDEDAN
FT                   STTYPGWPSSVIITLACASDGSTFQVPTQYVWRKYKVHGDKGSQNPLLYEIHVENIYTW
FT                   DPIPVQFSVTSPNGQVSKVYNITIQRSPSANAWLDPNSGLQVSIDKNSIESLNPVSYPF
FT                   NLAYTVNVGSEVDKIYLRAKPWYPGASLTINGATAEYQYDDVNSPYPVQYCEWREVPLS
FT                   AGANKVEVAVTAPNGKNTKTYTVTINRAAPPDTAPPSIGVPVNITVEATSSAGAVVNFN
FT                   ARAIDAVDGEVPVTYSKNPGSVFPVGDTAVTVTAQDQAGNTATAGFTVKVQDTTPPSFG
FT                   PVGDVEVDAAGSGGAAVNFSVTATDLVDGPVEVMYSRTPGSVFPVGTTRVTCMAEDSRG
FT                   NAAIKTFNVTVIGQTVENAVISSDAADFDKNIANQADVETTITWNSATAVTDVKKAGAS
FT                   IGMENYAVNGNILTIKKEYLATQPTGGLVLTVEFDRGNAATLAINILDTTPQIISATIS
FT                   PTTVTFDLDSPGDVSTTISWGSAATVTDVVYGSVYLTSPADYNVSGNTLTIKETCLSGL
FT                   NLTDGNSIDFEISFNAGDSAVLTVNAVSSYVPSGDAALSDLRVGGETVAGFVYKQYEYT
FT                   VQLPYGTQPGSPAAFVSATPNDSRANVRITQAASLPGAAKVEVTAEDGTVLTYTIHFTV
FT                   AEPPLSSNASLSGLTLSAGSLSFAPDTVSYTLSVANGVTSTTVTPVAADANARVQVNGK
FT                   DVESGRSSEPIALKVGSNTIAIVVTAQDGVTVRTYTVTVNRAAAPSRDRDDDRGSGGTS
FT                   TLQPQPVQPPAATVGGLKTTATVDAATGTVKTELDADALNMALEGALTGDDGKKTLEVE
FT                   LSKSATGSYNVEFPASALSNPQADINIEIKTDAGTVTLPGNMLAGTGFENQGDAGLTIK
FT                   NVDKSTLPEEVRNAVGDKPVIQLGLTVDGEQKAWNNPDAPVTVSIPYTPTAAELADPEH
FT                   IVVWYIDGSGNVISVPNGRYDPATGTVTFTTTHFSYYAVVYKQVSFKDVAKDAWYSKAV
FT                   SFIAAREITTGTGGGNFSPEAKLTRGQFIVMLLKAYGIAPDENPQDNFADAGNTWYTGY
FT                   LAAAKRTGISAGVGGNVFAPEKEITRQEMFTLLYNALKVIGRLPEGDSGKRLSDFSDTG
FT                   EIAPWSKEAMKLLVETGTIGGSGGKLLPKDTTTRAQMAQVLYNLLTK"
FT   gene            complement(146941..147627)
FT                   /locus_tag="HM1_0141"
FT   CDS_pept        complement(146941..147627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0141"
FT                   /product="two-component system sensor protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82760"
FT                   /db_xref="GOA:B0TD62"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="UniProtKB/TrEMBL:B0TD62"
FT                   /protein_id="ABZ82760.1"
FT                   /translation="MQIRHSYAGSAAKANTEDKVKELPETELYQHEAAAAIRRLEAGKN
FT                   RHTPIIAVTAGATPEEKERSLAAGMDDYIIKPVLLDALSGTLARWLPGAVKNGRQVLGD
FT                   AFAETAAASQDILPSFVPEEKKAELLQTVGADPALLSRVLAAFLRDMPEKLAALEAALK
FT                   EKDAPRARLLSHGMKSSGQFVGAASFAALCGEMEEKAVAGALDGAGELAEKIRRELVKI
FT                   QKELAQ"
FT   gene            complement(147664..152094)
FT                   /locus_tag="HM1_0142"
FT   CDS_pept        complement(147664..152094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0142"
FT                   /product="multidomain protein with s-layer homology region,
FT                   ig domain, f5/8 domain, fibronectin domain"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82761"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR003343"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="InterPro:IPR039005"
FT                   /db_xref="UniProtKB/TrEMBL:B0TD63"
FT                   /protein_id="ABZ82761.1"
FT                   /translation="MKGGCVMEITHKFGIAGIAGRLAAVAVIVLVLMLGIAQTAHAAGK
FT                   LIPISPVGVSASSFMAPYGPERAVDGSTAPASRWVCAKAYGVTNQWLQVDLGSSYRIDN
FT                   IEVIGMSSAGWSTAYNIQHYQVQASPDGTSFFNISIPYTTRYVRVRVDTGNGLNNKWAA
FT                   ITELKIYGTTDPTVTTNAAPASVGATSAVAGGNVTSLGNDTTVERGIVYSTNPANLTLA
FT                   SGTAVSAGSTGSTGPFTATLSGLQANTTYYYKAYVTNAFGTAYGGACSFTTGNPPVLAV
FT                   NTGLSVNKNSQAVTITDTMLRATDPEQGAASLTFAVGTAPARGTLKKNGNAVAAGGTFT
FT                   QADIDNSLITYTPNTNATGADSFSFTVSDGTAGGSAGGSFAINIIEPPAAIDIAAIPGV
FT                   TAPARGATPVTAITETAQYTGTVSWSPADNPFRGGTVYTATITLTPKTGYTLTGVAANF
FT                   FTVAGATSVSNAAGSGVVTAVFPATEADPPSNSPPAAKNPVPTQSVTAGGTATFTASDI
FT                   AEDTNNDPLTITAIVTGPDTAKATASLDSGTVTLTGVAAGDTSVVVTVYDGTDTADVTV
FT                   PVSVTAAPPTLVTSITVRGAGDAATVVNGGTLQMTAEVLPVDATDKTVTWSVYSGTGTA
FT                   GINASTGLLTGTGEGTVTVRATANDGSGVYGEATITVTAAPLPVMGGSVTISGSAKYGE
FT                   TLTAVTSGITYTPNTTEDVPTYRWKRGGADIPGATASTYTLAQADIGQTITVTVTADGV
FT                   HATGSVTSDPTAVVDKADGPAAPGAPSLASKTHDSVTLTTSAACEFRVNGGPWQDSNVF
FT                   TGLDPETEYTFTARVKETATHKASAESAGLTVTTDAEPAQPDTTPPVVADGTITAGSLT
FT                   HNRVTLSWSKATDDVSPQSALRYRVYYSDSDNIASVTDAVYNGTAVGDYATDTDTKEIT
FT                   GLNSNTTYYFNVIVMDEAGNKTAYTMTSVTTAAAPPVNTAPKRKSGVPATATASVTVNS
FT                   AYTIDLSTIFEDADGDNLTYKVSVNGVAYAGADKDYSYTPNAVGTTPLVFKANDGTADS
FT                   ADTYTVTLTASSAGGGGGGGSGGGGSAITGSTPAMPTYKATVSGTNISETKMPVSVNTN
FT                   MGSAATDLGALAKDIFAGTGTAVLTVPSIPGVNSYTVGIPAASLSGSQGEGALTFSTGE
FT                   GSITMPSGMLAGIPGTEEKTAGITIAQGDKTGLPEEVKAAIGDRPIVQLTLTLDGKQTN
FT                   WSNPDAPVTVSIPYKPTAAELANPEHIVVWYIDGSGNVVSVPNGRYNPDTGTVTFTTTH
FT                   FSYYAVSYKQVSFKDVAKDAWYSKAVSFIAAREITTGTGGGNFSPEAKLTRGQFIVMLL
FT                   KAYGITPDANPQDNFADAGSTWYTGYLAAAKRTGISAGVGGNMFAPEKEITRQEMFALL
FT                   YNALKVIGRLPEGDDSGKRLSDFSDTGEIAPWAKDAMKLLVETGTVSGSGGKLLPKDTT
FT                   TRAQMAQVLYNLLSK"
FT   gene            complement(152112..152978)
FT                   /locus_tag="HM1_0143"
FT   CDS_pept        complement(152112..152978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0143"
FT                   /product="phage tail collar domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82762"
FT                   /db_xref="InterPro:IPR011083"
FT                   /db_xref="InterPro:IPR037053"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDP9"
FT                   /protein_id="ABZ82762.1"
FT                   /translation="MLCPFSARADAGSIPFLGEIRLFAFDFAPNDGVWVPADGQTLQIT
FT                   QYDYLFGLIGTAYGGDGMNTFAVPNLNGAGSANPWGAGKGRYFIAAYGVYPDSGTDTMA
FT                   TINPYLGEIRLFMFSPATPVPKGWRVCNGDALPVSGNAALYSLLGTEYGGDTTNFALPD
FT                   LRGLEPVPGSRYCICTQGYYPSSDGKNMYALPTVYTGEIRLFATSASNTACTPPAGWLR
FT                   CDGQSLSASAYPRLSSLMGTMYGGSGSTFNLPNLNGGTNPANPWGGTDWGLYCIVADEQ
FT                   YSILPNP"
FT   gene            complement(153053..154141)
FT                   /locus_tag="HM1_0144"
FT   CDS_pept        complement(153053..154141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0144"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82763"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDQ0"
FT                   /protein_id="ABZ82763.1"
FT                   /translation="MCAMTIRVINNSNHDFQCIGSWGDSISCNSGALIPGGEKGKRIVE
FT                   IGTIDLPKAGLRSGNWGWWYVQDVVNKATIEFFAFADPWSHNGDRVSAGLRANNSHNID
FT                   RVTPNPLPGYFDTAKDNDSFTLIIQSQWTDNPPDYIFNFGHYGCKYAPVLDKWQWAAHA
FT                   YVKVVSFDGSRTVNFDCYGGTYPDDPSNDWVYPSLSFTATEDQLLLARAICSFEIDESR
FT                   TDYGRKPCVSTLTPSGKLRLGDCCGIIYLHSGVCHQMANRICAAVTNLDAGDMADMALY
FT                   NDTKGLWGTYGKLNNPGPGVVWDRIFNAYSDQMTLTDKQLKALGVCPDAKDEAVRLLYG
FT                   SWEDYLRECRNLVAQYKNKKKP"
FT   gene            complement(154255..160629)
FT                   /locus_tag="HM1_0145"
FT   CDS_pept        complement(154255..160629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0145"
FT                   /product="multidomain protein with s-layer homology region,
FT                   ig motif, i-set domain, pkd domain"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82764"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR003343"
FT                   /db_xref="InterPro:IPR003598"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR013098"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR013378"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="InterPro:IPR042229"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDQ1"
FT                   /protein_id="ABZ82764.1"
FT                   /translation="MNYRVIVAYSFGNYNAEDFVNDQSNWTIIKEFSSTGEKGNNNTWT
FT                   SYEKFMSSFDSNKINFVFYVESSGSGLTVGFDNLRIMDYGAQILIDSQPQDLTVTEGKT
FT                   ATFTVEARGVDLRYQWKKDGVELNTGDGYVTLPNIPTLTINNVKKSHEGSYTVMITSNL
FT                   YGGSVTSNAATLTVNPNNPPAAKDPVPTQSVTEGSTAAFNAADIAEDVDNDPLTITAIV
FT                   TGPDSAKATASLDSGTVTLTGVAVGSTSLVVTVSDGTDTADVTVPVSVTAAPVAPTIIT
FT                   QPSSQTVTAGQTAFFTVTASGTEPLSYQWKKDDNNLSDGGNISGATTDTLTINNAQVAD
FT                   AGNYTVVVTNAAGSVTSDEATLTVNATPAYSAPVLDTDGFPMLNSIDEDDYSSNGNTIA
FT                   QIVTDGSITCFDGSTAENIAVTSVDNTNGKWQYSINGGITWLDVSDVTGRVIDLSANSL
FT                   LLDENARLRFVPNANWNGTSTFTYRAWQNNAAGLQLDGVDDYVAVSGLGTYPAITIESW
FT                   IRIDSFSDGFNVIMNGNNWEIPGLLHSQFLKGNPTQLEIAVYGSPTPYVRFDYDFNQIV
FT                   GRWTHIAVTINKATGNYKLYVDGVYKETKYRNLANIPGINVSSFSLGAWNNSGTMQRFS
FT                   RGIFSDFRLWSVERSEAELAANMANGSLTGNESGLIGYWKFNEGNGTVVADSGPGSHNG
FT                   IIHGGAAWISSSGQTANTTVNGGSTYFSEAEETANIAVNAVNDAPSQPGAFTTPSLGQS
FT                   FVSGSNINVAWGEATDIEGDIITYTVDFWDGNIWITNVYSGTNTSFAFSDTGGINTSSA
FT                   RFRVKASDAEVSSSYSESDEFNIVNTYTVTFKNWDGSELKTEVVEHGSRATAPEEPTRE
FT                   GYHFTGWDVDFSNITSDLTVTATFAINEYTLTYIAGEHGSISGDATQTVSHGGNGTAVT
FT                   AVPDTGYHFVRWSDDVTTATRTDKDVTGNITVTAIFEINEYEFTPPSITAQPVSQTVTA
FT                   GQTVTFTVTAAGDAPLSYQWKKNGNSLIDEGNISGAATSTLTINSAQAYDAGSYTCYVS
FT                   NAAGSATSNAATLTVNTAPPANNPPTAKNPVPTQSVTAGGTATFTASDIAEDTDNDPLT
FT                   ITAIVTGPDTAKATASLNSGTVTLTGVAAGDTSVVVTVYDGTDTADVTVPVSVTAAPPT
FT                   LVTSITVRGAGDATTVVNGGTLQMTAEVLPVDATDKTVTWSVYSGTGTAGINASTGLLT
FT                   GTGEGTVTVRATANDGSGVYGEATITVTAAPLPVMGGSVTISGNAKYGETLTADTSGIT
FT                   YTPDTSDDVPTYQWKRGGADIPGATASTYTLAQADIGQTITVTVTADGIHATSSVTSAP
FT                   TAVVDKADGPAAPGAPSLASKTHNSVTLAANAAYEFRVNGGLWQDSNIFTGLSPETSYT
FT                   FTARVKETATHKASSESAGLTVSTDAAPAQPDTTPPAVADGTITAGSLTHNRVTLSWSK
FT                   ATDDVSPQGALRYRVYYSDSDNIASVTDAVYNGTAAGDYATDIGTKEITGLNSNTTYYF
FT                   NVIVMDEAGNKTAYTMTSVTTAAAPPVNTAPKRKSGVPATATAVVTVNNAYTLDLSTIF
FT                   EDADGDNLTYKVSVNGAAAVAANKDYSYTPAAVGITTLVFTANDGTTDSLDTYTVTLTA
FT                   GAAVTCTVTFDSQGGSAVASITGVAPGSVITAPSAPTRTGYTFGGWYKEASCVNAWNFS
FT                   VDTVTANITLYAKWIYNGGGGGGGGSGSSSSTPATPTYKATVSGSNISETKLPVSVNTN
FT                   TDSAATDLGTLAKDIFAGAGTAVLTVPSIPGVNSYTVGIPAASLSGSQGECVLTFSTGA
FT                   GSVTLPSGMLAGIPGTEESSAGITIGQGDKSGLPEEVKAAVGDRPIVQLTLTLDGKQTE
FT                   WNNPSAPVTVSIPYTPTAAELENPEHIVVWYIDGSGSVVSVPNGRYDPDTGTVTFTTTH
FT                   FSYYAVSYKQVSFKDVAKDAWYSKAVSFIAAREITTGTGGGNFSPEAKLTRGQFIVMLL
FT                   KAYGITPDANPQDNFADAGSTWYTGYLAAARRLKISAGVGGNVFAPEKEITRQEMFTLL
FT                   YNALKVIGHLPRGDSGKTLSDFSDADDVALWAKEAMKLLMETGTIGGSGGKLLPQDTTT
FT                   RAQMAQVLYSLLTK"
FT   gene            complement(161580..162728)
FT                   /locus_tag="HM1_0639"
FT   CDS_pept        complement(161580..162728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0639"
FT                   /product="reverse transcriptase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83244"
FT                   /db_xref="GOA:B0TGI3"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGI3"
FT                   /protein_id="ABZ83244.2"
FT                   /translation="MNVTENGMKYRQPLKEGYLQRVPAEQEGNAEVYAPSRITENNITD
FT                   TDSLTGGLLEKILDRDNMNKAFKKVKSNKGACGIDGMGVEELLRYLKENGQQLTQAIQE
FT                   GKYRPNPVRRVEIPKEEKGKVRRLGIPTVVDRVVQQAITQVLSPIFERQFSDSSFGFRP
FT                   KRSAHDAIRRCQKHVDEGYKYVVDMDLEKYFDTVNQSKLIEVLSRTIKDGRVISLIHKF
FT                   LRAGVVIGHKFEGTEVGVPQGGPLSPLLSNIMLNELDKELERRGHRFVRYADDMVILCK
FT                   SKKSAKRTLENILPYIEGKLFLKVNREKTEVGHISKVKFLGYTFYRHKGQTRVRIHPKA
FT                   VAKMKTRIKELTARSNGMGNEQRIFNLRKYIMDGLTTSNWLI"
FT   gene            complement(163211..166033)
FT                   /locus_tag="HM1_0638"
FT   CDS_pept        complement(163211..166033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0638"
FT                   /product="sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83243"
FT                   /db_xref="GOA:B0TGI2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011623"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGI2"
FT                   /protein_id="ABZ83243.1"
FT                   /translation="MSLEGEWEFYWRQLLAPEDFKSGGAASRTGFIRVPGTWNGYAPPG
FT                   SGKGQKLPGEGYATYRLVVHTNAGEPVLGLKILDFATSYRLWVNGELLSENGRVATSKD
FT                   ETRPQSFPRLVSFQNDAGTVEIVLQIANFTHRKGGIWTDIKMGTPGQLQALREKQAFST
FT                   LFLCGGLLIMAVYHLGLYLLRRKDRAPLFCALLCLFIAARASVTGEIFLLSYFPDLSWN
FT                   AVYIVQYLGFYLALPAFLQFMRILYPDEMPAKLAAAAWAAGAASSLTVLIAPPSVYTWL
FT                   MPFYEVYAVVLLLFVLGPVLIRAIARGREGAALFLPGTAALVLAVVNDSLVSNDILWGP
FT                   YIGDFGVFVFIFFQCCVLSMRFSRSFATVEKLSEEMRDKNTELIKLDGERCEALKRLEE
FT                   YSRNLENIVQERTSALARAKEEADLASRAKSDFLATMSHEIRTPMNGMLGMLELLEATP
FT                   LDEEQREYVSVVRDCSNLLLSLINDVLDLSRIEKGAVSLEEKDFETKSMKRYLVSLIEP
FT                   MAARKGLDFVSEFSPSVPPVLRGDPVRLRQVLLNLLNNAVKFTAKGCITLRAYVTGNEI
FT                   TFEVEDTGPGILEEIRGSIFKPFTRGHSGTDSMHGGAGLGLSICRRLVELMGGGISFET
FT                   TAGVGSLFRFTVPLKISDTGTGLEEAKPANGGTKASYLWENSPGTVLVADDFEFNRRVL
FT                   TMQLGKLGLEAETAAGGQEAVEMFSQKNYALVLMDCRMPGMDGFQAAAAIRRLEAGKNR
FT                   HTPIIAVTAGAAPEEKERSLAAGMDDYVKKPVLLDALSGTLARWLPGAVKNGRQVLGGA
FT                   FAETAASRVILPSFVPEGKKAELLQTVGADPALLSRVLAAFLRDMPEKLAALEAALKEK
FT                   DAPRARLLSHGMKSSGQFVGAASFAALCGEMEEKAVAGALEGAGELAEKIRRELLGIQK
FT                   ELAQYAGEMT"
FT   gene            166118..166300
FT                   /locus_tag="HM1_0637"
FT   CDS_pept        166118..166300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0637"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83242"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGI1"
FT                   /protein_id="ABZ83242.1"
FT                   /translation="MSGYVKGRGPQDCCGQEKKYRCFQLSGIAQDMHLLSPVLKLQHIN
FT                   EICYNLIYIGIIADI"
FT   gene            166329..167027
FT                   /locus_tag="HM1_0636"
FT   CDS_pept        166329..167027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0636"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83241"
FT                   /db_xref="GOA:B0TGI0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGI0"
FT                   /protein_id="ABZ83241.1"
FT                   /translation="MAGEKIMIVDDEAVVHELLTHYLEREGFKVFSVYSGSHVLDKTAF
FT                   HKPDLILLDILLPGLDGIEICHELRKKTDVPIIFITSRDAPHEVALGLGIGGDDYVKKP
FT                   FNPVEVVARVRAQLRRFRKQCALQEDEPAVLAFGDLRINLFDRTVEMKGERVELTVKEY
FT                   DLLLFLAQNPNRYFSSDQLIEAVWNHPRSISQKALMTHISNLRRKLGEDPDSPRYIATL
FT                   KGVGYMFSSR"
FT   gene            complement(167087..167701)
FT                   /locus_tag="HM1_0635"
FT   CDS_pept        complement(167087..167701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0635"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83240"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGH9"
FT                   /protein_id="ABZ83240.1"
FT                   /translation="MEKKTVEKGCKYPAIEIKKKTGNEQFLNAGSDVCTLRDFWAWAYS
FT                   DLIGNTERGRLAEFIVAMALGITEGISVSWDKYDLLSKEGIRVEVKTSAYLQSWSQQNL
FT                   SKISFGIQPTYGWDSVTNEYDAEKKRQSDVYVFCILKHKEQATLNPLDLLQWDFYVLST
FT                   AVLNKTAPGQKTISLRSLMDKGAKQCEYAMLYETIKSEAAR"
FT   gene            complement(167763..168566)
FT                   /locus_tag="HM1_0634"
FT   CDS_pept        complement(167763..168566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0634"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83239"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGH8"
FT                   /protein_id="ABZ83239.1"
FT                   /translation="MFNANTSTAKAKWVLETMGIKDVPAPYFDDIARQEKIKVKRRSLP
FT                   SEKDFSGMLIYRGEKKGILINTYIENIGRQNFTFAHELGHYFLRHKPPYTLDGESSFRC
FT                   SNQDMEVVDNYSSIEAEANQFAVELLMPELLFKPLLAGTVFDFTLMSSLANQFYVSKHA
FT                   CGNRILDFMKEPYILICSKGTSVTAIKCSNAAKRFGKVVKNIPTESHAYRAIQYEQNQK
FT                   QFYLSPGSVWFGQLYSNIIVYECTRGNYEHDVSMTILKVEYYTNH"
FT   gene            complement(168566..170182)
FT                   /locus_tag="HM1_0633"
FT   CDS_pept        complement(168566..170182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0633"
FT                   /product="type i restriction modification DNA specificity
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83238"
FT                   /db_xref="GOA:B0TGH7"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGH7"
FT                   /protein_id="ABZ83238.1"
FT                   /translation="MKAAELRKSILQAAVQGKLVPQDIHDEPASVLLKRIRAEKERLVK
FT                   EGKIKKEKPLPPISEDETPYDLPEGWVWCRLGELIQIAENNNIHKNLPENTLVNYVDID
FT                   AIDNKKYCIKDVKQIPVKSLSSRARRVLQKGFIVYSLVRPYLNNIAVVEDEKENYIGST
FT                   GFVVFKPIKIEINYFISFLLSPFVKTYYLSLLSGFNSPSVSQEDFLSTLFPLPPLAEQQ
FT                   RIVTKVNELMALCDELEAAEQELDALESRFEEYLPKSILQAAVQGKLVPQDIHDEPASV
FT                   LLERIRAEKARLVKEGKIKKEKPLPPISEDEIPYDLPEGWVWCRLGDIIIQNIGGGTPS
FT                   KQNLAYWNGNIPWASVKDLTGPILDKTRDCITELGLEESSSNLIPANSIIVCTRMGLGK
FT                   IAINTIPVAINQDLRALIISRMNIDLRYIIAYYKTLSIRGEGTTVKGISIEELHNMLFP
FT                   LPPLAEQQRIVAKANELMALCEEIKAVKTKPIEQRDTNKVIDFPAVKQDGQLQLAARGE
FT                   ISKKSSNELMQAIDEMFAEDE"
FT   gene            complement(170179..171615)
FT                   /locus_tag="HM1_0632"
FT   CDS_pept        complement(170179..171615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0632"
FT                   /product="type i restriction-modification system, m
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83237"
FT                   /db_xref="GOA:B0TGH6"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGH6"
FT                   /protein_id="ABZ83237.1"
FT                   /translation="MAISNTTKALKDIMRIDAGINGDAQYIEQIAWLLFLKAFDYKEQE
FT                   WELEDDYVPVIPEQYRWRNWAEDDEGITGDALIEHVENMFRTLRNLDVSDGDPRKFLVR
FT                   DVMEGVNNFMKSGTLLRQVINKINADINFDEVKTAHLFNGIYESMLKDLQSAGKAGEFY
FT                   TPRPVTRFIVDKVNPQLGEIVLDPACGTGGFLTSVIDRFDIKTADEYRTLQKTIRGIEK
FT                   KPFPFLLCVTNLIAHGIDVPLIRHDNTLRTPTTDYSLADKVDVIVTNPPFGGAEEKAIS
FT                   QSVPAELRNTETADLFLVHIMALLKDGGRCGMVLPDGFLFGTGVKAAIKKKLLEENNLH
FT                   TIVRLPKDVFAPYTNINTNLLFFTKGKPTQGVWFYRLEMPQGYKHFSKTKPMLYEHFAP
FT                   VRAWWNNRKESDVSQYVPVEDIIAAEYNLDFCGFPHETEEILPPDEFIAQYRNEKAILT
FT                   ERIESILAKIQIALAQEDVL"
FT   gene            complement(171634..173973)
FT                   /locus_tag="HM1_0631"
FT   CDS_pept        complement(171634..173973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0631"
FT                   /product="type i restriction-modification system, r
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83236"
FT                   /db_xref="GOA:B0TGH5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR013670"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029464"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGH5"
FT                   /protein_id="ABZ83236.1"
FT                   /translation="MDKRSLTEQEIRTRFITPAIKAAGWTDVQIREEYAITKGRIIARG
FT                   GSYKRDKAKYADYVLFYKPHIPIAIIEAKDNNHTISDGMQQALGYAEQLRVPFVFTSNG
FT                   DGFTFHNRNSEGSNRETILSISEFPSPETLWSMYKQYKGIDEKQEKVITEPYYVERPDK
FT                   QPRYYQLNAINLTVESIVKGNNRVLLVMATGTGKTYTAFQIIWRLWKAGIKKRILFLAD
FT                   RNALIDQTYTNDFAPFKDKMTIIRHRHVDKSYEIYLAIYQGLTGEGDKDIFRQFSPDFF
FT                   DLIVVDECHRGSAKADSEWREVLEYFKSATQIGLTATPKETKEVSNIDYFGEPVYTYSL
FT                   KQGIEDGFLAPYRVIRVLLDKDAEGFRPYLGQTDRFGNIIEDREYNITDFDRELVLEQR
FT                   TKVVAKVVSNYLKAHNARMDKSIFFCVDTEHADRMRQALINENSDFVKEDERYVMRITG
FT                   DDDIGKKQLDNFRDVSSRYPVLVTTSKLLTTGVDIQTVKYIVLDTNINSMTEFKQIIGR
FT                   GTRIREDLGKVFFTIFDFRDATRLFADPDFDGPCEQDDEYMPDENGNIHDSDSDSEFVR
FT                   EDPKDYTIDNDSESGKRKKYYVGDVEVSVLKQRVQYIDKNGKLITESLTDYTKRNVLSK
FT                   YASLHDFLHVWNSAERKQAILDELAEQGVLIEELQEQIGHEFDPFDLLCHIAFDQPPLT
FT                   RRERANKVKKRNYFAKYGEKAAAVLDALLDKYADSGISNIESLDVLKVNPIREFGTPQF
FT                   IVNKIFGGKEKFKQAIRELEQELYVA"
FT   gene            complement(173999..174178)
FT                   /locus_tag="HM1_0630"
FT   CDS_pept        complement(173999..174178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0630"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83235"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGH4"
FT                   /protein_id="ABZ83235.1"
FT                   /translation="MDYLTAKQAAEKWNISPRRVQVLCEQGRVKGAVRLGWAWAIPKDA
FT                   EKPRDARIKTKTEN"
FT   gene            complement(174329..175636)
FT                   /locus_tag="HM1_0629"
FT   CDS_pept        complement(174329..175636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0629"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83234"
FT                   /db_xref="GOA:B0TGH3"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGH3"
FT                   /protein_id="ABZ83234.1"
FT                   /translation="MIEECMAGKIDMVITKSISRFARNTLNCLKYIRQLKDKGIPVFFE
FT                   KENINTMDSKGEVMLTIMASLAQQESESLSQNVKLGIQYRYQQGEIQVNHTRFLGYTKD
FT                   ANKQLVVVPEEAEIVKRIFREFLEGSSLLQIGKGLEADGILTAAGKPKWRPETIRKILK
FT                   NEKYMEDAPLQKTYTVDCLTKKRVINNGIVPQYYVENSHEAIIPREIYMQVQEELARRA
FT                   KPFTDVGGKMRCYSCKYALSSIVFCGDCGELYRRITWYYGNRPTVVWRCVRKIECRTPE
FT                   CHSQSVKEADLKRGVVKAINKLVLGKEEFISAMRKNVEAVIGGGAGQGVDEIEEKLAQL
FT                   QDELVRLASGGQNYEAVVEEIYRLREIKGKILSGSADIHGKRRSVAEMEEFLNSQSGIF
FT                   FEFDDKLVRRIVNRVTVYDGRLTVEFKTGTEVNVEL"
FT   gene            complement(175633..175854)
FT                   /locus_tag="HM1_0628"
FT   CDS_pept        complement(175633..175854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0628"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83233"
FT                   /db_xref="GOA:B0TGH2"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGH2"
FT                   /protein_id="ABZ83233.1"
FT                   /translation="MHLAAEDSAGHKLRVAAYCRVSTDEEEQASSYEVQIEHYTSFIQG
FT                   NPEWELAGIFADEGISGTNTKKGRNSTA"
FT   gene            complement(175820..176233)
FT                   /locus_tag="HM1_0627"
FT   CDS_pept        complement(175820..176233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0627"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83232"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGH1"
FT                   /protein_id="ABZ83232.1"
FT                   /translation="MIPEAALEKAFMELMRSIDLSDLQDGPKRAAPDIEIKYDDPVKQA
FT                   EYAYSLIEIDDFAYLTKKLKKLLLEAPPVFDGEFMKSVVRRITVCGDRAEFELLNGKTY
FT                   GKELSLGAADGKERVGHTGAKKYAPGGGGQRRA"
FT   gene            complement(176244..176447)
FT                   /locus_tag="HM1_0626"
FT   CDS_pept        complement(176244..176447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0626"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83231"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGH0"
FT                   /protein_id="ABZ83231.1"
FT                   /translation="MWAFFEDYLKGTSQQEAARRNGIHSAQATLGKMLRDSKYLGDGFY
FT                   PPVISQEIYDWAQEERKAARFA"
FT   gene            176511..176687
FT                   /locus_tag="HM1_0625"
FT   CDS_pept        176511..176687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0625"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83230"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGG9"
FT                   /protein_id="ABZ83230.1"
FT                   /translation="MPYYLSILSRRTRPHFKRKPISAGEKTVHAFHKAVKEIFIEFLHI
FT                   SPAGKIAIDLLGR"
FT   gene            complement(176796..177011)
FT                   /locus_tag="HM1_0624"
FT   CDS_pept        complement(176796..177011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0624"
FT                   /product="conserved domain protein"
FT                   /note="contains helix-turn-helix motif"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83229"
FT                   /db_xref="GOA:B0TGG8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGG8"
FT                   /protein_id="ABZ83229.1"
FT                   /translation="MSVSYKKLWKLLIDKDMKKKDLREQAGISHASVAKIGRNENVTTD
FT                   ILVKICKALNCDISDIMEIVDDTKTH"
FT   gene            complement(177282..177536)
FT                   /locus_tag="HM1_0623"
FT   CDS_pept        complement(177282..177536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0623"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83228"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGG7"
FT                   /protein_id="ABZ83228.1"
FT                   /translation="MGYFASLYASELPHRAVAVYMYLKDRADKDGKCYPAINTIAAELK
FT                   LSRSTVKRAIGDLVKSGWIRKEQRWRENGGKSSCMYYVR"
FT   gene            complement(177548..179368)
FT                   /locus_tag="HM1_0622"
FT   CDS_pept        complement(177548..179368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0622"
FT                   /product="trag/trad family protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83227"
FT                   /db_xref="GOA:B0TGG6"
FT                   /db_xref="InterPro:IPR003688"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGG6"
FT                   /protein_id="ABZ83227.1"
FT                   /translation="MQTSQIITLTAAALTMFGVIGFLSLLAHYYTLNGIKSKTVGDGQH
FT                   GTARWATKQEIHKTYVHLPYTPTLWRRKKNLPSAQGLVVGCKISRGRVTALVDTGDIHC
FT                   LMIGAAGVGKTAHFLYPNLEYACASGMSFITTDTKGDLYRNYGGIAKEHYGYDVAVIDL
FT                   RNPTRSDGNNMLHLVNKYMDAYIADPENLSFKAKAEKYAKIIAKTIINPGGADAAAYGQ
FT                   NAFFYDAAEGLLTSVILLVAEYCPPPKRHIISVFKLIQDLLAPSGVKGKNQFQLLIEKL
FT                   PPEHKARWFAGAAVNSAEQAMQSVLSTALSRLNAFLDSELEQILCFDTAIDAEKFCTKK
FT                   SAIFLVMPEEDSTKYFLISLIVQQLYREMLAVADEHGGRLPNRVMMYLDEIGTIPKIES
FT                   IEMMFSASRSRRISIVAIIQSFAQLEKNYGKEGASIIVDNCQDMVFGGFAPNSESAEVL
FT                   SKALGNRTVMSGSVSRGKNDPGQSLQMIQRPLMTPDELKSMPKGRFIVTKTGVNPMRGT
FT                   LKLFLEWGITFGKPYEIAEKSARKVVYADRGELEQEIIRRHAACVDTDEEPEAAAGGMA
FT                   HAPVREEAKAAPKTKALLKSRQPEAPVRIE"
FT   gene            complement(179425..180930)
FT                   /locus_tag="HM1_0621"
FT   CDS_pept        complement(179425..180930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0621"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83226"
FT                   /db_xref="InterPro:IPR025054"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGG5"
FT                   /protein_id="ABZ83226.1"
FT                   /translation="MSKYIPFTDEQKRRANSIDIADFLRRQGEQLTRAGRDWRWKRHDS
FT                   VTIRGNQWYRHSREEGGLAIDFVREFYGLSFPEAVTLLLGGEGGVEWNQTHKSAPAPRK
FT                   PFALPEMNSDMRRVYAYLIKQRFIDRDVIAHFAKSKMLYESCERSADKTKEYHNAVFVG
FT                   YDENGVPRHAHKRGLYTVGGSYRGNVEGSDPAYSFHHIGANDTLYVFEAPIDMLSFITL
FT                   YPEDWKQNSYVALDGVAEHALLRQLELNPRLQKVVLCLDHDEAGIEAAGRLAEILNARG
FT                   CRKVPVRQPEYKDWNEDLKAKNGVAPIPAQGHPKLEALPEICAGLYETCKSLISTHNPY
FT                   AMLLEHYEKLKPLIANGKLPQGKAPAVTEHLRVMAAAALLAAQRQYRQMEQPAAIEQLI
FT                   AELQDSYRLHRDRGMLRSRADDLRQDVSSLNRQISAAGLRSPEDKHNLIASYLRLALDC
FT                   VRSQIFVRLEELKQNTETLCLQKADGNVRQAEHTGLASQRLML"
FT   gene            complement(180946..181065)
FT                   /locus_tag="HM1_0620"
FT   CDS_pept        complement(180946..181065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83225"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGG4"
FT                   /protein_id="ABZ83225.1"
FT                   /translation="MMKEYLRKKDKVLIPRLPSNRKPLPQRAAFFGRCGKRKR"
FT   gene            complement(181080..182864)
FT                   /locus_tag="HM1_0619"
FT   CDS_pept        complement(181080..182864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0619"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Sel1-like repeat"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83224"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR041073"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGG3"
FT                   /protein_id="ABZ83224.1"
FT                   /translation="MPRIIFKCRYLKNAPEHLANFIEYAATREGVEKVPDSTGLLPATQ
FT                   KQQRLIAEIISKLPDTAGLFEYEDYFKDKTRENASEFIAVALEQNLDLLGKRENYVGYI
FT                   ANRPGAEALGSHGLFTDADLPVVLSKVAEEVANHAGNVWTNVISLRREDAARLGYDNAK
FT                   AWRDLIRGQRNHIAEQMKIAPENLRWYAAYHNEGHHPHVHLIAYSVNPTEAYLTKQGIE
FT                   NMRSSLAREIFKQDLIQIYSEQTKRRDALTRQSRESMREIIGQISSGVCENKTIEELIA
FT                   RLAERLKHTSGKKKYGYLKAPLKAVVDQIVDELARDERVARCYEKWCELRNEVLRTYAD
FT                   MLPDPLPLSRRKEFKSIKNMVIAEAMSIGGHHFTFEPDEDMETDMYLAGEDIPKDVSAT
FT                   AAYFEKTARLGNVHAQYALAKLYLTGEDMPKDVPKAVELLAKSAMQDNSFAQYRLGKLY
FT                   LLGKDVPKDVDEAVKWLTASAEQGNQYAQYALGKLYLMGHEVPRDREAAVRWLSLSAGQ
FT                   GNIYAQFFLDRVDSFREPSVLLAATRLMHHLGNIFRDEQKRFGGGVMQVDRKLRKKLAQ
FT                   KKAAQGHAHDDREPRQSY"
FT   gene            complement(182876..183310)
FT                   /locus_tag="HM1_0618"
FT   CDS_pept        complement(182876..183310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0618"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83223"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGG2"
FT                   /protein_id="ABZ83223.1"
FT                   /translation="MRTGLEVDNMAEENKKKFPLWMRPETRKQVKEWYKKDNCGSQSEF
FT                   IEKAVLFYCGYISAENSMKYLPAALTSAMAGVVESSENRIARLLFKLAVEMSMMMNIIA
FT                   SNAEIDEALLQRLRGKCVNDVKKSVGAVTFEDVVKFQKGE"
FT   gene            complement(183688..183945)
FT                   /locus_tag="HM1_0617"
FT   CDS_pept        complement(183688..183945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0617"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83222"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGG1"
FT                   /protein_id="ABZ83222.1"
FT                   /translation="MRKSTVQIQYDAEKLRAIRQYMGKEDTEFQAELEDFLQKLYEEHV
FT                   PAPVREYIESRKFPEPERPNRPSCPAPSAPAKNNSAGGNA"
FT   gene            complement(184056..184349)
FT                   /locus_tag="HM1_0616"
FT   CDS_pept        complement(184056..184349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0616"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83221"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGG0"
FT                   /protein_id="ABZ83221.1"
FT                   /translation="MSGRKRYYLSFDMDNPRHREAETLFARQASRQRTEYVVTSILTAH
FT                   QTESLEQVVRQAVRDELRNAAPPPQTTLPEETDDGVRLSDLPGSLIRALEEL"
FT   gene            complement(184354..185235)
FT                   /locus_tag="HM1_0615"
FT   CDS_pept        complement(184354..185235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0615"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83220"
FT                   /db_xref="InterPro:IPR040607"
FT                   /db_xref="InterPro:IPR042051"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGF9"
FT                   /protein_id="ABZ83220.1"
FT                   /translation="MIKLGVDNGNYNTKSSEGMLYASGYTASDKEFITPDMQLFYEGRY
FT                   YAIGERRMRFQQDKTREPDTFMLTLPAIADAMKHAGTTSAEIALGVGLPIGSYGTQKEA
FT                   FRRYFLRDNVSFLFEGTSYRCRIAECKVFAQGHAALCRYYPQLKDYRSITLVDIGGYTV
FT                   DILTLHDFRLDRSSCASLRMGTITLYSRIQDTLQRNDILLSDELITDAIRGDIQHADSK
FT                   LIHAVVEQAVVAYCKELLNALRERGLDLRLPTVFAGGGAELLELMLRRSDINTVAVLNR
FT                   FANADGYKLLMG"
FT   gene            complement(185269..185634)
FT                   /locus_tag="HM1_0614"
FT   CDS_pept        complement(185269..185634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0614"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83219"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGF8"
FT                   /protein_id="ABZ83219.1"
FT                   /translation="MRETELTILFPTEKLEALRFFMRKKELDIEREMKDYLEKTYERIV
FT                   PVHVREYVESRIGQEPAQEQMPGPEAQERQTEPQRQPRQTRRQREQAATEAPSSPQAQT
FT                   GTEGPAEEETQGMTMSM"
FT   gene            complement(185652..186737)
FT                   /locus_tag="HM1_0613"
FT   CDS_pept        complement(185652..186737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0613"
FT                   /product="m23 peptidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83218"
FT                   /db_xref="GOA:B0TGF7"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGF7"
FT                   /protein_id="ABZ83218.1"
FT                   /translation="MADPATITLAVRAAVAAATDKRTWKAAGVLVAAILTPFILIVVMI
FT                   VSLLSAAADHNSNAIELCFNGGAISSRVPADYAAHIREMRNGFSELDAAIADISSQVED
FT                   GQLDATRIKAVFYSLFFGAENLRMDASDYRAFADCFVRYETRAEKDEDGNKTGKTYTVA
FT                   VPLKSLPEIYANLQTTLGRTITHEDRANASEIYHRILYGGGIPTYGEAFNAWSNGLPLS
FT                   DAPFVGADGFCSPLGEGWRGMVTSEFGYRTDPFTGRHKGHSGIDLAAPQGTPIRAALDG
FT                   TVLFARYKTTGYGYHLAIDHGGGFVTFYAHCSKILVTEGQAVKAGDIIAEVGSTGRSTG
FT                   PHLHFEVRINGEIQNPRSYLP"
FT   gene            complement(186742..187236)
FT                   /locus_tag="HM1_0612"
FT   CDS_pept        complement(186742..187236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0612"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83217"
FT                   /db_xref="GOA:B0TGF6"
FT                   /db_xref="InterPro:IPR009288"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR017939"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGF6"
FT                   /protein_id="ABZ83217.1"
FT                   /translation="MKSKTLYIAYGSNLNLTQMACRCPTAKVVGTSELKDYELLFRGSR
FT                   HSAVATVEPCKGGCVPVLLWTLKEKDLQALDRYEGYPHFYRKKILNVELKGGIVSAMAY
FT                   IMNDGHPFGAPSDHYLNTILEGYESAGFDTEVLEQAVEKSIRLAEEQQPEQENLFGLKW
FT                   W"
FT   gene            complement(187256..187981)
FT                   /locus_tag="HM1_0611"
FT   CDS_pept        complement(187256..187981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0611"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83216"
FT                   /db_xref="InterPro:IPR022025"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGF5"
FT                   /protein_id="ABZ83216.1"
FT                   /translation="MLCKASHNIHVHVDASPHNANTLRNITNIMASKEDLIYKALQVSV
FT                   ARERRYCKKVEQSFLEELNRKKPKTLEQVSRIWYNGNDGRHEHYHNSRYHCLNLHSVFQ
FT                   KGTIEFRLFNGTTHAGKIKAYIQICLAISHQALTQRCASRIKTQSTNEKYTFRTWLLRL
FT                   GLIGDEFKTARLHLLEHLDGCIAWKDPAQAERQKQRLRQKKEKELARAAGAVQASQEQD
FT                   QTDMEQAGTEEGPGLSMSM"
FT   gene            complement(188072..189097)
FT                   /locus_tag="HM1_0610"
FT   CDS_pept        complement(188072..189097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0610"
FT                   /product="phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83215"
FT                   /db_xref="GOA:B0TD09"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B0TD09"
FT                   /protein_id="ABZ83215.1"
FT                   /translation="MKPSDFAYALTKYLSAYLPGQCNASENTVRAYRDTFKLLLRFADT
FT                   QRGICPERLTLADVDKSFVEGFLSWLETVQGNAVSTRNHRLAGIHAFFRYLQSEKPDMM
FT                   LQCQQVLSIPVKRTVKPTVNYLTVDAVKTILAMPDTSTVYGMRDLALLGLLYDTGARVS
FT                   ELIELRPKDLRLAAPPVVTLFGKGRKSRQCPLSSEMTGHLVKYLSAWGLDAPAKSDHPL
FT                   FVGHNAEKLTRAGVAYILSKYASAAREKDASIIPTIVSPHMLRHSKAMHLLQAGVNLVY
FT                   IRDWLGHASVKTTEIYARADSEMKRAALQKAASTVMPQHSRQSSWSEDVELMKWLSSLG
FT                   K"
FT   gene            complement(189094..190080)
FT                   /locus_tag="HM1_0609"
FT   CDS_pept        complement(189094..190080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0609"
FT                   /product="phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83214"
FT                   /db_xref="GOA:B0TD10"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B0TD10"
FT                   /protein_id="ABZ83214.1"
FT                   /translation="MKPCKTSLQSPFAAHIEAFISQKRALGYRYGAEEHQLRRFDVFCV
FT                   EQKITEPTLTKELTEQWIEKRAGEAAKSQHLRCSAIRQFALFLSSCGLAAYVLPVRKNT
FT                   VSQSYAPYIFSAEELKAIFHAADQMTPCTVSPFIHEVMPMILRLLYGCGLRSAEACHLK
FT                   KCDVSLDDGVLTILNAKNEKDRLVPMSDSLADRCRAYSERMELLCPDTAYFFPNKYGGC
FT                   VEPFTIYPWFRRFLFEAGISHHGRGKGPRVHDLRHTFAVHSLRKMAGDGMDLYCALPAL
FT                   SMYLGHENISATEKYLRMTAAVHPEILGQLQCVYGNMLPAADLEVAQ"
FT   gene            complement(190080..191303)
FT                   /locus_tag="HM1_0608"
FT   CDS_pept        complement(190080..191303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0608"
FT                   /product="integrase/recombinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83213"
FT                   /db_xref="GOA:B0TD11"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B0TD11"
FT                   /protein_id="ABZ83213.1"
FT                   /translation="MNQPTPNQSPVQALVNRLESYLVTQNYTVDTLRHYRHVWRQLACY
FT                   ADEKGIVTADAEWMTQFLREHYGISDGNSLTRTQKTYYRAAGMLCDFQRYGYVLRRNHT
FT                   KREIFPRRYQCIFEAAEKYCAQNRIAERTRRQFSVHLRRFVSFLESRNLRIEAIEAAHM
FT                   REYFLTLEPLAKTTVAFDLYVLRSVLPLLFADGVASSDLSLLCPSVRVPARAKIPSAYS
FT                   PEDIQAILDAVDRENPQGKRDYAILLLAARLGLRVGDIRELRFENIRWDEAEIRFIQSK
FT                   TGNEIVLPLSHELGWALIDYVKNGRPITDSKVIFVRHIAPYDAFGKNNNLNSIISKYFK
FT                   AANIYVPPGKRHGMHVFRHSLASSMLANGTPLPVVSEALGHSETNTTARYLKIAVEQLR
FT                   SCALEVSE"
FT   gene            191264..191386
FT                   /locus_tag="HM1_0606"
FT   CDS_pept        191264..191386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0606"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83212"
FT                   /db_xref="UniProtKB/TrEMBL:B0TD12"
FT                   /protein_id="ABZ83212.1"
FT                   /translation="MLEPVIDSGLVDSFRYLHKNISLDWDDMSVEYYAKKINQP"
FT   gene            complement(191373..191801)
FT                   /locus_tag="HM1_0607"
FT   CDS_pept        complement(191373..191801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0607"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83211"
FT                   /db_xref="InterPro:IPR022025"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGF0"
FT                   /protein_id="ABZ83211.1"
FT                   /translation="MEMKEQRFGIEIELTGLSRLRAAQVLAEYFGTPVSNDGGYYGIYS
FT                   VLDGQSRRWKVMSDGSITTEKKEGRRIVPADSTYSVELVSPICRYEDIETIQEIVRQLR
FT                   TAGAIANASCGIHYGKKNVMLSYSAFSAVWHALTLTVD"
FT   gene            complement(191869..193701)
FT                   /locus_tag="HM1_0605"
FT   CDS_pept        complement(191869..193701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0605"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83210"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGE9"
FT                   /protein_id="ABZ83210.1"
FT                   /translation="MPKKVRSPAAARQDDIRVQEFLDMIAPSVVKFYTDHFICGNTYRC
FT                   VWALREYPTATEEQAILRHLGEKDGVTLRIYTRHVTPVEERKIISNAANKNRMKRSSTN
FT                   DLQQTVAAESNLQDVANIVASMHRNKEPLLHAAVYIELSAHDPDQLKLLQTEVLTELIR
FT                   NKLNVDRLLLRQKQGFICAMPSGWNVFGDQFERVLPASSVANLYPFNYSGKTDERGFYL
FT                   GRDKFGSNILVDFNKRADDKTNANILILGNSGQGKSYLLKLILTNLRESGMHVLALDPE
FT                   MEYEELTVNLGGCFIDLMSGEYIINVLEPKTWDISGDPGDTGAPQAFRQTSKLSQHISF
FT                   LKDFFRCYKDFDDRQIDTIEIMLGKLYDKWGITDRSNFDRLKPADYPILSDLYELVEAE
FT                   YKAFDESRRQLYTADTLREICLGLHSLCKGAESNFFNGHTNITGGSFVTFGVKGLLQAS
FT                   KNIRNALLFNVLSFMSNELLTAGNTAASIDELYLFLTNLTAIEYIRNFMKRVRKKDSAV
FT                   ILASQNLEDFDIEGIREYTKPLFSIPTHQFLFNAGNIDAKFYIENLQLEQSEYNLIRYP
FT                   QRGVCLYKCGNERYNLMVTAPEHKARLFGKAGGR"
FT   gene            complement(193881..194516)
FT                   /gene="fic"
FT                   /locus_tag="HM1_0604"
FT   CDS_pept        complement(193881..194516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fic"
FT                   /locus_tag="HM1_0604"
FT                   /product="cell filamentation protein fic, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83209"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:B0TG52"
FT                   /protein_id="ABZ83209.1"
FT                   /translation="MSSNYEYSYEWDQRYCYPHSNVLINKLGIRDAEKLQIAEREITSL
FT                   RIANAKVNVIKGNFDLLHLRQIHKYIFGDIYEWAGEIRWVNIAKGNMFCNYEFIEQNAD
FT                   QLFAKLKKENYLKDASADEIPIRLAYYLGEINVLHPFREGNGRAQRLFIEYLAENAGYS
FT                   VDFSEVTDKQMIEASVASFSCDYTKMNELFIKITKPLTENSITQIFMG"
FT   gene            194515..194646
FT                   /locus_tag="HM1_0603"
FT   CDS_pept        194515..194646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0603"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83208"
FT                   /db_xref="UniProtKB/TrEMBL:B0TG51"
FT                   /protein_id="ABZ83208.1"
FT                   /translation="MAIAPGSRVLFNELSYGFFNQFIIPGTPSDSIFIILRKRHAFH"
FT   gene            complement(194801..195391)
FT                   /locus_tag="HM1_0602"
FT   CDS_pept        complement(194801..195391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0602"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83207"
FT                   /db_xref="UniProtKB/TrEMBL:B0TG50"
FT                   /protein_id="ABZ83207.1"
FT                   /translation="MSRKEKKEQKQRQATRQLINTRAITDYSLQTYGHGELVYFIIKPS
FT                   NISVLSEASVSARIYALMTVLKGMAEIEMCCLNSRENFEDNKRFLKSRAEQEDNPAVRK
FT                   LLEADLTFLDRIQVQMATAREFLIIIRLRDEKESEVFPYLNRIEKTLREQGFSVKRAGK
FT                   EDIKRLLAVYFEQNVTTERFEDFDGERWIIFGD"
FT   gene            complement(195388..195690)
FT                   /locus_tag="HM1_0601"
FT   CDS_pept        complement(195388..195690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0601"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83206"
FT                   /db_xref="GOA:B0TG49"
FT                   /db_xref="UniProtKB/TrEMBL:B0TG49"
FT                   /protein_id="ABZ83206.1"
FT                   /translation="MYIYPDNLKSKAVLWLWQLRDIGVIGIGCLISVFALAQLGFLLPI
FT                   VATALYAFLTIRFDDTSILDFIRYACAFFLTGQQFYEWRLQSGDHWEPDGKRVGK"
FT   gene            complement(195704..196273)
FT                   /locus_tag="HM1_0600"
FT   CDS_pept        complement(195704..196273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0600"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83205"
FT                   /db_xref="UniProtKB/TrEMBL:B0TG48"
FT                   /protein_id="ABZ83205.1"
FT                   /translation="MTDKKLVYIASPYAGDIEYNTRMAIKYCRYAAEHGVIPLAPHLLM
FT                   PRFLCEANPEERELGIKMGLQLLALCSELWVFGGRISEGMRREIAEAERLGVPIKHIGE
FT                   IEMTGVKDMKKYGIWAKRSAASVCGAAEAWLKSDGKPMTFDTYEEAAGKAEALMKNIGT
FT                   VNVSYYPRPMEQEPEDAPAPSMSMKL"
FT   gene            complement(196270..197139)
FT                   /locus_tag="HM1_0599"
FT   CDS_pept        complement(196270..197139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0599"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83204"
FT                   /db_xref="GOA:B0TG47"
FT                   /db_xref="UniProtKB/TrEMBL:B0TG47"
FT                   /protein_id="ABZ83204.1"
FT                   /translation="MTRPMFIWDFAADLVLGQIMDWIYAQIVGFLGEFFSMMGNMGAEL
FT                   FEMSWVQAVVLFFSYLAWALYVTGLVVSAFECAIEYQSGRGSVKDAALNAFKGFMAVGL
FT                   FTVVPVELYKLAITLQGSFTSGITGLANGGISAMTLAALANVGGFGFNPIMGLFCVILM
FT                   GYAVIKVFFANLKRGGILLIQIAVGSLYMFSVPRGYIDGFISWCKQVVGLCLTAFLQST
FT                   ILIAGLMVFNSSMLLGLGLMLAASEVPRIAGQFGLDTSTRGNLMSTVYAAQTAFNMTRT
FT                   VVRAVAAK"
FT   gene            complement(197202..197543)
FT                   /locus_tag="HM1_0598"
FT   CDS_pept        complement(197202..197543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0598"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83203"
FT                   /db_xref="GOA:B0TG46"
FT                   /db_xref="InterPro:IPR024330"
FT                   /db_xref="UniProtKB/TrEMBL:B0TG46"
FT                   /protein_id="ABZ83203.1"
FT                   /translation="MKKTKKLLLVFCLILVLTGIFCVTAYADPTGDVAGAIEGTWKDAS
FT                   AQIKTVVNKVVFPAIDLILAVFFFAKLGMAYFDYRKHGQFEWAAPAILFATLVFMLTAP
FT                   LYIWSILGM"
FT   gene            complement(197773..198822)
FT                   /locus_tag="HM1_0597"
FT   CDS_pept        complement(197773..198822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0597"
FT                   /product="phage recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83202"
FT                   /db_xref="GOA:B0TG45"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B0TG45"
FT                   /protein_id="ABZ83202.1"
FT                   /translation="MKTNTLLTVLTDYFMSYLPDVKGYSQNTITSYQYAFQLLYDFLLE
FT                   EKGLPPEKITFKSLSSEIISKYLTWLEVNRGCSPATRNLRRTAISSFSKFALKKNLGEA
FT                   LQFHSSVAEIPPKNTHKNTDIKYFTKEEIAIILNMPDTGRAIGKRDVMLLSLLYASGAR
FT                   AQELCDLTLNDIYLGKETNIRLVGKGNKARLVTIPQNCAVMLKNYLESRNLDSSSPKDR
FT                   LKHIFSSQTNEKMSISCVEEIVKKYVIKSKKAYPQLFKRKTYTPHSFRHSIAVHMLECG
FT                   ESLVVIKAFLGHTSIMTTTIYANVTPELANKYLRERGQALNDLELQNQYADHPTVGMLP
FT                   FLSKQHRGR"
FT   gene            complement(198812..199792)
FT                   /locus_tag="HM1_0596"
FT   CDS_pept        complement(198812..199792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0596"
FT                   /product="phage integrase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83201"
FT                   /db_xref="GOA:B0TG44"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B0TG44"
FT                   /protein_id="ABZ83201.1"
FT                   /translation="MIYIFKSAFSSEMVQHLTLLHSAGKYIFQIQSSLTDLDKYLVTNG
FT                   FTSKVLDANTISAWLKTRDVSMKTKIKNLSHVKGFVKYLASLKIEASCPELPKMQQEYV
FT                   PYVFSDAEIKRIVSAADNFEARNSLTRSVLVFPVLLRILYGCGLRLGEGRSLCWTDADL
FT                   ENGVLTIREAKNLKQRFVPMDDSLTNFLKDYKKMTHSDGICREYLFESDLHPGKPFKNN
FT                   TFYEWFTRVLKVADVNYAKLNNRKRGPCPHCLRHCFTLKSFLKSDNEGRRFEDTAPFLA
FT                   AYLGHDSAKETEAYLRSNHTVYEQSHQRVNAAIGNLFPEVSFDEN"
FT   gene            complement(199776..201041)
FT                   /locus_tag="HM1_0595"
FT   CDS_pept        complement(199776..201041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0595"
FT                   /product="phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83200"
FT                   /db_xref="GOA:B0TG43"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B0TG43"
FT                   /protein_id="ABZ83200.1"
FT                   /translation="MHAKTMLVKESYLNEELESFLNHLLGLGYSENTVQNYRWIVNQFE
FT                   RFLLENHYRNYSNEIADQFLSTVSESRRYTENTVRTLKGMLYRFDAFMSGRDLALRSPR
FT                   VVRKCPIQFEGVFAEYLEDLRLRSYRERTVEDHRLNILKVLKEFDASGVKNIAHIVPAN
FT                   IYNIFNGIHRKNSFYSTLRQFLRFLFKNRVLHDDYSVLVPSVRYSSPVPSIYTKSEITQ
FT                   LLKAIDTSTKTGKRNYAIVMLALRLGLRTGDIVNLKISDVNFTNKEICFIQEKTQLPQR
FT                   LVLLPEIEKSLLSYLSTARPDCDSPNIFLSLLAPYRPLTPSLIWAHIHTHIESAGIIIG
FT                   ERKSGAHSLRMTLASELVAEKVPYDVVRKILGHDDPVSIKHYVKFDIESLRSCAIEIPP
FT                   ATGKHAAYMETRLGGKSNDIYI"
FT   gene            complement(201181..202869)
FT                   /locus_tag="HM1_0594"
FT   CDS_pept        complement(201181..202869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0594"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83199"
FT                   /db_xref="UniProtKB/TrEMBL:B0TG42"
FT                   /protein_id="ABZ83199.1"
FT                   /translation="MKRTLSIFIVLVLLLTALLPLTAYAEGEGNIDNGSGSMGSGTSEN
FT                   FWNPGDEGVRITVVRASDHAVVTIPVDFTNKHPDNIQAHFGKVSKISYTNGFSLTPSMQ
FT                   QYTYVNPAQAVPRIISSGSGNANIDDIKRYFCSEYTLMRIADVTGFNYDTLINGDYKIL
FT                   LEPVAYMTFQGVRIAVTATEAALYDEQLGGGLRSKMASLSHQNLPLAMFLETPDLGYPA
FT                   WSGSTTSKASNADIKSSLGLGIIRFSEAEPPQVSGYDYTYRVNTQVITSVTVSGGQADP
FT                   DHPVTARFTIGGQTYTVNNIYYPEGDSQLVWVRWTTPSTPQTMTIHVSVTGRGRASQGT
FT                   ITANIVDLSGHEPPNPVANDRNDSYTQPAVPNNPQKTSATWGVWRPWWHAYWVWHSTDE
FT                   DSGYWCDHGWWEFDWNTYTASLSASMSVVPDAKNPTASGKTMKSGYGINQTVTANVSTN
FT                   QSSAVTAAQTAVTYFPEFRYQSYWRLLERTGGGLGTQFEFARNRYSTYNRRTHFTPIWM
FT                   PDGSYTPYTYLMDCWTPQGMLSMNLADSVTISGNLWSDWHIAKLR"
FT   gene            complement(202945..203499)
FT                   /locus_tag="HM1_0593"
FT   CDS_pept        complement(202945..203499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0593"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83198"
FT                   /db_xref="GOA:B0TG41"
FT                   /db_xref="UniProtKB/TrEMBL:B0TG41"
FT                   /protein_id="ABZ83198.1"
FT                   /translation="MRNIQDKTKKRLTIAGLGIVCVALVIAISSQFKTETPPDGGNAPA
FT                   SIATVEVNPSADIGGKAGEKEVVVPASEPTAAPADNTAPQTDQPVQNLQPEVTKPPEPT
FT                   ESQKTDPTRKPSGEKVDNVQATDHNNVQKPDATQTGEPKGGERKDGKVYLPGFGWVTET
FT                   GGSGTKVDGDGDINKQVGTMD"
FT   gene            complement(203592..204143)
FT                   /locus_tag="HM1_0592"
FT   CDS_pept        complement(203592..204143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0592"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83197"
FT                   /db_xref="GOA:B0TG40"
FT                   /db_xref="UniProtKB/TrEMBL:B0TG40"
FT                   /protein_id="ABZ83197.1"
FT                   /translation="MKIREIYGIIRNKKGSSFPLIVAVALVLAMILCGVSEYMRLMMIA
FT                   QGVRDAVQSAVVSTVNDNYDDIYHGVREGYAGGYQLVGASWEDSVDYGDIYAYLDKTLG
FT                   LQKSGGYHVKYAGESVEYKLSGLSVDIRNAPLAPSDPAGVQGFLADAAIRLEVPVSFGG
FT                   KILPPMGINLRVRAKYMSVF"
FT   gene            complement(204140..204535)
FT                   /locus_tag="HM1_0591"
FT   CDS_pept        complement(204140..204535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0591"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83196"
FT                   /db_xref="GOA:B0TG39"
FT                   /db_xref="InterPro:IPR025469"
FT                   /db_xref="UniProtKB/TrEMBL:B0TG39"
FT                   /protein_id="ABZ83196.1"
FT                   /translation="MLTKLRDSRGEGYIDVAVLVLCTMLVVALAVKVLPVYIAKSQLDT
FT                   FAAELCREAEIAGRVGSETSLREQVLREKTGLDPVVTWSKTGKIQLNQEFTVTVTLRRD
FT                   IGLFGGFGSFPITLTAKATGKSEVYWK"
FT   gene            complement(204529..204645)
FT                   /locus_tag="HM1_0590"
FT   CDS_pept        complement(204529..204645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83195"
FT                   /db_xref="UniProtKB/TrEMBL:B0TG38"
FT                   /protein_id="ABZ83195.1"
FT                   /translation="MGFKSIPGKENAMKRIEKIKELFREKLEPGQEQGVRMC"
FT   gene            complement(204648..205520)
FT                   /locus_tag="HM1_0589"
FT   CDS_pept        complement(204648..205520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0589"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83194"
FT                   /db_xref="GOA:B0TG37"
FT                   /db_xref="UniProtKB/TrEMBL:B0TG37"
FT                   /protein_id="ABZ83194.1"
FT                   /translation="MPTLLFLFAALLAAGLFLILADALKLPTLGAARAMLSTGRRDKKA
FT                   AKTMETWLMSLAVRLSKHIPMDEYKKNRMNNILKAAGIGVTPEVYAAYAMVKAGMILLS
FT                   AIPCLLLLPPLSPALVFLAVLVYFKETRKADEQLREKRERIERELPRFVATVEQTLKSS
FT                   RDVLAMMENYKKNAGEAFARELDIVTADMRSSSYEAALTRFEARLNSPMLSDVVRGLIG
FT                   VLRGDDSAVYFQMLAHDFKALELQRLKGQAQKIPSKIRVFSFIMLMCFLFTYLAVIAYE
FT                   IVKSLNAMF"
FT   gene            complement(205527..206456)
FT                   /locus_tag="HM1_0588"
FT   CDS_pept        complement(205527..206456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0588"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83193"
FT                   /db_xref="GOA:B0TG36"
FT                   /db_xref="UniProtKB/TrEMBL:B0TG36"
FT                   /protein_id="ABZ83193.1"
FT                   /translation="MITLQLMACVGLIAGAFILLGLSPAEFTGGLFAFLTRRSRGIRDE
FT                   INEAVKRKKPSFLRREILEAQDILALTGRSGRFPLICASSLLLFAAGASIAILLQNVFL
FT                   IPVLALGLMFLPFWYVRLTAAHYRKNIAAELETALSIITTAYLRNEDILTAVEENIHYL
FT                   NPPVRGVFAQFLTQIKLINPDVNAALKAMKPRIENEVFHEWCDAIAACQYDRSLKTTLT
FT                   PIVGKLSDMRIVNAELEYLVFEPRKEFIIMVILVMGNVPVMYFLNKGWYDTLMHTAVGQ
FT                   LVLAVCAAAVFISAAIVIRLTKPIEYRR"
FT   gene            complement(206453..207904)
FT                   /locus_tag="HM1_0587"
FT   CDS_pept        complement(206453..207904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0587"
FT                   /product="type ii/iv secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83192"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0TG35"
FT                   /protein_id="ABZ83192.1"
FT                   /translation="MSKKHRQKGRENPQIKNPGAPLAEAPQIVRPVNLAGSRNLFFAPD
FT                   DSSRDFGSVLREVQEYISSKYSTLIIDGGGDEVKTNVKRYIAKYIQDGRIAVSGMTEEQ
FT                   LVDALYTEMAEFSFLTKYIFGTGIEEIDINAWNDIEVQYGNGSTVKLDEHFESPEHAVN
FT                   VIRRMLHVSGMVLDNASPAILGHLSKNIRIAVLKTPLVDEDVGVCASIRIVNPQSLKKE
FT                   DFINGGTATAEMLDFLAECLRYGISVCVAGATSSGKTTVAGWLLTTIPDSKRIFTIENG
FT                   SRELALVRKRDGKIVNSVIHTLTRSSENEKQNIDQDMLLDMALRFNPEVICVGEMRSSE
FT                   AYAAQEAARTGHTVLTTIHSNSCEATWRRMVTLCKRKYDMADDTLMSLVTEAFPIVVFT
FT                   KQLEDKKRRMMEIMECEILPDGQRNFRTLFQFQIAENRVEDGKFIIKGQHRQVMGISTS
FT                   LQKRFLENGMPQEVLAQITKGGLAG"
FT   gene            complement(207901..208716)
FT                   /locus_tag="HM1_0586"
FT   CDS_pept        complement(207901..208716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0586"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83191"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0TG34"
FT                   /protein_id="ABZ83191.1"
FT                   /translation="MLNFMKGSLFSRDTGNQPEGPAVEKDTQVLAVWGSPGSGKTTVSV
FT                   KLAKHLADKKRNVALLLCDMTAPMLPCVCPPSDLECEKSLGSILAAAHVTDTLVKQNCV
FT                   THKRYRHLLLIGMLKGENVFTYPPYSAELATELIDHLRNIAPYVIIDCGSAIATDILSA
FT                   VALMEADSVLRLVNCDLKSVSYLSSQLPLLRDNKWDADKQYRVASNVKPHEASEHIEQV
FT                   LGNVAFKIPHSGELESQAMAGDLFRDLTLKESRGFRKEIEKISREVFGV"
FT   gene            complement(208719..209531)
FT                   /locus_tag="HM1_0585"
FT   CDS_pept        complement(208719..209531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0585"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83190"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017592"
FT                   /db_xref="InterPro:IPR031571"
FT                   /db_xref="UniProtKB/TrEMBL:B0TG33"
FT                   /protein_id="ABZ83190.1"
FT                   /translation="MSFLRNRTVLGVICIALSLFICFAVTPLFNSGISKKTDIVRVARD
FT                   IKAGEQITRDMVKTVEVGSYNLPDNVVRSLDAALGKYAAADMAPGDYILNTKLTDSPAA
FT                   ENAYLYNLTGEKQAMSVTIKSFSNGLSGKLISGDIVSVIAPDYRKMGATVIPPELKYVE
FT                   VIGVTASSGYDTDTSHGLKKEDEKQLPATVTLLVSPEQSTILAGLEADGKLHLSLVYRG
FT                   SKENAAKFIEAQDKALKTLYPAPAGDATKENTGAAPPTDKSSTESEGE"
FT   gene            complement(209528..209989)
FT                   /gene="comC"
FT                   /locus_tag="HM1_0584"
FT   CDS_pept        complement(209528..209989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comC"
FT                   /locus_tag="HM1_0584"
FT                   /product="type iv prepilin-like proteins leader
FT                   peptide-processing enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83189"
FT                   /db_xref="GOA:B0TG32"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="UniProtKB/TrEMBL:B0TG32"
FT                   /protein_id="ABZ83189.1"
FT                   /translation="MGADFSGLGNPLFLLKGGIFIVLLLTASLIDVRKRIIPDAICLAI
FT                   ALTGFICFTPVKLLGCLSALPLLIAALVWGGMGGGDIKLMAAAGFVLGFRGGMAAMVMG
FT                   LAAMLLFYAGCFMVQRLRKRDCPRAFPLAPFLSAGCIAAYFIFQGGITL"
FT   gene            complement(209979..210209)
FT                   /locus_tag="HM1_0583"
FT   CDS_pept        complement(209979..210209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0583"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83188"
FT                   /db_xref="GOA:B0TG31"
FT                   /db_xref="UniProtKB/TrEMBL:B0TG31"
FT                   /protein_id="ABZ83188.1"
FT                   /translation="MRKIATKVKDQITGKALLAKALLRSERGENFVDSAIRILIAVVIG
FT                   ALLLAGLYTLFGDTVLPTLKQRIQEMFNYGG"
FT   gene            complement(210322..210702)
FT                   /locus_tag="HM1_0582"
FT   CDS_pept        complement(210322..210702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0582"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83187"
FT                   /db_xref="UniProtKB/TrEMBL:B0TG30"
FT                   /protein_id="ABZ83187.1"
FT                   /translation="MFFYCLRGEVVITEELELDLIRVVRDSNPLFKYQLIYKAGNATGM
FT                   VGVYSFDEDWYYLYKEDNDRYKVKRRKDLEGIPPAFTYKLPRRKQKEKPAEQKPPEQKI
FT                   ADGPSVLEEAPEQDFGMRMGGM"
FT   gene            complement(210744..210962)
FT                   /locus_tag="HM1_0581"
FT   CDS_pept        complement(210744..210962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0581"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83186"
FT                   /db_xref="UniProtKB/TrEMBL:B0TG29"
FT                   /protein_id="ABZ83186.1"
FT                   /translation="MSEEKSLLSKDANTGQTSYPRPSDAKLPENYTMRDGFLIKGGTLV
FT                   SLVTSGIVEAAARGFLHVDETEEYRTG"
FT   gene            complement(211010..211396)
FT                   /gene="spoVG"
FT                   /locus_tag="HM1_0580"
FT   CDS_pept        complement(211010..211396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVG"
FT                   /locus_tag="HM1_0580"
FT                   /product="spovg septation protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83185"
FT                   /db_xref="GOA:B0TG28"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="InterPro:IPR036751"
FT                   /db_xref="UniProtKB/TrEMBL:B0TG28"
FT                   /protein_id="ABZ83185.1"
FT                   /translation="MKKTENTQVAPLESAEQPLPMKVDVKIGSIRPEGAIRAIASVNLN
FT                   DCFAIRNVKIMDGGKGLFVAMPSYKAENGEYKDICFPVTKEFRQQLNDAVILAYQQALS
FT                   MSRNQTQGDPSFASPEQTPGMRMG"
FT   gene            complement(211462..212022)
FT                   /locus_tag="HM1_0579"
FT   CDS_pept        complement(211462..212022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0579"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83184"
FT                   /db_xref="InterPro:IPR025923"
FT                   /db_xref="UniProtKB/TrEMBL:B0TG27"
FT                   /protein_id="ABZ83184.1"
FT                   /translation="MNGVSIKNHRVLFYGNTAGYIENGRAIVDPMFHCEELKDYLTMKQ
FT                   GLEIEWTNGVYDRLAGGGLDPDGNAPVLKNCRIHQLKPEVDVMMKFIGYDELLERFGEP
FT                   NPDNYRVVYDGQIETNDLDAIYEKFNLDHPPGYQGHSLSMSDVIELYDQNGSSFHYVDR
FT                   FGFKEIAFQSPEQEQQYGQTMAL"
FT   gene            complement(212058..216641)
FT                   /locus_tag="HM1_0578"
FT   CDS_pept        complement(212058..216641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0578"
FT                   /product="conserved hypothetical protein"
FT                   /note="Member of the S-layer homology domain, PF00395, and
FT                   the PKD domain, PF00801"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83183"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:B0TG26"
FT                   /protein_id="ABZ83183.1"
FT                   /translation="MKQKGRRICVLALVLSLLLCGSAYAAAVLFPDIKGHWAEQTIIEL
FT                   AEKGVIKGYPDGTVRPDATITRGEFIALLARNHKVDTAAAGREPPTFDDIAGHWSEKNI
FT                   EALVDRGILDPADYGGGLKPDEPITRIEIIRMLVRAIGKGEEAKQTTDNTGFADDKSIK
FT                   SSDKGYVNIAIRYDLVKGYPDNTIRPEGKTTRAEAFTLLVRQDEVLEKIRKKAEKEGEK
FT                   KPPSGSSGGGSASYPRAQVAFELPAAAHTDTSITVTPVLKYAKTLAWSLAKEAADGSAQ
FT                   PLDLAEAVSGSLDKEGGTIVFKESGSYTLTASATNYDGKTTSCSQHITVYPVVGIAFEL
FT                   PQHTHTDKTVSIEVATTGLGNLDIVWSATKDGEAVAWDTAIDGDLSNEGGTITFKEKGG
FT                   YGITATVTDDTGRSFSHSSSITVYPVASVDFELPEKAHTDTTIDLITTLSEMDGLSINW
FT                   GLTRNGEVVAIGDYLEGELTNAGGAIRFKEKGVYALTATVTDATGREYAATSETTVYPV
FT                   GVAGFYLPEITHTDKVVTVKASFENIDAATAVWTLTRNGAPVTLGDYVEGTLTSNGGSI
FT                   RFKDKGEYILAAAFTDPAGRTYGYSLPVTVYPVPSLSFQLPATAHTDSDIKVDTTSAEL
FT                   DGLTVEWLVDNTYGFQDWATYVDGKLDNDGGTIRFKHAGVYELVARTTDAAGRVFLFEN
FT                   GSKTEVHPVLNIRFSLPEATYPDRTIDLRTSGNIGVLPVEWSVSKDGIAVPFDACVEGA
FT                   LNAQGGKIRFTQAGQYTLTASMTDALGRTFSYTDSVAVYPIPEIQLALPQTAYVGEAAA
FT                   AAVSGSDLKNLAAAWTISASGGDSKPYTDYASGDLSNLGGSVTFKTKGDYVLTVTMTDE
FT                   LGRAFSQSKAITVYPIPEIQLTLPQVGYAGETTSVSVSGNDLENLNASWTISKDGGEAK
FT                   AYTDYAGGSLTNEGGSITFKAKGSYLLTVTMTDTLGRSFARSEAITIYPIPEIQLNLPQ
FT                   VGYVGEAASVSVSGSELDNLTASWSISKDGGDSKPYAEYAGGSLSNVGGNIAFKAKGGY
FT                   VLTVTLTDALGRTFSQSKAVAVYPIPDMQISLPQLTYSGEALPVTVSGNELAGLNMVWR
FT                   ISIDGGALAPYTQYAAGTLGNSGGEVRISTDKTITVKFTAVTNDENGRSFTFASNTAAI
FT                   KPIAQIPFSIPSSVHVGTSFTVAMGNVSGLEGKSITWSLTKNGGAASYTGTLTNGGGGI
FT                   SIGATGTYTLMASVTNDVGRTFTHSENITVTNTAPNKPTASATVTRTAKDGKLLVNFAV
FT                   SATDPDGDAVTYEYSGQSADGYYAVGSYTVKVRAKDTYGLYSDWTTISFTVANSEPNTP
FT                   VITRTPDGNSVPPGTPVTITASSTDPDGDAITYVWEGRPAQTSTYPLGKNTVRVKAVDA
FT                   VGAESPWTAIVFFVADSTNGGGMTLTGPESVILEEGIEGATIIEYTFTVPPVSGHSGSD
FT                   YGRVRGYNKNTRQWDQLDYQTTTNGITFSRTLAPGVYTQLEFYYYTNHTCMYNKSNITY
FT                   SVKYYFE"
FT   gene            complement(216745..217329)
FT                   /locus_tag="HM1_0577"
FT   CDS_pept        complement(216745..217329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0577"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83182"
FT                   /db_xref="UniProtKB/TrEMBL:B0TG25"
FT                   /protein_id="ABZ83182.1"
FT                   /translation="MTVKNAFTQEDCIETGYAMYIAGKVVVLKPSSLPPERRDGAHQLY
FT                   FCEGGNGSNPNPIDRSIFTVSLADGERARWNRGDVLGILKPELLPDSARLHLSQIRPRG
FT                   VLDPREHEPRYSGYSFLPDGRYASGVWLCSEKEVKDYIEMQKEYQHRVMICDRDGFCVF
FT                   EMVRGEVIYPLPETIEAFRKEQARGGMSMNL"
FT   gene            complement(217342..217626)
FT                   /gene="spoVT"
FT                   /locus_tag="HM1_0576"
FT   CDS_pept        complement(217342..217626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVT"
FT                   /locus_tag="HM1_0576"
FT                   /product="stage v sporulation protein t, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83181"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:B0TG24"
FT                   /protein_id="ABZ83181.1"
FT                   /translation="MAGKGIYKVLDDKGRVLIPRQLRAAAGMQHGDIIKLAVQKGVVTA
FT                   QKVDLIEVGDQSPQAVEAYVFSAVKTMEKQTLLSLAARLISLLEENSKE"
FT   gene            complement(217616..218038)
FT                   /locus_tag="HM1_0575"
FT   CDS_pept        complement(217616..218038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0575"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83180"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:B0TG23"
FT                   /protein_id="ABZ83180.1"
FT                   /translation="MKMIEMQSIVDGQGQLTVPAQFLKDMGLVPGDTVKLAYINSSTDS
FT                   IHNTYKEFVLTPHGVAALKDDEDAELTLPHELLEAAEIPLDSDLEIVCARGTVVILQAD
FT                   LLDSLPDELRELFDDLGIHPDTVREVMRSGGVSDGR"
FT   gene            complement(218110..219045)
FT                   /gene="dam"
FT                   /locus_tag="HM1_0574"
FT   CDS_pept        complement(218110..219045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dam"
FT                   /locus_tag="HM1_0574"
FT                   /product="d12 class n6 adenine-specific DNA
FT                   methyltransferase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83179"
FT                   /db_xref="GOA:B0TG22"
FT                   /db_xref="InterPro:IPR012263"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR023095"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B0TG22"
FT                   /protein_id="ABZ83179.1"
FT                   /translation="MNSIISWVGGKKALRSLIYQRMPKEFGRYVEVFGGGGWVLFGKPP
FT                   GADMEVYNDFNADLANLFRCVKERPFALLKELNFLPLNGRDEFNVLKKYLEKEEFTSEY
FT                   LREELELAQQNLSGPQFEEIKAILMESAVMNDVKRAAAFFKLIRYSYGSGCTSYSCQPF
FT                   DIRKTFHLIWSGSRRLKDTVIENKDFEALIRQYDRDNAFFYCDPPYFETEGHYAVEFRR
FT                   EDHARLRDTLAGCQGKWLVSYNDCEYIRELYKDYQIEAVSRINNLAQRYDNGCEFPEVL
FT                   ISNYDTSERMRDIPTQIGLFDLMDDLYDTE"
FT   gene            complement(219053..219253)
FT                   /locus_tag="HM1_0573"
FT   CDS_pept        complement(219053..219253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0573"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83178"
FT                   /db_xref="UniProtKB/TrEMBL:B0TG21"
FT                   /protein_id="ABZ83178.1"
FT                   /translation="MDTDVKPQQKKENSDHGPPRKIYTVPLPKDLNRCKGCPYPGVGFI
FT                   CWDTDGTCLRTEMDRAGRPGR"
FT   gene            complement(219355..219954)
FT                   /locus_tag="HM1_0572"
FT   CDS_pept        complement(219355..219954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0572"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83177"
FT                   /db_xref="InterPro:IPR041329"
FT                   /db_xref="UniProtKB/TrEMBL:B0TG20"
FT                   /protein_id="ABZ83177.1"
FT                   /translation="MPNHITNILTAYGDEKKVRAMFEAIKNDEIGIGSIDFNKITPMPK
FT                   HIYRGDLGKEEIEKYGAENCWYDWSIKNWGTKWNSYGYDEHTADNFDGCTVKFLTAWSS
FT                   VSDLMKKLSSMFPDIRFDYKWADEDFGHNTGKAEYKSGKTLSCYIPAGGSAEALELAAS
FT                   ILDIDLAEAGYIYNESTGEYEYVEDEPDEIPKMGGV"
FT   gene            complement(219956..220483)
FT                   /locus_tag="HM1_0571"
FT   CDS_pept        complement(219956..220483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0571"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83176"
FT                   /db_xref="UniProtKB/TrEMBL:B0TG19"
FT                   /protein_id="ABZ83176.1"
FT                   /translation="MSNIKQTVKFFSPLSITTYPSHEYGECGAGDLPEELSPSEAVYYM
FT                   DEILSAIEKEKLPSEGDRGLMVYFYDDQALSEKIYSLHPTVEEWNGKLWGVMVAEVYGE
FT                   LTEAETDKLLDFAVGQMSDGWGEGFEQRPIKTDDGEIFVSFWNSDHFFIKPERELKQEN
FT                   EQNFSEQTMGGM"
FT   gene            complement(220744..220820)
FT                   /locus_tag="HM1_0570"
FT   tRNA            complement(220744..220820)
FT                   /locus_tag="HM1_0570"
FT                   /product="tRNA-Asp"
FT   gene            complement(220826..220901)
FT                   /locus_tag="HM1_0569"
FT   tRNA            complement(220826..220901)
FT                   /locus_tag="HM1_0569"
FT                   /product="tRNA-Val"
FT   gene            complement(220912..220987)
FT                   /locus_tag="HM1_0568"
FT   tRNA            complement(220912..220987)
FT                   /locus_tag="HM1_0568"
FT                   /product="tRNA-Glu"
FT   gene            complement(220992..221067)
FT                   /locus_tag="HM1_0567"
FT   tRNA            complement(220992..221067)
FT                   /locus_tag="HM1_0567"
FT                   /product="tRNA-Lys"
FT   gene            complement(221086..221160)
FT                   /locus_tag="HM1_0566"
FT   tRNA            complement(221086..221160)
FT                   /locus_tag="HM1_0566"
FT                   /product="tRNA-Gln"
FT   gene            complement(221265..224178)
FT                   /locus_tag="HM1_0565"
FT   rRNA            complement(221265..224178)
FT                   /locus_tag="HM1_0565"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(224420..224495)
FT                   /locus_tag="HM1_0564"
FT   tRNA            complement(224420..224495)
FT                   /locus_tag="HM1_0564"
FT                   /product="tRNA-Ala"
FT   gene            complement(224560..224676)
FT                   /locus_tag="HM1_0563"
FT   rRNA            complement(224560..224676)
FT                   /locus_tag="HM1_0563"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(225012..226521)
FT                   /locus_tag="HM1_0562"
FT   rRNA            complement(225012..226521)
FT                   /locus_tag="HM1_0562"
FT                   /product="16S ribosomal RNA"
FT   gene            complement(226485..226718)
FT                   /locus_tag="HM1_0561"
FT   CDS_pept        complement(226485..226718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0561"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83175"
FT                   /db_xref="UniProtKB/TrEMBL:B0TG18"
FT                   /protein_id="ABZ83175.1"
FT                   /translation="METTVVGNDGCSKRMTVQRKQLFKENDCSKRTIVQRERLSEENGC
FT                   SKRLSNKSLTQAHLQIFVESLILAQDERWRHA"
FT   gene            complement(227188..228162)
FT                   /locus_tag="HM1_0560"
FT   CDS_pept        complement(227188..228162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0560"
FT                   /product="two component diguanylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83174"
FT                   /db_xref="GOA:B0TG17"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B0TG17"
FT                   /protein_id="ABZ83174.1"
FT                   /translation="MGILIIDDAEDTRLYLQAVLASDGFEVYATASAQEALAHLQDRPS
FT                   IDLILLDVIMPGIDGIELCQQIKSDAAWRDVPVIMVTALTNIEDLDRAFAAGAMDYIMK
FT                   PVKKRELLARIRSALALKTEMDRRKEREEELLRVTAELEEAVRKLQNLSSLDGLTGLAN
FT                   RRRFDEYLASEWKRAIRNGTPISLILFDIDWFKPYNDTYGHIQGDDCLKAIASLMPKVV
FT                   RRSSDLVCRYGGEEFAVILPDTSQEGALAVAESIREALSEAGIEHRQSPLDRVTVSVGV
FT                   ATAYPSPSSEPVTLIGYADEALYEAKRQGRNRTVENAEIHRSR"
FT   gene            complement(228241..230970)
FT                   /locus_tag="HM1_0559"
FT   CDS_pept        complement(228241..230970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0559"
FT                   /product="signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83173"
FT                   /db_xref="GOA:B0TG16"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B0TG16"
FT                   /protein_id="ABZ83173.1"
FT                   /translation="MATNLINRTERSSSLFRLGTLKAQLNWWGILLVLMPTILLTGNFL
FT                   VFEIQHIQREEFEQLEQAITIQRIAIDEWFENCRDDVKALAQMKVLRTGDHQEMEAVFR
FT                   SFLNQHRQFTNMAFVNRDGFNEVDTAGRTGQINLSDRDYFRAGQNGKDFITDVIIGRNS
FT                   GRPLVIISAPVYGLDNQFRGVLFASVELTTLEAVMSRFRSGETGETYLVNAKGLMITQS
FT                   RFGPELVKRGIIDGSTPLQVKVDSQAFQQALKGKSGTAIYLNYQGKKVLGAFQRMQQQN
FT                   WVIIGEVSEAEAMTPYYHQMGTMIGLSLILLLLSVPLTVAVSNRIRKPIDKLIEGSRHM
FT                   QQKNYSYRIDLPESPNVPIELKELSQTFNRMAEMIDDHVQELRRANEAKSDFLANMSHE
FT                   IRTPMNAILGMTELLGETQLTPEQAEYVRICRGAGDTLLYLINDILDLSKVESGRMELQ
FT                   LTQFNLVELVEKTAELMAVRAHKKGLELVCHIFPGVPSQVVGDPGRLQQILINLMGNAV
FT                   KFTERGEIVLQVERDPDQPGEAGAIRFAVSDTGIGIAADKKEVIFERFSQADSSTTRRY
FT                   GGTGLGLTISRYLVEMMKGRIWVESELGKGSTFYFTARFGQADPIEEMSLPVEALRGIR
FT                   VLIIDDNETNRIILRETVKSWGVVPVEASGGAEGIAEMKRAKAQGLPYQLVLLDCRMPE
FT                   MDGFQVAERIQAEVEFCEATVLMVTSDNRNDDIQRIKQLGLAAYLVKPVKRNDLLKTVL
FT                   SVLERCPKKQEPQRGHEGTLTPLGVLRILLVEDAEDNCLLIQTYLRSEPVEIDVAENGQ
FT                   VAVDKFKTGQYDVVLMDIQMPVMDGITATREIRQWERRKGRLQTPVIALTANAMREDME
FT                   RSLEAGCNDHLTKPIKKKTLLEALYRFSGRSNSGEGQG"
FT   gene            complement(231006..231404)
FT                   /locus_tag="HM1_0558"
FT   CDS_pept        complement(231006..231404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0558"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83172"
FT                   /db_xref="GOA:B0TG15"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="UniProtKB/TrEMBL:B0TG15"
FT                   /protein_id="ABZ83172.1"
FT                   /translation="MSLERLCDEEVIDRKAVISLLKDVDPKESRELFVRLVEIYLKETP
FT                   KRIKALAEAFATGSSAEARQSAHSLKSSSAMLGIYKVAELSRQIEQYAKDGALAEAYAI
FT                   QAALERECDRACACLRLIRDSGFPTVNP"
FT   gene            complement(231624..233438)
FT                   /gene="pepF"
FT                   /locus_tag="HM1_0557"
FT   CDS_pept        complement(231624..233438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepF"
FT                   /locus_tag="HM1_0557"
FT                   /product="oligoendopeptidase f"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83171"
FT                   /db_xref="GOA:B0TG14"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR004438"
FT                   /db_xref="InterPro:IPR013647"
FT                   /db_xref="InterPro:IPR042088"
FT                   /db_xref="UniProtKB/TrEMBL:B0TG14"
FT                   /protein_id="ABZ83171.1"
FT                   /translation="MEKEKALPKRQDISAEFKWKLEDIYPTDDAWEKDFQAVPALLDKI
FT                   TALKGKLQEKSANLLAVLQLQDELGKGLEKIFTYARMRRDEDNTNPTYQALTDRAVALN
FT                   ARAAGETSFITPEILAIPDDILQRFQKEEQGLALYRFLLDDLKRQKAHVLTADEEAILA
FT                   QASELGQSPGQIFTMLNNADLTFPTIRDEEGREVEITHGRYGQLMESKDRRVRKEAFYG
FT                   LYGTYKKLENTLAATFTSAIKRDVFFSRVRRYPSALEAALFGDNVPKDVYDNLIGTVRK
FT                   HNDAMHRYVRLRKKLLGVDQLHMYDLYVPMVADVDWKVTYKEALEMVKQGLEPLGDDYG
FT                   RVLDESFKTGWIDVYENKGKTSGAYSWGPYGTHPYVLLNYQDRLDDVFTLAHEMGHALH
FT                   SYYSHKEQPYIYSAYTIFVAEVASTVNETLLIRHLLEREQDKSRRLYLINHYLEQFRGT
FT                   LYRQTMFAEFEKIVHAKIEAAEALTLQELKQIYHRLNVDYYGPDIIVDDDIDIEWARIP
FT                   HFYNNFYVYKYATGFSAATALSAQILAEGQPAVERYLTFLKSGGSDYPLELLKRAGVDM
FT                   GTAEPIEKALSVFRELLDEMEKLTARAN"
FT   gene            complement(233563..235605)
FT                   /locus_tag="HM1_0556"
FT   CDS_pept        complement(233563..235605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0556"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83170"
FT                   /db_xref="GOA:B0TG13"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:B0TG13"
FT                   /protein_id="ABZ83170.1"
FT                   /translation="MEKGTDMQKSLLKKMVFFSLLITLVPVLISLALMYWQVRSEMIAN
FT                   QEQRLTEHLQNQVRLIETIFKETQNKGRIISQEGLIMEAVNGANQGASLQVSALSRFLQ
FT                   DVYRADQGLYENIFITGRNGLIYADAVGGSSIGTDVRSFDFFQPSIGGQSYVSQVIQSP
FT                   ITKRPVVVVSTPIRSHQGEAEPAGILAMAVEFNRIAQPIIESPIGQTGYNYITNEKGLV
FT                   LAHPDSSKVWELDISKMTNGLEQIPAKAAQSAGTLTHPVDRDTYTTAYTAVPGLPLLLL
FT                   STIDQDEYASRFSNMLVLIAGVTMALVILAGTVATIYSKELVATIKQLRAAMAHGAAGN
FT                   LTVRAKIKAKDEMAGLAKAFNIMVESQSQVVGAVRKSSDELAASSQELAASNAEINATI
FT                   SDMSKHMEQMARDAELGSQSIVQVSQVLVELASLIQIARQAALVVDEKSQLTLAQARKG
FT                   KATVHETMVDMTNIQNRSQEIEGIITNLNEYTQQISSITDTITSIATQTNLLALNAAIE
FT                   AARAGEHGRGFAVVADEVRKLAEQSTQGAAEVSAILEKVQSRTADAVQATQRSREDVQQ
FT                   GVAAVRHSGEVLEQILQAVELSSKEVARIVEITDEEVTSSDKILQLIDEVAKVIERTSQ
FT                   IATHMAASSEEAAATMENLAAASEQISAMAAQLSQSVRKFKTDAH"
FT   gene            complement(235842..237473)
FT                   /gene="ppaC"
FT                   /locus_tag="HM1_0555"
FT   CDS_pept        complement(235842..237473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppaC"
FT                   /locus_tag="HM1_0555"
FT                   /product="manganese-dependent inorganic pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83169"
FT                   /db_xref="GOA:B0TG12"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR004097"
FT                   /db_xref="InterPro:IPR010766"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="InterPro:IPR038222"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:B0TG12"
FT                   /protein_id="ABZ83169.1"
FT                   /translation="MGVIVIGHRSPDTDSICSAISYAYLKEKLTGREYIAARCGNLKPE
FT                   TDFVLRYFNVEAPRVICDVRSRVADMLGGQAPVAISPDTPIREVGILARDKNIKSLPVV
FT                   DERNRLLGIITLGDIAQRYLNLDELNDLDRMGLTIGGILRTMGGRFLVPAPLDMKLRGK
FT                   AIIGAMHVETMVQRIGEGDTVVTGDRENAQLAALEAGAGCLIVTGGLSISERVERLARQ
FT                   KGIPVLTVPYDTFNAARLLGLSAPVSTIMHQDMVCFQPDEFADDARKVMLETRFRNYPV
FT                   IDHEKKLLGVISRYHLLALQRKQVILVDHNEKSQAVAGLDQAQVLEVIDHHRIGDVQTG
FT                   EPIYFRGEPVGCTSTIIAAMYEENGIEPPKEIAGLMTAAILSDTVLFKSPTCTARDRRT
FT                   AEKLAKIAGIDLQDFGLKLFTAGSSLEGRTPEEIIFQDFKEFHLGPLKLGIGQVETMDY
FT                   DGVTRMQATLLEEMESIRKKKGLDLALLMLTDIIKEGTRLLVAGEKKEPVEKAFGVTIQ
FT                   EQSAYLPGVISRKKQVVPPLSAYLGT"
FT   gene            complement(237497..238525)
FT                   /locus_tag="HM1_0554"
FT   CDS_pept        complement(237497..238525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0554"
FT                   /product="cation efflux family protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83168"
FT                   /db_xref="GOA:B0TG11"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:B0TG11"
FT                   /protein_id="ABZ83168.1"
FT                   /translation="MPRRAIAMLREANYTSLKSAMGNYFLAAVKFLAYQWTGSSAMQAE
FT                   AIHSFNDGCAQAAVFAGSVFASRKPTASFPNGFGRLSNLIVLFVAIFMTYNAVKAISSG
FT                   YAAMLNPHLPTGFYWNLFVLAVSLAVDGIVLVTAMKDIAREAEVEAEGFALFRLSLQKY
FT                   HLASPETRLVFFEDLLASVAILVAMAGLTATQFGIVPWGDGLAGLVIGLLLLGIAVSVA
FT                   WENVKGLIGYTAPEEVVDEIAETIMDVQGVEDLYDLDVVREGAYLDVDGTIELPETWSV
FT                   GQAEDVKEEIQRRLKVIYPNIHNVTLSIHEDDELSRWGSRDFVRLKRKKVANRLVKAEK
FT                   KT"
FT   gene            complement(238680..239777)
FT                   /locus_tag="HM1_0553"
FT   CDS_pept        complement(238680..239777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0553"
FT                   /product="s-layer protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83167"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:B0TG10"
FT                   /protein_id="ABZ83167.1"
FT                   /translation="MKYRVGPKAGALLLAGVVFFSGAVAPAVLPMITASPAWAGEKTSV
FT                   PADARGHWAEAQIAEMVARGWIRGDEQGLFHPEKAMSRAEFVSLLVRVFEFQVVFIKAP
FT                   DVRDVAADVPGDAWYAGDLIQAAHTFLALPDKAFHPEEELTREVMAEWVWAAYRHKGGN
FT                   VDATSPLKAIPFSDAGAIEPAYRESVGAASAVGFIKGDEEGYFKPKATVTRAQAAVIVN
FT                   RVAGKLSPRGDSIPFTLHGRTDYGKWSTPRQAVLIRNEAEARTFAEQWRDTTLDMPVLS
FT                   TDGIDFASQALIALIGFASSSSNPPQVTAMIRQGNTLTVYLEKKTGLIETADITGAYRY
FT                   YRLSKSDVEGLEAVRAELRLVQVNH"
FT   gene            complement(239885..240541)
FT                   /locus_tag="HM1_0552"
FT   CDS_pept        complement(239885..240541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0552"
FT                   /product="fe-s cluster, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83166"
FT                   /db_xref="GOA:B0TG09"
FT                   /db_xref="InterPro:IPR007202"
FT                   /db_xref="UniProtKB/TrEMBL:B0TG09"
FT                   /protein_id="ABZ83166.1"
FT                   /translation="MNRSWLPPGKNCGLCGEHSCRSFIRAVHGQEKTYEDCPFYDEKHA
FT                   RAAADWEMEADYPEGDVLGHRYDFVLQPLPGEISARKIVLPFRGDLVEKLEIREGDLVL
FT                   GRPMGAGCPIPHVLRVIDADPLTGLLTTWVVGPKFARDGQQEVKDVSAYHMIGFEGIAT
FT                   AIRKEPTLGCRMTFLPGFCMMSLNHTGLVNMVLEKAEGPHIRIEDVRILATRDWD"
FT   gene            complement(240543..241253)
FT                   /locus_tag="HM1_0551"
FT   CDS_pept        complement(240543..241253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0551"
FT                   /product="cobalamin synthesis protein, cobw/p47k family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83165"
FT                   /db_xref="GOA:B0TG08"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR012202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0TG08"
FT                   /protein_id="ABZ83165.1"
FT                   /translation="MKLLVIAGPPSAGKTALTKQIVRRFKDEMKIAYLKIDVVKAFEDI
FT                   ELQREFNILTKKVYSGDLCPDHAGVMVLGDAIEWAEKNEADLFIVESAGLCLRCSPYLN
FT                   QGLGVIVLSSISGIHAPEKMGAMVALADIAVVTKIDLVSQAEREVFIQKIKEVHPHIVL
FT                   METNALQGTSLNRLYQLIAKSEEIDKHNLVLKGSPPIGTCTICIGKKEIGWKHHFGVIK
FT                   KLDGQIADYLYRGE"
FT   gene            complement(241269..242048)
FT                   /locus_tag="HM1_0550"
FT   CDS_pept        complement(241269..242048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0550"
FT                   /product="abc transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83164"
FT                   /db_xref="GOA:B0TG07"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0TG07"
FT                   /protein_id="ABZ83164.1"
FT                   /translation="MIQEIMVLPGRDKTGGLENFSGITLKAGETLSIVGPTGSGKTAFI
FT                   TDIELLAQGDTSTRRHVLINGGEPPEELRYNPAMKPIAMITQNTKCFTDLTAEEFLEIH
FT                   ARARRINERGIIDKTIELANKFTGERIRKETKVTILSGGQTRSLMIADALLIGAAPIIL
FT                   LDEIENAGIFKQEVVRLIQNTGKIVIFVTHDPVIALLTQKRVIMSNGAVRKVIDQNESE
FT                   VRAAQNLIELDKRVGIIREKIRAGDIITKELISVNFG"
FT   gene            242135..242314
FT                   /locus_tag="HM1_0549"
FT   CDS_pept        242135..242314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0549"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83163"
FT                   /db_xref="UniProtKB/TrEMBL:B0TG06"
FT                   /protein_id="ABZ83163.1"
FT                   /translation="MPSFRQERPFPAAVHFYSGARSPLTPHPAARQDSLPTLLAVDLTS
FT                   ASKEMLLTDIVYVS"
FT   gene            complement(242465..243631)
FT                   /locus_tag="HM1_0548"
FT   CDS_pept        complement(242465..243631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0548"
FT                   /product="rubredoxin-oxygen oxidoreductase, putative"
FT                   /note="This enzyme is a homodimer consisting of two
FT                   monomers, each having a flavodoxin-like domain and a
FT                   Zn-beta-lactamase-like domain containing a di-iron center
FT                   for the reduction of dioxygen to water. This enzyme has
FT                   been characterized in Desulfovibrio gigas"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83162"
FT                   /db_xref="GOA:B0TG05"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR016440"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B0TG05"
FT                   /protein_id="ABZ83162.1"
FT                   /translation="MRPVKVKDDIYWVGAVDWDLRDFHGYLTQRGSSYNAYLIMDEKIT
FT                   LVDTVKAYLVEEMLDRIAHVVDPSKIDYIICNHVEMDHSGGITRLMELAPNATIITSPN
FT                   GQRGLKAHYKRDWPMQVVKTGDRLSLGKRNLSFVLTQMVHWPDNMVAYMPEEKILFSND
FT                   AFGQHIASMERFDDQFSYHLIMEEAKKYYANIVLPYGAQVQNALQALAGLEIDLIATSH
FT                   GLLWRSHVPEILEEYGKWAANYTEEKALIIYDTMWESTKKIAYAIQRAFEHKGIDSKMV
FT                   NLDSNHMSDIMTELITAKYVCVGSPTLNNNMLPSVAAFLTYLKGLAPKQRVGLAFGSYG
FT                   WGGQGVAQIEEALKAAGFDMLKPVKAQYIPDERALEEITAQVEAVVGG"
FT   gene            complement(243767..244978)
FT                   /locus_tag="HM1_0547"
FT   CDS_pept        complement(243767..244978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0547"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83161"
FT                   /db_xref="GOA:B0TG04"
FT                   /db_xref="UniProtKB/TrEMBL:B0TG04"
FT                   /protein_id="ABZ83161.1"
FT                   /translation="MNTLSERFLARQIEKTVRKMVTEAPVPPLEESWARLEQKRREQVS
FT                   AQFRQHRLEKPRVEAPPSEESLLEQPKSKRRLALLYLRRAAVAAAVLVVGGVLSFQGVG
FT                   FMTTGMRTAGIVGNSALDKASAPAFMVEQSSSAAPPPVAGGATVSESSATVSERSAAVS
FT                   ENSATVSERSAAVSENSATVSERSAAVSENSATVSDSSASVSERSATTSENALAFTGQA
FT                   APVTASPEPVEMTPPGRARERVAAAKPSWKDIASFPKEEQPLALALPVPADGAHSNAAD
FT                   TSPVSITSAHNQPGPVVTYLPPGYTLLASKQREQGEPAASTSLRYIGPAPHYFRLTLSA
FT                   APLPPEEGEVQAQRDVDIAGAPGKLVLFAKGLLRIEWRRDKTFYTLTGILPEEEAVRIA
FT                   QSVR"
FT   gene            complement(244992..245198)
FT                   /locus_tag="HM1_0546"
FT   CDS_pept        complement(244992..245198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0546"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83160"
FT                   /db_xref="UniProtKB/TrEMBL:B0TG03"
FT                   /protein_id="ABZ83160.1"
FT                   /translation="MSETMEKCPIYAHLESRYAPDIDFIMNRYGVPDWQAICNEVCPNV
FT                   LGYYEGTADGRCAIRLRMLRIED"
FT   gene            complement(245201..245821)
FT                   /locus_tag="HM1_0545"
FT   CDS_pept        complement(245201..245821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0545"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83159"
FT                   /db_xref="GOA:B0TG02"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:B0TG02"
FT                   /protein_id="ABZ83159.1"
FT                   /translation="MCYEELIETLKAGGTDGLRLAYEQFYRSVYQAAFFILRDPGLAED
FT                   VTHDVFLKLGERIGQLRDPAKLESWLCQMAVNSARDLLRRRGRNVLCAEIRDEGVAFAE
FT                   GSPEAATEKQEQSSILRQCISRLPPDYRSVIYLRFYLDQSIEQISATLDIPSGSVKSRL
FT                   SRAKQRIRHWLERDGQEKRLQDEEDIDEPTAIVKIEKTGKEIP"
FT   gene            complement(245988..246803)
FT                   /locus_tag="HM1_0544"
FT   CDS_pept        complement(245988..246803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0544"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83158"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:B0TG01"
FT                   /protein_id="ABZ83158.1"
FT                   /translation="MFMEEVMAGRQAKTRPGDERVAIELSRGKGGKILFDDQAVPLLVA
FT                   RRKGRCNLSLRLTDRGLEVRGPAALTGDQIQEVLRRKGNWIVRHWRRLQQEKERLARVA
FT                   EEKRVFFRGEPIDIVAITDNAPVPAEGRVKLDAGRLFIRLEPERKGQWRPVAGEWMRAQ
FT                   AEALIPQRVGEIARRLGCAYDKVTIRDQKTRWGSCSSKQSLSFNWRLVLFPPVVMDYVI
FT                   IHELCHLQELNHSARFWTLVERCMPDYALHRRWLRERGREFSVPFENEQ"
FT   gene            246988..247137
FT                   /locus_tag="HM1_0543"
FT   CDS_pept        246988..247137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0543"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83157"
FT                   /db_xref="GOA:B0TG00"
FT                   /db_xref="UniProtKB/TrEMBL:B0TG00"
FT                   /protein_id="ABZ83157.1"
FT                   /translation="MRRRPESLTTRTQQWLESADTIRETGIIYGACAFAFLYLTAKVLQ
FT                   SLLF"
FT   gene            247210..247323
FT                   /locus_tag="HM1_0542"
FT   CDS_pept        247210..247323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0542"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83156"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFZ9"
FT                   /protein_id="ABZ83156.1"
FT                   /translation="MNSGGSVFVFRWWIVSSTPVKVVCGDKATEAEALIVC"
FT   gene            complement(247346..248128)
FT                   /gene="lexA"
FT                   /locus_tag="HM1_0541"
FT   CDS_pept        complement(247346..248128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lexA"
FT                   /locus_tag="HM1_0541"
FT                   /product="lexa repressor"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83155"
FT                   /db_xref="GOA:B0TFZ8"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR006199"
FT                   /db_xref="InterPro:IPR006200"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFZ8"
FT                   /protein_id="ABZ83155.1"
FT                   /translation="MMQLTPKEREVFEVIRKNVREKGYPPSVREIGLQMGWASSSTVHV
FT                   YLKRLEEKGWIRKDPTKPRAIEVLADRQERREWGSNNPPDAMAAVGVSEEGSPVWTTSH
FT                   LAGPSAGQMAEEQLPGDGDNAAEGRSQSAAGPFLQVPLLGNVAAGSPILAAEYVEDYLP
FT                   IAKSMLGEGEFFGLRVKGDSMIDAGILHGDTVIVRRQAHASNGQIVVALIDDDATVKRF
FT                   FKEADHVRLQPENSALEPIRVRDLSILGKVVMVLRNVH"
FT   gene            complement(248527..248775)
FT                   /locus_tag="HM1_0540"
FT   CDS_pept        complement(248527..248775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0540"
FT                   /product="transcriptional regulator, abrb family"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83154"
FT                   /db_xref="GOA:B0TFZ7"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFZ7"
FT                   /protein_id="ABZ83154.1"
FT                   /translation="MKSTGIVRKVDELGRVVIPMELRRIMGIADKDGLEIFVEEEKIVL
FT                   KKYEPACVFCGSASDVHNYRGKAVCKECAGEMSKFVC"
FT   gene            248970..249116
FT                   /locus_tag="HM1_0539"
FT   CDS_pept        248970..249116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0539"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83153"
FT                   /db_xref="GOA:B0TFZ6"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFZ6"
FT                   /protein_id="ABZ83153.1"
FT                   /translation="MENNIERKSDNVLNGTTWEFLKTGWWVWHVFAIALVFYLGHLLWP
FT                   IYR"
FT   gene            complement(249272..249478)
FT                   /locus_tag="HM1_0538"
FT   CDS_pept        complement(249272..249478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0538"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83152"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFZ5"
FT                   /protein_id="ABZ83152.1"
FT                   /translation="MQLSTRDFLMKSLLNEQELVRDYQKFAQTTEDKEVAKIFLDYAEK
FT                   DALRANQIKDILQNKYGLDADEK"
FT   gene            complement(249496..250950)
FT                   /locus_tag="HM1_0537"
FT   CDS_pept        complement(249496..250950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0537"
FT                   /product="peptidase, u32 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83151"
FT                   /db_xref="GOA:B0TFZ4"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="InterPro:IPR032525"
FT                   /db_xref="InterPro:IPR032587"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFZ4"
FT                   /protein_id="ABZ83151.1"
FT                   /translation="MGIELLAPAGNPEKLAMALHYGADAVYLAGKELGLRAYAGNFTSE
FT                   EMARAIALAHEQGKKVYVTVNIFAHNRDFANLPAYLTELRDMGADAIVVSDPGVFAVAR
FT                   RTVFDLPIHISTQANVTNAESARFWADQGAKRIVLARELSLAEIRAIRQAVDIELEVFV
FT                   HGAMCMSYSGRCMISDYLTGRGANRGECAQACRWKYALVEETRPGLYLPVEEDERGSYV
FT                   FNARDLCLLPDIPALIDAGVNSFKIEGRMKSVHYVATVTQVYRRAVDSALAAQAAGRPA
FT                   RTLTSWWEELAKISHRPYTRGFLHGPPGQEPALPYRRDYDFVGVVQAYDAQKRVAEIEV
FT                   RNRIRLGDILELAGPGTAPFLTIVNEMRDDEGNAIDKAPRPHQRIFIRLPRPVAPLDLV
FT                   RRPKDGGEDAFLKVRINPSHIFYLDIILEGFGHLGVPTTVDKEAGLVLIRTTPDTREEV
FT                   IRVLESLPWPALWVGDEDEILSSPPN"
FT   gene            complement(250940..251956)
FT                   /locus_tag="HM1_0536"
FT   CDS_pept        complement(250940..251956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0536"
FT                   /product="conserved hypothetical protein tigr00247"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83150"
FT                   /db_xref="GOA:B0TFZ3"
FT                   /db_xref="InterPro:IPR003770"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFZ3"
FT                   /protein_id="ABZ83150.1"
FT                   /translation="MRSRRKKAWPFGILAIIGIIAAVIAFQSYRQGLEPLEPGNKQEII
FT                   VEIPANVTARDIGDILEVKKVIRSSRAFANYARGHGGESLKAGEYLLSPSLSVPDILQV
FT                   LIEGKTRLYSFTIPEGYTTRQIVDLLTGKGLVDRDAFRKALAQTPLEYDYLKKLPANEN
FT                   RLEGFLFPATYRIRRDTSPEEIVRMLVSRFDQEMTPEVRARMKELNISVRDTVVLASLI
FT                   EREAQKAEDRPVISAVFHNRLNKGMKLEACSTIQYLLGQPKAKLYYKDLQIESPYNTYK
FT                   YAGLPPGPIANPGKASLQAALYPTKTDYLYFVAKGDGYHQFSRTFNEHLRAVAKYGN"
FT   gene            complement(252011..252133)
FT                   /locus_tag="HM1_0535"
FT   CDS_pept        complement(252011..252133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0535"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83149"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFZ2"
FT                   /protein_id="ABZ83149.1"
FT                   /translation="MEGHPNIRMAFCMGRISFSFFDSRLFPRPDQSCFSHPLCL"
FT   gene            complement(252150..252419)
FT                   /locus_tag="HM1_0534"
FT   CDS_pept        complement(252150..252419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0534"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83148"
FT                   /db_xref="InterPro:IPR009711"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TFZ1"
FT                   /protein_id="ABZ83148.1"
FT                   /translation="MDQEQENIIVLTDEDGNELEFEELDRVEVDGKEYAILLPLDDEED
FT                   EAIILRVEYEENGEEVFSHIEDDEEWEKVADFWQELSEEDGEEE"
FT   gene            complement(252571..253020)
FT                   /locus_tag="HM1_0533"
FT   CDS_pept        complement(252571..253020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0533"
FT                   /product="holliday junction resolvase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83147"
FT                   /db_xref="GOA:B0TFZ0"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TFZ0"
FT                   /protein_id="ABZ83147.1"
FT                   /translation="MRIMGLDVGDKTIGVAVSDLMGWTAQGVATIRRSRLAADLEHLRE
FT                   LVKTYEVERIVCGLPRNMNGTYGPRAEGIRKFGSLVEKKLNIPVDYWDERLTTVAAQKT
FT                   LIAGDLSRAKRKQVVDKLAAVLILQNYMDAKAHLAAKEQSKETSE"
FT   gene            complement(253025..254065)
FT                   /locus_tag="HM1_0532"
FT   CDS_pept        complement(253025..254065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0532"
FT                   /product="aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83146"
FT                   /db_xref="GOA:B0TFY9"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFY9"
FT                   /protein_id="ABZ83146.1"
FT                   /translation="MRRKLSKSAEHSPFGEPGLGSLRKTELGKKRLGKSGLDVSRLCFG
FT                   SLTIGPLQASLPLDRGAALLRRAFWSGVTFVDTAQIYGTYPYIREALRGYKGDGGNMGD
FT                   VVIATKSYAYSAEGMQDALEEARRELDRDVVDIFLLHEQESEHTIRGHWEAFEYLLEAK
FT                   ARGWVKAVGISTHAVAAVRAAAAMDEVDVIHPLINMEGIGILDGTASDMLAAIAEAHQA
FT                   GKGIYGMKVLGGGNLHARAPEALAWALAQPHLDAIAIGMQSEGELEVNLRLFAGESVAE
FT                   ANWCEVRRRERRLHIEDWCTGCGACVPACPQGALRLEERVVVDQARCLLCGYCARMCRD
FT                   FCIKVV"
FT   gene            complement(254046..254324)
FT                   /locus_tag="HM1_0531"
FT   CDS_pept        complement(254046..254324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0531"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83145"
FT                   /db_xref="InterPro:IPR009309"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFY8"
FT                   /protein_id="ABZ83145.1"
FT                   /translation="MANETFDQTMMFLAKAEDELATSDILRTVYEALKEKGYNPINQLV
FT                   GYLLSGDPAYITSHKNARSLIRRLERDDLLEELVRFYLESHDEEKAQ"
FT   gene            complement(254487..257138)
FT                   /gene="alaS"
FT                   /locus_tag="HM1_0530"
FT   CDS_pept        complement(254487..257138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alaS"
FT                   /locus_tag="HM1_0530"
FT                   /product="alanyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83144"
FT                   /db_xref="GOA:B0TFY7"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TFY7"
FT                   /protein_id="ABZ83144.1"
FT                   /translation="MEFTGNRVRQLFLEYFEQKGHTIVASSSLVPHNDPTLLFSNAGMN
FT                   QFKDVFLGFEKRPYLRATTSQKCVRAGGKHNDLDTVGRTARHHTFFEMLGNFSFGDYFK
FT                   KDAIRYAWEFLTDVCGLPKDKLYATVYLDDDEAFALWRDMIGLPEARILRLGEKDNFWA
FT                   MGDTGPCGPCSEILIDRGEHLRCKAEECAIGKCDCDRWLEIWNLVFMQYNRDENGTMTP
FT                   LPRPSIDTGMGLERVTSVLQKVGSNYDTDLLRPLIAFVEQLCGQVYHRDDRGFPFRVIA
FT                   DHIRSCTFLITDGVLPSNEGRGYVLRRILRRAVRFGKVLGIDKPFMYEIVPVVVELMGE
FT                   AYPDIREKQDFVCKVIKIEEERFHETLHDGMRIAADMVAKVKQEGGNVLPGKQAFTLYD
FT                   TYGFPLDLAEDIAEENGLTVDKDGFQQAMEAQRERARAARQDTAYGAGMELWAELLQQL
FT                   GPTVFTGYGRTSGESVVKAIVAGATRVTEAGAGTAVQVVLAETPFYAESGGQIGDSGLL
FT                   RAGDAVVRVEDTKKMAGGLHVHFGVVAEGVFKEGDQVVAEVESARRLAIARHHSATHLM
FT                   HKALKEVLGEHVNQAGSLVTPDRLRFDFSHFSPLTRDEWNRIEAAVNRAVFQALPVEVF
FT                   ETSIDEAKAMGATALFGEKYGDRVRVVRMGNYSMELCGGTHLDNTSQVGLCKLLSESGI
FT                   GAGLRRIEAVTGEAALAYLNEQEETVRMLAEKLKVPAAEVTNRVDSLQAQLREKEREME
FT                   QLLSRLAKYQIDDLLAGKEEINGVTVLAAKVQAPDMDALRSMSDLLKEKLGSGVLILGA
FT                   VAGDKVNLVAAATKDIVGRGVHAGNLVKEAAKVCGGGGGGRPDMAQAGGKDPSRLSDAL
FT                   EAAKKLLKSQIK"
FT   gene            257154..257315
FT                   /locus_tag="HM1_0529"
FT   CDS_pept        257154..257315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0529"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83143"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFY6"
FT                   /protein_id="ABZ83143.1"
FT                   /translation="MKIDKDPSPDRLKRRPGTSQSTFLSRLDHRSTRPVDMCPICNIAC
FT                   WGGGCQGT"
FT   gene            complement(257538..258359)
FT                   /gene="cbiK"
FT                   /locus_tag="HM1_0528"
FT   CDS_pept        complement(257538..258359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiK"
FT                   /locus_tag="HM1_0528"
FT                   /product="cobalt chelatase cbik"
FT                   /note="anaerobic cobalt chelatase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83142"
FT                   /db_xref="GOA:B0TFY5"
FT                   /db_xref="InterPro:IPR010388"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFY5"
FT                   /protein_id="ABZ83142.1"
FT                   /translation="MVNAKAKADIPAILLVAFGTSAPEGRAALDHIEAKVKAAFPGVEV
FT                   RWSYTSSMIRKKISREQQVFIDSPLTALAKLRDDGYNQVVVHSLHIFPGREYCDLEDIV
FT                   RSLQAMKTSDGPVFDRLVLSDSLLHEFDDYRRACEAIAGLIPENSDEEALLLMGHGTDH
FT                   RSLSVFGCLNDLLRHQYRGKNVMLATVEGYPKLQHALNDLAASGVKKVKVAPFLVVAGS
FT                   HAQKDMAGDAPHSWKSRLEAKGYDVSLHMQGLGENDAIVEMMVDHLKKAWR"
FT   gene            258532..260154
FT                   /locus_tag="HM1_0527"
FT   CDS_pept        258532..260154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0527"
FT                   /product="transposase, is4 family"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83141"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B0TAA0"
FT                   /protein_id="ABZ83141.1"
FT                   /translation="MFRFDVDPQVSFYDFAALWDQLVPADSVFRLFRELAPLLIQPEDF
FT                   TGLYCLDNGRPSHAARQMTMACMLQEMLGETDRGMEAQTRVNIEVKFALGMALDEPGID
FT                   HANFGVHRQRLIQKELDKVYLDRFIRLMYYLGVLTGKEPWITDTTHVIAPISAPTTIEL
FT                   IRQAMRLLVRLLAKQYSVPWHAIPHAPRAVRYLETVTEVKEHNLDDKAKMERLVEVVSE
FT                   ADELLAYVESSEASWKKKPDVIHYALLLCRILRERIIRKDDGTLEIAPGGSVKDMIVSA
FT                   VDSEARFGCKGKTKWRGYKMAIVEVGNSGFIAAAEAMKANDYDGSSLVPLADQLPTDCV
FT                   ENPTIIGDTHYGAGDDRVTLKEKGIDVVAPLSPKTKCDILAGEGFQVSEDQTQLICPRG
FT                   KVITTYSEVADGKNFVLRAKDHDCKHCPRYTTCFKEKKHRRTIFIHNAYGVMLEAAKHS
FT                   QTKIYKEQMRLRSRIEAKQNELVNRYGLRRVRRIGKRNLAYAARLSALAANFQKLNRLR
FT                   NDKNATMVLEVSALRGVAFKKAA"
FT   gene            complement(261059..261385)
FT                   /locus_tag="HM1_0526"
FT   CDS_pept        complement(261059..261385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0526"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83140"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFY3"
FT                   /protein_id="ABZ83140.1"
FT                   /translation="MELKEKVTIIESVDGDLWNLTTKGRRAVTIFVDRLTHTVTEHGQK
FT                   NFLNKKEIERLFRYGARVRVKYKDYIFNYTSVMVEWSLALNTNVNHMPVGDPYFVFYEC
FT                   RVVK"
FT   gene            complement(261722..263071)
FT                   /gene="dgt"
FT                   /locus_tag="HM1_0525"
FT   CDS_pept        complement(261722..263071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dgt"
FT                   /locus_tag="HM1_0525"
FT                   /product="deoxyguanosinetriphosphate triphosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83139"
FT                   /db_xref="GOA:B0TFY2"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR026875"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFY2"
FT                   /protein_id="ABZ83139.1"
FT                   /translation="MNDERKELPEFLGQIEDREKKLSELKEVTRKLLDEVSFFNDMRQS
FT                   SVDMPSTQRSRHALERDYTRVLYSSSFRRLQGKMQLLGVSHEHFFRNRLTHSLEVAQIA
FT                   RSFAYEFGYSHEDIYAIEACALAHDIGNPPFGHSGERVLNEISKDFGGFEGNAQTLRVL
FT                   TTLEKKIPDHGGLNLTYRTLLGTVKYYNQRSANKDKFIYDNDFQMINQLKGSRDFKLRT
FT                   IDAQLMDLADEIAYAGHDLEDSLNLRLFTIDELQHELQLYFLENKLSDKEKELLLNTFS
FT                   SIVENAKEKANKAKTSEEFNSIFIKEITSLLIHILMRDVTYAKISDDFKKKTGSENVME
FT                   FTFGQYGKLAKALKTITFRCIQRTDIVQQYELQGERIIRGLFEVLMDTKFNKDCHLMPP
FT                   EFRKGHNNYCTRGRNVIDYISGMMDSYAIAAYKKLFGSHALSKLYWDQSH"
FT   gene            complement(263666..264550)
FT                   /locus_tag="HM1_0524"
FT   CDS_pept        complement(263666..264550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0524"
FT                   /product="integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83138"
FT                   /db_xref="GOA:B0TFY1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFY1"
FT                   /protein_id="ABZ83138.1"
FT                   /translation="MRVIGIHEATYYARRQRLQREPKERAYNGGRPQPGYSWTQDGKRI
FT                   SDEQIKEYLMELIAGEESVYGYRKLGLCLHKQHQLIINHKKTYRLCKELDILSPQRQIK
FT                   AKHPRRMARNRTITASNELWEMDIKYGYIAGEDRFFYLMSLIDVYDRSIVDYHIGLNCE
FT                   GADAANTLKRALWKRNCFEKEKKPIVRTDNGSQFISRVFEETCEQYQVEHERIPPKTPN
FT                   KNAHIESFHANLERECYIKHAFESYQDAYQVVGEYIDFYNQRRIHGSLYNMSPAEFCRQ
FT                   LADGNVPAFIVTL"
FT   gene            complement(264601..264927)
FT                   /locus_tag="HM1_0523"
FT   CDS_pept        complement(264601..264927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0523"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83137"
FT                   /db_xref="GOA:B0TFY0"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFY0"
FT                   /protein_id="ABZ83137.1"
FT                   /translation="MRRNRYPKELKEQLIQEAMEVGNATQVARRHGIDPKRLYYWIRES
FT                   QHKGFQEAPAEAKQIAPYVPSAQEFKRLESENIALKKLLGEKTLEIQILQDLIKKKNPS
FT                   YRKN"
FT   gene            264998..265741
FT                   /locus_tag="HM1_0522"
FT   CDS_pept        264998..265741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0522"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83136"
FT                   /db_xref="GOA:B0TFX9"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFX9"
FT                   /protein_id="ABZ83136.1"
FT                   /translation="MIETTVAQRLIRRMAETYGKITDVYTLDALFAKAPVIHAALDAGA
FT                   HVVVRMKEERRRIMKEANACFANRLPDSTWEERDGKGNTVYVQAWDEEGLAQWPQVRVP
FT                   MRIVKIIRHTNKTVIEANKEVFVTDVVERWIATTCSSEKADTQTIAQIAAARWDIENIG
FT                   FRNLKTFNALDHCFVHDSVAIKAMIGFQVLAFNLKRLFFFHHLPASSRNRDVPLRYLID
FT                   EMREATRWLSLHLYRWVWEWGLSTA"
FT   gene            266034..267656
FT                   /locus_tag="HM1_0521"
FT   CDS_pept        266034..267656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0521"
FT                   /product="transposase, is4 family"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83135"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B0TAA0"
FT                   /protein_id="ABZ83135.1"
FT                   /translation="MFRFDVDPQVSFYDFAALWDQLVPADSVFRLFRELAPLLIQPEDF
FT                   TGLYCLDNGRPSHAARQMTMACMLQEMLGETDRGMEAQTRVNIEVKFALGMALDEPGID
FT                   HANFGVHRQRLIQKELDKVYLDRFIRLMYYLGVLTGKEPWITDTTHVIAPISAPTTIEL
FT                   IRQAMRLLVRLLAKQYSVPWHAIPHAPRAVRYLETVTEVKEHNLDDKAKMERLVEVVSE
FT                   ADELLAYVESSEASWKKKPDVIHYALLLCRILRERIIRKDDGTLEIAPGGSVKDMIVSA
FT                   VDSEARFGCKGKTKWRGYKMAIVEVGNSGFIAAAEAMKANDYDGSSLVPLADQLPTDCV
FT                   ENPTIIGDTHYGAGDDRVTLKEKGIDVVAPLSPKTKCDILAGEGFQVSEDQTQLICPRG
FT                   KVITTYSEVADGKNFVLRAKDHDCKHCPRYTTCFKEKKHRRTIFIHNAYGVMLEAAKHS
FT                   QTKIYKEQMRLRSRIEAKQNELVNRYGLRRVRRIGKRNLAYAARLSALAANFQKLNRLR
FT                   NDKNATMVLEVSALRGVAFKKAA"
FT   gene            268169..269791
FT                   /locus_tag="HM1_0520"
FT   CDS_pept        268169..269791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0520"
FT                   /product="transposase, is4 family"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83134"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B0TAA0"
FT                   /protein_id="ABZ83134.1"
FT                   /translation="MFRFDVDPQVSFYDFAALWDQLVPADSVFRLFRELAPLLIQPEDF
FT                   TGLYCLDNGRPSHAARQMTMACMLQEMLGETDRGMEAQTRVNIEVKFALGMALDEPGID
FT                   HANFGVHRQRLIQKELDKVYLDRFIRLMYYLGVLTGKEPWITDTTHVIAPISAPTTIEL
FT                   IRQAMRLLVRLLAKQYSVPWHAIPHAPRAVRYLETVTEVKEHNLDDKAKMERLVEVVSE
FT                   ADELLAYVESSEASWKKKPDVIHYALLLCRILRERIIRKDDGTLEIAPGGSVKDMIVSA
FT                   VDSEARFGCKGKTKWRGYKMAIVEVGNSGFIAAAEAMKANDYDGSSLVPLADQLPTDCV
FT                   ENPTIIGDTHYGAGDDRVTLKEKGIDVVAPLSPKTKCDILAGEGFQVSEDQTQLICPRG
FT                   KVITTYSEVADGKNFVLRAKDHDCKHCPRYTTCFKEKKHRRTIFIHNAYGVMLEAAKHS
FT                   QTKIYKEQMRLRSRIEAKQNELVNRYGLRRVRRIGKRNLAYAARLSALAANFQKLNRLR
FT                   NDKNATMVLEVSALRGVAFKKAA"
FT   gene            complement(271430..272362)
FT                   /locus_tag="HM1_0519"
FT   CDS_pept        complement(271430..272362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0519"
FT                   /product="crispr-associated protein, af1879 family"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83133"
FT                   /db_xref="InterPro:IPR009260"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFX6"
FT                   /protein_id="ABZ83133.1"
FT                   /translation="MYFLSDEERKKLLHYYLPKARREGVAEELRGWNWSQPPLSPVYDC
FT                   PLGVFEVASGYCSSSRDVYLRRVEGARSKPNGAMFQGSLLHGLAARFIVATKGLIYQEG
FT                   VDGYREILRKLQEMTLSELLDEGLVFELASLAEADREELERKSRLLLEFERGRLIARLQ
FT                   EALVKQPYIGEDALTALAVPVVVEQKLDGSFLGLSAHLSADAYNIGQPMIVEVKFGEPR
FT                   DFHRLATAGYALVMEAVYEHPVDVGCLVCVTFKGDRVIIRRDIHLIDDELRQWFVEARD
FT                   EKARMVYEEIDPGLAKDCPQSCPFANRCS"
FT   gene            complement(272565..273185)
FT                   /gene="cas4"
FT                   /locus_tag="HM1_0518"
FT   CDS_pept        complement(272565..273185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cas4"
FT                   /locus_tag="HM1_0518"
FT                   /product="crispr-associated protein cas4"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83132"
FT                   /db_xref="GOA:B0TFX5"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR013343"
FT                   /db_xref="InterPro:IPR022765"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFX5"
FT                   /protein_id="ABZ83132.1"
FT                   /translation="MLTLRVTDVKQYVYCPRIPYFTYVQPLKPRPTAKMDFGKDAHARL
FT                   DKLEKRRTLAAYPELEAGERKFHTYIHSARLGLEGKLDLHLVHRGEIFPVEFKSTSRRP
FT                   GLNHKYQLTAYAMLLEELYQKPVRRGYFKLVNPLADGARPEKSEITLPVEITVPMRDFV
FT                   KDVLRRIRAMVKQESLPSPKRPGNRCRDCEYRVYCLDLGDVVR"
FT   gene            complement(273179..273466)
FT                   /gene="cas2"
FT                   /locus_tag="HM1_0517"
FT   CDS_pept        complement(273179..273466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cas2"
FT                   /locus_tag="HM1_0517"
FT                   /product="crispr-associated protein cas2"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83131"
FT                   /db_xref="GOA:B0TFX4"
FT                   /db_xref="InterPro:IPR019199"
FT                   /db_xref="InterPro:IPR021127"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFX4"
FT                   /protein_id="ABZ83131.1"
FT                   /translation="MKTLVIYDIELDKVRTKVSELCKDYGLQRIQYSAFFGELNTNRRE
FT                   ELRQRIKKTLGRTVGRIHFFPICDKDLRLVMQVMNLPELLVDGDDGEASC"
FT   gene            complement(273469..274563)
FT                   /gene="cas1"
FT                   /locus_tag="HM1_0516"
FT   CDS_pept        complement(273469..274563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cas1"
FT                   /locus_tag="HM1_0516"
FT                   /product="crispr-associated protein cas1"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83130"
FT                   /db_xref="GOA:B0TFX3"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="InterPro:IPR042206"
FT                   /db_xref="InterPro:IPR042211"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFX3"
FT                   /protein_id="ABZ83130.1"
FT                   /translation="MENFEIRLLLQVIPMKPLDLILDASESEKQHIIISQFGASLGKKS
FT                   GRLVVREKGQVVTEVPFDRVEQVTVITSGASLSTDAIEECVRHGIEINLLDFRGSPYAK
FT                   LFAPGLTATVKTRREQLLAFNDQRSIFLAKAFVRGKIQNQINTLKYFAKYRKSARQEVY
FT                   AYLQDAALLMEKNLQELTGIDGLNIDAVRGPLMSVEGRAATRYWDAVAFLLKGYVVFPG
FT                   RENRGATDPVNSLLNYGYAVLEARVLGAVLQAGLDPYAGFLHVDRPGKTSLVYDFIEEF
FT                   RQPVIDRPVLAMVIAGVEIGMEGERLADGTKRDLLERIQQRLAATERFDGKKYPLQSIL
FT                   LRQARRMASYLRGDQKYKPFVCSW"
FT   gene            274995..276356
FT                   /locus_tag="HM1_0515"
FT   CDS_pept        274995..276356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0515"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83129"
FT                   /db_xref="GOA:B0TA98"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:B0TA98"
FT                   /protein_id="ABZ83129.1"
FT                   /translation="MQSVAQPLEEVQKIFCRTPGGKKAGRLIQHFTQYASKVYGFSQMV
FT                   RQAKDGRKQPRIKAPAIFTVAFFGAFFCMESMEQMDRWQKTGVFRQLVPKNIRLPSHDT
FT                   VRQALMKWDLKEQRKQHNCVIQRYKEQRGPQKESINGWRVTAIDGVELFHTKAYRCPEC
FT                   LTREHRDKTTDYYHAVVVAQQVGGNANLIYDWEMRKPQDGVDKDEGETTVAQRLIRRMA
FT                   ETYGKITDVYTLDALFAKAPVIHAALDAGAHVVVRMKEERRRIMKEANACFANRLPDST
FT                   WEERDGKGNTVYVQAWDEEGLAQWPQVRVPMRIVKIIRHTNKTVIEANKEVFVTDVVER
FT                   WIATTCSSEKADTQTIAQIAAARWDIENIGFRNLKTFNALDHCFVHDSVAIKAMIGFQV
FT                   LAFNLKRLFFFHHLPASRHRDVPLRYLIDEMREATRWVSLHLYRWVWEWGLSTA"
FT   gene            complement(276684..277697)
FT                   /locus_tag="HM1_0514"
FT   CDS_pept        complement(276684..277697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0514"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83128"
FT                   /db_xref="InterPro:IPR019267"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFX1"
FT                   /protein_id="ABZ83128.1"
FT                   /translation="MDIRSIAPFLHPPLNVQCYRIVAEAGPRGLLLPPYPGSTFRGVLG
FT                   HGLRKIACTAGPQQECSFCLFQKVCLVTILFQPVAPERQEGFFGRAQELPPPFVLRPLT
FT                   GGKTEWRPGETFELAVHLFGKGCDYAPYLLSALSVAMEGGLGKGKRPAKMVRVFGENPF
FT                   TGESVAVFVDNQWRMDGAPTLGGKDVDQRVRDVLQNFDGKVTMEYVTPLRLKSDSRLQH
FT                   SVDPVLFVRSVLRRLSLLSMFHGQGRWEFPFQEYIEHSSGLAFCDEHYSWVDWERYSSR
FT                   QESRLKLGGIIGSASLEGEVLPSFLPLILWAELTHVGKSTVFGLGKIWIKNKHVVR"
FT   gene            complement(277654..278361)
FT                   /locus_tag="HM1_0513"
FT   CDS_pept        complement(277654..278361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0513"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83127"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFX0"
FT                   /protein_id="ABZ83127.1"
FT                   /translation="MWLLAAFSASNLFSLKVSGATSSGGKSHLIPTPYVVKMALIDASF
FT                   RLDGRGEEDFAWIRPLTIAFQVPEAVVVNNNFVKVLKEARDGDETYQQTVGLRQYVYWH
FT                   GPIRIAFEIGGLSELQRERLSRLVTLVNYFGKRGSFVQYRGQEITAELEAGFSFDMNEP
FT                   RKPGNGPLSREMLIQMMDDMGGSSGFDAFNSYSSSRQKLHEDRIFRPIVLVSVKEASSR
FT                   GYTLYRALSPSPA"
FT   gene            complement(278376..279320)
FT                   /locus_tag="HM1_0512"
FT   CDS_pept        complement(278376..279320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0512"
FT                   /product="crispr-associated negative autoregulator,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83126"
FT                   /db_xref="InterPro:IPR010154"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFW9"
FT                   /protein_id="ABZ83126.1"
FT                   /translation="MTISSISLCARVTLDMHSLNNEGAEGNQLQTRMVHIVDQTGQLAV
FT                   TNAISGDMLKHIQNENLAQIASEMGLPICSGCKRVNANRINVDRDFFKSIEKLDTKDNI
FT                   GTLRELIRYCTVDDLEGILITEGKRSVARKSVIEFGWLVGVPEKTRTESYFHVKFDAES
FT                   RSGGSGSEDGSNTGQNIFYRPANSGEYALVLNVELDRIGFHDVTREYVLDEAERSKRKR
FT                   AMLQSILHTFVKLNGAHRNTQHPHMVNMAGVISVSYNKTPAPTISPLADGYREEIQAVV
FT                   QELNRWKGNEINCYKFDSLSQFARLVTDLAKKL"
FT   gene            complement(279355..281193)
FT                   /locus_tag="HM1_0511"
FT   CDS_pept        complement(279355..281193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0511"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83125"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFM6"
FT                   /protein_id="ABZ83125.1"
FT                   /translation="MIVERFFVPHSTGTYADALEAVGLALLLDNLSGDSVSTIKDSGPY
FT                   FEIQLNEPLILEELPVDQVLPYDPGYPYFMTAKDKNVPAGYLLYDYEEEKKIANTYWEQ
FT                   YKKQKAKKTATVTSDVAQTMQGAEPNPRHNLLKNMYVLQAFNSHNRLLSEFAAADPEAV
FT                   KDAIIEKLRTYCHGCLKTLDAPDPIPKEAKRSSKAQRFAPDLTAVQALNPIVGKGINRN
FT                   KPTGTGLAGLPSAYVDWFAEYLRYLAVHCIANAFNVGDDIKYAVLVPGEVSFNELKKLA
FT                   DDFVRLPLGKRTSCQLDIHNAIGLAEKLIDHSRQLQEHNERQTRWKLPKQVIAGIATAY
FT                   FKSLGSGKALTNVNTIGLPGWFPIETIQDADDWKQILEEHRRIMYGLDEEHSEEAELLY
FT                   QYRDFISSGQLKNLLDFAASYGAFVFKQAANQKRGYLGLSQRHLERLVTSLSKPFSDIV
FT                   KDEGFRAIADAIRRSTVVEQYRKSQGRQEYEIRYGLFSDLKRKSRSKQELICLIGDFVS
FT                   DYNKENARKEEVRAKKAVEKGAGELYRRPSVSDDAIEKVVALIDIFGSEPVAMLLAAFG
FT                   SAKTETKKETKTDGKTETSVKTETSADTENGKDTGD"
FT   gene            complement(281183..283696)
FT                   /gene="cas3"
FT                   /locus_tag="HM1_0510"
FT   CDS_pept        complement(281183..283696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cas3"
FT                   /locus_tag="HM1_0510"
FT                   /product="crispr-associated helicase cas3, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83124"
FT                   /db_xref="GOA:B0TFM5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006474"
FT                   /db_xref="InterPro:IPR006483"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035011"
FT                   /db_xref="InterPro:IPR038257"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFM5"
FT                   /protein_id="ABZ83124.1"
FT                   /translation="MQPELTALFTQITGKKPYGFQTQVAREVLEQERVILRAPTGSGKT
FT                   WAALLPFLYAKENRTPWADRLIYAVPLRTLGKNLYSTIKKRLDDQFPGKYRVTMQTGDV
FT                   PDDPLFEGDIILCTVDQLLSAYILHPYAVGPRRANVVAGALSGAYVVIDETHLLTPRES
FT                   LATAVDMVRRYQGLMTALFMTATMPDTVMDEVARRCKAKTITVTEEQMESDPQSRQVKP
FT                   ERRIHRMTIPLSPEAVLSEHRTSSLVVCNTVDRAVRFYQTLKKMLGENKSDIPLFLLHS
FT                   RFLPEDRARLERRITEQFGPDRTGRGIIISTQVLEAGVDISADVLHTELAPANAIVQRS
FT                   GRVARYGGLGSIFVYDITEDGKRNYAPYFGVSIAANASSATNDINASSDEAEARRIMDA
FT                   TWDSLEKWDGKVIGFTQELAWVNEIHAAVEQRALRSRTERKVIDDVNAAMRSQSSHFLR
FT                   DLVRNAASINLLVHPDPNTLDMRRQPPLFSLHPGVFRRIVRRVLRGEQDGAMWFMDFRE
FT                   NDEIIWMEIKNEKDLDGRYFFAVSPQLAAYHPEIGLTMESGTFQCKEKLDKPPVYERFR
FT                   YRKELLSDHLQAVAGECEQQGKRNQAAVARWAELLCLRTDTIESFSWLGAAGHDAGKAS
FT                   LQWQTWARNYQFVLTGKVEEECLAHTDYDPENPRVKEAEKSKRKPSHAAEGAYYLFDRL
FT                   LQPVADGLIPDDLPKAEIIARSVMTAIARHHGPHVKELNRQIEFCGMPDAVANWLSEQV
FT                   KTMPVDTAILENIGLQSAWKSESSFDRNRFAKLLVDPKLNECGNNVLKELAWLFYLYLV
FT                   RRLRMADWASMERAHPEKEVEKGDC"
FT   gene            complement(283734..284039)
FT                   /locus_tag="HM1_0509"
FT   CDS_pept        complement(283734..284039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0509"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83123"
FT                   /db_xref="InterPro:IPR002767"
FT                   /db_xref="InterPro:IPR029756"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFM4"
FT                   /protein_id="ABZ83123.1"
FT                   /translation="MPVIAEVTVVPLGTGSPSLSRYVADCHQLLREAEGIRYQLTPMST
FT                   VIEGELDRVVEVVRKMHEAPFTAGALRVSTTIRIDDRRDKPLSMEGKVRAVEERFM"
FT   gene            complement(284042..284305)
FT                   /locus_tag="HM1_0508"
FT   CDS_pept        complement(284042..284305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0508"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83122"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFM3"
FT                   /protein_id="ABZ83122.1"
FT                   /translation="MNSQEMAELLSDLLLRDKRFQASVIKGNELFVQFNDLEEMGPVSK
FT                   WVAIQVRLGNRIEEMDKPTGRCGCPHRSRERVGVKELRGEEG"
FT   gene            complement(284343..284504)
FT                   /locus_tag="HM1_0507"
FT   CDS_pept        complement(284343..284504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0507"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83121"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFM2"
FT                   /protein_id="ABZ83121.1"
FT                   /translation="MPSMRTIDGKTSESPLIGRVNPGSREMNERDEIRRMNMKDDYEGR
FT                   KKIGRFFL"
FT   gene            complement(284594..285328)
FT                   /locus_tag="HM1_0506"
FT   CDS_pept        complement(284594..285328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0506"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83120"
FT                   /db_xref="InterPro:IPR023875"
FT                   /db_xref="InterPro:IPR025404"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFM1"
FT                   /protein_id="ABZ83120.1"
FT                   /translation="MLHYRYDGEFDGLLTAIYEAYYRRQVPDDIRPSGWAETNLFAEEV
FT                   AITTDPEKAEKVFTAMAVKISPDARRHTAYAFLSELPGMEKAIYEYLRLGFRMGAAVDT
FT                   HLTDERVLQVHRLSQKVRTERHRMLGLLRFRLLKGNVYYAPMEPDHNITGLLAPHFVDR
FT                   LGDQNWIIHDLRRGLAALYNQKEWILTELDGIVDFTQSTMEQVYQDLWRDYFRSVTITG
FT                   RINQRLQRRCMPARYWKHLIEK"
FT   gene            complement(285400..286143)
FT                   /locus_tag="HM1_0505"
FT   CDS_pept        complement(285400..286143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0505"
FT                   /product="exsb protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83119"
FT                   /db_xref="GOA:B0TFM0"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFM0"
FT                   /protein_id="ABZ83119.1"
FT                   /translation="MDAYRERAVVILSGGLDSTTCMALADCRGEDIFALTFAYNQRHIR
FT                   EIEAAQAVACHYGAHHQIIDLGAVFAASALTSTEIRPEVAAPLGGSAVAKMEAMGCAEK
FT                   NPVAIATAIPATYVPARNILFLAYALSFAEKVGARRIYTGVNALDNPGYPDCRPEFIAA
FT                   FQRMIDVGTKAGTEGRSVEVFTPLIEMNKADIIRLALDLDAPLHLTLTCYYGERPACGE
FT                   CNSCRLRLEGFRLLGKGDPIAYRKG"
FT   gene            286363..287985
FT                   /locus_tag="HM1_0504"
FT   CDS_pept        286363..287985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0504"
FT                   /product="transposase, is4 family"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83118"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B0TAA0"
FT                   /protein_id="ABZ83118.1"
FT                   /translation="MFRFDVDPQVSFYDFAALWDQLVPADSVFRLFRELAPLLIQPEDF
FT                   TGLYCLDNGRPSHAARQMTMACMLQEMLGETDRGMEAQTRVNIEVKFALGMALDEPGID
FT                   HANFGVHRQRLIQKELDKVYLDRFIRLMYYLGVLTGKEPWITDTTHVIAPISAPTTIEL
FT                   IRQAMRLLVRLLAKQYSVPWHAIPHAPRAVRYLETVTEVKEHNLDDKAKMERLVEVVSE
FT                   ADELLAYVESSEASWKKKPDVIHYALLLCRILRERIIRKDDGTLEIAPGGSVKDMIVSA
FT                   VDSEARFGCKGKTKWRGYKMAIVEVGNSGFIAAAEAMKANDYDGSSLVPLADQLPTDCV
FT                   ENPTIIGDTHYGAGDDRVTLKEKGIDVVAPLSPKTKCDILAGEGFQVSEDQTQLICPRG
FT                   KVITTYSEVADGKNFVLRAKDHDCKHCPRYTTCFKEKKHRRTIFIHNAYGVMLEAAKHS
FT                   QTKIYKEQMRLRSRIEAKQNELVNRYGLRRVRRIGKRNLAYAARLSALAANFQKLNRLR
FT                   NDKNATMVLEVSALRGVAFKKAA"
FT   gene            288233..289384
FT                   /locus_tag="HM1_0503"
FT   CDS_pept        288233..289384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0503"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83117"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFL8"
FT                   /protein_id="ABZ83117.1"
FT                   /translation="MNQQITQQIQNMQSTLRQVDSVVGQIRQIERSNEQQLTSLAQREA
FT                   QAQSQLQQLQNLCSQMTQQLQNLSNQSQQYSSTVMQTTSPSVSIASGSGLAYGFSSGAG
FT                   STASYGVTPFGTTSGYGGTSGYGGTSGAFGSTIGMGTAAPFAPTPGFVGEQSPYAQGSS
FT                   LSASTFSPTAGFIGDPPSNQGGTAMTALGSSGMGMSMGGSGMGMSMGGSGGFSSTGGSG
FT                   GFSSTGGSGATSSIGMGGMGSGALMSASGGFSSIGGSGLSATTTMSTPGFVGSPSPYAP
FT                   SGSLSPTSFAPSQGFVGDLSPYAPSSGLSATSLTPSQGFVGDLSPYAMGAASGASSLGS
FT                   AGMGGSNFGGATMGTSGFGGSSTGFGGTGMSTSGFSGFSGSLQ"
FT   gene            289488..289625
FT                   /locus_tag="HM1_0502"
FT   CDS_pept        289488..289625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0502"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83116"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFL7"
FT                   /protein_id="ABZ83116.1"
FT                   /translation="MDSKDKCSQQAANTNAHQMEAANELTPNKQVDNCPACKEPEVETW
FT                   "
FT   gene            289628..289858
FT                   /locus_tag="HM1_0501"
FT   CDS_pept        289628..289858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0501"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83115"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFL6"
FT                   /protein_id="ABZ83115.1"
FT                   /translation="MDALEDLPEESPEGLPEESSEILPKELSEPQSRFTRLDHMAVTEE
FT                   ANNLGDDLLIDNQPAVDKPSDPGLRPSQQPR"
FT   gene            complement(290006..291361)
FT                   /locus_tag="HM1_0500"
FT   CDS_pept        complement(290006..291361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0500"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83114"
FT                   /db_xref="GOA:B0TFL5"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFL5"
FT                   /protein_id="ABZ83114.1"
FT                   /translation="MFNEENKPLQGLLLGILALAFVLRVTVISLQGSALFLNSDDAGYI
FT                   RCAAKWLETGVMTFGSDRPTAFVGPLFPGFVAIIFAFFGSDDAGVQAVRYAQALLGLLS
FT                   VFLTYRLVELLSERRTALLAAFFMAVYPSNILVNGLILTETLFTVLNLGYLFLLVKLSH
FT                   GEQGSEKAEMFLFGLLGAYTALLTLTRATAALFPLVFMVYLLWRRRYAFRSWLRNGLIV
FT                   LMVFALSMSPWWVRNYIAFDRFIPFSSGAGEPLLLGTYVDMEGLVNGSAPDWPVGMDEL
FT                   DTQQKYKEFAIERLKENVPKEPLRYLKWYTWGKFLLMWGGAFMWEPIWWSIRHLVDLIH
FT                   QLLMVLALGGIAMALWRWWNRREELRAQGGLLRDEVPGDRWGAGGRLTGLLLLLSMPIY
FT                   YTAVHNLYFGFPRYNIPFLPIIFFFSAYAVIESVDALLGVRKGDDGRSGPFR"
FT   gene            complement(291385..293892)
FT                   /locus_tag="HM1_0499"
FT   CDS_pept        complement(291385..293892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0499"
FT                   /product="ATP-dependent protease, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83113"
FT                   /db_xref="GOA:B0TFL4"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041699"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFL4"
FT                   /protein_id="ABZ83113.1"
FT                   /translation="MSAMKALSAAQLQSRRLPLDRLTVRCAPDIFEFSSTREITPLEEG
FT                   IIGQPRAVKAMEFGLGAKHPGFHIFISGPIGSGKTGFAVTKVKQVAQSESTPDDICYVN
FT                   HFGQPDRPIVLTLPAGMGSELRRDVKELVEELHGEIRKALEGEAHEKRRSAFLRQVETR
FT                   LTAMFREMEELAKEEGFILQKGQSGIFTIPMTEEGKPMSKDDFDSLEEKRRQEINDREH
FT                   RLESRLADVLRRSRNLQKEANNHLKEIERDSAHQATKHLVDALKEKYKNHVKVVEFLTN
FT                   VQEDVLENLSDLKGGAPSEEEEGTPAQLILLARGQRPSQLTRYEVNLFVENGAQVGAPV
FT                   IVESNPTFTNLFGKVEYRSSFGSMATDFTMIKPGAVHQANGGYLILQALPLLASPGAWE
FT                   GLKRVLRTRELRIENLGEQLGLPSTATLKPEPVPIDVKVILIGSPRIYYLLYNMDEDFR
FT                   KFFKVRVDFDSVMERNQENIRKYAAFVGSVCEREMLLPFTAEAVARVIDYSSRLVSHQR
FT                   KLSTSFHDIKDMIVEAAMWAESEGATEVLAGHVDQAIQEKNFRVNRIEERIQETICDGM
FT                   LLVDTDGAVVGQVNGLAVLDLGDYAFGKPNRITARVYLGREGVIHIEREIRLSGQSHSK
FT                   GVLILTSFFASRFARERPLSLSAALTFEQLYDGIDGDSASSAELYALLSALSELPLRQD
FT                   IAVTGSVNQRGEVQPIGGVNEKIEGFFRLCQARGLTGSQGVIIPASNAPNLMLDQAVLD
FT                   AVEAGRFHIYAVSHVDEGIEILSGVQAGQPDEDGKYPPGTVNALITEKLLRMEEKWQES
FT                   SKQAKKSRKPASIRSGERSGENG"
FT   gene            complement(294044..294550)
FT                   /locus_tag="HM1_0498"
FT   CDS_pept        complement(294044..294550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0498"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83112"
FT                   /db_xref="InterPro:IPR019301"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFL3"
FT                   /protein_id="ABZ83112.1"
FT                   /translation="MITPIQRIMDTSGLVNTVRGQTTVKEGALFPRLMEEQFRKSAERA
FT                   DSSETARDTKRMAQKAGLAPSPEAAAPTAGAANSAVGSILSEAEKEKERQRLREACQEF
FT                   EALYIHQMLKGMRSTVPKSDLIEEAPGRKIWESMLDEEYAKSMAKREEVGFAKMLYKEL
FT                   SRPLE"
FT   gene            294721..296709
FT                   /locus_tag="HM1_0497"
FT   CDS_pept        294721..296709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0497"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="Missing cache domain, PF02743"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83111"
FT                   /db_xref="GOA:B0TFL2"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFL2"
FT                   /protein_id="ABZ83111.1"
FT                   /translation="MKLQTKLTVWTCTTLSIGLVATLAVYGWMETRSVQARVERDLTAK
FT                   GEALVMSAAKGLETMVESHIRNGVELPSGQFVRGEELKGLLFDDELTLIPESKAEADKR
FT                   YRPEETVERFDGARIPMREYEYKYMSKADPYTDRYWQHYIDAFMGSDPDVVFALATKHS
FT                   SDPAKTGYISTHNSFYSPTDPDLSRDAWGATGILSQKYRSNRIFNDKAGGAAASNTNRE
FT                   KPLKTVYERKIEGKTVTMWDMSYPIYFEGKHWGGFRLSISKERADMLIAARTKELFWKL
FT                   LTVAAVAIVGLAGTMVLIIAVIIIRPLNAMVFVSHRLAEGDFTHTVDIRQEDELGDLGK
FT                   AFNSMIASVKTLVHGIMKSTYEVNRLAGNLQSAAGQTAEAADEIARSVQEVSAGAADQE
FT                   QETEATANIIRRITAQLSALSKTATEVTEATTQAQRRAQEGQASIHEATGQMKVIHDTV
FT                   LQSAGVIHQLGERSKEISRIVDTITAIAAQTQMLALNAAIEAARAGHEGRGFAVVAEEV
FT                   RKLAEQSRHAAQDIARLVASVQSESARAIDSIESETEVVRAGIQVVQRTGEFFQEIIAA
FT                   VSDVTCKMQTVSAAVIELAGEEKQVLAAVDHVSSIARSNNDTSRHIALSTQEQTAAMQE
FT                   IAASTEMLAHTARRLSELVQRFVVERQ"
FT   gene            297052..297303
FT                   /locus_tag="HM1_0496"
FT   CDS_pept        297052..297303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0496"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83110"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFL1"
FT                   /protein_id="ABZ83110.1"
FT                   /translation="MIISKQKAVILTCRACRERFELSVKGVVHNEALPHTVPLDVVYIG
FT                   STHYVADESHAMAEILCVCPNCSAKNKFEAWIPRYLRL"
FT   gene            complement(297355..297528)
FT                   /locus_tag="HM1_0495"
FT   CDS_pept        complement(297355..297528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0495"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83109"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFL0"
FT                   /protein_id="ABZ83109.1"
FT                   /translation="MLPLAQIGGKIGYHQHRQFTGTKKAGKQRRKQKSRLMRKKYAGGG
FT                   FFIVMGSTGHRV"
FT   gene            complement(297557..298261)
FT                   /locus_tag="HM1_0494"
FT   CDS_pept        complement(297557..298261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0494"
FT                   /product="branched-chain amino acid abc transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83108"
FT                   /db_xref="GOA:B0TFK9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030660"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFK9"
FT                   /protein_id="ABZ83108.1"
FT                   /translation="MLTVKDLHVYYGAIHALKGISLEVRQGEIVTLIGANGAGKTTTLH
FT                   TLSGLIKPKSGVIRFQDQDIAGMAAQKIVAMGMSQVPEGRRIFANMSVLENLELGAFLR
FT                   KDKDGIKEDMEKVFTRFPRLKERTSQLAGTLSGGEQQMLAMGRALMSRPKLMLLDEPSM
FT                   GLAPLLVQEIFAIIKEINEAGTTILLVEQNAHMALSIAHKAYVLETGKIVLSGPAKELA
FT                   ESEEVKKAYLGG"
FT   gene            complement(298248..299027)
FT                   /locus_tag="HM1_0493"
FT   CDS_pept        complement(298248..299027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0493"
FT                   /product="branched chain amino acid abc transporter,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83107"
FT                   /db_xref="GOA:B0TFK8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFK8"
FT                   /protein_id="ABZ83107.1"
FT                   /translation="MILLSVNHLSKTFGGLKAVSDVNMELKIGELVGLIGPNGAGKTTL
FT                   FNLLTGVYKPTDGDIVLRRETIVGLKPHQINQKGIARTFQNIRLFSNLTVMDNVKIAYH
FT                   QHRSYNMLSAILRLPSYFHGEEEMDKKAERLLEIFKLGHKKDELAKNLPYGEQRRLEIA
FT                   RALAAQPQLLLLDEPAAGMNPQETAELMEMIRWVRKEFDLTILLIEHDMSLVMGICERI
FT                   YVLDYGQIIAEGTPEQIKSNPKVIEAYLGEDVTHAHG"
FT   gene            complement(299008..300000)
FT                   /locus_tag="HM1_0492"
FT   CDS_pept        complement(299008..300000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0492"
FT                   /product="branched-chain amino acid abc transporter,
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83106"
FT                   /db_xref="GOA:B0TFK7"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFK7"
FT                   /protein_id="ABZ83106.1"
FT                   /translation="MSGVKKLLNLPNLIVAAVLLLFYGFVSFGLELGFIDDYYKLNLFL
FT                   ICINIILATSLNIINGMTGQFSIGHAGFMAIGAYGSAIMTMKLGYPFPVGILVGALAAA
FT                   IAGFLVGMPTLRLKGDYLAIATLGFGEIIRVIILNIEYVGGAAGLNGISQFTSWEWLFF
FT                   LTVATVLIIKNFMTSTHGRACIAIRENEIAAETMGIDITRYKVIAFTMGAFFAGIAGSL
FT                   HAHYFYTIQPTTFGFMKSFDILVFVVLGGLGSLTGSVISAIALTILSAFLQEYAELRMV
FT                   IYSLLLVIVMLVRPQGLMGTAEFSYAGMRRLYARLTGKGRGAGNDTAVG"
FT   gene            complement(300001..300882)
FT                   /locus_tag="HM1_0491"
FT   CDS_pept        complement(300001..300882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0491"
FT                   /product="branched-chain amino acid abc transporter,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83105"
FT                   /db_xref="GOA:B0TFK6"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFK6"
FT                   /protein_id="ABZ83105.1"
FT                   /translation="MEVFFQQLINGLSLGSIYALIALGYTMVYGIIRLINFAHGDVYMV
FT                   GAYVGFFATTQGWGFLPSLIISMVVCAILGVVIERLAYKPLRGAPKIAVLITAIGVSFF
FT                   LENGGVLAVGAKIRTFPNVFQEVQYHFFNGSVVITNRQIVIMVVTVLLMLLLQYIVHYT
FT                   KTGKAMRAVSHDTQAAMLMGINVDNTISATFAIGSSLAAAAGVLVGIYYNAINPYMGIM
FT                   PGLKAFVAAVVGGIGVIPGAFVGGLSLGVIEALVSGYGQSLYRDAVAFALLIIILIVKP
FT                   SGLFGSNVREKV"
FT   gene            complement(300997..302190)
FT                   /locus_tag="HM1_0490"
FT   CDS_pept        complement(300997..302190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0490"
FT                   /product="branched chain amino acid abc transporter, amino
FT                   acid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83104"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFK5"
FT                   /protein_id="ABZ83104.1"
FT                   /translation="MRWKKSVVTAVSLVVTASLLTACSGGGNKDTAANAPAANEFVIGG
FT                   NFELSGGQATFGKAAVNGAKMVFDKVNAEGGINGKKIRFVVLDNKSEATESTNVATKLI
FT                   NSEKAVAILGCTTSGDTLGMVQLAMDKKIPVLSTSATNPKVTVDENTKKTNDFIFRACF
FT                   IDPFQGTVMANFTLNNLKLKTAAVLTDNQAPYSKGLAQFFKESFVKGGGEIVADEGYVT
FT                   GDQDFKATLTKIRGKNPDVLYVPGYYEEVGKIVKQARELGMTMPIMGGDGWDSPKLTEI
FT                   AGAAALNNTFFSNHYSSEDTDPLVVDFVKRYKELYGEVPDSMAVLGYDGALIMVDALKR
FT                   AGEPNPLKIKEALAATKDVQTVTGKISYDEQHNPIKAAAIIEMKDGKQTFKDKVAPK"
FT   gene            complement(302618..303802)
FT                   /locus_tag="HM1_0489"
FT   CDS_pept        complement(302618..303802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0489"
FT                   /product="branched-chain amino acid abc transporter, amino
FT                   acid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83103"
FT                   /db_xref="GOA:B0TFK4"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFK4"
FT                   /protein_id="ABZ83103.1"
FT                   /translation="MGKSRWLKGLGVVLSLALLAGCSGQSKEAKAPGQAGDEILIGANF
FT                   ELSGDVATYGTSSLNSAMLYFDEVNAKGGINGKKIKVIKYDNKSDKAESLSVVTRLVTQ
FT                   DKVSAVIGPVTSGNTLSVVSFADDKKVPVITPTATNPDVTVDPKTGKVHEYVFRTCFLD
FT                   SFQGKAAAEFALKKGAKNAVILVSQADEYSKGLGKFFKEAFTAGGGVIVSEEAFDKNDN
FT                   DYRAILTKVKGKNPDVIYLPAYYEAVGKIVKQARGLGITATFVGSDGWDSPKLVEVAGK
FT                   DNLNNCFFTNHYTPEDPDPAVQAFVKAYKEKYGQVPDALDALAYDGARLLVDAIQRAGS
FT                   AEPEKIKEALAATKDFPAVTGTFTLNENHDPVKDIVIVELKEGVQTVNAKIKAQ"
FT   gene            complement(303924..304088)
FT                   /locus_tag="HM1_0488"
FT   CDS_pept        complement(303924..304088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0488"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83102"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFK3"
FT                   /protein_id="ABZ83102.1"
FT                   /translation="MMTVGTFRHVGGIFGKQQGETDRKRSAPRKAMTIVKLVSNAFIHQ
FT                   FLPFTAFLT"
FT   gene            complement(304135..304884)
FT                   /locus_tag="HM1_0487"
FT   CDS_pept        complement(304135..304884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0487"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83101"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFK2"
FT                   /protein_id="ABZ83101.1"
FT                   /translation="MTGFSNEVATREKALQRLDEEYRRYRQALEAAFTLAETMMQKALE
FT                   PVRTELQTIRERLESMPTMPDIPQIPGQGILTDLSERAPDLAAPGSAENSGGAARRPRS
FT                   RKKEKSEEKAKTPRIRWGTTDEEIRHTVFAQLRSLEEKGKDITITTIKAEVPSMMRYVY
FT                   GEKALFKGIGELLEEYRSEGVKQASSPAASQVIELPSRKDGSDFDGPEPDPAPMSAPTV
FT                   TVESEAALFQPELPVTPVGSLLDLSKV"
FT   gene            complement(305160..307004)
FT                   /gene="asnB"
FT                   /locus_tag="HM1_0486"
FT   CDS_pept        complement(305160..307004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnB"
FT                   /locus_tag="HM1_0486"
FT                   /product="asparagine synthase (glutamine-hydrolyzing)"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83100"
FT                   /db_xref="GOA:B0TFK1"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFK1"
FT                   /protein_id="ABZ83100.1"
FT                   /translation="MCGIVGWVDWEADLSQQGTILDAMVETLTHRGPDASGTWISPQAL
FT                   IGHRRLSVVDRIGGVQPMIREVGGRRYVLTYNGELYNTPELRQELEVRGHRFRTRSDTE
FT                   ALLLAFIEWGEDCVQKLNGIFAFGVWDETERRLFLARDRMGVKPLFYVRRGSALLFASE
FT                   LKALLAHPDIRPELDAEGLAEVFAIAPARTPGHGVFKGIQEVRPGYTLTIDAASMRKKP
FT                   YWTLKSRPHEDNLEQTTERLRELLLDAIERQLVSDVPVCTLLSGGLDSSTLTAVAAHVY
FT                   ARDGLGPLNTYSIDYRDNDIYFKPSAFQPNADAPWIKRVSAHLGTVHHDVIIDTPELVD
FT                   ALRPALWARDLPGMADVESSLYLFCREIKKGATVALSGECADEVFGGYPWFHRPELLNV
FT                   GTFPWSRRLAERADLLAPEMRQYIQPEAYVARRYEETLAEVPRLPGEDAEEARRREMFY
FT                   LNIHWFMATLLDRKDRMSMAHGLEVRVPFCDHRIVEYVWNIPWAMKTCEGREKGLLRRA
FT                   LRGILPEDVLWRKKSPYPKTHHPAYTAAVRQWLTEILHDPASPLLPIIDVEKVRALAAA
FT                   DAVTTDLPWFGQLMGLPQLYAYLAQVDLWLRTMQISIR"
FT   gene            complement(307215..307355)
FT                   /locus_tag="HM1_0485"
FT   CDS_pept        complement(307215..307355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0485"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83099"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFK0"
FT                   /protein_id="ABZ83099.1"
FT                   /translation="MLGHPGQRLFIPFARVLGDHLFLFIDPLVGRMPTILLGVYQGNIH
FT                   P"
FT   gene            307406..307552
FT                   /locus_tag="HM1_0484"
FT   CDS_pept        307406..307552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0484"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83098"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFJ9"
FT                   /protein_id="ABZ83098.1"
FT                   /translation="MYWRSERFGRSGVVNAACEAEQRAIDMQKNPRVLARQRSNQAEQT
FT                   RSP"
FT   gene            complement(307600..310752)
FT                   /locus_tag="HM1_0483"
FT   CDS_pept        complement(307600..310752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0483"
FT                   /product="acriflavin resistance protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83097"
FT                   /db_xref="GOA:B0TFJ8"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFJ8"
FT                   /protein_id="ABZ83097.1"
FT                   /translation="MRITELALKRPAMMTMVALFFVVIGLYSYRSIGVELYPALNTPFV
FT                   TVSAAYPGAGAEEIETQVVKPLEEGLSSLAGLKKLTSVSVEGRATILIEFELTADANQA
FT                   AIDVQKKVDSIKGRLPEDVKDPVVIKRDMNALPVAAIAFSSSRPLYEANEMAKDLIKER
FT                   LQKIPGVAEVTISGGQEREIQINIDRTKLERYGLSINQVIRRLDSENLNEPSGRLDRPE
FT                   AEYMVRVLGQFRSVEEIRNLEIPMANGKSIALREIADVSDTYKELREYTRLNGQPALAL
FT                   MVFKQSDASLVDVGDRVKKEIDSLKKELPGDTQLIIARDFSQYIRLSVNGTRANILEGI
FT                   LTTSVALLFFLRDWRSMVSVLIAIPVSLISTLAGMYFAGFTFNVMSLMGMAMCIGILVD
FT                   DSIVVLENIHRHLAMGKSPKQAALDGRSEIGMAAIAITLSDVVVFAPIAFMSGMVGQFF
FT                   RQFGLTVVFATLMSLFVSFTLTPLLASRLMKPRGGGAKLHPLAGVSWYQAACIFAPVDR
FT                   YAARFRDRYLRILEWSFRHRKQVIAAGVLFFFASAALVPLKLIGFEFAPRTDQGDITVN
FT                   VELPIGTPIQKTDQALKTIESYLQTIPEIRYFQTSLGSTGGIGMGSAGSNIGRIGVSLV
FT                   NKRERKRSVWDVSEQIRQWAVNFPDGRITVTESDSMASGSGYPVQIEVSGSDPKTLLTA
FT                   VDDIKAIVAATAGSRDTDSNWRVGQPEIQISIDRLKAAYMGVSVKDISETLRASLNGNV
FT                   STKYRVGDKEYDVTVRINRLNKSDLDALRTLTLTNNAGLPVQLQQVARIGIGVGPTEIR
FT                   RADRQRTITISAGLQGRVLDDFLKEVDSKIKAKGLPQGVSYRFTGSAQSMQDSFRELVA
FT                   ALALSIVLVYMVLVMLYESYMTPFIRMLSLPLGIAGALIALAVTKNSLNIFSLIGIIMM
FT                   DGLVAKNGTLLIDYTHTLRERGRSLKEALIEAGQTRLRPIIMTTVTMVFGMLPSALALT
FT                   EGSETRSSMAVVLIGGLLSSTLFTLIIIPVVYTLMEDWKEGLRRRWGKVKERLYSQGGA
FT                   SA"
FT   gene            310961..313081
FT                   /gene="oorA"
FT                   /locus_tag="HM1_0482"
FT   CDS_pept        310961..313081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oorA"
FT                   /locus_tag="HM1_0482"
FT                   /product="2-oxoacid:ferredoxin oxidoreductase, alpha
FT                   subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83096"
FT                   /db_xref="GOA:B0TFJ7"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR017721"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFJ7"
FT                   /protein_id="ABZ83096.1"
FT                   /translation="MNRLAEPPRRLLMGNEAIAWGAIEAGVRVVAAYPGTPSTEVTEKI
FT                   LEHAADYGIYAEWSVNEKVALETAIAASWAGARAMACMKQVGLNVASDPLMTLAYLGVK
FT                   GGLVLIVADDPGPHSSQTEQDTRLFARFAKLPVLDPATPEEAREMVKAAFRLSEDLQVP
FT                   VIVRPTTRTAHVCQDMSFSPPPLPALPLPPVRFERDPGWVILPSLSAKRHRRLNAIQDE
FT                   MRRWFLQHRLNGIAPLCGEDGTAGCTGNCSEDTGNVKNAGYAGHSGKAVEDLAIVAGGV
FT                   AYSYVQEGLAILGVSIPVYKVGAPVPLPSAPILDFLGNKKSVLIVEEQEPVIEEQLTVE
FT                   AYRTGLCLSIIGKNSGHLPREGEFSTDLLLPLLRRFVTGSIHCDRTPAASASPAPLTPV
FT                   GQPGSAPAISTGSAVAPAPVSAHSLPAPPLRTPILCAGCPHRNSFYAFIQAARSRDALF
FT                   TGDIGCYTLGAMPPLGAADTIICMGASVAMAAGFSHIEPDRPHIAFLGDSTFFHSGIPP
FT                   LINAVYQQARMTLVVLDNRTTAMTGHQPHPGLGRKGTGEIAPTIDIAAVARGCGVEWVR
FT                   TVDPYDIAATIAAAREALDYPGVSVIIARRDCVNLARRSTPYRIDAEACRRCGICLHKF
FT                   GCPALYEVKPADKASAALSEKNLSVEGAGAPTTDTGQGGKPAVAIAREKCFGCGACAQI
FT                   CPWKAISPEVAS"
FT   gene            313078..313692
FT                   /gene="oorB"
FT                   /locus_tag="HM1_0481"
FT   CDS_pept        313078..313692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oorB"
FT                   /locus_tag="HM1_0481"
FT                   /product="2-oxoacid:ferredoxin oxidoreductase, beta
FT                   subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83095"
FT                   /db_xref="GOA:B0TFJ6"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFJ6"
FT                   /protein_id="ABZ83095.1"
FT                   /translation="MKTFNLIITGVGGQGGVLASRLFAEAALAAGYKVRTSETIGMAQR
FT                   EGSVISHVRVGERLWSALIPDGAADVLISLELAEGLKGWTKVAPHGRAIINRRPIIPPA
FT                   ASLGLTRYDEGAIIEFLQQQGQRVHLIDATAAALETGNAKTTNMVMLGALSTLPGLPVT
FT                   ADMLWQAAEALLPARLREINRQAFLTGRSLGSCAGTSPLVS"
FT   gene            313892..315214
FT                   /gene="paaK"
FT                   /locus_tag="HM1_0480"
FT   CDS_pept        313892..315214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="paaK"
FT                   /locus_tag="HM1_0480"
FT                   /product="phenylacetate-coa ligase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83094"
FT                   /db_xref="GOA:B0TFJ5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011880"
FT                   /db_xref="InterPro:IPR028154"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFJ5"
FT                   /protein_id="ABZ83094.1"
FT                   /translation="MTPSAVACERTEMRRPIDFDAIAQSQFPLLVQTIRRAYQMSPFYR
FT                   ERFQAAGIAPDHIRSMDDLARLPFTTKQDLRQAYPLGLMAVNEEEVVRIHSSSGTTGKP
FT                   VIVPYTRKDVDDWAVMMARCLKTVGVSRRDRVQVTPGYGLWTAGIGFQAGVEKLGAMTI
FT                   PTGPGNTDKQLEMMTDLKASVLIGTSSYGLLLAEEAERRGILEAIQLRIGIFGSERWGD
FT                   KMRRRIEEIFGIETFDIYGLTEIYGPGIAIDCPCHEGLHFWSDYLIFEVIDPETGHVLP
FT                   PGQEGELVITTIAKEGMPLIRYRTRDITTIETYACSCGSPFPMIRRVLGRTDDMIKIKG
FT                   VNIYPGQIDHVLKHTPGVSSEYQIVLERVDNKDHIRIRVELSNGHEPEDVARACRKNIK
FT                   SVIGIVADVEVLPHGGLPRSEKKTRRVFDHRYDYLENPPKA"
FT   gene            315284..316375
FT                   /locus_tag="HM1_0478"
FT   CDS_pept        315284..316375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0478"
FT                   /product="spore germination protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83093"
FT                   /db_xref="GOA:B0TFJ4"
FT                   /db_xref="InterPro:IPR004761"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFJ4"
FT                   /protein_id="ABZ83093.1"
FT                   /translation="MRKELISSTQVFALATIFLLGSWIILTPSSRITKQDAWIGSLLLG
FT                   LPACGYALLLSAVKDLYPGENLIGLSRKAFGQRIGSILAVFWLWFPLHLAALVLNNLTS
FT                   LLMYQIYPTASAITLSLPLIIVIAYSAALGPEVIARFALILLPLIIAGLLAIYGLAIPL
FT                   FDAHHLFPLLEASTGDFLRQGLAGFSFPFAEMILLFPFLAHAPKDRSLLRPLLSAVILS
FT                   TLLFALRDMIAIAVFGQAEVDTLLFPLFSVVLHEELGIFLDRLDVAFIPVFFFSSLIKG
FT                   MICFYSFIEHLTDWLGAKERSLLIPPAALLTVGLSLFVYEHLLDVFDFANKAYALYLLP
FT                   WALGFPLGALILRYRKKVKPSQS"
FT   gene            complement(316342..316584)
FT                   /locus_tag="HM1_0479"
FT   CDS_pept        complement(316342..316584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0479"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83092"
FT                   /db_xref="GOA:B0TFJ3"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFJ3"
FT                   /protein_id="ABZ83092.1"
FT                   /translation="MIILLLGIAGLLLLVQGTSLEKAPWKMKAAYLFMLVTGVYYTLIG
FT                   SQMGEPLLHPTRWIGQWYMPMGERLYDWLGFTFFR"
FT   gene            complement(316581..317792)
FT                   /locus_tag="HM1_0477"
FT   CDS_pept        complement(316581..317792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0477"
FT                   /product="spore germination protein"
FT                   /note="Member of spore germination B3/ GerAC like,
FT                   C-terminal, PF05504"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83091"
FT                   /db_xref="GOA:B0TFJ2"
FT                   /db_xref="InterPro:IPR008844"
FT                   /db_xref="InterPro:IPR038501"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFJ2"
FT                   /protein_id="ABZ83091.1"
FT                   /translation="MGPVLLLAVLLAPLFAGCGGKQELDRVAFIIAVGIDKVEEGRFRL
FT                   TAQFFKAPARIGVESEKMNPYWLVSAEGESMMDASLKLRRRVDGPISWHQARTYIIGEE
FT                   TAKEGMKEIVDFLVRNIEVRKGANMAIVEGSARDYMVLSPEFEMNIAQETWRMIENYRE
FT                   WGGTMRLRMSEFIQASYEPQRGVLFPYLRKDKPTPVESTGTQKERLASYAVPAVSGGAM
FT                   VRDFRMRGQLNEEETRGFLLVRAKEKAVAPVLVDCMDEEVGRQATVILSSIRRRIDVVD
FT                   QGGIPAFQIEITASGKLMEYHCETPLVKDRVKQLEAMTSEKARRYVLAAWKQAQQSETD
FT                   LFELSRELKAFYPEIWSKEKEQWSQRLREIALDVNVSVRLSNVGTIDKGVISENQKAKQ
FT                   GDEE"
FT   gene            complement(317812..319494)
FT                   /gene="gerAA"
FT                   /locus_tag="HM1_0476"
FT   CDS_pept        complement(317812..319494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerAA"
FT                   /locus_tag="HM1_0476"
FT                   /product="spore germination protein ka/spore germination
FT                   protein aa"
FT                   /note="Also known by the gene symbol of gerKA"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83090"
FT                   /db_xref="GOA:B0TFJ1"
FT                   /db_xref="InterPro:IPR004995"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFJ1"
FT                   /protein_id="ABZ83090.1"
FT                   /translation="MESWVRWSKVQQKKRQPLRSERVLTDIEKNIQKLRADFERSDDLR
FT                   IRRLHVDMDGQSIPVALAFLVSVTDMHRLDRIILSLQRDRLSADIMPTAPLDRRKRFAE
FT                   ELLAGGSVFAITHWNKAMKELLFGAALLFVEGAAVTYALRIPKKSGRSPEEPQAEQVVR
FT                   GPHYGFVEDLYENIALVRRRINSRSLKVEVAEVGRLSLTKIALLYIEGVIDQRVLAEVK
FT                   ERLAHIDIDEVASSNTIEEWIEDHPISILPQIAHTERPDVAASALANGRFAILVDGSPS
FT                   ILIAPTTFIEFFHSPEDQYERYYFSSFTRILRYIGAFFSLTLPSIYVALTTFHPEMLPS
FT                   LLLFSIASSRAGIPFPALMEALIMESIFELLREAGLRLPRSVGQAVSIVGALVIGEGAV
FT                   RAGLVSQAMVIVVAITGITSFAIPAFNQAQAFRMIRFLLLLLGGTFGVLGLLCGLSILL
FT                   LHLCAIRSFGVPYLSPLSPLEPLALRSKLLRFPFWTMTKREDYLAPSHNIRRIGKSAGR
FT                   RRMAWMAPEIDSLPADKRRPFRPLRQMVRSPKGSVEGRRDGDQ"
FT   gene            complement(319665..320282)
FT                   /locus_tag="HM1_0475"
FT   CDS_pept        complement(319665..320282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0475"
FT                   /product="GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83089"
FT                   /db_xref="GOA:B0TFJ0"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TFJ0"
FT                   /protein_id="ABZ83089.1"
FT                   /translation="MKIKEAEFVISAVKGEQYPEDNLPEVALVGRSNVGKSSLINKLCN
FT                   RRHLARTSSTPGKTQTLNFYRINQAAYIVDLPGYGYASVSKTQRASWGPMMEHYLKKRL
FT                   QLRGVIQLVDIRHPPTKDDIAMREWLNHFKIGAAVIATKADKINRGRYAKHVKQIRQDL
FT                   AIPKEIPIIVFSAETGHGKEDVLDLLDYFWNGIQPEEEREIL"
FT   gene            complement(320497..322938)
FT                   /gene="lonA"
FT                   /locus_tag="HM1_0474"
FT   CDS_pept        complement(320497..322938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lonA"
FT                   /locus_tag="HM1_0474"
FT                   /product="ATP-dependent protease la"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83088"
FT                   /db_xref="GOA:B0TFI9"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TFI9"
FT                   /protein_id="ABZ83088.1"
FT                   /translation="MAEEEKIRQTIQELPLLPLRGIIVFPYMVMHLDVGRERSVNAIEE
FT                   AMAQDRIIFLATQKEAQTDQPGAEDIYQIGVIAEIKQLLKLPGGTIRVLVEGLARAEIL
FT                   EYIDMEPLIRVRVREHIEPDVKSNAVEALMRSLINQFEQYVKISKKIPPETFVSVVAVE
FT                   DPGRLTDTISSHLTLKTQDKQRILEALDVTERLEILTEILAREMEILELERKINVRVRK
FT                   QMEKTQKEYYLREQIKAIQKELGEKEDRQAEGEDLRNKIAKAKLPKEVEEKALREVERL
FT                   EKMPPMVAEATVVRNYLDWLLALPWAKQTKDRLDIDKAEAILNEDHFGLDKVKERIIEY
FT                   LAIRKLAQKMKGPIICFVGPPGVGKTSLARSIARALERKFVRLSLGGVRDEAEIRGHRR
FT                   TYVGAMPGRLIQGLRTAGSKNPVFLLDEIDKMSMDFRGDPASALLEVLDPEQNSTFSDH
FT                   FIEVPFDLSKVLFITTANGMHNIPRPLLDRMEVIYIPGYTEEEKTRIALDHLVPKQLKE
FT                   HGLKKEQVQISENTVRRLIREYTREAGVRNLEREIASLCRKSARAIVKNPERRLSISAG
FT                   NLPSYLGIPRFRYGLAEAESQVGVATGLAWTETGGDTLAIEVAHMPGKGNLALTGKLGD
FT                   VMKESAQASLTYVRSRARELGIADNFHQNTDIHIHVPEGAIPKDGPSAGITIATALTSA
FT                   LSRRPVRREVAMTGEITLRGRVLPVGGIKEKMLAANRAGCTTVILPAENKKDLEEVPAN
FT                   VKKKLRFVLVEHMDQVIREALLEPVPVQAPEPPETIPAAIETSVPVYQGMLEETPPGLQ
FT                   T"
FT   gene            complement(323067..324758)
FT                   /gene="lonB"
FT                   /locus_tag="HM1_0473"
FT   CDS_pept        complement(323067..324758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lonB"
FT                   /locus_tag="HM1_0473"
FT                   /product="ATP-dependent protease lonb, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83087"
FT                   /db_xref="GOA:B0TFI8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014251"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFI8"
FT                   /protein_id="ABZ83087.1"
FT                   /translation="MGGLLGLLQIFFIIIIGMYFWHLLKNQQSSKLAVERESRKEVEKL
FT                   QMMRRIALTEPLAEKTRPTTFEEIIGQDDGIRALKAALCGPNPQHVIIYGPPGVGKTAA
FT                   ARLVLEEAKKNPLSPFSVQAKFIEIDGATARFDERGIADPLIGSVHDPIYQGAGALGMA
FT                   GIPQPKPGAVTKAHGGVLFIDEVGELHPIQINKLLKVLEDRKVLLESAYYSSEDQNIPS
FT                   HIHDIFQKGLPADFRLIGATTRLPQEIPSAIRSRCLEVFFRPLTQEEIGAVACRAAKKM
FT                   DMAIPEKAVEVIRRYATNGREAVNIVQISAGLALARGVNVLSVEDVEWVVHSGQYTPRP
FT                   EKKIPPEPQVGVVNGLAVMGPSLGALMEIEVTALPVSPGAGTLTLTGIVDEEEMGGLGG
FT                   RTMKRRSLVKTSVDNVLTVLRAQKGIEPRDWDIHVNFPGGTPIDGPSAGIAIATAIYSA
FT                   VKGVAIDNRLAMTGELSVRGRVKPVGGIVTKVEAARLAGATRVLIPAENWLERFSSIPG
FT                   ISVIPLHTMEQVFAEALLTDSSVVETSVAPAADLLSAAAVGAAPPP"
FT   gene            complement(325005..326267)
FT                   /gene="clpX"
FT                   /locus_tag="HM1_0472"
FT   CDS_pept        complement(325005..326267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpX"
FT                   /locus_tag="HM1_0472"
FT                   /product="ATP-dependent clp protease, ATP-binding subunit
FT                   clpx"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83086"
FT                   /db_xref="GOA:B0TFI7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TFI7"
FT                   /protein_id="ABZ83086.1"
FT                   /translation="MYKGFGDDKSQLKCSFCGKLQDQVKKLVAGPGVYICDECIELCNE
FT                   IIEEELQDENTFDLGDVPKPKEIREILDQYVIGQEQAKKALSVAVYNHYKRINLGSKID
FT                   DIELQKSNIIMLGPTGSGKTLLAQTLARILNVPFAIADATSLTEAGYVGEDVENILLKL
FT                   IQAADYDVEKAEKGIVYIDEIDKIARKSENPSITRDVSGEGVQQALLKILEGTVASVPP
FT                   QGGRKHPHQEFIQLDTTNILFICGGAFDGIEKLIMNRIGKKTMGFNADIKGKQEKKIGE
FT                   TLREILPVDLLKFGLIPEFVGRLPVIVTLDALDEDALVRILTEPKNALVKQYQKFFELD
FT                   QVQLEFTDDALRAIAQEAIKRNTGARGLRAILEEVMLDVMYDIPSRNDVTKCAVTKEVI
FT                   LKQKEPVLVTSDRKKKKEESA"
FT   gene            complement(326285..326884)
FT                   /gene="clpP"
FT                   /locus_tag="HM1_0471"
FT   CDS_pept        complement(326285..326884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /locus_tag="HM1_0471"
FT                   /product="ATP-dependent clp protease proteolytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83085"
FT                   /db_xref="GOA:B0TFI6"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFI6"
FT                   /protein_id="ABZ83085.1"
FT                   /translation="MSYLVPMVVEQTNRGERAYDIYSRLLKDRIIILGSAIDDNVANLI
FT                   IAQLLFLEAEDPDKDIHLYINSPGGAITSGFAIYDTMQLIRCDVSTICVGMAASMGAFL
FT                   LAAGAKGKRYASPNAEIMIHQPLGGVKGQATEIEIHARHILKTRDRLNKILADRTGQPL
FT                   ERIERDTDRDYFMSAEEAKAYGIIDGVMEFKSPAKA"
FT   gene            complement(326955..328340)
FT                   /gene="tig"
FT                   /locus_tag="HM1_0470"
FT   CDS_pept        complement(326955..328340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tig"
FT                   /locus_tag="HM1_0470"
FT                   /product="trigger factor"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83084"
FT                   /db_xref="GOA:B0TFI5"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFI5"
FT                   /protein_id="ABZ83084.1"
FT                   /translation="MLFKFSDRLVEVDPADDSQIYDTIDERGTYVKASVERLENNQVSL
FT                   QIEIDEATFEQGLEKAYKKVVRQVAVPGFRKGKTPRKILEARYGKEILFEDAVEFIVPD
FT                   AYKQAIAEHNVEPVEQPKIDVIQIEAGKPLIFKALVTVKPEVVLGEYKGIEVEVQPVEV
FT                   REEDVQRQLETMQKRHARLITLTEGEAQMGDTAVIDFEGFKDGLSFPGGKGTDHPLELG
FT                   SNTFIPGFEEGLVGVSVGETVDLHLTFPEQYHVEELAGQPVLFKVTVKELKRKEYAPID
FT                   DEFAKDVSDFETLDELKEDIRKNLMSAAEKAREQAKRNAVVEKVVGASQVDIPMVMIDS
FT                   RVDQMLEEYGHRLRYQGISMEQFLAMTKQTQKDLKAQFIPEAEKVVKEELVLEAVAKAE
FT                   GMSVSDEELNKEIEEMAANYRKPADQIRKILESRGQIDALTEGILLKKAAKFLVDSAKE
FT                   IAG"
FT   gene            complement(328519..328601)
FT                   /locus_tag="HM1_0469"
FT   tRNA            complement(328519..328601)
FT                   /locus_tag="HM1_0469"
FT                   /product="tRNA-Leu"
FT   gene            complement(328667..328743)
FT                   /locus_tag="HM1_0468"
FT   tRNA            complement(328667..328743)
FT                   /locus_tag="HM1_0468"
FT                   /product="tRNA-Arg"
FT   gene            complement(328804..328880)
FT                   /locus_tag="HM1_0467"
FT   tRNA            complement(328804..328880)
FT                   /locus_tag="HM1_0467"
FT                   /product="tRNA-Pro"
FT   gene            complement(329449..330090)
FT                   /gene="rdgB"
FT                   /locus_tag="HM1_0466"
FT   CDS_pept        complement(329449..330090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rdgB"
FT                   /locus_tag="HM1_0466"
FT                   /product="non-canonical purine ntp pyrophosphatase, rdgb,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83083"
FT                   /db_xref="GOA:B0TFI4"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFI4"
FT                   /protein_id="ABZ83083.1"
FT                   /translation="MYNIILATQNMGKVREFEAMTRAQTPALPIRWLSLRDFPQITELK
FT                   ETGDTFRDNALMKAEQVARACGVPAMADDSGLVVDALNGAPGVYSARFAGEPKDDRRNN
FT                   EKLLKLLQEVPFEQRKARFVCVLALAMPDGQKFFAEGVCDGVIATEGRGDGGFGYDPLF
FT                   YLPAYEKTFAELPAELKNKISHRASAMEKMFFLLRVLLFPEPEPIRRPNL"
FT   gene            complement(330311..331042)
FT                   /gene="rph"
FT                   /locus_tag="HM1_0465"
FT   CDS_pept        complement(330311..331042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rph"
FT                   /locus_tag="HM1_0465"
FT                   /product="ribonuclease ph"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83082"
FT                   /db_xref="GOA:B0TFI3"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFI3"
FT                   /protein_id="ABZ83082.1"
FT                   /translation="MERVDGRQADQLRPVQIQRQYLIHPEGSVLITVGNTKVICTATVE
FT                   EKVPPFQKGSGKGWVTAEYGMLPRATGTRTQREVTRGKATGRTMEIQRLIGRALRSVVD
FT                   LQRLGERTIWIDCDVIQADGGTRTASITGAFVALKDACRRLLKNKQIQKDPIIEALAAV
FT                   SVGKVAGELLLDLAYEEDAKAEVDMNVVMTAGGRFVELQGTAEGTPFGRDELDAMLRLA
FT                   EKGICELIEAQNQALAESAQA"
FT   gene            complement(331102..331656)
FT                   /gene="fumB"
FT                   /locus_tag="HM1_0464"
FT   CDS_pept        complement(331102..331656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fumB"
FT                   /locus_tag="HM1_0464"
FT                   /product="fumarate hydratase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83081"
FT                   /db_xref="GOA:B0TFI2"
FT                   /db_xref="InterPro:IPR004647"
FT                   /db_xref="InterPro:IPR036660"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFI2"
FT                   /protein_id="ABZ83081.1"
FT                   /translation="MKAVRLTTPLTQEVLRQLKAGDTVLISGTIYTGRDAAHKRLVETL
FT                   DRGEDLPFNVKDAVIYFVGPCPAKPGQVIGSAGPTSSYRMDTYSPRLIEQGLTGMIGKG
FT                   LRGPAVVDAMKKHGCVYFVAIGGAGALMARSIKEAKVIAYDDLGTEAVRELVVEDFPVI
FT                   VCIDAEGNNLYEQGRAQYQRA"
FT   gene            complement(331688..332536)
FT                   /gene="ttdA"
FT                   /locus_tag="HM1_0463"
FT   CDS_pept        complement(331688..332536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ttdA"
FT                   /locus_tag="HM1_0463"
FT                   /product="tartrate dehydratase alpha subunit/fumarate
FT                   hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83080"
FT                   /db_xref="GOA:B0TFI1"
FT                   /db_xref="InterPro:IPR004646"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFI1"
FT                   /protein_id="ABZ83080.1"
FT                   /translation="MPGLRTITFEQIASAVEGLCIKANTQIGADVKEALEKAHAAEESP
FT                   LGKTIIGHIMENNAIAENEMVPICQDTGMTVVFVTIGQEVFVEGGLTDAINEGVRRGYE
FT                   KGYLRKSVVKDPLIRVNTGDNTPAVIHYDIVPGDKLHIMVAPKGFGSENMSQLKMFKPA
FT                   DGVEAIKKFVIEAVEKAGPNPCPPIVVGVGIGGTMEKASFLAKKALLRHIGHHSDKAHI
FT                   AALEKELLEKINNLGIGPQGLGGRTTALAVNVETYPTHIAGLPCAVNINCHVARHSETE
FT                   L"
FT   gene            complement(332741..333484)
FT                   /gene="hgdC"
FT                   /locus_tag="HM1_0462"
FT   CDS_pept        complement(332741..333484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hgdC"
FT                   /locus_tag="HM1_0462"
FT                   /product="activator of (r)-2-hydroxyglutaryl-coa
FT                   dehydratase domain protein"
FT                   /note="Synonym: 2-hydroxyglutaryl-CoA dehydratase component
FT                   A"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83079"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="InterPro:IPR008275"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFI0"
FT                   /protein_id="ABZ83079.1"
FT                   /translation="MKIGLDLGSRYVKAVFMEDGRLVDYRCYDTLAFYREYGRKVDGEL
FT                   VVDYERLGWPTGAAITSTGYGRNLVKLAGGQVIPELRAHTRGAIFQTGLSDFTLLDLGG
FT                   QDSKVIKVAGGRMVDFRTNDKCAASSGRYLENMAAVLAMDVAALGECRDEPVELSSTCA
FT                   VFGESELIGQIIEGHPIEHLAAGVNRTIVKRVEPMLRELYSPVVVFTGGVARNQAIRAM
FT                   LEDALPVQVILPAYPQLNGAIGCAV"
FT   gene            complement(333625..334623)
FT                   /locus_tag="HM1_0461"
FT   CDS_pept        complement(333625..334623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0461"
FT                   /product="2-hydroxyglutaryl-coa dehydratase subunit,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83078"
FT                   /db_xref="InterPro:IPR010327"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFH9"
FT                   /protein_id="ABZ83078.1"
FT                   /translation="MADKIGLTTTIPVEIVYAAGKIPVDLNNLFITCDAPGRLVDRAEQ
FT                   AGYPRNICGWIKGLYTTLLEQESLRQVIAVTQGDCSNTHALMETWQVAGVAVIPFAFPY
FT                   DRDADLLRLQMEKLMQLLGADWEAVGRWKKRLDQVRKKAHEIDRLTWEAGVVDGQTNHL
FT                   ALVGCSDFNGDPDAYEAYLDGIIAEAARNSTQGLAGDRQAVRLAYVGVPPIVSDLYSYV
FT                   ESMGARVVFNEVQRQFAMPFDEDDIIEQYRRYTYPYSIFDRIDDINREVARRRVDGIIH
FT                   YTQSFCYRQIEDIILRQRTAVPVLTLEGDRPGPLDARSRMRIDAFLDMLAR"
FT   gene            complement(334753..335607)
FT                   /gene="murI"
FT                   /locus_tag="HM1_0460"
FT   CDS_pept        complement(334753..335607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murI"
FT                   /locus_tag="HM1_0460"
FT                   /product="glutamate racemase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83077"
FT                   /db_xref="GOA:B0TFH8"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFH8"
FT                   /protein_id="ABZ83077.1"
FT                   /translation="MQRCQPIGIFDSGVGGLTVAREVFRQMPGEEILYFADTAHVPYGP
FT                   RPASELIRFALEITDFLVAEGAKLILVACNTSSSLALDIIRERHKVPVVGVVDPGAEEA
FT                   VRLSRNGRIGVLATEATIRKGAHSRRVGELNSAMQVFGQACPRFVPLVESGRYSGDEAR
FT                   AASKQYLAPLIEAGVDTIVLGCTHYPFLEPVIREVIGEKITLIDPACQTVAQGKALMER
FT                   GIIPFRDPRGPKPRHRFYVSGDPVSFARVGGALLGVPLDNDTRQVCLDGILEREWNQKV
FT                   VFA"
FT   gene            complement(335670..335786)
FT                   /locus_tag="HM1_0459"
FT   CDS_pept        complement(335670..335786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0459"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83076"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFH7"
FT                   /protein_id="ABZ83076.1"
FT                   /translation="MVLAVHPALRERWTWCAFLKNLSEGEPFFSAGIFYVMV"
FT   gene            complement(335966..336694)
FT                   /locus_tag="HM1_0458"
FT   CDS_pept        complement(335966..336694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0458"
FT                   /product="spore germination protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83075"
FT                   /db_xref="InterPro:IPR019606"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFH6"
FT                   /protein_id="ABZ83075.1"
FT                   /translation="MDRERSWSAGIILVVTALVIAFGLGGCSAVDRFISMKDDFKAKET
FT                   GAAKQEQLGKNEQPVTQGQALPVDGQATVDPPPGPEQAIMLYFADAKGQNLVVERRSIP
FT                   KTGSIAKAAVNELIKGPSIHSGALPTIPTGTRLIDINIKDGLCTVNLSKELQKNHQGGS
FT                   ASEALTVYSIVNTLTQFQAIQKVQLLVEGKKIETLAGHMDVSQAMARKNSMIAKEGETA
FT                   QKASGETQKGGADEAEKKNH"
FT   gene            complement(336797..337552)
FT                   /locus_tag="HM1_0457"
FT   CDS_pept        complement(336797..337552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0457"
FT                   /product="zip zinc transporter family protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83074"
FT                   /db_xref="GOA:B0TFH5"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFH5"
FT                   /protein_id="ABZ83074.1"
FT                   /translation="MEDLFPTMIWPMLAISLIAGLATTAGALCLLMLGSLGARTLSALL
FT                   GFAAGVMVSVVVLDLLPTAWNWGGPWSVLTGFCLGALLIALCDVVLTQFALASKRGRQA
FT                   GPLRKMGYLIALGISLHDFPEGIAIAAGTAAEHHLGWVVTLAIGLHNIPEGVATAAPLR
FT                   MSGMAPWKIIGLTMVMAFFTPLGTLLGFGLLALSTKSLAQLLALAGGAMAYLVWDELWP
FT                   EASKRSPRWAITGAIVGALGMAALSGMHH"
FT   gene            337534..337695
FT                   /locus_tag="HM1_0456"
FT   CDS_pept        337534..337695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0456"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83073"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFH4"
FT                   /protein_id="ABZ83073.1"
FT                   /translation="MGKGLPYPFRPSLCLALFINDDRNRFSFLIIINAHSGKNSTAPQK
FT                   KSLPEGCA"
FT   gene            337859..338182
FT                   /locus_tag="HM1_0455"
FT   CDS_pept        337859..338182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0455"
FT                   /product="permease, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83072"
FT                   /db_xref="GOA:B0TFH3"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFH3"
FT                   /protein_id="ABZ83072.1"
FT                   /translation="MSTGLINGLIGIGGGTIVIPTMVFLLGVAQHQAHGTSLAVILPTS
FT                   VASAFVYWWKGHLSWSLFWPIVLTGVAGAYLGARLMNRLSPERLRQLLGIVMIAAGVRL
FT                   LWR"
FT   gene            338173..338538
FT                   /locus_tag="HM1_0454"
FT   CDS_pept        338173..338538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0454"
FT                   /product="permease, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83071"
FT                   /db_xref="GOA:B0TFH2"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFH2"
FT                   /protein_id="ABZ83071.1"
FT                   /translation="MEMISLSVIGFFSGILSGLAVGGGTLLVPALILVLDVPQHQAQAL
FT                   ALTTFLPVSAVALATHFKNGNVRPKLAFLLALGAISGAIGGALLAAHLPGPLLRKIFGL
FT                   FLVAMGGYEIVSKPKKS"
FT   gene            complement(338560..338949)
FT                   /locus_tag="HM1_0453"
FT   CDS_pept        complement(338560..338949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0453"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83070"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFH1"
FT                   /protein_id="ABZ83070.1"
FT                   /translation="MADERILQEFKSLQDGQAQLTQMVADLVRIVGNINAAVEELRQDV
FT                   DFMKQEMGVMRQDIDALRRDIDALRQDMNVMRRDIDSLKVIAVQTQASIDDIRETQEDR
FT                   GNLLDLLALRVSHQEAKLLGMSKKR"
FT   gene            complement(338981..340471)
FT                   /locus_tag="HM1_0452"
FT   CDS_pept        complement(338981..340471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0452"
FT                   /product="dolichyl-phosphate-mannose-protein
FT                   mannosyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83069"
FT                   /db_xref="GOA:B0TFH0"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFH0"
FT                   /protein_id="ABZ83069.1"
FT                   /translation="MGNRRSAWRGFAPWALVAVCLIGLLLRLKGLDSPFVDFHGWRQGD
FT                   TAAVARYFYEREFNLLRPQLPYYGAPPNYAELEFSLVPAIAAGLYYIFGEASWVARTVI
FT                   ILFSLWSLVSVYRIGAHFWGLWPGLVAALTMAVQPFYVYFSRSFQPDVPMLALSLAALA
FT                   DFLAWSREGSRAHAWRGCLWLTLAVLVKPPAAIAYLPLSLWWWSAYRSGQAGSFVVGLA
FT                   YLIAPLAALLIYLQSIHGIAEHPFVSGIALSFMERFWQEGIPVDWYGDVGRGIFFFVCT
FT                   PVFVLPALLGCLRGLFSKERRWIVAWLAGVAAFFLLAGSHVLNNLQYYFLPAVPLAALF
FT                   VGLSTEWLTVSRRGLLRRATAASLALLVLVGGAFLVSASFQRLLPERWLRYQPWTYERW
FT                   YQLDDKVLKVGRALEQITPAEALLLIAEETPRSLFYSRRFGWFIPPEECSAEYLAGVRA
FT                   EGAAYLVWPYEKPPTHLGGLTGEWHPEGFWLFDLGKMF"
FT   gene            complement(340471..340854)
FT                   /locus_tag="HM1_0451"
FT   CDS_pept        complement(340471..340854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0451"
FT                   /product="small multidrug resistance transmembrane protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83068"
FT                   /db_xref="GOA:B0TFG9"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFG9"
FT                   /protein_id="ABZ83068.1"
FT                   /translation="MKNGLGEGIYLILLAVALGAVGQVLLKMGANRLDIRTGPILEVAP
FT                   QVIVQMLKNPLLLGGLLVFGVSSLLWIVSVSKVQLSLAYPLVSLGYVIVLFASWAFLGE
FT                   PVNMIRIGGVLVICFGVVMVAQS"
FT   gene            complement(340835..341611)
FT                   /locus_tag="HM1_0450"
FT   CDS_pept        complement(340835..341611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0450"
FT                   /product="glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83067"
FT                   /db_xref="GOA:B0TFG8"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039528"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFG8"
FT                   /protein_id="ABZ83067.1"
FT                   /translation="MIRRRALALFVLLPAYNEAAALPRLLEKFMPLQARYPKLQIVVVD
FT                   DGSADETAEVAEGFADRLAVTVVRHRRNCGLGCAMNTGLRYVCSHGAADDVVVTMDADD
FT                   THDPGLIPEMLDKINRGADVVIASRYQEGGEQVGLSPLRRILSWGASTLLGWIFGIDGV
FT                   RDYSSGYRAYRIGVLRHAFERFGENFIEASGFQCMAEILLKMRMLNLRFAEVPLVLRYD
FT                   RKAGQSKMPVLETVLQYFFLARKVSRWEVLHEERLG"
FT   gene            complement(341689..342051)
FT                   /locus_tag="HM1_0449"
FT   CDS_pept        complement(341689..342051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0449"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83066"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFG7"
FT                   /protein_id="ABZ83066.1"
FT                   /translation="MGYTFEFTWVLRLPVEELPKEPSQSPGEQLLWRRTHGNIILGFTR
FT                   EGGRMYPVGMPVLIVTNREETIGIGRIQRCEIHALPNGKQTTVVEFSITRKFHEEERRI
FT                   VSGVFKEMYGYLPEGL"
FT   gene            342169..343782
FT                   /locus_tag="HM1_0448"
FT   CDS_pept        342169..343782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0448"
FT                   /product="helicase (snf2 family) protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83065"
FT                   /db_xref="GOA:B0TFG6"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFG6"
FT                   /protein_id="ABZ83065.1"
FT                   /translation="MIIVNYRKKPFKRSVTDTKTALSGSSPGRKTALGRITCLSQLAFE
FT                   PLPHQIDAAWRALYPMGGRAILADEVGLGKTIEAGIFLKELQLRGQLNKTLILTPKNLT
FT                   GQWASEMRNKFGFPCWVNKREYGWHWHPFVVASIDLAKRSPHADIIRQIPYDAVIIDEA
FT                   HRLKNPRSSNYQFARTINSKNLLLLTATPVQNDLKELFHLVDLLRPGYFGNFADFQSAF
FT                   LRGKREPKDPRELQEILSGVLIRHHRETCAVKLPKRHVHLLPIDLTEPERELYNAVIQY
FT                   LRGEFRRRKKNRKSTLSLLILLREICSSSFAALGTIEQMGLEELVPLARRIRQNAKGHV
FT                   VTEFLKQNREKVVIFTEYFQTMDYLSLHLQAAGIPVLVYHGGLGRWTRAMTQHQFQKSD
FT                   VPVLISTESGGEGINLQFCSQVINYDLPWNPMRVEQRIGRVHRLGQSRDVHVYNLSTRG
FT                   TIEEQMLRLLSEKIEMFAQTIGPIERILYSQKVEGNLEKQALEYLLDLQEEISREQKET
FT                   APAAPVPPEFQAVPAPLFFF"
FT   gene            complement(344033..344887)
FT                   /locus_tag="HM1_0447"
FT   CDS_pept        complement(344033..344887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0447"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83064"
FT                   /db_xref="GOA:B0TFG5"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR019264"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFG5"
FT                   /protein_id="ABZ83064.1"
FT                   /translation="MKKDIGTWLKDVLGIALGGLIFAFGLNYFIIANHLAEGGLTGVAL
FT                   TLHYLFGWPVGTTYLLMNVPLFVIGWRVLGTEFALKTVLGTAVASIGVDLTRAFQSPMP
FT                   GDLLLASLYGGSAIGLGLGVIFLFGGSTGGGDIIARLVNHRWGWPMGRVLFLVDVVVIT
FT                   SVGFIFGRSVAMYTLVAVFVASRIIDFVQEGAYSARAAMIISEKSTEIAQRVLEELERG
FT                   ATVFSARGVYTDAEKNVLYCVVSRSELVRLKTLVYELDPRAFMIVNEVHEVLGEGFRNW
FT                   HSS"
FT   gene            complement(344943..346001)
FT                   /locus_tag="HM1_0446"
FT   CDS_pept        complement(344943..346001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0446"
FT                   /product="metal-dependent phosphohydrolase, hd subdomain,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83063"
FT                   /db_xref="GOA:B0TFG4"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFG4"
FT                   /protein_id="ABZ83063.1"
FT                   /translation="MRQMGIEFVTIGDKLARPIFTSDGQVLLGKGVLLTAGYISKLKNL
FT                   GISAIYIEDDRFQDVKVEDAVSEETRREALQSLKDATDYVRSGRKIDGAKIKNSVNSVI
FT                   EDCFNSHGVLVNLMDMRTKDNWLLPHSVSVCVMATMLGIARSLDRHRLQDLAVGALLHD
FT                   VGLTTVPKEILDKGEDRLGKEEREIYEKHAEEGFNIIRRTGELSIVAAHVAYQHHERVD
FT                   GTGFPRGIQDPDIHLYGKIVAIVDLYDKLINGAMGARPLPPHQACEVLMGLSGRYFDLS
FT                   LVQLFLKNVATYPTGISVRLSTGEIGVVVDQNKSIPMRPVVRVLMERHRFVEPKEYDMI
FT                   KDTTIFIQDVLR"
FT   gene            complement(346170..346808)
FT                   /gene="pduL"
FT                   /locus_tag="HM1_0445"
FT   CDS_pept        complement(346170..346808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pduL"
FT                   /locus_tag="HM1_0445"
FT                   /product="propanediol utilization protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83062"
FT                   /db_xref="GOA:B0TFG3"
FT                   /db_xref="InterPro:IPR008300"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFG3"
FT                   /protein_id="ABZ83062.1"
FT                   /translation="MKYNVPVQVPVGVSNRHIHLSQADLEALFGAGYSLTEMKPLKQPG
FT                   QYACKEVLIVAGPKGVIANVRVLGPTRKQTQVEVSRSDAFVLGLQPPVRDSGDLAGSPG
FT                   CVLIGPKGSVILKEGLILASRHLHIHTTEAEALNLKDKDRITVAFGGERSVLFQNVLVR
FT                   AGDAMALEFHLDTDEANACLLKSGEMAYIIEKCDPEAAEAPVAAALAAS"
FT   gene            complement(346999..347232)
FT                   /locus_tag="HM1_0444"
FT   CDS_pept        complement(346999..347232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0444"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83061"
FT                   /db_xref="InterPro:IPR015077"
FT                   /db_xref="InterPro:IPR023883"
FT                   /db_xref="InterPro:IPR038062"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFG2"
FT                   /protein_id="ABZ83061.1"
FT                   /translation="MKITETMGIGECVAKFPNTVPVFMSFGMSCLGCSAARFENIGQGA
FT                   RAHGIDVDKLIEELNKVVGKDDDACGCGCSCE"
FT   gene            347301..347432
FT                   /locus_tag="HM1_0442"
FT   CDS_pept        347301..347432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0442"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83060"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFG1"
FT                   /protein_id="ABZ83060.1"
FT                   /translation="MQSPEAKIPFLSPLIAPQKKYSHLSPQVCPLGDKEISGYIVVV"
FT   gene            complement(347414..347764)
FT                   /locus_tag="HM1_0443"
FT   CDS_pept        complement(347414..347764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0443"
FT                   /product="anti-anti-sigma factor superfamily, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83059"
FT                   /db_xref="GOA:B0TFG0"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFG0"
FT                   /protein_id="ABZ83059.1"
FT                   /translation="MLRYDSRNVGDVEILTLSGCFDASGAAAFRAHVVQRIEQGKRKFV
FT                   FVFSGVDFIDSTGLGFLVSILKTTLKHGGRLRIACLVPMIYEIFVMTKLDQVFAIDETE
FT                   EQSLEAIQTTTI"
FT   gene            complement(347883..348494)
FT                   /gene="cheC"
FT                   /locus_tag="HM1_0441"
FT   CDS_pept        complement(347883..348494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheC"
FT                   /locus_tag="HM1_0441"
FT                   /product="chemotaxis protein chec"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83058"
FT                   /db_xref="GOA:B0TFF9"
FT                   /db_xref="InterPro:IPR007597"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFF9"
FT                   /protein_id="ABZ83058.1"
FT                   /translation="MDFLSLTPLQMDALREVGNVGAGNSATALSQMVQKAIDMKVPSLG
FT                   VVPFDHVADHMGGPETLVAGVYLRVEGKAPANLLFVLPIDSAKALVDMLMGFPAGTTQA
FT                   IGEMEASALKEVGNILAGTYLSALSMFTRLTFEQSVPALAIDMAAAIISVVLTSIAEVG
FT                   DHALLLATEFIGEGQQIAGFLFLIPEEGSLELILGSLGLA"
FT   gene            complement(348501..348851)
FT                   /gene="spoIIAA"
FT                   /locus_tag="HM1_0440"
FT   CDS_pept        complement(348501..348851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoIIAA"
FT                   /locus_tag="HM1_0440"
FT                   /product="anti-sigma f factor antagonist, putative"
FT                   /note="Stage II sporulation protein AA"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83057"
FT                   /db_xref="GOA:B0TFF8"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFF8"
FT                   /protein_id="ABZ83057.1"
FT                   /translation="MLEYRTRKLGSCNIVDLKGEIDGLGLERFKKALTEAVTEQCEAIV
FT                   LNFTDVVFISSSGLGALVAYYKQLQSDNLQLAVFGLRDVIRQVFEIVRLNKVIAIVDSE
FT                   EDALALVGAAKE"
FT   gene            complement(348924..349634)
FT                   /locus_tag="HM1_0439"
FT   CDS_pept        complement(348924..349634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0439"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83056"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFF7"
FT                   /protein_id="ABZ83056.1"
FT                   /translation="MARVVLELRHFSNGSGYDVVACHPDATVADYLEAVEAFFSNSAWT
FT                   GLRRGRDFVGWANCEGCPNCCRERIPLTIGDAIRLALSLPAVADRVRAAGALTAEDLLQ
FT                   AIDVFGEIHIQGRVMDVTLRRTEAGWCGLFDHAKQRCLRHTFRPLVCRTYFCCPVSHRA
FT                   EKLRQRILNAGEDALVRQLLLSSRGVHFASMGLRLSDYPPGPWSDSEGLSLCYESAVLL
FT                   APFLTGLNLARMPI"
FT   gene            complement(349635..350222)
FT                   /locus_tag="HM1_0438"
FT   CDS_pept        complement(349635..350222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0438"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83055"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFF6"
FT                   /protein_id="ABZ83055.1"
FT                   /translation="MLTYEDVWDDLLAALEDSGLEAFDVQNFIEMSTCLREFRCYCQVT
FT                   GARAGSEIRAEIAFVWDAVMTARSVYGHEAAPPSGFRTLPGFLSRDGAMTDALELEIKY
FT                   YFPAKDFESAGFLTRTVQNIIMAIVDHQNFPEVNFEISVAPDQVVNVHRAYAFYRWPVP
FT                   LNTERLELAPLCREIARVLQALHHSGHFEESL"
FT   gene            complement(350256..350648)
FT                   /locus_tag="HM1_0437"
FT   CDS_pept        complement(350256..350648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0437"
FT                   /product="6-pyruvoyl-tetrahydropterin synthase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83054"
FT                   /db_xref="GOA:B0TFF5"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFF5"
FT                   /protein_id="ABZ83054.1"
FT                   /translation="MYELIVQTHFDAAHYLRDYPGDCARVHGHTWQVEVTLVGRQLDDL
FT                   GMLIDFKEVKKAVKAICDQLDHRMINEHDYFLQRNPTAENLSCYFFHELAGWLKENHPH
FT                   VRVGTVRIWESPRASICYRADDDISA"
FT   gene            complement(350636..351496)
FT                   /locus_tag="HM1_0436"
FT   CDS_pept        complement(350636..351496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0436"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83053"
FT                   /db_xref="GOA:B0TFF4"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFF4"
FT                   /protein_id="ABZ83053.1"
FT                   /translation="MKKMDLHSHSTASDGSLTPRELVALAKREGVGLMALTDHDTVDGV
FT                   AEARKAGEELGVQILNGVELSVDHEHREMHLLGYRIDPGNPVLQEGLRRLIHYREERNP
FT                   KIIERLRSMGIPITMEEVTQEAGSTVIGRPHFGRVLVKKGVVASVDEAFARYLGSGKPA
FT                   YVPKERLLPEEGIALLRRAGGIPVLAHPIFLAEQSYSELLPLLQRLKAAGLMGIEAYYP
FT                   EHSVHDIRKFVRLAEETGLYVTGGSDFHGGGKPSARLGCILPDGGPLPEEVQKRIEEWI
FT                   GPCMN"
FT   gene            complement(351765..352184)
FT                   /locus_tag="HM1_0435"
FT   CDS_pept        complement(351765..352184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0435"
FT                   /product="rubrerythrin"
FT                   /note="The structure is a tetramer of two-domain subunits.
FT                   In each monomer, the N-terminus forms a 4-alpha-helix
FT                   bundle containing the diiron-oxo site (centre I). The
FT                   C-terminus forms a rubredoxin-like FeS4 domain"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83052"
FT                   /db_xref="GOA:B0TFF3"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFF3"
FT                   /protein_id="ABZ83052.1"
FT                   /translation="MEFVNEVKLGVTKGTVVEDAVNANFRGETQETGLYLAMARQAQRQ
FT                   GYPEVAEVLKRIAWEEAEHAAHFAELNGMISESTKENLEKMLAGEIGANKGKKMAATEA
FT                   KQNDIDAAHDFFDESSKDEARHAQMLKGMLDRYFK"
FT   gene            complement(352429..352587)
FT                   /locus_tag="HM1_0434"
FT   CDS_pept        complement(352429..352587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0434"
FT                   /product="rubredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83051"
FT                   /db_xref="GOA:B0TFF2"
FT                   /db_xref="InterPro:IPR018527"
FT                   /db_xref="InterPro:IPR024922"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR024935"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFF2"
FT                   /protein_id="ABZ83051.1"
FT                   /translation="MKKYGCLVCGYVYDPAKGDPDNGVAPGTPFEELADNWVCPLCGVG
FT                   KDEFETL"
FT   gene            complement(352663..353874)
FT                   /gene="nirB"
FT                   /locus_tag="HM1_0433"
FT   CDS_pept        complement(352663..353874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirB"
FT                   /locus_tag="HM1_0433"
FT                   /product="nad(p)h-nitrite reductase, large subunit protein
FT                   nirb, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83050"
FT                   /db_xref="GOA:B0TFF1"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041575"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFF1"
FT                   /protein_id="ABZ83050.1"
FT                   /translation="MSHREQILILGGGIAALSAAEAARQADPERPITICAEESHYPYYR
FT                   LRLSFLLGQSFDKESLLIHPPAWYDERNIVVLTGRRARSIDAERRIVTLESGETIPYGR
FT                   LVIAVGAAAFLPPLPGTELPGVYTVRQVDDVAAINTDLRPGRRVIVVGGGILGLEAAWT
FT                   LHEQGIAVTVVEHGPRLLSRQLDAGGSRLLERLAADEGITILTEADSMAIEKGEGVLRL
FT                   RLADGRTVEGERIIFSTGIRANLELARSAGIAAGRGICVDEWMQTSVPAIFAAGDVAEF
FT                   KGNLPGLWSVAAEQGKRAGRNAVLPQTDWTPYRPAAPSNMLHVFGIKIFSLGAVSSGVT
FT                   LGDEEASAKEYKKFFFSDGRLVGAVLMGDLKWANRLKAAMESGRDFSGATGTMEAFLAA
FT                   LADE"
FT   gene            354006..355175
FT                   /locus_tag="HM1_0432"
FT   CDS_pept        354006..355175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0432"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83049"
FT                   /db_xref="InterPro:IPR003788"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038375"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFF0"
FT                   /protein_id="ABZ83049.1"
FT                   /translation="MSSPLQQAIGDRIRAEGPIPFRDYMELALYHPRHGYYTAGDPPMG
FT                   RRGDFITAPEISPLFGRVIGRQLTEMWEHLKRPDRFDIIEFGPGRGLLAKAVLEALTAG
FT                   PLADRLVYHLVEISPTLRAHQRESLAGLPLTVYPDPAEAIPGSYGWSAAKALPCGLTGV
FT                   VLSNEFLDALPVHRLIHKDGRPWELYVAKGTAHAGPFCWHYGPLSDPCLEDWIARHITG
FT                   KGVTLEEGQLFEVNLAAADWMKAVDRLLTRGFVLTVDYGHPVEKLYSPERYEGTLVCYR
FT                   RHRADADPLEDVGEKDMTAHLDFTSLQSVASELGWQNLGLISQMWFLAHWLRPEDLLTG
FT                   PAMTVEDFRRHQALKKVLLPGGMGEIFKVLIQSKGLPPLPLTGLGATNR"
FT   gene            355319..356260
FT                   /locus_tag="HM1_0431"
FT   CDS_pept        355319..356260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0431"
FT                   /product="efflux transporter, rnd family, mfp subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83048"
FT                   /db_xref="GOA:B0TFE9"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFE9"
FT                   /protein_id="ABZ83048.1"
FT                   /translation="MIKLRRLLPSRTSLPPRIIVLLLSTLPLLAGLYALLPSPPEVVTV
FT                   TVDKGPVQKDLWISGEVQAKRQNTLFSSIPGPIEWIVAEGEQVNEGDTVARIAGQPLTT
FT                   PIAGQLMEKKVATGSWVPPGTPLAEVADPTDLVIQAMVDETDVLKLAPDQAVRWTLAGY
FT                   PGQVFSGKVLTVSRVISRDHEGNKGFRVLLSAPPGLTLYAGMTAEGRVILEEQAEAVRV
FT                   SVDALWEEEGKSQVYLLRKGRAITVTVETGLRDDHYVQILSGIQPGDRVIIPGDVKLTS
FT                   GQSVRPKGSDRPGSADGPGSEKAPKGEGGTKT"
FT   gene            356314..356982
FT                   /locus_tag="HM1_0430"
FT   CDS_pept        356314..356982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0430"
FT                   /product="abc transporter"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83047"
FT                   /db_xref="GOA:B0TFE8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFE8"
FT                   /protein_id="ABZ83047.1"
FT                   /translation="MIEMNAVGKSFPFGASPLQVLSGIDLTVASGEFLAVMGPSGSGKS
FT                   TLMNLIGCMDRPSEGQYRLAGQETARLTEKELCRLRNAMVGFVFQSFHLLPRLTAWRNV
FT                   ETPLFYAGVAPEERRRRAKELLERVGLGHRLHHRPTELSGGERQRVGIARALANDPALI
FT                   LADEPTGNLDQQTGQEILELFAALRREGKTIVMVTHDPDVAKWADRVVRIKDGKLCATA
FT                   "
FT   gene            356969..358171
FT                   /locus_tag="HM1_0429"
FT   CDS_pept        356969..358171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0429"
FT                   /product="permease, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83046"
FT                   /db_xref="GOA:B0TFE7"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFE7"
FT                   /protein_id="ABZ83046.1"
FT                   /translation="MQLREYIRLAVEGIAAHRLRSGLTVLGVVIGVFAVVTLMSLGDTV
FT                   RRQVSGQIAELGAGLLMVMSGREDAGHGPGFITMNLTLSDADRLRQIDGVDKVNPNLTV
FT                   PARAERAKAGLSVTCYGDNADFLLVHGYELASGRMFQASEVIARSHVVLLGAKAKESLF
FT                   GDAEAEGHMIRLNGATFRVIGTLKEKGRALIHDRDRIVVAPVTAVQDFSGLKNIGVIFV
FT                   RAEDPSRVPLVRERILSVLAKSHRQKDVQVFSQNDALQVSDKVLGTLTAFLACIAAISL
FT                   AVGGIGILNIMLVSVRERTREIGIRRALGATPGQIMTQFLLEALFLGAAGGAAGSVFSV
FT                   LAVYGLTCWAGWDTGGLTHILSKEALLLGILGASGIGLLFGLYPALQAARLDPIDALRY
FT                   E"
FT   gene            358290..358505
FT                   /locus_tag="HM1_0428"
FT   CDS_pept        358290..358505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0428"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83045"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFE6"
FT                   /protein_id="ABZ83045.1"
FT                   /translation="MEDYAQPYSPYDIDDQLDEAFQTLNKDSRADGSHGLLEGTDRPAP
FT                   GVVCTHLFVCPQCGSDRQLPIPRRFI"
FT   gene            complement(358621..360042)
FT                   /gene="nrfA"
FT                   /locus_tag="HM1_0427"
FT   CDS_pept        complement(358621..360042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrfA"
FT                   /locus_tag="HM1_0427"
FT                   /product="nitrite reductase (cytochrome; ammonia-forming),
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83044"
FT                   /db_xref="GOA:B0TFE5"
FT                   /db_xref="InterPro:IPR003321"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFE5"
FT                   /protein_id="ABZ83044.1"
FT                   /translation="MIRKKWILAIWLVLLVAFAAVAVAGCGGKPASTTAALGDTGLAPD
FT                   EMDLDKFAKLYPHHYDSFMKNAEMSSVGTKYGGNLEKDSHLEKYPYLKSLFGGYAFSLE
FT                   YNEDRGHVYTMKDLATVKRVTSLPNGKKQIGSCLTCKSAEVPGMIAKMGEAYYTTPVEE
FT                   HLKNATHGMTCSNCHDPQTMKLRVVQPAFIDAMKRRGEDVTKATQQQLRDYVCAQCHVE
FT                   YYFNPAKKGEVTFPWDKGFTPTAIEAYYDEVAAKENNFKADWTQPATGAPLLKAQHPEF
FT                   ETFQGSIHQINGVTCADCHMPYVKQGGQKITSHWWTSPLKTMEQSCLVCHREPVDKLRD
FT                   YVLQKQDLTFEMLNKAGTLTEVAGKSINKAMQAGASDADLAEARKLLRSAQWYWDFVAA
FT                   ENSMGFHNTPLTMNTLAKSIDLAQKSTMAAAKAGNFHDIPEATPYSEFINERLNTRGWP
FT                   KDKGETAKPTRTNWK"
FT   gene            complement(360091..360549)
FT                   /gene="nrfH"
FT                   /locus_tag="HM1_0426"
FT   CDS_pept        complement(360091..360549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrfH"
FT                   /locus_tag="HM1_0426"
FT                   /product="cytochrome c nitrite reductase, small subunit
FT                   nrfh"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83043"
FT                   /db_xref="InterPro:IPR005126"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="InterPro:IPR038266"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFE4"
FT                   /protein_id="ABZ83043.1"
FT                   /translation="MDRAKKTKIIILAGGIFLLAAGTATAAMHKITGNSAFCGTCHVMD
FT                   NYMASWQHSSHREVAGCNDCHTDQRNFAAKTWSKVYAGSQHAFVNTVLTPPDHLKLYEA
FT                   SKPIIQRNCLRCHDDLVAQTNLAKAEPDGQNCIDCHRSTPHGRERPST"
FT   gene            complement(360542..360676)
FT                   /locus_tag="HM1_0425"
FT   CDS_pept        complement(360542..360676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0425"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83042"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFE3"
FT                   /protein_id="ABZ83042.1"
FT                   /translation="MVIKITKSTAMILYTEGKSGRGMSRSKGSKEGDLSGEGGERRGG"
FT   gene            complement(360802..361740)
FT                   /locus_tag="HM1_0424"
FT   CDS_pept        complement(360802..361740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0424"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83041"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFE2"
FT                   /protein_id="ABZ83041.1"
FT                   /translation="MRRRTGARRRSNSRRRGNMPGDIVSLLEAEERLQAPAVTGRRRKR
FT                   RTKKRTSLILPWEQDRPDRGDGSGEGRNGDGRYREGGRGKGRSGKKHAGKKAALEDVSE
FT                   NDTERSADGESSPDVSSILSNLLALPAIGDNVAAGDKTGVPGDADRSGDGGEGGSGESL
FT                   ALLRTLMAKGLDLERIEKEVARLKSNVHRMESMAREADSALDSLVRTMGYFGIKPKRGT
FT                   WVYNRMRRLEEQDAAAAAASSAPAPAGTGVGGLDLGAMMNLASMFLGKGGGGTAAAAPA
FT                   SRGIMGTVMNLMKSPTVQNLVLDGIARFLKK"
FT   gene            complement(361824..363047)
FT                   /locus_tag="HM1_0423"
FT   CDS_pept        complement(361824..363047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0423"
FT                   /product="metal dependent phosphohydrolase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83040"
FT                   /db_xref="GOA:B0TFE1"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFE1"
FT                   /protein_id="ABZ83040.1"
FT                   /translation="MSVNREFAHISFHQTLEQPAPVHVALPDLIGGFSLAIDLAEGKPL
FT                   RHAQSISFLADHVAQALCIGGSERDALYYAALLHDIGVSSQNQLCPLCQVFEEEGKLDS
FT                   VTSLIDADQALHRRWERWDGSGPLALRGQAIPLVARILAVAVAAERVGGEHRDFWNWRT
FT                   RVEDYFQRDTGVFDPAIVAALKALLRDRAFCLDLFAFSQGRVVDRFRPEETITLAGGTM
FT                   HLLGKAFARFIDVKTPFTADHSRNVADWSRRIAGAMALPEARKHQIYLAGLLHDLGKIA
FT                   IPKAILEKAGPLTAKEFDLVRNHPYYTACILNQIPALETIALWASAHHERLDGSGYFLG
FT                   ITGEMLPMEARIIAVADVYEALAADRPYRKGLETAAIQGMLKEMAYRRHLDADVVEALD
FT                   GLLGGQCC"
FT   gene            complement(363245..363544)
FT                   /locus_tag="HM1_0422"
FT   CDS_pept        complement(363245..363544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0422"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83039"
FT                   /db_xref="UniProtKB/TrEMBL:B0TFE0"
FT                   /protein_id="ABZ83039.1"
FT                   /translation="MDLSNLKEVLGQLMNQGNINLPIGAEQEKQVKGFIDKVKQKKGLN
FT                   DAERNQAVQLVSQFTRYLSPEQGKQIKALLDQLMKTQKVSDKDKAALEQIRKML"
FT   gene            complement(363639..363761)
FT                   /locus_tag="HM1_0421"
FT   CDS_pept        complement(363639..363761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0421"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83038"
FT                   /db_xref="GOA:B0TF55"
FT                   /db_xref="UniProtKB/TrEMBL:B0TF55"
FT                   /protein_id="ABZ83038.1"
FT                   /translation="MGNPLDGTAFEFLRWAWWGLHIPVIMMLFYLGHRYWPKRR"
FT   gene            363905..365926
FT                   /locus_tag="HM1_0420"
FT   CDS_pept        363905..365926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0420"
FT                   /product="aminopeptidase, m1 family, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83037"
FT                   /db_xref="GOA:B0TF54"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="UniProtKB/TrEMBL:B0TF54"
FT                   /protein_id="ABZ83037.1"
FT                   /translation="MVARPRVPYFSFLSITLFLAITLSVIGLFPIGFFPIGLFQLELLA
FT                   PISLPAAYAEKPPLPASAPPLDYRIQCRYFPERTTIVGRVDLTWPFPGAQPLEQLALHL
FT                   YPNAFRPGSTFRKESSGKHRGYTAGQGDDGEMEVTRITANYDGESIDVTKSLRYIQPDD
FT                   NNLNDKTLAAVDLPRPLRPGQRLELAIEFRTRLPRVYARSGTAGPFVMAGQWYPKLAAF
FT                   ERYGQRGRTREGFNLHQFHANSEFYANFANYDVQITLPKGYTVGATGQETAPPVVQDGL
FT                   QTVRFGQAWVHDFAWSADPRFRLFTRTVTPQGGRPVEIRLYCQKDHVHTADRQLDAVAA
FT                   ALEGLAAYGPYPYAVLTVIDPPADAPGAGGMEYPTLITGGTPSFPGERSAEPDRLLIHE
FT                   AAHQYWYGLVASNEFEEAWLDEGLTTYTEGKILERYKADTRIPVRFFGFPLLYSPLRDG
FT                   CPGLFRAALGPWVPDPIRLDSWKFASEQSYAVSVYNRAALALYSLERLIGEEKMQAILS
FT                   TYCSRWSFRHPGTEDFLRIVAEKAGDRAAKLFQQWLSTPGALDYAVGSVRMAKGPDGPV
FT                   WTIRIDRRGELGAPVEVAVIGKDGQRQQFFWDDGERYKEFTLPGTAPEAVVVDPGEKLA
FT                   LDINRLNNFWAKEQNNAAALRWSLFVAAVCQGLMAVGL"
FT   gene            complement(365947..366648)
FT                   /locus_tag="HM1_0419"
FT   CDS_pept        complement(365947..366648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0419"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83036"
FT                   /db_xref="GOA:B0TF53"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022301"
FT                   /db_xref="UniProtKB/TrEMBL:B0TF53"
FT                   /protein_id="ABZ83036.1"
FT                   /translation="MEFITPAFVSSLLAIVAIDLVLAGDNAIVIGLAARNLPREHQRKA
FT                   IIWGTVGAIIIRAIATVAVVGLLKIPGLLFIGGLLLLWIAYKLIVEEKEHDIKPEKNVM
FT                   AAIRTIVIADAVMGIDNVLAVAGAAHGSFLLVVLGLLISVPIVVWGSTLFIRLVERFPI
FT                   ILYLGAGVIAWTAGSMVTHEPYLKGGIAGTPVLGWLVPAVFTVGVILLGRSKKQAALKA
FT                   SFRKDFEKEEK"
FT   gene            complement(366871..367626)
FT                   /locus_tag="HM1_0418"
FT   CDS_pept        complement(366871..367626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0418"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83035"
FT                   /db_xref="GOA:B0TF52"
FT                   /db_xref="UniProtKB/TrEMBL:B0TF52"
FT                   /protein_id="ABZ83035.1"
FT                   /translation="MSQFRIKRMQMAGISLGIFHKKNPWMAAWWSAALPGLGHLWMGEY
FT                   FKGLILMTWESYVNLKANVNMAILYTFTGRFQAAQDVIDEGWALVYVSVFCFAIFDGYR
FT                   MSVELNTLVDLERKQKKRQLKFTNYSIVGVNYLSHKNPWVAAGWSALFVGFGHIYNMKT
FT                   VKGVILSLWLVTIIYLSHFPQAVIYTFTGRMEAIGNLLDYHWLMFFPSIYVFGIWDSYN
FT                   DAVEMNKLFEEAFKQHLRRQFGDDSHLKR"
FT   gene            367699..368178
FT                   /locus_tag="HM1_0417"
FT   CDS_pept        367699..368178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0417"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83034"
FT                   /db_xref="GOA:B0TF51"
FT                   /db_xref="UniProtKB/TrEMBL:B0TF51"
FT                   /protein_id="ABZ83034.1"
FT                   /translation="MRLIYGLFKTTLKTELGIYALLEKGFHREKVRVVPLDATVSATSQ
FT                   VIDSMYKSDGLSLFDGMALSASIGMLFGVIFGSVLYVGPIALGIIGFFLGAGIGYWVDQ
FT                   KMSKDLHHNVPGPSGEIIVSVECDTEEEQETAEAIFREYQAVALGVFPPSTTRIG"
FT   gene            368171..369190
FT                   /locus_tag="HM1_0416"
FT   CDS_pept        368171..369190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0416"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83033"
FT                   /db_xref="GOA:B0TF50"
FT                   /db_xref="UniProtKB/TrEMBL:B0TF50"
FT                   /protein_id="ABZ83033.1"
FT                   /translation="MVDEGSLRSVRFGEAIGCDQEVMILAHLWFIFRSGIRLSLSLWPV
FT                   ALLTWLFQALLLIPLLIPLFSYLSHALPPLAALSVPGEPSAAGVSTALSLVAGSHPRDW
FT                   DAMQISLYYDLLFPFSSTAAGKLWQNLQWIPFLLFALLRPFWQAGVWSSLRHRLVFPRH
FT                   RKGLFRTFFEGVVCWGYASLQIALWLAPVWIGLWWLFDSLSNRFDAISWSPAASLLIAG
FT                   LSIMVIADLLGLVGDAARWRLVMSPAGEKRRLLGLLRSTASGLTRHLAPLLLARFALNI
FT                   IFLIALSLMLWSLQQWPAEGITGMTGAFLLQQTSVFLLIFSRLALMGATARYLQKTQT"
FT   gene            complement(369254..369403)
FT                   /locus_tag="HM1_0415"
FT   CDS_pept        complement(369254..369403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0415"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83032"
FT                   /db_xref="UniProtKB/TrEMBL:B0TF49"
FT                   /protein_id="ABZ83032.1"
FT                   /translation="MADVIYYFANSFPYPSNQFTGQTNAQSVNVNEESRAIAQAIFSKS
FT                   SPFG"
FT   gene            369472..370491
FT                   /locus_tag="HM1_0414"
FT   CDS_pept        369472..370491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0414"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83031"
FT                   /db_xref="GOA:B0TF48"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:B0TF48"
FT                   /protein_id="ABZ83031.1"
FT                   /translation="MSTFTRLQAENFSAFESLDLSFSPGINVFIGKNGTGKTHVMKTLY
FT                   AAGAITGRLEGFIDKMIRIFLPYEYRIGRLVRRKRGSTTAKIVVSCNKEQLSLTFTNHS
FT                   KNTPIDANEEKWKKLKIKCAYIPVKEMLANAPGFRSLYSERLVHFEEIYADIIDRAYLP
FT                   PKRGPLEENRANLLRKLENVLEGKVVTEGETFFLKNNQGMLEFTLLAEGLRKLALLWLL
FT                   IQNETLLKGSVLFWDEPEANLNPQMVRVVVEILLELQRFGVQVFIATHDYVTLKEFELQ
FT                   RTKEDKILFHSFFRKDDGEPVDISTSSDYSLIDENAIIDKYLDLYDREVHKALGGEEV"
FT   gene            complement(371203..372447)
FT                   /locus_tag="HM1_0413"
FT   CDS_pept        complement(371203..372447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0413"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="Does not match cache domain, PF02743, or HAMP
FT                   domain, PF00672"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83030"
FT                   /db_xref="GOA:B0TF47"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR039379"
FT                   /db_xref="UniProtKB/TrEMBL:B0TF47"
FT                   /protein_id="ABZ83030.1"
FT                   /translation="MSINVSGEEAKVAQKLLNLSTRDLALLAELRPLIEPRLDEVANNF
FT                   YKQLLAIPELKSFIETHSSVDKLRVTFKGYLKSLFTDKVDDRYIEERQKIGHVHNRIKL
FT                   PAYWYTAAYQALFNAIIPILEEMRDKGRALEVNTALQRLTNLDQQTVMSAYITDYMQEI
FT                   DKKAELENALNEIQLLQTRVNDSSQTLAATAEETAASAAEMASAAQRIAQNAIQATQFA
FT                   SQVNQLAESGEKRIQQTGTAIENLNVLIQGMQDKIKALDESSEKIESIAGVIQGIATQT
FT                   NLLSLNAAIEAARAGESGRGFTVVANEVKKLAGFSEQSVQEIAEMIRISRQHTLEVSQA
FT                   MVDTSKAMDAASQQAAEVVRSFGEIIKSIGYNQDKVKQIATEIESLTTTSKQIEEASDE
FT                   VARSAEALSVMAINR"
FT   gene            372863..373693
FT                   /locus_tag="HM1_0412"
FT   CDS_pept        372863..373693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0412"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83029"
FT                   /db_xref="InterPro:IPR019606"
FT                   /db_xref="UniProtKB/TrEMBL:B0TF46"
FT                   /protein_id="ABZ83029.1"
FT                   /translation="MFILLALVSAIALSGCSLSRATPPAESAPDDQGKAVTAAAETTVR
FT                   LFFPDQELQRLVKEERPLNGGAEEKVRQTFELLKGGPQNGQLTTLIPAKTRLLGVTIKD
FT                   TQLEVNLSQEIRQSNVGSTGEALLIGSLVNSFSSLGYTGVQLIVEGQKVETLAGHLDIS
FT                   RPLSFFDELTIRQGPIPPPEKIGDIEKDVRQGHQQWRLDPLEVTRVDGIALGFEPEKDC
FT                   FSLISQSEAVGKPVAKVRVRHGKMDFLVELTQPAGAGKEHIWVIRSVAAVPPGA"
FT   gene            373812..373991
FT                   /locus_tag="HM1_0411"
FT   CDS_pept        373812..373991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0411"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83028"
FT                   /db_xref="UniProtKB/TrEMBL:B0TF45"
FT                   /protein_id="ABZ83028.1"
FT                   /translation="MMADKPKGMHTYHLDPESLERLYKKYGRPGEIAPGVKAPRKRSIA
FT                   PDREPGAVPLLETE"
FT   gene            373991..374179
FT                   /locus_tag="HM1_0410"
FT   CDS_pept        373991..374179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83027"
FT                   /db_xref="UniProtKB/TrEMBL:B0TF44"
FT                   /protein_id="ABZ83027.1"
FT                   /translation="MDLDGRTNDTFPPGKGIAFFRPFSCFDFEHKISHFSNIKSLMRSL
FT                   AQMKTALRRLLPVDLSN"
FT   gene            374276..376198
FT                   /locus_tag="HM1_0409"
FT   CDS_pept        374276..376198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0409"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83026"
FT                   /db_xref="GOA:B0TF43"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005105"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR018821"
FT                   /db_xref="UniProtKB/TrEMBL:B0TF43"
FT                   /protein_id="ABZ83026.1"
FT                   /translation="MMDPLAQIRAIAPFDQLPEEALRSVAEKMTSLRFSKGEVIFSQNQ
FT                   PAFPHLFLALDGMAEIIIQNDAGVSTVIGFRQGGEFFGETCIVEKKYPATVKAIDDMTC
FT                   LTIPFDELHRLWEKHAAFSAYFSRLFASRFRAMIDEIVAEHSGEAPGMDGRPFRKRAVD
FT                   MMSSPVYTIAASEPVTKAARLMADKRVGSLVVTEGEHPIGIITERDLVYNVLAAPFPDD
FT                   ATGPLAFPPLKSAMNSRFITLPPESYYYQVLLTMIRETVRYVGVVDKGRLLGIVALTDL
FT                   IRNRDAGALSIVDGIEHCRSVDELAARAKVIDRLLTAMVAEQAQPAEITEVITVLYDRL
FT                   TVRIIELALDVLAKRRLTPPAPFCWLTMGSGGRREQTLRTDQDHAIVFADVPEEDRESA
FT                   RAFYLDLGELVTKGLEACGFARCPGQVMAGNPRWCHSFSEWMHRLGVWVEESVPDHVRQ
FT                   LTIFLDFRGLYGDQTLARRLRDAVCQTYRRFPVGLHHLAKDDLRHQVSLGFFKPFVTEK
FT                   SGDHKDEIDLKRSLLVHLIDCVRVFALREGIPETNTLTRIHRLAERGVFHANDAEQFCF
FT                   SYNTLTGMRFRENLRKLQEGRSPDNYIHPYRLTKREQAALKEAIQGVIRLQSLTGSAFR
FT                   VEGFL"
FT   gene            376321..377088
FT                   /locus_tag="HM1_0408"
FT   CDS_pept        376321..377088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0408"
FT                   /product="DNA polymerase iii polc-type"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83025"
FT                   /db_xref="GOA:B0TF42"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B0TF42"
FT                   /protein_id="ABZ83025.1"
FT                   /translation="MRFFDPVEVSSLIETFRYLFGLERSGFPGRMPEPALSARLVEKCR
FT                   RNRGRHSPFRLLRDITFVVFDTETTGLSVPNDDVIALGGVALPPGGEGAEWTEDTGKVR
FT                   VFDRLVNPHRPIPVLAREITGIDDDMVFSQPTIYPVLDDFLDFIDGAVLVAHGIAFDVG
FT                   FLDKYLRPLRTKLYHPVIDTITLSRVLEPFRAEHSLDALVADYGITPRRRHSALGDAQM
FT                   TADLFAAMLVRLQKLRQVHTLGDLQRILAQQHL"
FT   gene            377234..378433
FT                   /locus_tag="HM1_0407"
FT   CDS_pept        377234..378433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0407"
FT                   /product="metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83024"
FT                   /db_xref="GOA:B0TF41"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B0TF41"
FT                   /protein_id="ABZ83024.1"
FT                   /translation="MHPSPLFSIMRLLPIAFFLLINYLSYMALVRWMPFFRPGRWRVAF
FT                   VIIAFLSALPPLYSVATGFQTQEAWLRIAYYPAFAWNIGQLIFLLAVPLVFIFKRLQSS
FT                   PEAEAQQESQSHVHLPEKVTRRQLLQGAITAVPFFALTVAADGVLIGDNRVVTRTYPVT
FT                   IPGLSPHLDGLRLVQISDVHLGTFFPLDRLDDALELVEKQKPDILTITGDYVDDVTLLH
FT                   EAIRRTEQVSATLGSYYCLGNHEHYRDLDKVRGAFRSSSIRHLDNSCSTVENSLCLLGI
FT                   DYPFTGRGEDNRAAVTERMLDKALSGAPAEVPKILLTHHPDGFNAARKRGVALSLAGHT
FT                   HGGQVGIGDRSLFPFAMAYMRGWYGDDEHKLFVHSGLGHWMPFRLGCPSEIVTFVLRSA
FT                   "
FT   gene            379029..380159
FT                   /gene="bcsA"
FT                   /locus_tag="HM1_0406"
FT   CDS_pept        379029..380159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcsA"
FT                   /locus_tag="HM1_0406"
FT                   /product="chalcone synthase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83023"
FT                   /db_xref="GOA:B0TF40"
FT                   /db_xref="InterPro:IPR001099"
FT                   /db_xref="InterPro:IPR011141"
FT                   /db_xref="InterPro:IPR012328"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018088"
FT                   /db_xref="UniProtKB/TrEMBL:B0TF40"
FT                   /protein_id="ABZ83023.1"
FT                   /translation="MPRIVSIASAVPDHVFYQEDICHAVQQMFSASFRDLERLLPIFQN
FT                   AQIDKRHFCVPMDWFQQNHSFAEKNSLYIENAVDLGVRAVTQCLNNAGLAPEDVDCFLF
FT                   VSSTGIATPTIDVRIANKLAMKPSLRRLPLWGLGCAGGCAGVARAAELAIARPGRPVLL
FT                   LTLELCGLTFLWGDRSKGNLIATSLFGDGAAAAVIVEDGQTAASDGASPSPALSPQIIA
FT                   SQTTCWPDTLDIMGWDVQDEGLKVIFSRDIPAFVLRHIPPAVDAFLREQGLERSAIDRL
FT                   IAHPGGAKVISAYEECLGLSSEQTRLSRQVLREYGNMSSATILFVLERAMEERSAENCG
FT                   GDSCGNHGGGGICRGEYALMTALGPGFCSELALLRW"
FT   gene            380223..380759
FT                   /locus_tag="HM1_0405"
FT   CDS_pept        380223..380759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0405"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83022"
FT                   /db_xref="GOA:B0TF39"
FT                   /db_xref="InterPro:IPR007269"
FT                   /db_xref="UniProtKB/TrEMBL:B0TF39"
FT                   /protein_id="ABZ83022.1"
FT                   /translation="MLVFFALFSFVLAQRVVELAIARRNARRMTAKGAVEVGHAHYRYL
FT                   VALHVCFFAALMTEVLVLGRKPPQWWMAPAAAFLIAQGLRYWCMTSLGHFWNTRIFVLP
FT                   GANAIRRGPYRFFRHPNYLAVVTELLCIPLLFGAWITAAVISIVNLYLLSVRIQAEEAA
FT                   LAEATDYGEVFRSSP"
FT   gene            complement(380832..382640)
FT                   /locus_tag="HM1_0404"
FT   CDS_pept        complement(380832..382640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0404"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, fis family"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83021"
FT                   /db_xref="GOA:B0TF38"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0TF38"
FT                   /protein_id="ABZ83021.1"
FT                   /translation="MQGVLLLLSPEEHLRWVLARGLSRVGYRVISVQNGNEAVQQLERE
FT                   AVNLVIVDLDGPGSEGMPVLHRLLGVRSNVPFLVLTGQASAETALEAQRLGARDYLQKP
FT                   FSLDELRLALEKALEIESLRQEVRFLRLEAAGRRENVELIGVSPAMRAIRELIAQVADA
FT                   RAPVTVVGEAGTGKEVVARAIHHQSRRREYPFVVFPCAAIPPNLLESELFGWEPPGPAK
FT                   AGNEAKVRSGRLELAHRGTLLIRDIELLPLDLQVRLCRVLEDGAFTRIGGTRQLAVDVR
FT                   VIVASSRSLADAVREGRMREDLYYRLNVIPIHLPPLSVRKEDIADLARHFLCRYEPRGR
FT                   IRGFTADAVHILTGYAWPGNVRELANRIERAVIITRGEWITAAELTAVDPPCIGQKETG
FT                   LNTSSANGAAASTRRGDQNRRSGEVVTQVGAVPHEQGDIAVSSVTRDGTPLLSKQDSGT
FT                   AQRRSDKANLPAQERPGETVVLNQGKELLLYTSRRRRRVETGAGEDQPSSAAEREKIAE
FT                   GDGTKAGSGRRTPHERCLQSDGVTLTIAGPFSLENVEKKIIESALQETGGDLVETARML
FT                   GLNRPALSARMQKHHISLTPFRSGER"
FT   gene            complement(382728..384119)
FT                   /locus_tag="HM1_0403"
FT   CDS_pept        complement(382728..384119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0403"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83020"
FT                   /db_xref="GOA:B0TF37"
FT                   /db_xref="UniProtKB/TrEMBL:B0TF37"
FT                   /protein_id="ABZ83020.1"
FT                   /translation="MALAFGFSVVIGNFLGFYPANRASPRSRTNERERGVVVNPRRKSL
FT                   LMITLTAAAMTIAALVGVFLFPRGGFLSRLLDGREWVAALLALFLVIGFWATRKKSGFD
FT                   GEEDGHDEGDLEALRWDIRDEKNNRDGERRWDDEQEEGAGGKGDDEEAGPERPVTLHDK
FT                   GGLMFDVRPCPGQCSAPARLLDELVPPLNHSLGVIRCAVQVLEEEFGYRTDIILHTRII
FT                   AVEAQRQQQYLREAIGLLQVDGTPPDWLDLSVLVDGVLERFRKRLPGYAVSQEVFRQQV
FT                   PLKVWAEGERLAEAICRLLVGLCRPDVTGQLHVRINVAPEKTVPAVEADGAYKRNDENM
FT                   VKGNGGEIGCTLECHLRGARELTASPEGHLARLAIEAQGGRVVITPGATGEVQVVLRMP
FT                   PVFTAAEPERFLRDKGFLLRPAPAAPAQNGTGDEELESSHRGSAIESKKNEMDSVRPLY
FT                   AGARE"
FT   gene            384651..384812
FT                   /locus_tag="HM1_0402"
FT   CDS_pept        384651..384812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0402"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83019"
FT                   /db_xref="UniProtKB/TrEMBL:B0TF36"
FT                   /protein_id="ABZ83019.1"
FT                   /translation="MNIYPKNALVLIQAKSSTEALRKARATERLKAIPLSHYYQWSKES
FT                   PALSTERC"
FT   gene            385237..385494
FT                   /locus_tag="HM1_0401"
FT   CDS_pept        385237..385494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0401"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83018"
FT                   /db_xref="GOA:B0TF35"
FT                   /db_xref="UniProtKB/TrEMBL:B0TF35"
FT                   /protein_id="ABZ83018.1"
FT                   /translation="MMIPSLVARQGTGFFILSCYCFNGVCFNLFRCNLSLILIKINSAK
FT                   EVENKMLGLHDPWIAGAYLLCIASTLLCVGYAYWGQHQGE"
FT   gene            385648..387258
FT                   /locus_tag="HM1_0400"
FT   CDS_pept        385648..387258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0400"
FT                   /product="na+/solute symporter"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83017"
FT                   /db_xref="GOA:B0TF34"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:B0TF34"
FT                   /protein_id="ABZ83017.1"
FT                   /translation="MEHGLLYIMLAFYLGATVLLGYLGYRHTRSSKDYLIAGGNIHPFL
FT                   MALAYGSTFISTSAIVGFGGAAGVYGMSLLWLTVFNIFVGIFIAFVFYGVKTRKLAHQL
FT                   GVHTFPEFLGARFSSPFIRNFSAGVIALSMPLYAAAVMIGGARYMEEAMQLNYTTSMII
FT                   FAVIVLAYVFFGGLRGVIYNDALQSSIMFIGMGVLLYLTYDKLGGVVTAHEKLSALKDL
FT                   VPQALAAKGHLGWTAMPRFGSEIWWFVVSTLVLGVGIGVLAQPQLAVRYMTVSGKKEIY
FT                   RALSVGGVFILFMTGTAFTVGALSNVYFMEQSGKLALAATAVGGAAPNVDKIIPLFITQ
FT                   AMPEWIMYLFLLSLMAAAMSTLSGQFHLIATSLTYDLNPKAKKGDQKTLLWARVGTVIG
FT                   FTLTLLLALQLPPSIIAIATALFFGMCASAFLPMYTAALYWPKVTPAGATWSMISATVT
FT                   YLVLVLFVHEKEAAIFGVCQQLFGAKTLAAAPWTYIDPMVISLPVSAVVLVAVSLMTQK
FT                   AAQADTTLLPKSAPRQRQL"
FT   gene            complement(387821..387949)
FT                   /locus_tag="HM1_0399"
FT   CDS_pept        complement(387821..387949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0399"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83016"
FT                   /db_xref="UniProtKB/TrEMBL:B0TF33"
FT                   /protein_id="ABZ83016.1"
FT                   /translation="MEVIGLKGQVKELEARVVSIEKQLEILARHLAYITSDPFPLR"
FT   gene            388241..388317
FT                   /locus_tag="HM1_0398"
FT   tRNA            388241..388317
FT                   /locus_tag="HM1_0398"
FT                   /product="tRNA-Pro"
FT   gene            388325..388410
FT                   /locus_tag="HM1_0397"
FT   tRNA            388325..388410
FT                   /locus_tag="HM1_0397"
FT                   /product="tRNA-Tyr"
FT   gene            389423..390235
FT                   /locus_tag="HM1_0396"
FT   CDS_pept        389423..390235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0396"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83015"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0TF32"
FT                   /protein_id="ABZ83015.1"
FT                   /translation="MRVYALVGPSGTGKSHRAIRLAAELHCQVIIDDGLIIEENRILAG
FT                   TTAKRSSTRLGAIKTALFQEQEHRDEAVQALLRCAPKGVLILGTSEGMVEKIAARLKLP
FT                   AIEKIIYIHDIASSNEIRKARYNRAHHGRHVVPAPALEVTRNWTDALINPVKVFFQKKG
FT                   SERKTWAEQSVVRPTFTSLGNLSISTPAIVAGITHQVQEVPGVADVGSISISHGDDGVT
FT                   VRLPITAVYGQPLHVLGRKVQRLAFDILENMGISVLAVDVTIEKLVMK"
FT   gene            complement(390400..391803)
FT                   /gene="bioA"
FT                   /locus_tag="HM1_0395"
FT   CDS_pept        complement(390400..391803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioA"
FT                   /locus_tag="HM1_0395"
FT                   /product="adenosylmethionine-8-amino-7-oxononanoate
FT                   transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83014"
FT                   /db_xref="GOA:B0TF31"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR005815"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B0TF31"
FT                   /protein_id="ABZ83014.1"
FT                   /translation="MQSIDLEKIPANTGCEDLQELDKRYLWHPFTQMREYCREDNLIIE
FT                   RGEGSYLFDTQGRKYLDGISSLWVTVHGHNRKEINEAIRSQAEQVSHSTLLGLSNVPAT
FT                   RLAKELVRITPEGLSRVFYSDSGATSVEIALKMAFQYWQQQPDTRKRGKQRFLTFSGAY
FT                   HGDTIGSVSLGGMDLFHSLYRPLLFQSLKAPAPYCYRCPMGREAGECGFACLEEFDRLI
FT                   SAHKDELAAVVIEPLVQGAAGIITAPPGYLRAVRERCTECDVLLIADEVAVGFGRTGSL
FT                   FACEQEGVSPDLMCLAKGITGGYLPLAATLATEKIYEAFLGEYSEYKTFFHGHSYTGNP
FT                   LACAAALANLEIFERDCVIEGLQGKIERLRQGLEHFHALPHVGDVRQRGFMIGIELVKD
FT                   KATKEPFAPALRMGHRVILEARRRGVILRPLGDVLVLMPILGMSDSELDQLLQVTYESI
FT                   GAVMSEMTV"
FT   gene            complement(391784..392527)
FT                   /gene="bioD"
FT                   /locus_tag="HM1_0394"
FT   CDS_pept        complement(391784..392527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioD"
FT                   /locus_tag="HM1_0394"
FT                   /product="dethiobiotin synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83013"
FT                   /db_xref="GOA:B0TF30"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0TF30"
FT                   /protein_id="ABZ83013.1"
FT                   /translation="MLHGGIFVTGTDTGVGKTVVTAALCKVMTAVKIRAVPFKPVQTGA
FT                   PLTEGGFFREDLAFYRRNLEIDLPDDWLSPVCYEAPLAPAVAAALSDQPVDLDVLDQFL
FT                   WRLANRCDMVLVEGAGGLAVPLTTPDFTMADLACRWRLPLLIVGRAGLGTINHTVLTVR
FT                   YAREKGIPLLGIILNGASVTPDLAEQTSPEMIRRMTGIPILARLPHMGDISQAGLFAEY
FT                   CRLLAAQLDIHKLTEEAARHAIDRP"
FT   gene            complement(392627..393223)
FT                   /gene="bioY"
FT                   /locus_tag="HM1_0393"
FT   CDS_pept        complement(392627..393223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioY"
FT                   /locus_tag="HM1_0393"
FT                   /product="biotin synthesis protein, bioy"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83012"
FT                   /db_xref="GOA:B0TF29"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:B0TF29"
FT                   /protein_id="ABZ83012.1"
FT                   /translation="MVGWTPREMAQVALFAALTAAGAFIKVPVPFVPFTLQYLFVAMAG
FT                   IVLGSRMGLASQLVYIGIGLIGLPVFAEGGGPGYVLKPTFGYLIGFALGAWLIGRLTER
FT                   QEKASILPFFGAAMAGLAVIYGIGALYLYGIMNLVLAKSITLWNTLLYGILLPLPGDIL
FT                   LSGAAAYIGVKLWVLRGTRGKALFVEEGVKEEAQA"
FT   gene            complement(393403..395592)
FT                   /locus_tag="HM1_0392"
FT   CDS_pept        complement(393403..395592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0392"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83011"
FT                   /db_xref="GOA:B0TF28"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:B0TF28"
FT                   /protein_id="ABZ83011.1"
FT                   /translation="MFEEEGERSLLAEMIAKELGLKAVQVAKAIELLDEGNTIPFIARY
FT                   RKEATGEMDENKLRELAERLKYLRSLAQRKEEVLKSIEEQGKWTDDLAKALEQAKTLAE
FT                   VEDIYLPFRPKRKTRASQARERGLEPLARLIQAQALRVGTPEAAAAPFVNPEKDVPDAA
FT                   AALQGALDIIAEEVAEDAEVRRWVRAFTARRGVLVAKAVDPEATTPYLMYYDYREPVAK
FT                   IPPHRVLAINRGEKEKVLKVKIEVEWEPIGRHLESRLITGPSIFMDRLRETLQDSYKRL
FT                   LAPAMERELRNELTEKAEEQAMKVFQANLKNLLMQPPIGRRRVLGIDPGFRTGCKWAAL
FT                   TETGSLLEVGVIYPHEPQKRWEEAKGNLCQIVKKHGIELIAIGNGTASRETEALVAEAI
FT                   GEMEQAVQFIIVSEAGASVYSASPLAGEEFPHFDLSLRSAISIGRRLQDPLAELVKIEP
FT                   KALGVGQYQHDMNQKRLEETLGDVVESCVNTVGVDLNTASASLLRYVAGISSQVAKNIV
FT                   AYREEKGPFRKRSELKKVSRLGPQAFVQCAGFVRIPDGDNPLDNTPVHPESYDGALRLL
FT                   KVLGFGPADIGGPRHNELKAALAKVDVAKMAEATGLGVPTLKDIIEALMKPGRDPREDL
FT                   PKPRFSSAVLSLDNLKEGMVLQGTVRNVVDFGAFVDIGIKHDGLVHVSQLADKFVRHPM
FT                   EVVAVGDIVTVAVLSVDRQRERVGLTMRGVPQTSQ"
FT   gene            complement(395673..395936)
FT                   /locus_tag="HM1_0391"
FT   CDS_pept        complement(395673..395936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0391"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83010"
FT                   /db_xref="UniProtKB/TrEMBL:B0TF27"
FT                   /protein_id="ABZ83010.1"
FT                   /translation="MEEIQKEQQKNQQQNEQQKRAQTDGRNEIGKDKQKSGLNVELMRK
FT                   IIEEKRQKSANQGHTKKGKAEGGPVSARPGIKKYKKGGLFDK"
FT   gene            396194..396352
FT                   /locus_tag="HM1_0390"
FT   CDS_pept        396194..396352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83009"
FT                   /db_xref="UniProtKB/TrEMBL:B0TF26"
FT                   /protein_id="ABZ83009.1"
FT                   /translation="MNGNEVRSYLLSPEELEELWARLGKPGELAPGIKAPKKRNKSSAH
FT                   RPEDPKE"
FT   gene            complement(396480..397148)
FT                   /locus_tag="HM1_0389"
FT   CDS_pept        complement(396480..397148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0389"
FT                   /product="haloacid dehalogenase-like hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83008"
FT                   /db_xref="GOA:B0TF25"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B0TF25"
FT                   /protein_id="ABZ83008.1"
FT                   /translation="MIPYELILFDLDGTLTDPKTGITKSVQYALSKYGIIVEDLDSLIP
FT                   FIGPPLIESFQRFYGFDESQARRAVDFYREYFSVTGLYENALFPGIPELLARLSAAGKR
FT                   LAVATSKPTCFAEQILRHFGIDCYFDHIVGSNLDGTRCAKSEVVAAALALFPRVDRRRV
FT                   IMVGDREHDIIGAKANGIASMAVSYGYGSLEELEAAGPGQIAGSVEVIEPLLAYRSSIR
FT                   "
FT   gene            complement(397255..398421)
FT                   /locus_tag="HM1_0388"
FT   CDS_pept        complement(397255..398421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0388"
FT                   /product="thump domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83007"
FT                   /db_xref="GOA:B0TF24"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B0TF24"
FT                   /protein_id="ABZ83007.1"
FT                   /translation="MAKMELIATAAFGLEAVVARELRELGYDDQSVEDGRVIFRGDERA
FT                   ICRANLWLRSAERVLVKVGSFPATTFEELFQGTKALPWPDWLPEKAEFPVEGKSVRSKL
FT                   FSVSDCQAIAKKAIVEKMKERYRRSWFDEKGPRYTIEVSLLKDVATLTIDTSGAGLHKR
FT                   GYRDLVGQAPLKETLAAAMIQLSFWRHDRVLLDPFCGTGTIPIEAAMIGRNLAPGRNRT
FT                   FAAEQWGQIPASLWQQVREEAHSLAALDRELRITGTDIDEAALSLARRHARKAGVDNAI
FT                   HLQRQPMSESRSRFKYGHLICNPPYGERLGERQEVERLYREMGKVFSALDTWSFYVLTS
FT                   HPGFEALFGRKADKKRKLYNGRIQCNYYQFYGPKPPRREEAAETSEKA"
FT   gene            complement(398632..399483)
FT                   /locus_tag="HM1_0387"
FT   CDS_pept        complement(398632..399483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0387"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83006"
FT                   /db_xref="UniProtKB/TrEMBL:B0TF23"
FT                   /protein_id="ABZ83006.1"
FT                   /translation="MTKKGKTSYPAPKAYSWHRVWQSQEKECCGEPTEYECEEASCEVD
FT                   YCADSEKRAPRKDTCGQVVSVRTLPLCPNSPGNVACGQVKVPVVLAEPTIQIEVEADLE
FT                   LDQYALEIKRIKKEVVLTQCELVLGSNKLFIGGYVRKNIEYATVDCEHCSTKCGDIRHC
FT                   TVHVPFECVTPITFANPPQFHAAKPCVNIEFEGHKVIADESICVDVKNEKPFCELLSSV
FT                   IYEEDIIQHKDRCCDSGEKLFKKFTEKMVIILTLKVLQKQQRVIPLGPPPYHHHHHCKN
FT                   DY"
FT   gene            complement(399984..400307)
FT                   /locus_tag="HM1_0386"
FT   CDS_pept        complement(399984..400307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0386"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83005"
FT                   /db_xref="UniProtKB/TrEMBL:B0TF22"
FT                   /protein_id="ABZ83005.1"
FT                   /translation="MEKKFENKLNGNKFKKIKMLTASDYCDEGISPAEEAFFDTAISAA
FT                   LELGAAKTGDYVIGWLDKNEDRKIYLGFYNDYSHDYRLVEITALSTNYLQNEMKITNIF
FT                   NLD"
FT   gene            401292..401597
FT                   /locus_tag="HM1_0385"
FT   CDS_pept        401292..401597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0385"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83004"
FT                   /db_xref="InterPro:IPR025306"
FT                   /db_xref="InterPro:IPR026363"
FT                   /db_xref="UniProtKB/TrEMBL:B0TF21"
FT                   /protein_id="ABZ83004.1"
FT                   /translation="MFQDKVLTCKECGCEFEFNASEQEFYAEKGFTNEPGRCPQCRAAR
FT                   KAQNNNSRGGYRQEREMYPVTCSSCGKETTVPFQPRGDKPVYCRDCFQPQPRSNRW"
FT   gene            complement(401709..401930)
FT                   /locus_tag="HM1_0384"
FT   CDS_pept        complement(401709..401930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0384"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83003"
FT                   /db_xref="UniProtKB/TrEMBL:B0TA91"
FT                   /protein_id="ABZ83003.1"
FT                   /translation="MVPRQASPGKNVAFPSIYPPHLLSAAFGDKDFALFGKLIQLPLAS
FT                   PGVRGPRAGGLPLASFRFRLAADTLALS"
FT   gene            402031..403458
FT                   /locus_tag="HM1_0383"
FT   CDS_pept        402031..403458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0383"
FT                   /product="reverse transcriptase (RNA-dependent DNA
FT                   polymerase)"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83002"
FT                   /db_xref="GOA:B0TA92"
FT                   /db_xref="InterPro:IPR000123"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:B0TA92"
FT                   /protein_id="ABZ83002.1"
FT                   /translation="MMEGEATMRSRDAQRQPNIPKGNCQREEAVNPQGTGGVPSALPAQ
FT                   EAKQPREETYDLMEKVVERGNMTEAYKRVMANKGAAGIDGMGLESLRPYLKEEWSRIKQ
FT                   ELLEGTYRPQPVRRVEIPKPQGGTRKLGIPTVVDRLIQQALNQILMPIFDPDFSTNSYG
FT                   FRPGKSAHQAVKKAKEYIADGYRWVVDMDLAQFFDRVNHDILMARVARKVKDKRILKLI
FT                   REYLKAGVMLNGIRVKSEEGTPQGGPLSPLLANIILDDLDKALESRGHRFCRYADDCNV
FT                   YVRSRRAGQRVMEGMAKFLEGRLKLQVNWEKSAVDRPWNRKFLGFSFTWHKAAKIRLAP
FT                   QTVKRVKEKIRQFTGRNRSIAMEDRLVTLNQYLKGWMGYFRLIDTPSVLKELDEWLRRR
FT                   LRMCLLKQWKRPKTRRRNLVALGIPEEWACNISGSRKGYWRLSLTPQMNKALGLAYWRE
FT                   QGLVSLVETYQSHRQPA"
FT   gene            complement(403589..403768)
FT                   /locus_tag="HM1_0382"
FT   CDS_pept        complement(403589..403768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0382"
FT                   /product="bfd-like [2fe-2s]-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83001"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:B0TF18"
FT                   /protein_id="ABZ83001.1"
FT                   /translation="MDAGKIVCGCKKVTYGDLQAAIAKGAKSFEEVQSATKVSTGCKKC
FT                   TDHVKSIVSDLLAR"
FT   gene            403845..403994
FT                   /locus_tag="HM1_0381"
FT   CDS_pept        403845..403994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0381"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83000"
FT                   /db_xref="UniProtKB/TrEMBL:B0TF17"
FT                   /protein_id="ABZ83000.1"
FT                   /translation="MQVFKGLIAIFFSGKNRTSDRILLDFLVKCKNRRNFTGGFCAIQA
FT                   SVPC"
FT   gene            complement(404018..405427)
FT                   /gene="oadA"
FT                   /locus_tag="HM1_0380"
FT   CDS_pept        complement(404018..405427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oadA"
FT                   /locus_tag="HM1_0380"
FT                   /product="oxaloacetate decarboxylase, alpha subunit"
FT                   /note="also has gene sym pycB"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82999"
FT                   /db_xref="GOA:B0TF16"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B0TF16"
FT                   /protein_id="ABZ82999.1"
FT                   /translation="MEKRVIKFTDTTLRDSHQSLLATRMKIEDMLPILEKIDAIGYHSI
FT                   ECWGGATFDTTMRFLNEDPWERLWTIKKYCKTPTQMLLRGQNCVGYKHYADDVLEAFIK
FT                   YACEGGMDIFRIFDALNDVRNMEKAMEYTKKYGGHVQGVLCYTISDFHTTKYYVDMAKK
FT                   LVERGADSICIKDMAGILTPGAAYELVKEVKAAVGLPLQLHTHYTSGMGGMMYLKAIEA
FT                   GCDIIDTAISSLALSTSQPACETMVATLESLGYKTNMDLLKLKEIADYFKEVRKKYREF
FT                   DLTDGTPDTNVLVYQVPGGMISNFLSQLAQQNALHKLPDVLAEVPRVREDFGYPPLVTP
FT                   SSQIVGSQAALNVLLGERYKMATNEVKQYMRGFYGQPPAPVNEEVRKKIVGNDEVIHCR
FT                   PADLIPPGMEEAKKAVASVMQKEQDVVTYAIFPNVALPFLEERLAKQTQVDFKLAKEGV
FT                   DDEGKVVTYPA"
FT   gene            complement(405477..405908)
FT                   /locus_tag="HM1_0379"
FT   CDS_pept        complement(405477..405908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0379"
FT                   /product="biotin carboxyl carrier protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82998"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:B0TF15"
FT                   /protein_id="ABZ82998.1"
FT                   /translation="MKRFKVRVDNQMFYVEVEEIPGEGAMTAAAPAPVARTAAPVAPKA
FT                   AAAVAPQAAAAAPAPKAAPKAAAPAPAGGGGITAPMPGTILDVRKNVGDVVKAGDTVLI
FT                   LEAMKMENEIQADHAGTIQEIRVKKGQAVNAGEVLVVIG"
FT   gene            complement(406221..407756)
FT                   /gene="mmdA"
FT                   /locus_tag="HM1_0378"
FT   CDS_pept        complement(406221..407756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmdA"
FT                   /locus_tag="HM1_0378"
FT                   /product="methylmalonyl-coa carboxyltransferase, alpha
FT                   subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82997"
FT                   /db_xref="GOA:B0TF14"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:B0TF14"
FT                   /protein_id="ABZ82997.1"
FT                   /translation="MNMEERLAQLAKYREKITQGGGPKRIAKQHESGKMTARERIEALL
FT                   DPGSFVELGVFVGESNFDKLENPGEGVVVGYGTVEGRVVYIYAQDFTVSGGSLSKAHAD
FT                   KIVKVMDLALKNGAPCIGLNDSGGARIQQGVDALEGYGSIFYRNTLSSGVIPQISAILG
FT                   PCAGGAVYSPALTDFIFMVNGISRMFITGPQVIKAVTGEDVSPEALGGALTHNQKSGVA
FT                   HFMADSELECFEQIRTLLSYLPSNNMEEPPVVDPAEPEFDPEELLTIIPPNPNQGYDVR
FT                   DVLVRILDAGSFFEVQPLFAPNGITAFGRLNGKVVGILANQPKVLAGCLDIDVSDKLAR
FT                   FVRFCNAFNIPLLTFEDVPGFLPGTNQEYGGIIRHGAKMLYAYSEATVPKITIILRKAY
FT                   GGAYLAMCGKPLGCDAAFAWPTAEIAVMGPDGAANIIYRKEIEGAEDPIAMRKQMVEKY
FT                   REEVSNPFIACARGYVEDILDPRETRSRLIATLDALATKRESRPRKKNGNIPV"
FT   gene            complement(407876..408700)
FT                   /locus_tag="HM1_0377"
FT   CDS_pept        complement(407876..408700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0377"
FT                   /product="methymalonyl-coa mutase c-terminal domain
FT                   protein"
FT                   /note="the conserved domain is under EC 5.4.99.2"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82996"
FT                   /db_xref="GOA:B0TF13"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006159"
FT                   /db_xref="InterPro:IPR017515"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B0TF13"
FT                   /protein_id="ABZ82996.1"
FT                   /translation="MEKKPIRVVVAKPGLDGHDRGAKVVAQALRDAGMEVIYTGLRQTP
FT                   AQIVEVAIQEDAQVVALSSLSGAHSALFPQVVEGLRAQGLKDVLVLGGGVIPDDDIPFL
FT                   KEAGVAEIFTPGTDTRDIVAYIEEHFYGPKKKPEILHIDHVGIAVKDLKAAIAFYENVI
FT                   GIKCTAIEEVPEQKVRVAFLPSGDAEVELLESTDPEGPIAKFIAKNGEGIQHVAYRVDD
FT                   LEAKLEELKKAGVPLIDQKPRRGAGGADIAFLHPKGTFGHLVELCQRPGKLK"
FT   gene            complement(408722..410395)
FT                   /locus_tag="HM1_0376"
FT   CDS_pept        complement(408722..410395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0376"
FT                   /product="methylmalonyl-coa mutase, n-terminal
FT                   domain/subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82995"
FT                   /db_xref="GOA:B0TF12"
FT                   /db_xref="InterPro:IPR006098"
FT                   /db_xref="InterPro:IPR006099"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="UniProtKB/TrEMBL:B0TF12"
FT                   /protein_id="ABZ82995.1"
FT                   /translation="MFDSEKVAQVSEAKAKWQENSLGKVLKKAPERRSEFVTDSGITMN
FT                   TLYTPDDVADLDYARDLGFPGEYPYTRGVQPNMYRGRHWTMRQYAGFGTAEQSNERFRY
FT                   LLEQGQTGLSCAFDLPTQIGYDSDDPLSQGEIGKVGVAIDTMADMEILFDKIPLDKVST
FT                   SMTINAPAAVLLAMYIAVAEKQGVSPDKLTGTIQNDILKEYIARGTYIFPPAPSMRLIT
FT                   DIFAFCAEKVPNWNTISISGYHIREAGSSAAQEIAFTLADGIAYVQAAINAGLDVDKFA
FT                   PRLSFFFNAHLNFFEEIAKFRAARRLWAKIMRERFGAKNPRSWAFRVHTQTAGSTLTAQ
FT                   QPNVNIIRVAYQALMAVLGGTQSLHTNSKDEALALPNEESVLIALRTQQVIGYEIGAAD
FT                   VVDPLGGSYYVESLTNQLEAKAKEYIQKIDELGGAPNAIEYMQREIQASAYRYQKGVES
FT                   GENVVIGVNKFQMKEEPPKGLLKVDPALGEAQKAKLKKVKESRDNVAVQNALARVRAAA
FT                   EGNENMMPVIIDAVKVYASLGEICGVMREVFGEYRQQIIF"
FT   gene            complement(410534..411403)
FT                   /gene="sucD"
FT                   /locus_tag="HM1_0375"
FT   CDS_pept        complement(410534..411403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucD"
FT                   /locus_tag="HM1_0375"
FT                   /product="succinyl-coa synthetase alpha chain 2"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82994"
FT                   /db_xref="GOA:B0TF11"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0TF11"
FT                   /protein_id="ABZ82994.1"
FT                   /translation="MAILVNAASNVLIQGITGKQGSFHFKQMRAFGTNVVAGVAPGKGG
FT                   NLFEGVPLYETVQEACEHHRIDATVLFIPAAFCKDAALEAIEAGIKVIVIITEHIPVQD
FT                   ELIIVNRAKLKEAVIIGPNTFGMASWKCKLGILPNVAFSPGPVGVVARSGTLTYEIVGS
FT                   LTNVGIGQTSVVGLGGDRVPGSSFVDMLKRFEVDPDTKCVVLVGEIGGNAEEEAAEFIK
FT                   TMSKPVVAYLAGKSAPPGKRMGHAGAIIERGKGTYEGKVKALTAAGAQVATFPYEVVEK
FT                   VQTLLGRP"
FT   gene            complement(411406..412533)
FT                   /gene="sucC"
FT                   /locus_tag="HM1_0374"
FT   CDS_pept        complement(411406..412533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucC"
FT                   /locus_tag="HM1_0374"
FT                   /product="succinyl-coa synthase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82993"
FT                   /db_xref="GOA:B0TF10"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/TrEMBL:B0TF10"
FT                   /protein_id="ABZ82993.1"
FT                   /translation="MKCFEFMGKEIFARFGIPVPRGRMVLTPEDAAQAAAEIGKPVVIK
FT                   SQVLSGKRGKAGGIKFADTPEEAAQAAAEVLSMTVQGLPVRRVLVEEKLKIDAELYVAI
FT                   TIDGAAKAPVVIASAKGGMDIEEQDEADIVKTHLDVFLGLPAFLARDVARKIGLRGNLA
FT                   KEFSDILSKMYCILNHKDAELVEINPLVVSGDHLIAADAKLTIDDSALYRQKDIPFVDE
FT                   DMTEVEKMAKAAGVGSFVELGGDIAIMANGAGITMGTLDMIQLFGGRPANFMDAGGGTG
FT                   VEGTAKAISILLAQNPKVIFINIFGGITRCDDVANALAQVKRDMGIPVPVVVRMVGTNE
FT                   EAGVRILKEVGIDAYRDMKTAAQMAVALAKRGEGA"
FT   gene            complement(412820..413566)
FT                   /gene="sdhB"
FT                   /locus_tag="HM1_0373"
FT   CDS_pept        complement(412820..413566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhB"
FT                   /locus_tag="HM1_0373"
FT                   /product="succinate dehydrogenase/fumarate reductase
FT                   iron-sulfur protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82992"
FT                   /db_xref="GOA:B0TF09"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:B0TF09"
FT                   /protein_id="ABZ82992.1"
FT                   /translation="MAETIRLRVKRQDGPNGTPRWEEFAIPYRKNLNVIAMLQDIQKNP
FT                   VLANGQKTTPVVFECNCLEEVCGACSMIVNGKPRQACSALVDQLSQPITLEPLSKFPLI
FT                   RDLQVDRTRMFESLKKVKAWIDIDGTYDLGAGPRMAPRDQEWAYPLSRCMTCGCCAESC
FT                   PNYNQKSAFIGPAAISQVRLFNAHPTGEMQSHERLDAVMGPGGITDCGNAQNCVRVCPK
FT                   EIPLTTSIADIGRQTVFRWIDRALRS"
FT   gene            complement(413569..415320)
FT                   /gene="sdhA"
FT                   /locus_tag="HM1_0372"
FT   CDS_pept        complement(413569..415320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhA"
FT                   /locus_tag="HM1_0372"
FT                   /product="succinate dehydrogenase or fumarate reductase,
FT                   flavoprotein subunit"
FT                   /note="This HMM represents the succinate dehydrogenase
FT                   flavoprotein subunit as found in the low-GC Gram-positive
FT                   bacteria and a few other lineages. This enzyme may act in a
FT                   complete or partial TCA cycle, or act in the opposite
FT                   direction as fumarate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82991"
FT                   /db_xref="GOA:B0TF08"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011280"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:B0TF08"
FT                   /protein_id="ABZ82991.1"
FT                   /translation="METRIIVVGGGLAGLMAAIKICEAGGKVDLFSLVSVKRSHSVCAQ
FT                   GGINGAVNTKGEGDSPYEHFDDTVYGGDFLANQPPVKAMCDAAPGIIYMMDRMGVMFNR
FT                   TPEGLLDFRRFGGTKHHRTAFAGATTGQQLLYALDEQVRKWEAAGRVTKYENWDYLSAV
FT                   IDGEGICRGIVAQDMASMEIRAFRGDAVILATGGIGMIFGRSTNSTINTGSPQSSAYQQ
FT                   GVYYANGEMIQVHPTAIPGEDKLRLMSESARGEGGRVWTYKDGKPWYFLEEWYPAYGNL
FT                   VPRDVATRAIHKVCYELGLGIDGKPQVYLDLSHIDAKTLDRKLGGILEIYEKFVGDDPR
FT                   KVPMKIFPGMHYTMGGLWTDYNGMTNIPGLFASGEAEYQYHGANRLGANSLLSAIFGGM
FT                   VSGPATMKYVKGLKKSAADVPQSVFDQELKRQQAKMEEIYRMSGTENPYKIHEELGNMM
FT                   LQHVTIVRINKDLKATDNKLQELMARWKKIGLPDSSRHANQSAIFTRHLWNMLELARVI
FT                   TIGALNRNESRGAHYKPEFPNRDDENFLKTTKAKWTAQGPVLEYEDVDVSLIKPRPRRY
FT                   DVDKGAN"
FT   gene            complement(415343..415972)
FT                   /gene="sdhC"
FT                   /locus_tag="HM1_0371"
FT   CDS_pept        complement(415343..415972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhC"
FT                   /locus_tag="HM1_0371"
FT                   /product="succinate dehydrogenase (cytochrome b558
FT                   subunit)"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82990"
FT                   /db_xref="GOA:B0TF07"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR011138"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:B0TF07"
FT                   /protein_id="ABZ82990.1"
FT                   /translation="MSDNNHFLIRKVHSLLGIIPIGLFFAEHTLMNSMAIVSQDIWLAW
FT                   TSFLHHLPFKIFLEMAMIFLPIAFHAIYGLYIVYVAKNNVLQYNYFRNWMFYLQRITAI
FT                   ITVLFVVWHVWSLKMMNFWSVTSGTYFTNFGQYLASSPIALAAYVIGFLAAAFHFANGI
FT                   WSFCVAWGITIGPKAQNVTFLLCMGIMGVLSVGGLGALYFLMNAAH"
FT   gene            415934..416077
FT                   /locus_tag="HM1_0370"
FT   CDS_pept        415934..416077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82989"
FT                   /db_xref="UniProtKB/TrEMBL:B0TF06"
FT                   /protein_id="ABZ82989.1"
FT                   /translation="MNFTDQKMIIVRHSAAPFRPRGYLKNLISLSFRPIHKIHTLAQKK
FT                   TR"
FT   gene            416663..417553
FT                   /gene="trxB"
FT                   /locus_tag="HM1_0369"
FT   CDS_pept        416663..417553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxB"
FT                   /locus_tag="HM1_0369"
FT                   /product="thioredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82988"
FT                   /db_xref="GOA:B0TF05"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B0TF05"
FT                   /protein_id="ABZ82988.1"
FT                   /translation="MSDRYDSVVIGCGPAGLSAALNLHIRNKAFILLGTKQCSHRLAKA
FT                   ERIDNYLGLPEISGKELMDRYLHHVSSRGIELREERVTAVYPGDGAFAVVTGKGQYTAR
FT                   SLIVATGVHIEKVLPGENEFLGRGVSYCATCDGPLFRGKRVALIDYTGGAAYDEVLFLA
FT                   SVADTLYYLLPEGKTASATAAVKLPLPANVTQLRRSSLSIKGADTVTSLVADEQEFALD
FT                   GVFILRETQKAEILVPGLATDDKAVTVDGQMATNIPGVFAAGDCTGKPYQLARAVGQGA
FT                   VAALSAVGYLDNPRN"
FT   gene            417973..419745
FT                   /gene="glcA"
FT                   /locus_tag="HM1_0368"
FT   CDS_pept        417973..419745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glcA"
FT                   /locus_tag="HM1_0368"
FT                   /product="glycolate permease glca"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82987"
FT                   /db_xref="GOA:B0TF04"
FT                   /db_xref="InterPro:IPR003804"
FT                   /db_xref="UniProtKB/TrEMBL:B0TF04"
FT                   /protein_id="ABZ82987.1"
FT                   /translation="MWTQVYDPMGNIFLSAAIAVIPIIYLFWALAIQKMKGFIAGTTTT
FT                   AIAVLIAIFVYGMPAQMAIASTLQGALYGLFPICWIVITAVFLYNLTVKSGQFEIIKDS
FT                   IASITDDRRLQALLIAFSFGAFLEGAAGFGTPVAISAGMLVGLGFNPLYAAGLCLIANT
FT                   APVAFGGIGIPIIVAGQVSGIDDFAISQMVGRQLPLLSVFVPFWLVMIMSGWKGVKEVW
FT                   PAALVSGLAFAIGQWWSANYLGAMLPDIISSLCSIIALVVFLKVWKPKNIWRFENEPAA
FT                   TYNASTANLTFKKVLKAWSPFIILTIMVGDWGMKSVKAVLDTVTIKFAFPVIHNAVINP
FT                   VTSKPIAAMYSFNWLSAAGTAILISAFITMLIVRMPFGQAMGIFWDTLKSLKFPMITIA
FT                   SVLGYAYIGNSSGMTYTMGMALATTGALFPLFSPVLGWLGVFITGSDTSANAVFGKLQG
FT                   ITADTIGVDPVLTVAANSSGGVTGKMISPQSIAVATAATGLVGKESDLFRFTVKHSLFF
FT                   LAIVMVITYAQATVLKWMIPVYQKGAAAAAAAANLAQLHSEGYMLLGITAVIVAILGFS
FT                   VMGQTESKGAYSKR"
FT   gene            419952..420530
FT                   /locus_tag="HM1_0367"
FT   CDS_pept        419952..420530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0367"
FT                   /product="cytochrome c assembly protein (thioredoxin),
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82986"
FT                   /db_xref="GOA:B0TF03"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B0TF03"
FT                   /protein_id="ABZ82986.1"
FT                   /translation="MTKTMTKWSRWCFVPLLALSLTTAGCVSSNTGAGALEQPPRSTNT
FT                   SNEAAKERLKAPDFKLMSLYGKEESLSAYQGKPVVVNFWASWCAPCRNEMPDLNEFAKE
FT                   YEGKVVVLGVNLTFNDKEKDVRNLVQKLDIKFPILLDNDPNNSAAEAYRIQPIPATFFI
FT                   DKNGNIADVLIGAARSKNDFIKRVEPLLE"
FT   gene            420590..420766
FT                   /locus_tag="HM1_0365"
FT   CDS_pept        420590..420766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0365"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82985"
FT                   /db_xref="UniProtKB/TrEMBL:B0TF02"
FT                   /protein_id="ABZ82985.1"
FT                   /translation="MTGPSGAPKKEVYPENRDKPLFLMTLAFYFMTVKSSERLLPFLQG
FT                   WAKEYVATPASTP"
FT   gene            complement(420756..422066)
FT                   /locus_tag="HM1_0366"
FT   CDS_pept        complement(420756..422066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0366"
FT                   /product="iron-sulfur cluster-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82984"
FT                   /db_xref="GOA:B0TF01"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B0TF01"
FT                   /protein_id="ABZ82984.1"
FT                   /translation="MADLQTLQKAQELINQCMKCGNCQAVCPLYAETMHEGAVARGKIR
FT                   LAVDVLEGKLQPSHAVLDKFALCLTCKACEANCPCGVHCVDIILAARAQLAEKVGLPLI
FT                   KQSIFRGLKLRRLFNFGLKLGANFQGVALKKRGEGLKGRTLRLPVMGMDMRRVIPDLAT
FT                   THSRDMYDEFNPAHSGKGKVRAAFFTGCVNNLIYNDTCKAIVEVLRANDVDVIIPKAQH
FT                   CCGAPVFINGDRNIGRDMARHNLDVFTAADEKYSFDYIFTACGTCVCSFAEHYPHLLQD
FT                   EPKYKAMAEKLAKKTIDVNPLVIKMGGLQKPLGRVDHVVTYHDSCHLARSMKVTAEPRE
FT                   IIKAIPGIRFVEMKDAARCCGGAGSFSLTHYDLSKQITAKKAENIRSTGATLATTGCPG
FT                   CRMTIEDGLAQSNVKIDTVHPVALLYASYKNSGVIKG"
FT   gene            complement(422069..423457)
FT                   /gene="glcD"
FT                   /locus_tag="HM1_0364"
FT   CDS_pept        complement(422069..423457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glcD"
FT                   /locus_tag="HM1_0364"
FT                   /product="glycolate oxidase, subunit glcd"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82983"
FT                   /db_xref="GOA:B0TF00"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B0TF00"
FT                   /protein_id="ABZ82983.1"
FT                   /translation="MSVQQAIREVEALLGKERLLTAVEDLACYSFDGTADAPSKRPDAV
FT                   IMPETTEEVQAIMRIASKYKIPVYPRGAGTNLSGGTIPIKGGLVVTFQRMNKILEIDAE
FT                   NLTATVQPGVIIASLNAAVAPYGLIYPPDPGTVSTATMAGSTAECSGGLRGLKYGVTKH
FT                   YIMGLEVVLANGEKFRAGGKTVKNVTAYDLVKLFTGSEGTLGIITELIVKLIPAPETKK
FT                   SMLAIFSDLDDAGKTIAGIIAAKVIPATLEIMDKTTIETVEAFAKAGLPTDAEAVLLIE
FT                   VDGIAEVVEKEAQAVVEVCKRFNGKVQVARDDAEREKLWAARRAALPALARKSPTTVLE
FT                   DATVPRSRIPEMLRAIRAIAKKYDLLIGTFGHAGDGNLHPTILCDERNAEQMKRVHKAV
FT                   DEIFRVAVDMGGTLSGEHGIGMAKMKYLEWELGATGVDVLRRIKEALDPDYLLNPGKMV
FT                   AGRS"
FT   gene            complement(423478..425640)
FT                   /locus_tag="HM1_0363"
FT   CDS_pept        complement(423478..425640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0363"
FT                   /product="4fe-4S ferredoxin, iron-sulfur binding protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82982"
FT                   /db_xref="GOA:B0TEZ9"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR004452"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEZ9"
FT                   /protein_id="ABZ82982.1"
FT                   /translation="MSNEQHNEDFKASIQKALNDQVMRGALSRFADAYPTARKNAYQGV
FT                   DIEALRNEIACAKAKNGENLDQLIKLFTENATKRGAKVYFAKTAEDANRYIANLAIEKK
FT                   VKKIVKSKSMASEEIHLNDHLKKAGLIVNETDLGEWIIQLAGQKPSHMVMPAIHLSKEQ
FT                   VAGYFSKELKSDIPPDIPLMVQKARAELRTKFIEADMGISGANFAVAETGTIATVTNEG
FT                   NARLTTTLPRVHVALVGIEKVIKDFKEAANIIKALPKSATGQLITSYVTMVTGVTPTEV
FT                   DGQVQDKELHIVLMDNGRSDMLKDPKFKQAWQCIRCASCLNVCPAYQMVGGHVYGHIYA
FT                   GGIGAILTFFFNDPTDAEKPQNLCLGCGRCTEVCPGKIPIPDLILEMRRRMAEKKGIGL
FT                   IPKAIFNVVANRKLMHSLLRVASVGQLPLTGGKPFIRHLPFFFSELTKERSLPAVAPKP
FT                   FRDIAKEREKKNRGKKKRVNFYAGCLIDFCYPHIGTAVYDVLEQAGCEVYFPWEQACCG
FT                   APAKYMGDRDSQIRLAKQNVAAMEEGNPDYIVSACPTCTVALLEDVVEVLKDDPAWHDR
FT                   AKKVAAKVRDFSALAEELGVKAPGKKKSLKGKFTYHDSCHYRRHLHLSDVPRKLLTEVA
FT                   GMELVEMKDSDQCCGMAGSYLVKFPEISAPILQKKLDNIAATGSELVCVDCPGCVMQIS
FT                   GGLDKRRSSVKIRHTAEVLAEALRKG"
FT   gene            complement(425646..426200)
FT                   /locus_tag="HM1_0362"
FT   CDS_pept        complement(425646..426200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0362"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82981"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEZ8"
FT                   /protein_id="ABZ82981.1"
FT                   /translation="MSSEKLFSVFKEKAGVMSAQVHRVGTWAQAGDLIAEQVKALKAQR
FT                   VHLFPTPQLEKTNCRAALAKTGVTISEKLDRHELDIADVGITFVPYAVAETGSIFHPET
FT                   DPLGRAVTMLPPTHIAVVPFNKILPTVAEALETVVKDFGAVPGYMSFISGPSRTADIER
FT                   VLTIGVHGPSKLIVIVVDEGV"
FT   gene            426444..427814
FT                   /locus_tag="HM1_0361"
FT   CDS_pept        426444..427814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0361"
FT                   /product="transporter, major facilitator family"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82980"
FT                   /db_xref="GOA:B0TEZ7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEZ7"
FT                   /protein_id="ABZ82980.1"
FT                   /translation="MQWRDPVDKRNFYFMTANGALYFTALAFIDGTIVVPLFLNQLTQS
FT                   PVLVGLASTVRTVGFFLPQILMAGWVTGATRLNRFIFRLHLTTRLPLFLPALAVWFDAP
FT                   PALVALLFLSAYTLFAFGEGIAQVPWMDVFGRTIDDSHRGKLFGTMQALGGLGALAGTL
FT                   VVQRVFASPRLTFPDNFALLIAIGAACMFLSTIMIRLAVDPPKTKEEARQLSVAHVLRR
FT                   IPQYLTEDRRFSRMLLVQVLTSFNVLGFPFYILFIQQAGVLPPWAPGFLLSLQVLGQVS
FT                   GGLLLGYLSDRVGNRRTIMSVTAINIAVPLFIVFSQQLAGMAAFAGTGLGFMFLGACFG
FT                   GWLGFVNYLMEITPAEKRPVYVSLSNLFSAPVALLPITAGAFLRLVPMQWIFWVVAAIE
FT                   AAALLLAYRLPEPRESRGAGTLDAVGKVGLAGAKRTVQGALGERAPTPAYPPEEGKE"
FT   gene            complement(427945..428505)
FT                   /locus_tag="HM1_0360"
FT   CDS_pept        complement(427945..428505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0360"
FT                   /product="ketoisovalerate oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82979"
FT                   /db_xref="GOA:B0TEZ6"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEZ6"
FT                   /protein_id="ABZ82979.1"
FT                   /translation="MEHRLIFAGFGGQGVMLMGQLVAYAGMLEGKHVAWIPSYGPEMRG
FT                   GTANCAVTVSERPVASPIVYEPTGAIVLNQPSLEKFGPLLVPGGLLLINSSLIGRSSPR
FT                   TDIAQLCLAANDLANQLGNLKVANMFLLGALLRLTNVVDKESIMAALQKILPPRRHNLL
FT                   PVNRAALETGMEQAASSVRPSRV"
FT   gene            complement(428507..429256)
FT                   /locus_tag="HM1_0359"
FT   CDS_pept        complement(428507..429256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0359"
FT                   /product="ketoisovalerate oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82978"
FT                   /db_xref="GOA:B0TEZ5"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEZ5"
FT                   /protein_id="ABZ82978.1"
FT                   /translation="MGTKVFSRPDCLRDVASHYCPGCHHGIIHRLVAEAIDELELAPRT
FT                   IGVAPVGCSVFIYDYIDTDFIQAPHGRAPAVATGVKRALPDRIVFTYQGDGDLAAIGTS
FT                   EIIHTAARGENVTVIFVNNAIYGMTGGQSAPTTLLGQSTTTAPQGRDAGADGAPIQVCE
FT                   MLNTLQRPAFISRVSVHTPAQVVRAKKAIRRAFQCQQEGKGFSFVEVLSACPTNWGMTP
FT                   LDANKWLEQYMLPYYPIKDFRIPEGVQ"
FT   gene            complement(429260..430372)
FT                   /gene="oorA"
FT                   /locus_tag="HM1_0358"
FT   CDS_pept        complement(429260..430372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oorA"
FT                   /locus_tag="HM1_0358"
FT                   /product="2-oxoacid:ferredoxin oxidoreductase, alpha
FT                   subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82977"
FT                   /db_xref="GOA:B0TEZ4"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEZ4"
FT                   /protein_id="ABZ82977.1"
FT                   /translation="MINMAEKVLMKGNEALAEAAIRAGCRFFFGYPITPQNELLEYMAR
FT                   HLPEVGGTFLQSESEIGAINMVFGAACAGVRVMTSSSGPGISLKQEGISYIAGSEVPAV
FT                   IVNIMRTGPGLGGIAPTQSDYFQATKGGGHGDYRLMVLAPASVQEMVDLTALAFEKADE
FT                   YRNPVLILGDGVLGQMMEPVVLPAPSPEKTVEKPWATTGKGDNEKAKLITSLYIQPEEA
FT                   ERFCDHLRAKYSAMEERETRFECYRTDDAEIIAVAYGTAARLCMAAVDMVREKGIRAGL
FT                   IRPITLFPFPSAPLRKAAEGGAWFLTVELSTGQMVEDVRLAVGGRQPVAFYGRSGGMVP
FT                   DPRVIAARLEELAEKKGNAETAQPNEGGAA"
FT   gene            complement(430381..430587)
FT                   /locus_tag="HM1_0357"
FT   CDS_pept        complement(430381..430587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0357"
FT                   /product="4fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82976"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEZ3"
FT                   /protein_id="ABZ82976.1"
FT                   /translation="MPKVIFREERCKGCRLCTAACPAGIVVMDESRLNAKGFQPAVVTD
FT                   MEKCRGCALCARVCPDLVIEVEK"
FT   gene            430505..430654
FT                   /locus_tag="HM1_0356"
FT   CDS_pept        430505..430654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0356"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82975"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEZ2"
FT                   /protein_id="ABZ82975.1"
FT                   /translation="MTTIPAGQAAVQRRHPLQRSSRNMTFGNNNTSPADDLLGLSIRKV
FT                   SNIL"
FT   gene            complement(431009..432139)
FT                   /locus_tag="HM1_0355"
FT   CDS_pept        complement(431009..432139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0355"
FT                   /product="abc transporter"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82974"
FT                   /db_xref="GOA:B0TEZ1"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEZ1"
FT                   /protein_id="ABZ82974.1"
FT                   /translation="MKGIRRTPFWSVFRKEFLHLWRDRPSLAMAAGIPLMMLFLFGYGV
FT                   NPDVRRLPTVVWDQCRSAESRELLQAFVNTTYFELKESAGGYGDIGQSLAAGRSRVALI
FT                   IPPDFAANLQAGRLATIQVLLDGTEPQSTRQALQVAQSLVQAHGAQMLRQKEGALQQSF
FT                   PLEARIGIWYNRELKTHFFTIPALIGLIMQNVTMTLTAFALVREKERGTMEQLIVTPVR
FT                   PAELILGKLCPYVIVGMISFTLVLSAGSAWFSVPVRGSLPLLFGLAFLFVLTSLSIGML
FT                   MSTFSDNQLQAMQMAFAFILPSILLSGFVFPRETMPTPIRILGNFIPLTDFLVILRGIF
FT                   LKEIGMGELYREVLSLAAFTVFLFVVALRRFRKRLD"
FT   gene            complement(432169..432945)
FT                   /locus_tag="HM1_0354"
FT   CDS_pept        complement(432169..432945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0354"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82973"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEZ0"
FT                   /protein_id="ABZ82973.1"
FT                   /translation="MRAKKAIISLALTSLLGVAAFLPDLPEQPLSRLSRTEPSRYAGFV
FT                   EADVFTVVAEVTGRMQRLSVREGDTLAGEDVVAQIDDTYAELRVRQAEAALALARASGR
FT                   VGDAAVSPALLAAQVAQAEHSLELARLERDRCTVRAGRGGTVQRIHVQPGQTIGPGAPI
FT                   ATLIDRQDLKVRIFVPAEALPQFTPGGKVRLVEGMETFAGTVEQVSEQEEFSSFIVGGS
FT                   GKSGDRVFAVKIAIREGCERLRPGMSVQVKPDNGED"
FT   gene            complement(433167..434054)
FT                   /locus_tag="HM1_0353"
FT   CDS_pept        complement(433167..434054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0353"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82972"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="InterPro:IPR036582"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEY9"
FT                   /protein_id="ABZ82972.1"
FT                   /translation="MFFLAVALSLMLLVSSEWSEAQLAAPPGRSSAERRPVIVLNGLPM
FT                   EFAPHPRIERGYILAPVRPLAEALGAEVTYDNKSRKAVIRRDNLCLEVQAAPLNRKWQP
FT                   WERGTRASGKIEDDRMLVSVYWLARHLGDGWVWDRETATGFLRGGAPWRDEDYVAFTRW
FT                   AEILWMRAAARENTKLLKERGLQPPPTIRREEDLQRFLGAYWSHDNVHSLWESRYADKE
FT                   SAVAGRPVDGVVIDATTVHSWRIVSRTPEEVQVEGYLSGAGKYGFLDQKVTYVLRPDGK
FT                   GAFKIQERRVGALI"
FT   gene            complement(434331..435113)
FT                   /gene="rnz"
FT                   /locus_tag="HM1_0352"
FT   CDS_pept        complement(434331..435113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnz"
FT                   /locus_tag="HM1_0352"
FT                   /product="ribonuclease z, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82971"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEY8"
FT                   /protein_id="ABZ82971.1"
FT                   /translation="MFRITFFGTGNGLSYPNRENTFFLVQVGKAYLVDCGGAPWPKLVK
FT                   AGLRPDDLGAILITHGHPDHTYGLPALIQSLWLAGRKKLLPIYFPAGARGIVQGLLDLF
FT                   ELTTKPNMFPIAFREQPLEERETEALQDGSLTVSTFPAIHGIPTMGVSFLDESKEGLEK
FT                   SPIKVVYSADTAYNPLLETVALEATCLIHECNGADKAAGKHSSLHDVARLMKKTNPKQV
FT                   AIVHLTEGEGYERLMAQYGLAQPRFMIAEDGMSIRVAQ"
FT   gene            435370..436182
FT                   /locus_tag="HM1_0351"
FT   CDS_pept        435370..436182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0351"
FT                   /product="putative transcriptional acitvator, baf family"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82970"
FT                   /db_xref="GOA:B0TEY7"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEY7"
FT                   /protein_id="ABZ82970.1"
FT                   /translation="MLLVLDIGNTNIVCAVFDDDKQSASWRLATDRRKTVDEYRILMLE
FT                   ALETKQIAMGDIDRVAISSVVPPVNPVLIKMFRDYWGLQPLLVQPGIKTGLNIKIDDPR
FT                   ALGPDRIVNAVAAYSLYGGPVIIVDLGTATTVCAVNEKGDFLGGVICPGIGISVEALVA
FT                   HAAKLPRVEITEPEQAIGKNTVAGMQSGIYYGYVGMVDGLVRRFKNEMGESSDSPVKVV
FT                   ATGGFGELIGRGCATVDHIHPSLTLEGLRLLYERNRPAALSRRAIRPR"
FT   gene            complement(436214..437389)
FT                   /locus_tag="HM1_0350"
FT   CDS_pept        complement(436214..437389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82969"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEY6"
FT                   /protein_id="ABZ82969.1"
FT                   /translation="MRKTIKAVGAMVLAAVLLQGGVFWLLENWAAQAVNPDDHPVSAGK
FT                   SQWRQVKVKAPLERARQFSLSHRGEYLVWNDGDGFTVWDIEEGRPFYSEKMPPGQRVAL
FT                   VQWLNDRNRLLLITEQSAAPVNLPAPSSKGKTANQVLVDSMNRVDKRPMPSNPSSKQLE
FT                   FSFLNADGGQRIFSTRIRGLTAADEVKEAVVSTQSNLLYLTLGDSRQTTGLYRVDIQHD
FT                   AARIALRAGTNVERLRVNPAQGQVYAEFWSGDSASKPFVQGIKGTQLINPAAGQALNYL
FT                   LVGMDAKNNLYLGQGPGRQVQELWVWNGKKLEKSIRLPETAHRDRMLVGPEGQLVVVDE
FT                   PKSMLKVYPKGSESPSVFSFAAGARLINSDNHFVGLILPGSAGGDLWLFTF"
FT   gene            complement(437393..438376)
FT                   /locus_tag="HM1_0349"
FT   CDS_pept        complement(437393..438376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0349"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82968"
FT                   /db_xref="GOA:B0TEY5"
FT                   /db_xref="InterPro:IPR018711"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEY5"
FT                   /protein_id="ABZ82968.1"
FT                   /translation="MKSFFKNTALFIVINLLVGVIMGPLLLFYGPMPALRQMVVGSIVT
FT                   SRHGFVAEWFLSTERIREILGPSEAEDIRTTPLSGFAVSKANNKGNDRIEVEDIQGYRF
FT                   TGKVMIVHDPLRIKVAVSSKLGEAGETVPEMARREGAVAAINGGGFIDPNGQGNGAYPD
FT                   GITVSRGQFISVIDEDQKENIIGITKKGQMIVGRYSARELRSMDISEVVTFGPPLVVNG
FT                   RPTITSGDGGWGVAPRTGIGQRSDGSIIMVVIDGRQIGSIGATLRELQDLLLKYGAVTA
FT                   GNLDGGASTTMVYNGKVINQPSSVFGIRYIPTSLVVLPTNQSKGGI"
FT   gene            complement(438436..439233)
FT                   /locus_tag="HM1_0348"
FT   CDS_pept        complement(438436..439233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0348"
FT                   /product="hydrolase, carbon-nitrogen family"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82967"
FT                   /db_xref="GOA:B0TEY4"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEY4"
FT                   /protein_id="ABZ82967.1"
FT                   /translation="MKVGLLQFNVCSGDRKANVETVARYMAEAREACPDVLVLPEMWTT
FT                   GYDWVNLAALADDGESFGALLACWAKETGATIVGGSSPVGANGRYANTLYAYTPEGERI
FT                   LSYEKVHLFGMMGEERHLAAGSSTGNFCIGAVPCGAVICYDLRFPEWIRKTVLAGCEIL
FT                   FIPAQWPLSRLDHWRILLQARAIENQCYVIACNRTGRDEQGVAFAGHSMVIDPWGVIAV
FT                   EAGEEEGWIWGEIDRDKVERVRRKMTVFADRRLDLYDFCHCPS"
FT   gene            complement(439230..439343)
FT                   /locus_tag="HM1_0347"
FT   CDS_pept        complement(439230..439343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0347"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82966"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEY3"
FT                   /protein_id="ABZ82966.1"
FT                   /translation="MQRLSSCDPLVTCQQTDLLEKTVDKIVDIVNYWEDVS"
FT   gene            complement(439385..439546)
FT                   /locus_tag="HM1_0346"
FT   CDS_pept        complement(439385..439546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0346"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82965"
FT                   /db_xref="GOA:B0TEY2"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEY2"
FT                   /protein_id="ABZ82965.1"
FT                   /translation="MLGLTWDLRLPIVTFIGSVAGTPVLTVLLSRMAKGCGFAGADDGL
FT                   GIKSALLV"
FT   gene            complement(439717..441213)
FT                   /locus_tag="HM1_0345"
FT   CDS_pept        complement(439717..441213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0345"
FT                   /product="acetyl-CoA hydrolase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82964"
FT                   /db_xref="GOA:B0TEY1"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="InterPro:IPR017821"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR038460"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEY1"
FT                   /protein_id="ABZ82964.1"
FT                   /translation="MLSQRLRNESFKDRIMSAEEAAMLIEDGMTLGFSGFTPAGDAKAV
FT                   PVALVERVKKEGKPFKINLFTGASISSKVDSLLSDAGIVNMRLPYQSDKGMRKNLNAGK
FT                   VHYMDQHLSHTAELLRSGALPPVDVAIIEAVAITEEGHLVLSTAVGNSPIFAQMAHTII
FT                   VELNLAQPLALEGIHDIYMPAPHGEREPIPLKHPGDRIGTTTLAVEPDKIKAIVVTNQP
FT                   DVNAAMAPADEETATMASHLINFLRQEVEAGRLGPNLAPLQSGVGSVANAVFYGFLDTD
FT                   FTDLEVYSEVLQDAVFELMDAGKIKVASGCSLTISPAKHDEVLENLEKYRDRLVLRPQE
FT                   LSNNPEIARRLGLIAINTAIEVDIYGNVNSTHIMGTQMMNGIGGSGDFARNARLTFFCT
FT                   KSTAKDGKISSIVPMVSHCDHTEHDVDVIVTEQGLADLRGLSPRERALKIIENCAHPVY
FT                   KPQLMAYYEEALQRGGHTPHVIEKALSWHAKFIKEGTMTA"
FT   gene            441938..442615
FT                   /locus_tag="HM1_0344"
FT   CDS_pept        441938..442615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0344"
FT                   /product="integral membrane protein terc"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82963"
FT                   /db_xref="GOA:B0TEY0"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022301"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEY0"
FT                   /protein_id="ABZ82963.1"
FT                   /translation="MAVGSIILVDLILSGDNAILIAMACRNLPPELRTKGIVWGTAGAI
FT                   GLRMILGALIIYLLKVPLLQAAGALLLIWIAIKLLIQENDHGDVAGPERLWQAVKTIII
FT                   ADAVMSLDNVLAVAGVSHGKPGLLWFGLLVSIPLVVYGSRLFLTLIDRFPLILYGGSGI
FT                   LAWSAGKMLIHDPLVFAFLKKASLSPLLLEEKLVAAVVTAIVLGLGWYLNERQKKKTAL
FT                   EEA"
FT   gene            complement(442883..443317)
FT                   /locus_tag="HM1_0343"
FT   CDS_pept        complement(442883..443317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0343"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82962"
FT                   /db_xref="GOA:B0TEX9"
FT                   /db_xref="InterPro:IPR024528"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEX9"
FT                   /protein_id="ABZ82962.1"
FT                   /translation="MALLLDLALSFIVTAAFGVLQQLPTCTLLPAGILGVVGRSIYLGV
FT                   NAQGQSPVMGSFLGAVAIAVLAEALARWQKMPVIVYVVASFIPLVPGLIIYESMGVLLQ
FT                   GEYTRGIALATQAGLIAVAIAAGLAIVSSVARFYNRLYHR"
FT   gene            complement(443317..444099)
FT                   /locus_tag="HM1_0342"
FT   CDS_pept        complement(443317..444099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0342"
FT                   /product="integral membrane protein duf6, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82961"
FT                   /db_xref="GOA:B0TEX8"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEX8"
FT                   /protein_id="ABZ82961.1"
FT                   /translation="MERHDVLRLAMDAGEIMLVNGGETYRVEDTIRRICQAGGLSGAEA
FT                   FVTPTGIFLSVDGAGGDPPLSLVRRIPQRTIDLSKIAGVNDFSRRFAAGRMAVDEGMQE
FT                   LAAIRREVTHNHGRTLLASAVGAAAATLLLGGSLADLFPAALVGAVTMGLLDRLTVLQT
FT                   THFIKEFAGGAIAAVIALLLSESVRLAGGQAGLLHPDKIILGTLYLLVPGVTFTNAVRD
FT                   LIAGDLVSGAVRGLDALLVAGALAGGSGFVLAFWGGGF"
FT   gene            complement(444225..445169)
FT                   /locus_tag="HM1_0341"
FT   CDS_pept        complement(444225..445169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0341"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82960"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEX7"
FT                   /protein_id="ABZ82960.1"
FT                   /translation="MDDENQKGEWKTLADVSDHLKVPRERVMAWVLAGDLAAVDLDGSG
FT                   EYRIRQEELTDFLRRQQERTNLAVEKTRRKIEEEAIVLSGLYDWLQQDNASLAALYKTM
FT                   DDCLLQVIDQFKSQYDNARSSGEISRARAFQDGLLEVYARWEKPKQAYQQWLLSQERRW
FT                   QVFIAQLGPMMESDGVLLTPADPFLAINMSDSNDDSQGTILENRRRHRDFYQALYLWTK
FT                   RENNTLREHYERMERCISKMVDAMQDMAKKASKNMEFERGQAFQEASTIIYQQWEHSRS
FT                   QYNQWLLGFHERWLTCQATVKLELAKYRQQQDE"
FT   gene            complement(445185..448088)
FT                   /locus_tag="HM1_0340"
FT   CDS_pept        complement(445185..448088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0340"
FT                   /product="lysm domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82959"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEX6"
FT                   /protein_id="ABZ82959.1"
FT                   /translation="MTLERIIGSGNGEWGQSGVELYLISLDLGCPDRDREQVGSVDAEM
FT                   ELLHVTRMDDEVRANIRLQVRAIMEPAVEGAGRRSDAGAGCRGACNGKGERSGDCPESL
FT                   SLIEQEIPPGPKMFRQEQILVVQMPGPEDEHKGDDGDTYRLQEASALSILYIHPYWSEE
FT                   RLKVDLLLSVGLVTEEVPGSRNIRWMEQTVRIEGEGLPEEARVVAIAWRADHGDREATT
FT                   ELRTQLAYLSDEGDPMGILEKVTTFSDGILWLGEPRLTLNGSNWAIYGPAWLPLSQSLG
FT                   AEAELAFGEVPAEEEGLQSGFGAIEPIPLGRSADLEPDAQAKEEIAATSDTESAIHGVA
FT                   REGGVTVGNMAIGYGAVANGTVNDGTVHDDVVGEGDTDDVFAAGVVSDGMSLAQDEVDS
FT                   ALQEATVTLDQSEPFGPLSGIQALWPHDMEEMLGGAPIPELSPIPLQRFGDIGYDPAEH
FT                   EREFQADPGHREWTEYPAPPGFDGVSEYPLPEADSPQDFHDQTAAAQDEGLAITMERET
FT                   EGLGQGDSTELIGGFADYLDSTLYTAQYGEGFLYPDPSLATAMSEGTEEESEPASLWEE
FT                   TPAGSFDEVEAAPDIVAEAQTASIVAEADLPSIVAEADLPSIVSEADLPSIVAEADLPS
FT                   IVAEADLPSIVSEADLPSIVAEADLPSIVADADLPSIVAEADLVSIVAEADLPSIAAEA
FT                   DLTPVEAEAEMLSVTEEAGTAVTEEMEATDSTAEAEAPLVPAEPVTPVLVEKVDPLFEA
FT                   EEVETEFLESEVDTSTMGMEIAEYSSPTPLAGDLMDILPELAQDTPAEPPITQPLSIKT
FT                   SLSGTPRITSRFRDRLGAGDGAPGKKIGPKEEPQPIPAVRRLARPLPNIPVAVNPAPEM
FT                   SLRESKPRDIRRIQRPGDDLHKTAAAAKNPMTEKSDAKGNRKDGGWRFVVVGAGDTVSS
FT                   IARRNRIPEEVVRSVNKLSTDDTLRAGQTLMLPRHWM"
FT   gene            complement(448130..449332)
FT                   /locus_tag="HM1_0339"
FT   CDS_pept        complement(448130..449332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0339"
FT                   /product="glycosyltransferase, group 1 family protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82958"
FT                   /db_xref="GOA:B0TEX5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEX5"
FT                   /protein_id="ABZ82958.1"
FT                   /translation="MGAYHEQGMPFADNGAVAEAQAGRWSVRIGIDARAAIWYRGTGIG
FT                   TYTYQLCRHLYDLYDAAAPERLRLFWPGEEYRQLHITQEEVFRLVEQNRERFWEEVHIP
FT                   QAIQREKIDLYHVPQNGIGLPASKACKLVVTIHDLIPYICPETVGRGYLRIFLEEMPRI
FT                   LERVDHIIAPSRCTACDLMQIAGVPEEKITVIYEAAEPIYRPLDKARARAFMQEKYGVS
FT                   RPYVLYVGGFSPRKNLRLLIHAFHQVRRQLPEDYCLVLPGKQSKEFNDIEIMVTSRGLQ
FT                   EHVHFIGFVGVDDLPWIYNGASVFVYPSLYEGFGLPPVEAMACGTPTLVANVASLPEVA
FT                   GDGALLFSPVRAGQLEELLFALLTDPALAAELGERGLRRAACFSWRQAALSTGEVFARL
FT                   V"
FT   gene            complement(449368..450414)
FT                   /locus_tag="HM1_0338"
FT   CDS_pept        complement(449368..450414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0338"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82957"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR014255"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEX4"
FT                   /protein_id="ABZ82957.1"
FT                   /translation="MKTVYGIMGIDPRVLLAYRMRPRRIEPVRGAYRIEDTGGVWVLKR
FT                   FPHAVEDLQFIFRAQHHLAARGFRRFSPIRLTPQGALCLSVGSEHWLCSAWVEGRECDF
FT                   DRWRDLAATAAAVAEFHYAGRGFIASEFAGRCLWQRWPQIIATKTAQLEACRRVAVERM
FT                   EQRVHAGGEEPDDSTEFDRLFLTHADTLLAEAREACALLDHSAYSMLMEREAAGGGLCH
FT                   HDLAHHNVIIDDEGQIFFLDFDHAVMDTRLHDVGSLLIRALKRDRWSVEKGVNLLSAYH
FT                   DAYPLSQAEREVLVAFLSFPNDFWQYVYAYYFESLAQPPEYHIKRLKRFLNHQKQRRRF
FT                   LNEFPGRL"
FT   gene            complement(450422..450547)
FT                   /locus_tag="HM1_0337"
FT   CDS_pept        complement(450422..450547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0337"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82956"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEX3"
FT                   /protein_id="ABZ82956.1"
FT                   /translation="MQQPFSLIAVLDENDGPARLFHGRRSTAAENPRSALPVERG"
FT   gene            complement(451149..452048)
FT                   /locus_tag="HM1_0336"
FT   CDS_pept        complement(451149..452048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0336"
FT                   /product="tungstate abc transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82955"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEX2"
FT                   /protein_id="ABZ82955.1"
FT                   /translation="MIRKTAPKTLALVLFLILSLLLSACGTAPKPGGGQAQNTPAPAQT
FT                   DLILATTTSTMDSGLLDVIIPAFEKKTGYKVKPLSVGTGQALAYGEKGEADVLLVHAPD
FT                   AEKKVVEKGAAVNRKLVMHNDFILIGPPDDPAGVKGLHSTVEALKKIAGAGKLFVSRGD
FT                   DSGTHKIEKSFWQKAALTPAGNAWYQETGAGMGQTLNVASEKQGYTLTDRATYLAQKKN
FT                   LKLDIVLEKEPALLNIYHVMEINGEKFPKVNKDGAKAFSDFLLSAECQEMIKNFGVDKY
FT                   GEPLFVPDAGKNVESLGK"
FT   gene            complement(452097..452954)
FT                   /locus_tag="HM1_0335"
FT   CDS_pept        complement(452097..452954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0335"
FT                   /product="abc transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82954"
FT                   /db_xref="GOA:B0TEX1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEX1"
FT                   /protein_id="ABZ82954.1"
FT                   /translation="MNPEVCAALEKVEVVKSRRSLLQIDKLHFRAGEITAIIGPNGAGK
FT                   STLLKVLHGLEKPTAGTVCFRGQSLGGRDLLELRRRMAMVFQSPCLFQTTVYENIAAGL
FT                   RIRKFRRSEIDPIVRRWAARFGVEPLLERQARHLSGGEAQRVALARALACGPELFLLDE
FT                   PFASLDPPTREALCRELRAVIKEEGITAVVVTHVMEEVFLLADRAVMLSAGRVVQDGTP
FT                   EELLARPANSEVADFVGKRRILLGRVVARTGEMVEVATPEGRFRLPAAAGGEGTFLLCL
FT                   REGE"
FT   gene            complement(452951..453649)
FT                   /locus_tag="HM1_0334"
FT   CDS_pept        complement(452951..453649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0334"
FT                   /product="abc transporter, substrate-binding protein"
FT                   /note="Putative tungstate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82953"
FT                   /db_xref="GOA:B0TEN4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEN4"
FT                   /protein_id="ABZ82953.1"
FT                   /translation="MDLIIEGVGQAIRLLIQGDPEVWAVTWLTLRVSGLATLISVLIGV
FT                   PLGVLLAQSRFPGKAVVVSLVNTGMGLPPVVVGLFVTIMLWRSGPLGVLGLLYTPAAMI
FT                   IAQAVIASPIVMGLTFAAIEQLDPNLRLQILSLGATRWQVYWRLIQEARLSILAAVIAG
FT                   FGGVVSEVGASMMVGGNVKGLTRVLTTATVMEVSKGNLDVAIALSLILLALAYGVTLVL
FT                   TVIQQGRRMG"
FT   gene            complement(453829..454287)
FT                   /locus_tag="HM1_0333"
FT   CDS_pept        complement(453829..454287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0333"
FT                   /product="regulatory protein, lysr family, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82952"
FT                   /db_xref="GOA:B0TEN3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEN3"
FT                   /protein_id="ABZ82952.1"
FT                   /translation="MEAKDVMTAPEQLETKVNCKIWVEVRGEVVFSQGRMRLLEAIEET
FT                   GSISQAAARMGMSYRAAWGKVTTTEGRLGLKLVERFPGHREHGAALSETGRALLRQFQE
FT                   FNRASQASVEDLFHKHMRGLIESLPPKAPSPVPLHPKTDDIQHAIPSD"
FT   gene            complement(454375..455964)
FT                   /locus_tag="HM1_0332"
FT   CDS_pept        complement(454375..455964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0332"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82951"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEN2"
FT                   /protein_id="ABZ82951.1"
FT                   /translation="MLVVDRYVGVDPRFQSNARKARTRRSERRSPERAGTLADQRDDVP
FT                   DLENPLFDDSQPIEGIVLIANPLGYGNPLPPLDLEPLEEIFPDTPLPPFVWEQGLAEAE
FT                   PSTVRIGGEKEAATALAGDAALTEDVFENEVITGDEAVTGKNMPAEGEASLGNAMTVGN
FT                   DAFFRNEPALSGNASLAPDLRAERETLVDLLAEYDLTLRSLHRQGGRFLAETDRGPLRV
FT                   EFLEGEKALQRGRNITAALKHLREKGFTQCPEPRVSKYGERVIPWGDRAYYLYNKLPGR
FT                   SAKLDASRDLQEAGRSLALLHRGGRGFQPVEPSVAAPLDIPGQFAWGRQVAADWLATVG
FT                   RQRFFSDSDHLLRENLPKLTERGEKGFAWMEAAYQEKRRQTEQEGALCHGDYGAASLLK
FT                   TQQTFWVDRFNHCRCDIPVTELAQFISNIVRSSRDGWKEAIYVVEGYESVEKLNEADWR
FT                   ILLGCLIIPFDLFEHLEGKIRTEPANTIEIIPDRKLQDQGFRRTRRTIETCNRAYAAAY
FT                   RLAAQAELALPI"
FT   gene            complement(455984..457042)
FT                   /locus_tag="HM1_0331"
FT   CDS_pept        complement(455984..457042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0331"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82950"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEN1"
FT                   /protein_id="ABZ82950.1"
FT                   /translation="MASILAPALRKGEMTMRDGQESPKLSKWDMDALQEYPYTVTAADR
FT                   QGNFWRLETNRGIKAFYRHEEKADRVAETHAMLEHLAERGFRRASRFIRTRDGRPFAQR
FT                   GPYTYVLTDWLPGRSTDFQRDDDLRQAARTLAAIHWSGAGFHGGGEKDAQKVSRLLKTL
FT                   ADRREALQWYRQLAQMKRQTSEVDRLLKEWGPEFEQKATRALRRVADTMVKPSGEAGWT
FT                   ICHRDWREGNLHLDGARLAVTGWDSCGPDLPAAELAQFLRRVADARGRWDVESGMQIID
FT                   AYRETGNLGTGDRELLVGLLEFPQRFWSLVAGHYRGAGEPSTPELLRREIAEEAGRQDF
FT                   VASLERHLGTGN"
FT   gene            457066..457179
FT                   /locus_tag="HM1_0330"
FT   CDS_pept        457066..457179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82949"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEN0"
FT                   /protein_id="ABZ82949.1"
FT                   /translation="MTTQNTSAGEKEIPKLYAENLGMFMREDRGACLPPFD"
FT   gene            complement(457191..458315)
FT                   /locus_tag="HM1_0329"
FT   CDS_pept        complement(457191..458315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0329"
FT                   /product="CoA enzyme activase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82948"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="InterPro:IPR008275"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEM9"
FT                   /protein_id="ABZ82948.1"
FT                   /translation="MTRKQKNQQQHTQRQNDQPQNMHPINNQGLNTQRPSAGERYYLGV
FT                   DVGSVSTNLVLLSENGEVREAHYLRTQGRPLEMIQKGLADLARRYADEQIGGVGTTGSA
FT                   RTLASVVLGADVVKNEITAHAVAAGQLVPGVRTILEIGGQDSKLILLRDGVVSDFAMNT
FT                   VCAAGTGSFLDQQASRLQLPIEEFGGLAEQADHPVRIAGRCSVFAESDMIHKQQMGHAL
FT                   PDIIAGLCEALVRNFLNNLGKGKTLEAPIVFQGGVAANAGMKRAFEKALDHPVVVPEHH
FT                   KVMGAVGAALLAREAVERAGGLTRFKGFAMASEDVRAGSWECGDCPNLCEVIEIVESER
FT                   PIARWGDRCGKWENSLSVIQTERAAEAAAELQQG"
FT   gene            complement(458312..459409)
FT                   /locus_tag="HM1_0328"
FT   CDS_pept        complement(458312..459409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0328"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82947"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEM8"
FT                   /protein_id="ABZ82947.1"
FT                   /translation="MKVTFPHMGNMDIVVKALLEELDLEVIPPPPITKRTLSLGVRYAP
FT                   ESACLPLKINIGNFIEAAERGADTVVMAGGIGPCRFGYYNQVQREILVDMGIDLRMVVL
FT                   EPPDNHIGELLNRIKVLTGAHSWWRVIKAIRIAYVKCQALDDLERQASRLRCRELNRGD
FT                   VDRLYQSGRDAIDAASSVKEIRQCRDDALTRMTALPLDHALRPVRIGIVGEIFTVLEPY
FT                   SNGFMEKSLGRLGVEVSRSLYLSEWVNEHLFKGILPVKGHHRTRKLAAPYLSCAVGGHG
FT                   QESVGGAIEYAQEGFDGVIQVGPLTCMPEIVAQSILPQVEKDYDIPILTIYVDEQTGDA
FT                   GLMTRLEAFVDMLERRKQRKEQAAR"
FT   gene            459486..459626
FT                   /locus_tag="HM1_0327"
FT   CDS_pept        459486..459626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0327"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82946"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEM7"
FT                   /protein_id="ABZ82946.1"
FT                   /translation="MPLIFYLNSHIASFSIFIWNRQDFIGYFAKKDMLRYNNTAYPLAK
FT                   I"
FT   gene            459691..460008
FT                   /locus_tag="HM1_0326"
FT   CDS_pept        459691..460008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0326"
FT                   /product="conserved hypothetical protein, putative cupin
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82945"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEM6"
FT                   /protein_id="ABZ82945.1"
FT                   /translation="MIDIPALVSACTEKWMNMAVSQVNDAVIRLGVIEGEFHWHKHDRE
FT                   DEFFFVVSGKLFIDLEDRTVVLLPQQGYTVPLGVLHRTRAPERTVILMVEKNTVDPKGD
FT                   E"
FT   gene            complement(460141..461244)
FT                   /locus_tag="HM1_0325"
FT   CDS_pept        complement(460141..461244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0325"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82944"
FT                   /db_xref="InterPro:IPR018709"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEM5"
FT                   /protein_id="ABZ82944.1"
FT                   /translation="MKITSVLTMRPPKAEVERPPVIGIPRALGYYEYLPLWRAFFEALG
FT                   CAVALSPRTNKALLDQGVRAAVDEACLPVKMYYGHVKALSGKADHVFTPRIISVQPKTY
FT                   LCPKFLGLPDMIRGAAAFDGGYPPLLVVDVNTRLPGGGWEKALTEAARKLNFSRNRARE
FT                   AFKVARKAQDEFEGRLLQGEYPPIALARWEKSGRVLEPGGLLPRLPSRHREPMTGEEPR
FT                   IAVAGHPYQLFDPFTSMNLLDKLKSRGIRMVTPMAVTEEKTRVATSHLPKRLFWSFGQQ
FT                   MLGGSLHLLKGPIDGLIYVAAFGCGPDSLVGEMVERHARRLGNVPYLLLTVDEHTGEAG
FT                   VVTRLEAFVDLVARRRETAEAATAAEG"
FT   gene            complement(461241..463169)
FT                   /gene="spoVAF"
FT                   /locus_tag="HM1_0324"
FT   CDS_pept        complement(461241..463169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVAF"
FT                   /locus_tag="HM1_0324"
FT                   /product="stage v sporulation protein af"
FT                   /note="Also member of Bacillus/Clostridium GerA spore
FT                   germination protein PFAM, PF03323"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82943"
FT                   /db_xref="GOA:B0TEM4"
FT                   /db_xref="InterPro:IPR004995"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEM4"
FT                   /protein_id="ABZ82943.1"
FT                   /translation="MSEAKKQEQTKKELRQTVLSEEELVADLKTNILQMNSELGVNVGF
FT                   DIACREMEIAGRQAAMYYVNGFTKDLDLLQIMKSLDAFEKEAKDKGAFDIDRLMDHHLF
FT                   YLQVTTEAKLRQVYYHILSGRVAFLFDGEKKAIVVEARQMPGRQPQEPDIERVVRGSRD
FT                   GFTETIVTNTALIRRRVRDPRLRFKLLQVGRRSQTDVAVAYIEDIASPELVQEITDRIN
FT                   AVDIDGLPMAEKTLEEFLTQGDWNPYPRVRYTERPDVAAMHLFEGHVLVLVDTSPSVMI
FT                   APVTVFHHLEHAEEYRQNAPVGVFLRMVRYAAIFASLFILPLWLMYAINPALLPTWLAF
FT                   IGPKEMGSVPIVGQVLIAEVGLDMLRMAAVHTPSPLATALGLIAAFMIGEVAIEVGLFN
FT                   PEIILYLAVAAVGTFATPSYELGQANRLIRLFLIVMVAFFGLPGLLVGISAFLALVMRT
FT                   KSFGRPYFWPIAPTNAKMIPVALLRAPVPAKRLRPQLLDPIDPDRLPDPYAGSAGGATS
FT                   GKAVSGKAEYGNVGEKGPRQSGAGAENAGSGHGIGGASESHEVRERREGYGGSEVHEGQ
FT                   SCYDMSPGGHHGGLHGHDRRQVGELFEETDVAGEPDHPGLREPLRWRKHRRGLWSWFKS
FT                   KVGGSRR"
FT   gene            complement(463170..463760)
FT                   /gene="spoVAE"
FT                   /locus_tag="HM1_0323"
FT   CDS_pept        complement(463170..463760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVAE"
FT                   /locus_tag="HM1_0323"
FT                   /product="stage v sporulation protein ae"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82942"
FT                   /db_xref="InterPro:IPR025914"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEM3"
FT                   /protein_id="ABZ82942.1"
FT                   /translation="MTAETARKRRVIVITDGDKVARKAVESATRRIGGRCISLSAGNPT
FT                   PVTGKKLAQMILSTPHDPVVVMVDDRGAVGMGKGEQALWEISHDDRIELIGAVAVASNT
FT                   LGAEGITVDQSVDRYGRLVDGPVDKNGYPEPPGNRYLEGDTVETLTQLPIPVIIGTGDT
FT                   GKMQGADHVRRGAPITTQALLEILRRAGNNGVD"
FT   gene            complement(463778..463975)
FT                   /locus_tag="HM1_0322"
FT   CDS_pept        complement(463778..463975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0322"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82941"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEM2"
FT                   /protein_id="ABZ82941.1"
FT                   /translation="MNAPKRRRWIVGILLLALLGGVGAWWTWRGEKPPKEAILVWKQGP
FT                   DREIPAGLFLRIKRADHDSY"
FT   gene            complement(464271..465065)
FT                   /gene="sigF"
FT                   /locus_tag="HM1_0321"
FT   CDS_pept        complement(464271..465065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sigF"
FT                   /locus_tag="HM1_0321"
FT                   /product="RNA polymerase sigma-f factor, putative"
FT                   /note="Also known as spoIIAC"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82940"
FT                   /db_xref="GOA:B0TEM1"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014236"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014322"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEM1"
FT                   /protein_id="ABZ82940.1"
FT                   /translation="MNQRLSEMNLPRFPLLGEEETTRLLRLAKDGDGDARERLIQCNLR
FT                   LVFNLVQRFQHRGYELEDLFQIGVIGLIKAIDKFDLSYNVRFSTYAVPMIVGEIRRFLR
FT                   DDSPVKVSRSYKEIAQRIHRVRQELNGSLGREPTVQEIAGAMNMPVEDVVEALEAVQLP
FT                   TSIHETLYQDDGDPIFLLDQLASVGTEESAWFDHLALKDVLSRLAAREREILEMRFFQD
FT                   KTQTEVATLVGLSQVQISRIERAALKKIRDMLSQTPPHEDGA"
FT   gene            complement(465079..465519)
FT                   /gene="spoIIAB"
FT                   /locus_tag="HM1_0320"
FT   CDS_pept        complement(465079..465519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoIIAB"
FT                   /locus_tag="HM1_0320"
FT                   /product="anti-sigma f factor"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82939"
FT                   /db_xref="GOA:B0TEM0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR010194"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEM0"
FT                   /protein_id="ABZ82939.1"
FT                   /translation="MKTKNQVKLEFPSIPENVALARVIVATMLAGMDFTLTDLDDAKVA
FT                   VSEAVSNAILHGYQNRPNGLVYLTITADPEGLEVIVEDYGRGIVDVAKAMEPAFSTLGD
FT                   RMGMGFVFMQSFMDKVDVDSQVGRGTRVRMYKACRQAMRAVQ"
FT   gene            complement(465516..465863)
FT                   /gene="spoIIAA"
FT                   /locus_tag="HM1_0319"
FT   CDS_pept        complement(465516..465863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoIIAA"
FT                   /locus_tag="HM1_0319"
FT                   /product="anti-sigma f factor antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82938"
FT                   /db_xref="GOA:B0TEL9"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR014237"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEL9"
FT                   /protein_id="ABZ82938.1"
FT                   /translation="MDIDRNGNALVVRLQGEIDLCAAEALRPRLDKEIERQKAKHLVFN
FT                   LRGVDFIDSSGIGFILGRYKRVKALGGKVALAGPTRSVHRIIELSGMYKLMEGYANEVE
FT                   ALRALEGGKTG"
FT   gene            complement(466042..467202)
FT                   /gene="dacA"
FT                   /locus_tag="HM1_0318"
FT   CDS_pept        complement(466042..467202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dacA"
FT                   /locus_tag="HM1_0318"
FT                   /product="d-alanyl-d-alanine carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82937"
FT                   /db_xref="GOA:B0TEL8"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEL8"
FT                   /protein_id="ABZ82937.1"
FT                   /translation="MKRSTFRLSLAMVFFFLASLIPVQAWAAPPLETQADSAVLMDPTT
FT                   GAILFEKNSHKRVAPASVTKLMTLLVAFEAIEQGKASLDDKVVTSQRAFEMGGSQIYLE
FT                   PGEEMVMRDLLISIAVHSANDACVAVAEHISGSYEAYVDDMNKKAQSLGLKDTHFMNPH
FT                   GLPVDNHYTSAHDMAVIAREALKHPTLMQFVAIKHHKIRESSSKPMQLDNHNRLLWWYP
FT                   GTDGFKTGWTSEAKYCLVSTVERDNLRLIASVFGVPEIRGHFKESMKLYNYGFSRYTFK
FT                   SVAKPGEPLGEVAVGKGRKERVQVVAQGKPGLIVERGKEKGIESRVELEPYATAPIAQG
FT                   QKLGDLVIVQNGQEVSRIDLVAKEDVPKGTLTMELTKIWQAMYGIR"
FT   gene            complement(467268..467768)
FT                   /locus_tag="HM1_0317"
FT   CDS_pept        complement(467268..467768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0317"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82936"
FT                   /db_xref="GOA:B0TEL7"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEL7"
FT                   /protein_id="ABZ82936.1"
FT                   /translation="MKLQEPSPPELRRLAESIAAEHSAMALAVSEGERANSPWLAPVYY
FT                   VCRDFQFYFFSSPASRHGAAAGETPVEAAATVFNEPDDYGGIRGLQMAGTLAMVSDWKE
FT                   RSWATAAFGARFSFFSRFLREPRLMLELRKNELYRFAAREVWITENRTGFGRRYLYRPD
FT                   GTE"
FT   gene            complement(467787..469205)
FT                   /gene="pdp"
FT                   /locus_tag="HM1_0316"
FT   CDS_pept        complement(467787..469205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdp"
FT                   /locus_tag="HM1_0316"
FT                   /product="pyrimidine-nucleoside phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82935"
FT                   /db_xref="GOA:B0TEL6"
FT                   /db_xref="InterPro:IPR000053"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR013102"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR017872"
FT                   /db_xref="InterPro:IPR018090"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="InterPro:IPR036566"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEL6"
FT                   /protein_id="ABZ82935.1"
FT                   /translation="MRAYDIIAKKRDGGELTAEEIRFFIHGFAKGKPFVNQEANALRSG
FT                   DEESLDNGERHCVTDYQAAAWAMAVFLRGMTEAETAALTEAMVTSGETVDLSPIPGIKV
FT                   DKHSTGGVGDTTTLILAPLVAAMGIPVAKMSGRGLGHTGGTLDKLESIPGLSIDLSREK
FT                   FLAQVKDIHVAVAGQTANLVPADQKLYALRDVTATVESIPLIASSVMSKKLAAGADAIL
FT                   LDVKVGRGAFMKNQDDAKELARAMVAIGNRLGRRTAALLTAMEQPLGNAVGNALEVAEA
FT                   IAILANRDECGFGPISADLRTVTLELAARLAWMAGKADSVEAGLHLAETTLTSGAALER
FT                   FRRFVAAQGGDSRVADAPETLLPQASIRQPVRASHGGLVTALDAMAVGRAAALLGAGRQ
FT                   QKGDPIDPAVGVVIHKRIGDTVKAGDVLAEVFANDSRWQAAAQAVSDAYAIGPGGEEEN
FT                   GALAPLPLILGEVH"
FT   gene            complement(469192..470370)
FT                   /gene="deoB"
FT                   /locus_tag="HM1_0315"
FT   CDS_pept        complement(469192..470370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoB"
FT                   /locus_tag="HM1_0315"
FT                   /product="phosphopentomutase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82934"
FT                   /db_xref="GOA:B0TEL5"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR010045"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024052"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEL5"
FT                   /protein_id="ABZ82934.1"
FT                   /translation="MKKRVILIVLDSVGIGELPDADRYGDRGSHTLANTARAVGGLHLP
FT                   HLAKLGLGNIDAIDGVAPVERPDGAFGKMAERAPGKDTTTGHWELAGVVLDKPFPVYPD
FT                   GFPPEVMAAFEKAIGRNTLGNVAASGTEIIERLGEAHMATGAPIVYTSADSVFQIAAHE
FT                   EVIPLEELYRYCQIARQILQGDHAVGRVIARPFVGVPTAFRRTTNRHDYSLKPPGRLVF
FT                   DVIGEAGQEVAAVGKIYDIYAGQGFSRHVSTRSNMEGVDCTLAYMQEVEQGLIMTNLVD
FT                   FDMHYGHRNDPEGYARALQDFDSRLPEILAALAPEDLLILTADHGCDPTTASTDHSREY
FT                   VPVLLTGRKTPAGVNVGVRSTFADVGETVLAWLGLPPLGVGQVIEEVRHAGL"
FT   gene            complement(470402..471388)
FT                   /gene="xerD"
FT                   /locus_tag="HM1_0314"
FT   CDS_pept        complement(470402..471388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerD"
FT                   /locus_tag="HM1_0314"
FT                   /product="tyrosine recombinase xerd, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82933"
FT                   /db_xref="GOA:B0TEL4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011932"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEL4"
FT                   /protein_id="ABZ82933.1"
FT                   /translation="MLFSLWRKEADKSRKQRQKGLRAMRHGDAFLAHLAVERGLSGNTI
FT                   DAYRRDLADLAAFLAERGIGDPADVTRSDLQDYLYHTYRRGLSAATRARRLAAIKGYFG
FT                   FLFDEAIRRDDPTELIDGPRLQRLLPDVLNVEEVAALLQAPPRTIVGLRDRAMLETMYA
FT                   CGLRVSELIALTLDQVRLDLGLVRVVGKGMKERIVPLGGLAAAAIEEYLSRTRGTLAGH
FT                   GAEKHLFLNQRGKPLTRQGFWKILKAYAAEAGIAKEVTPHTLRHSFATHLLSNGADLRA
FT                   VQEMLGHADVSTTQIYTHLTMGRLREVYDRSHPRARLAVRAQREEPG"
FT   gene            complement(471516..471989)
FT                   /locus_tag="HM1_0313"
FT   CDS_pept        complement(471516..471989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0313"
FT                   /product="iron-dependent transcriptional repressor"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82932"
FT                   /db_xref="GOA:B0TEL3"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036421"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEL3"
FT                   /protein_id="ABZ82932.1"
FT                   /translation="MAGDEFFTFREYMKKEEDCLTASMEDYLEMIYRLCQDQGFTRVHD
FT                   LAAALNVQPPSATKMVQKLAEALWVKYEKYGIIVLTDKGRETGRFLLRRHNTIERFLRL
FT                   IGLPEEVLQETEKMEHTVGEKTLVCLTDFVEFLRTRPDIMSDYEQFRREKQSS"
FT   gene            complement(472030..472272)
FT                   /locus_tag="HM1_0312"
FT   CDS_pept        complement(472030..472272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0312"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82931"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEL2"
FT                   /protein_id="ABZ82931.1"
FT                   /translation="MMLLLVTKVRRRIRTIVRVLVVLLLLGLLVPPFLNYAEQTAATTP
FT                   KEERPTGQPLRVEQRETPLMEQFVMKWKEWTAKKP"
FT   gene            472377..472574
FT                   /locus_tag="HM1_0311"
FT   CDS_pept        472377..472574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0311"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82930"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEL1"
FT                   /protein_id="ABZ82930.1"
FT                   /translation="MARRRYIVARSMTNTDAATTAATHKAQFVEGLQQNLPDYGKPTMT
FT                   GAERGLYGSIRPTWEIYPGE"
FT   gene            complement(472629..473261)
FT                   /gene="spoIIM"
FT                   /locus_tag="HM1_0310"
FT   CDS_pept        complement(472629..473261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoIIM"
FT                   /locus_tag="HM1_0310"
FT                   /product="stage ii sporulation protein m, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82929"
FT                   /db_xref="GOA:B0TEL0"
FT                   /db_xref="InterPro:IPR002798"
FT                   /db_xref="InterPro:IPR014196"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEL0"
FT                   /protein_id="ABZ82929.1"
FT                   /translation="MAILFRRSVTVGLGQGHLHAHWGFYALALTLIACGTVTGAVSAKH
FT                   LPPGQAEELQSRILQAFQEIRGGVDHHALLQPAVAHNLETVGLILLLGLTVLGIPLIAA
FT                   FLFFRGFVLGFAAGFLLLSRPEDGWFIILLALAPPSLVLLPALLLSGGMALAFSLWLVR
FT                   RRPYRAVPLRRALFMYALVGAGTLVLGAGAGLIDAYITPGLLGLFLH"
FT   gene            complement(473648..474196)
FT                   /locus_tag="HM1_0309"
FT   CDS_pept        complement(473648..474196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0309"
FT                   /product="hydrolase, nudix family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82928"
FT                   /db_xref="GOA:B0TEK9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEK9"
FT                   /protein_id="ABZ82928.1"
FT                   /translation="MEHLKEKTLESERVFDGNFIRLRKDRVVLPNGATSTREVVEHPGA
FT                   AAIVPLTPRKEVVLIRQWRHPIKEVSIEIPAGKLSEDEDPLECAKRELSEETGFSARRW
FT                   DPLIQFYASPGFCDEEMHLFIARDLYVSDGRPDEDEFVEPLVVPLEAALEMIETGEIMD
FT                   AKSIIGLLRAARFLEMEKV"
FT   gene            complement(474230..475345)
FT                   /gene="pepT"
FT                   /locus_tag="HM1_0308"
FT   CDS_pept        complement(474230..475345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepT"
FT                   /locus_tag="HM1_0308"
FT                   /product="peptidase t"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82927"
FT                   /db_xref="GOA:B0TEK8"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR010162"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEK8"
FT                   /protein_id="ABZ82927.1"
FT                   /translation="MIQRERIVKEVMALCAISSPGGGEREIADRLTATLRELGMTVVED
FT                   DAGAKIPGSAGNLYARLEGTVPGKALFFSAHMDTVVPCEKVCPVIRNGAICSDGTTVLG
FT                   GDDKAGIAAILEALRVLVETGEERPTIEVIFSVQEEGGLKGAKVFDTKRLKSPMGYVLD
FT                   ASGPVGHIINAAPFQNNIEAILHGRTAHAGFCPEEGVSAIKIASRAIHKMKLGRIDGET
FT                   TANIGTINGGTATNIVPERVVIAGEARSIDEKKLILQTRHMVDCFEQAAQELGGKAEVK
FT                   VTQVYPGYRLHASDPVVALALKAAVAMGIQPRLVPTGGGADANIYNGAGLPTANLAIGM
FT                   EKVHTKEEFIPIDALVGSARFVLEIIRQAVR"
FT   gene            complement(475342..476949)
FT                   /locus_tag="HM1_0307"
FT   CDS_pept        complement(475342..476949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0307"
FT                   /product="hdig domain protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82926"
FT                   /db_xref="GOA:B0TEK7"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEK7"
FT                   /protein_id="ABZ82926.1"
FT                   /translation="MHVGHPGYSLYALLRVGAVTVALVWAGFHPDPAIRRTLYPLLLLF
FT                   AFYSAGLYILLYRMPRQMNRLFAGATVVDLLGVTVFIYQTGGESNNLFYLAYILLVAAR
FT                   SVQFGFCGGLMTAIAAITLFFSVTLPSHSYWGDLFLQGSILLVTAFVVGSLADRMRQTH
FT                   RELERKVDELTALTEVTRTVNSSIELPQVLPAVLELSATVMKVDACAVHILDEQGSLQA
FT                   VASQGFPALEQERLPVEQCFMGKAIRTGAPVLYYVDQQAGDVCEPFFRAQGFACALSAP
FT                   LSNSSRTMGVLTVFAVEPNVFAYDDIELICLLATQVGNAIENATLYKKQKDLYLAVVQA
FT                   FVAAIDAKDSYTRGHSEYVHRYVRRIAARMNVPDDQLERIATAALLHDIGKIGVNSNIL
FT                   RKPGALNDEEYAEIKMHVTIGEQIISQVTDFRDLAPIVAAHHEWYNGKGYPEGLAGEAI
FT                   PLGARIIAVADAFEAMTANRVYRRAMSRERALAEINRCSGVQFDPAVVEVFLQLAEEGK
FT                   LDEPIEAIESIVRERVGA"
FT   gene            complement(477172..478854)
FT                   /locus_tag="HM1_0306"
FT   CDS_pept        complement(477172..478854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0306"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="Missing cache domain, PF02743"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82925"
FT                   /db_xref="GOA:B0TEK6"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR021796"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEK6"
FT                   /protein_id="ABZ82925.1"
FT                   /translation="MYRRLRLAPKFILGMVPLLVVMAVAITLLPDLFVKAAEHTKIQES
FT                   KAIAEQQADLQTFLAKHITGERPEDPNFTIKYTSDKYRNAKDMPDAWEKKMLQMYVQNP
FT                   KLAEFSEVLDSNGLRVLRYSKPLFIQEACLACHGEPKGQKDPFGHEKEGYKVGEFRGAI
FT                   SVATTLEGLSKEKVALINTAVTLVVLLLTVIVMYMMVQRFIGKPLEDIVVTVKGLSEGD
FT                   LTTRVKDKGSADEIGELTALFNQMIENQAKMVGTVRKTAVELAESFEKIATSSDHVSRA
FT                   ASEVADNIQHVARDASTGNGSIADAVQMLHDLSQLIGAAKEQALAAAEKSRLTSQAAES
FT                   GKDTINETVACMEKIKHKTMETEDHISTLSEYSQQIGMITDTITSLANQTNLLALNAAI
FT                   EAARAGEMGRGFAVVADEVRKLAEQSNRGAGEVAALVRKIADSTAAAVKAMQQSRSEVE
FT                   QGACVVNKAGDVLEEILKAVTETVQDVEAIAAMTDREVDKSTRMVEVIQSLHQIIENTA
FT                   ANAEEVAASTEETSAAMETIANSAEKANAMAEELKKTVSRFKV"
FT   gene            complement(478981..479103)
FT                   /locus_tag="HM1_0305"
FT   CDS_pept        complement(478981..479103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0305"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82924"
FT                   /db_xref="GOA:B0TEK5"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEK5"
FT                   /protein_id="ABZ82924.1"
FT                   /translation="MPVFFLWHYFILLKFFCNYILKSQIFYGEAGHKQARYFYG"
FT   gene            complement(479108..479890)
FT                   /gene="spo0A"
FT                   /locus_tag="HM1_0304"
FT   CDS_pept        complement(479108..479890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spo0A"
FT                   /locus_tag="HM1_0304"
FT                   /product="stage 0 sporulation protein a"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82923"
FT                   /db_xref="GOA:B0TEK4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR012052"
FT                   /db_xref="InterPro:IPR014879"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEK4"
FT                   /protein_id="ABZ82923.1"
FT                   /translation="MLKNIRLIIADDNKEFCDILRDYISQQEDMELVGVANNGQEALKL
FT                   IQQEEPDLIILDIIMPHMDGIGVLEGMVGMALAKRPRTIILTAFGQESMTQRAVQLGAD
FT                   YFILKPFDLEILGNRIRQLTNGSAPASTPQPSPSPIIRPRNMDVEVTNIIHQMGVPAHI
FT                   KGYQYLRDAILMVINEVSLLGAVTKELYPMIAQKYTTTPSRVERAIRHAIELAWDRGNV
FT                   EMMSKFFGYTINLERGKPTNSEFIAMVADKLRLGQKVG"
FT   gene            complement(480007..481503)
FT                   /gene="spoIVB"
FT                   /locus_tag="HM1_0303"
FT   CDS_pept        complement(480007..481503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoIVB"
FT                   /locus_tag="HM1_0303"
FT                   /product="stage iv sporulation protein b"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82922"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR008763"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR014219"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEK3"
FT                   /protein_id="ABZ82922.1"
FT                   /translation="MARERLKRCIGLLLALSLIAGSLTEEALSLWLTPSRLRTTVGEEI
FT                   PINSMFPQKMMRHVSVALQRSPEWTLHEFPGAIPVSPANATEQPGRLDISLRLLGWIPL
FT                   KHIVVDVLPPMQLLAGGHSIGVLLHSQGVIIVGQAPITDEQGAKHYPGKDAGLQVGDVI
FT                   HKVNGQPIKSDAELARAIDEAGRAGKKLEIETSRNGQTNQVTVEPIRCAETKRFRVGLY
FT                   VRDRASGVGTLTFFEPKSKSYGALGHVINDADTNQRIDVAEGRIIPALVKSIQQGKRGA
FT                   PGEKVGVFREEDPPFTGTIQHNTTVGIFGRLEGKLNNPHYPDPLPIALSAQVQEGPAEI
FT                   ITVVEGERLERFQIIIDRVMPHRTDGKGMIIRVTDPRLLTITGGIIQGMSGSPIIQNGK
FT                   IVGAVTHVFINSPSTGYGVLIEKMLEEAGLWKPGNQQVGALPKRQGILFSKKGRWLSPR
FT                   SASNFCVLDFFQRLSFRFKRKSDAFPHFLKNNRPDNLSSW"
FT   gene            481655..481837
FT                   /locus_tag="HM1_0302"
FT   CDS_pept        481655..481837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0302"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82921"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEK2"
FT                   /protein_id="ABZ82921.1"
FT                   /translation="MDIPKTLGYPVIPLPGCRADRREKSGPAFFGGAALFIRKIFPLFD
FT                   KLLRFLCAVGIFIRL"
FT   gene            complement(481867..483558)
FT                   /gene="recN"
FT                   /locus_tag="HM1_0301"
FT   CDS_pept        complement(481867..483558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recN"
FT                   /locus_tag="HM1_0301"
FT                   /product="DNA repair protein recn"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82920"
FT                   /db_xref="GOA:B0TEK1"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004604"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEK1"
FT                   /protein_id="ABZ82920.1"
FT                   /translation="MLERLRVEHFALIEAAELELSPGMNILTGETGAGKSLVIDAVGLL
FT                   IGGRATADVVRAGADRARIEGFFRLPEGDGGKLRRELEALGVEVEEDDGLLLTREIARG
FT                   GKSVCRINGRSAPLSLYREVGGRLIDLQGQHEQQSLMNPRKHRVLLDRLAGSDGEKALA
FT                   AVEAAYRALDAVEKERERLKQGERDRIQRQDMLAFQAKEIDAVHLVEGEEEELEQERKR
FT                   LQNMEKLMDKTNAAYDALFGGQVGGALELLDRARSAVEEAAAFDSALAALVQNLEAAYY
FT                   QAEDAAERLRDYRQDLEYQPDRLEWVDDRLDAIRRLKRKYGGSIGEILAYREEIARELE
FT                   ELEHRDERIAELQAEAERRRKTYLEAATKLSALRKTMAAKLESSMAKELAFLGMSRAKL
FT                   TVRFDERPEPSAAGAEEVEFLFTPNLGEPPKPLAKIASGGETGRILLAFKTLLARVEGI
FT                   PSLIFDEIDAGIGGQALQAVAQKMAEVAEAVQVICVTHAPQLAAYADNHFRIMKTVRGQ
FT                   RTMTRIEALNEEERVKELARMLGGDRASTLTHSHAREMFARAKKSS"
FT   gene            complement(483588..484043)
FT                   /gene="argR"
FT                   /locus_tag="HM1_0300"
FT   CDS_pept        complement(483588..484043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argR"
FT                   /locus_tag="HM1_0300"
FT                   /product="arginine repressor"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82919"
FT                   /db_xref="GOA:B0TEK0"
FT                   /db_xref="InterPro:IPR001669"
FT                   /db_xref="InterPro:IPR020899"
FT                   /db_xref="InterPro:IPR020900"
FT                   /db_xref="InterPro:IPR036251"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TEK0"
FT                   /protein_id="ABZ82919.1"
FT                   /translation="MKSRRQRAILEIIGAEVVRTQEELAQRLRERGMEVTQATVSRDIK
FT                   ELGLIKVPVSKDESRYAPPAEAAQVPQAQDRLRRLLRDTVTHVDSSLNIVVIRTLPGHA
FT                   HAVAGAIDHSHWPEVLGTVAGDDTIFIVVKPVEAVEALMDKVRRWVE"
FT   gene            complement(484040..484771)
FT                   /locus_tag="HM1_0299"
FT   CDS_pept        complement(484040..484771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0299"
FT                   /product="sam-dependent methyltransferase, putative"
FT                   /note="Also member of COG0500, SAM-dependent
FT                   methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82918"
FT                   /db_xref="GOA:B0TEJ9"
FT                   /db_xref="InterPro:IPR010719"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEJ9"
FT                   /protein_id="ABZ82918.1"
FT                   /translation="MNSLTSAVEWSRRFLAEVLEPGDFAIDATAGNGHDTLFLARQVLP
FT                   GGDLWAFDIQEAAIDATARRLTEAGLADRFEIDEPFSASKAASKTAGRNVLARMAAPDQ
FT                   SSPPEEAAAAPRCPIRLIHCDHSQMGSLLQGYTKQPKAAVFNLGYLPGGDHALVTRAES
FT                   TVSALDALAAALAEGGRLVVVVYVGHAGAEAEVTAVDRWWRQLPPQRWDTVAVQFPNRT
FT                   GRPPYVLVAEKKGVQRRVPTT"
FT   gene            complement(484775..485626)
FT                   /gene="nadF"
FT                   /locus_tag="HM1_0298"
FT   CDS_pept        complement(484775..485626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadF"
FT                   /locus_tag="HM1_0298"
FT                   /product="ATP-nad kinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82917"
FT                   /db_xref="GOA:B0TEJ8"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TEJ8"
FT                   /protein_id="ABZ82917.1"
FT                   /translation="MPTVGVVLNDDKPQALEVARRMADWLSQREVPMGIPLTRVAELVH
FT                   SPSPELRDRLRQLDLIVVLGGDGTLLNTARLAAPHGIPVVGVNLGRLGFLTEVEVSDLF
FT                   PALERIIAGDYRIEERMMLEARLIRDGLEQPSYFALNDVVVTKGDHPRMIRVEAAVGDE
FT                   VVWTYSADGLIVSSPTGSTAYSLSAGGPIVSPELHALLLTPISPHALDARPLVIPQDQA
FT                   VRLTVISSHSHAVVTVDGQPGQPMVCGDSVLVRKASVACRLIRLGERTFFRILREKMQQ
FT                   GR"
FT   gene            complement(485776..486234)
FT                   /locus_tag="HM1_0297"
FT   CDS_pept        complement(485776..486234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0297"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82916"
FT                   /db_xref="GOA:B0TEJ7"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEJ7"
FT                   /protein_id="ABZ82916.1"
FT                   /translation="MPDSFTLDWTLLAVVIAVALIVGALLFSYLYRAYLRWLAWWRQRA
FT                   GRIGEQQAAKLLKREGYAVIKAQPPARMVMRVDGAPVPIHVRADYLVQRGGKTYVAEVK
FT                   TGGRAPRPTNGDTRRQLLEYSLIYRADGVLLVDMAAQKIHRVEFELFQ"
FT   gene            complement(486352..487176)
FT                   /locus_tag="HM1_0296"
FT   CDS_pept        complement(486352..487176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0296"
FT                   /product="hemolysin a, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82915"
FT                   /db_xref="GOA:B0TEJ6"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR004538"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEJ6"
FT                   /protein_id="ABZ82915.1"
FT                   /translation="MTPKKRLDVRLVDEGLSPTREKARAAILAGLVQVDGKRVDKAGTL
FT                   IADSARVTVTGEACPYVSRGGFKLAKALEVFPLNLSGLTVIDVGASTGGFTDVALRNGA
FT                   ARVIAVDVGYGQFAWSLRKDPRVRCLERTNIRHLTPEVLGEKAQAAVIDVAFISLEKVL
FT                   PAVAALLEEPGHVMALIKPQFEAGREKVGKKGVVRDPQVHCEVIEGLVRWATERGWKVR
FT                   GLDYSPITGPEGNIEYLFFLQKPDTQGEAVSVTPDSIAALVRRAHETVGNLN"
FT   gene            complement(487227..489170)
FT                   /gene="dxs"
FT                   /locus_tag="HM1_0295"
FT   CDS_pept        complement(487227..489170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dxs"
FT                   /locus_tag="HM1_0295"
FT                   /product="1-deoxy-d-xylulose-5-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82914"
FT                   /db_xref="GOA:B0TEJ5"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TEJ5"
FT                   /protein_id="ABZ82914.1"
FT                   /translation="MTQILSRISNPGDLQRLSATELDQLAKEIREVIIQTTSKNGGHLA
FT                   PNLGVVELTLALHLVFQSPKDKIIWDVGHQSYVHKLLTGRYNHFHTLRRYKGMAGFPKR
FT                   SESEHDVFNTGHSSTSISAALGFAFARDLKKEDGAVIAVIGDGALTGGIALEALNHAGH
FT                   AGNDMIVVLNDNEKSIADNVGAMSTYLSRIRTDPRYFRNKEEVEEIVRRIPSIGNHVLK
FT                   VMEKMKDSFKHLVVPGILFEELGFSYLGPIDGHNLSQLREVMTNACRLKGPILVHVLTK
FT                   KGKGYGPAETNPSVFHGVGPFDVETGKVKKHLGPPTYTQVFSDTLLRLAREDERIVGVT
FT                   AAMPDGTGMTPFARAFPSRFFDVGIAEQHAVNMSAALALQGLKPVVAIYSTFLQRAYDQ
FT                   VFHDVCLQRAPVVFAIDRGGIVGDDGETHHGLFDIAFLRHIPELVMMAPKDENELQHML
FT                   RTALEYEGPIAVRYPRGTGVGVTLDEELTTVPIGRGELLRQGSDVTIVAIGAMVGIAEE
FT                   AADLLEAEGIRAAVVNARFVKPLDKELIIKQARETGRIVTVEEHVLAGGFGSAILELLE
FT                   MEGVHCAVRRIGIPDEYVQHGSVSVLREDYGLTASNVARVARELADADRSRASIRMAPP
FT                   APIKIAFRGESR"
FT   gene            489325..491256
FT                   /locus_tag="HM1_0294"
FT   CDS_pept        489325..491256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0294"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82913"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEJ4"
FT                   /protein_id="ABZ82913.1"
FT                   /translation="MEPFLSRAVEDIGAFVSKRLTVQTGGSSMILSKKIRKGVGLVVAA
FT                   LLLGQAGLATAAPAAEPLPPDVSVVELAKPAVVQVRAGATATFRFSDRAWPVAVGGTAS
FT                   GFIVNADGAVVTSSRIIELLQKDEGAIRNALAERFFNEVQKQVGHRLTETERLGVAENT
FT                   TLIEEVKLYKQVVLSDGQAVDFDIKWTGSPPPEALTTSTPVYSSRPVPHIQRPVTGEGV
FT                   ENLGEGVSPVITEPVTVKEPLQTPEPIIPLSANKEFDPVQELAVLTISINNLPALPLMA
FT                   ADKDDVGQRATVIGYAGNADATALLAPTNLMNVTVTSGNVTATKSGKMKADYGPLLDIE
FT                   STIGPAGAGGPVITDKGEIIGIAGRTARAIGVYPVINTQAVLAALGKSGLSNASEPSEA
FT                   TRIYASALDMFSQGYMTKTIGILEDLLKLCPHHGPAKALMAEARQRKEAGDDNIYWPDM
FT                   ALYGGITLALIAAGGGYLGLRYRKLGPAAFPALSRSIGAWGAKKRSDRGPEGDGSAAEP
FT                   APPPPSVVGQTASLRQTAKAESRPVIEFILGPLTGRRMIIPREGLLVGRDPATCQVVLD
FT                   DPFISKQHLFVGPDPLDKTAIIVTDKGSTNGTFLESPDGERLVGTRTLQKGDQVYLGQR
FT                   NAFVLRFE"
FT   gene            complement(491522..492412)
FT                   /gene="ispA"
FT                   /locus_tag="HM1_0293"
FT   CDS_pept        complement(491522..492412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispA"
FT                   /locus_tag="HM1_0293"
FT                   /product="geranylgeranyl pyrophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82912"
FT                   /db_xref="GOA:B0TEJ3"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEJ3"
FT                   /protein_id="ABZ82912.1"
FT                   /translation="MDLKAELKQLNMKIDAALSRYMPAEDVAPPVIHKAMRYSLFAGGK
FT                   RLRPVLVLAGCRAVGGDEESVMAAACALEMIHTYSLIHDDLPAMDDDDLRRGMPTNHVV
FT                   FGEATAILAGDGLLTRAFGVLAEEGLRCGRSPALVLQVIAELADAAGSMGMIGGQVMDM
FT                   ESENKQIDVATMAYIHAHKTGALIRASLRIGALLGGGSVEQVEALSRYGDHLGLAFQIT
FT                   DDLLDIQGDPEKIGKPVGSDVKNNKATYPALLGLEKARQEAERVVQAALDSLAGFDEKA
FT                   ELLRELAQYLLVREN"
FT   gene            complement(492415..492666)
FT                   /gene="xseB"
FT                   /locus_tag="HM1_0292"
FT   CDS_pept        complement(492415..492666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xseB"
FT                   /locus_tag="HM1_0292"
FT                   /product="exodeoxyribonuclease vii, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82911"
FT                   /db_xref="GOA:B0TEJ2"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TEJ2"
FT                   /protein_id="ABZ82911.1"
FT                   /translation="MAKGKANLNLTYEAAIGRLEEVVRSLETGEASLDESLKLFQEGIG
FT                   LVRHCHSQLDAYEAKVQRLIETPDGAAVVEERRTEEGE"
FT   gene            complement(492642..494009)
FT                   /gene="xseA"
FT                   /locus_tag="HM1_0291"
FT   CDS_pept        complement(492642..494009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xseA"
FT                   /locus_tag="HM1_0291"
FT                   /product="exodeoxyribonuclease vii, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82910"
FT                   /db_xref="GOA:B0TEJ1"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEJ1"
FT                   /protein_id="ABZ82910.1"
FT                   /translation="MDKIWSVTQLNTYIQGLLEAAPRLTDLWVQGEISNFKHHTSGHMY
FT                   FTLKDRESVVKAVMFRGKNRCLSFRPENGLKVILRGQVSVYPRDGIYQIYAEEMEPAGL
FT                   GGIFLALEQVKQRLAADGLFAAERKRPLPLLPRKVGIVTAPTGAAIRDLFSVLQRRFPT
FT                   MNIAFAPAVVQGEEAVPSLIRALQRIVRVPGVDVVIIGRGGGSREDLWAFNDEALCRAI
FT                   AACPVPVVSAVGHESDVSLTDLVADMRAATPSAAAELVVPLYSALHGRVDDLALQLQRA
FT                   MTVRLARERRALSALAGRPSLDNPLLRLRAPRQRVDQFEERLRRAVSLSRAAQLRRRLK
FT                   ELEGRLLSASSPQRLCPRRERIEDLKHRLIALSEKGLHGRRRELAMQAGLLDALSPLAV
FT                   LDRGFALCLDSAGQVLRDSAAVAEGERVDIVLQRGELTCRVEERRENRRWQREKQT"
FT   gene            complement(494101..495510)
FT                   /gene="gltD"
FT                   /locus_tag="HM1_0290"
FT   CDS_pept        complement(494101..495510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltD"
FT                   /locus_tag="HM1_0290"
FT                   /product="glutamate synthase (nadph), homotetrameric"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82909"
FT                   /db_xref="GOA:B0TEJ0"
FT                   /db_xref="InterPro:IPR006004"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEJ0"
FT                   /protein_id="ABZ82909.1"
FT                   /translation="MSLKETIRQPMPCQDPQVRRTNFDEVALGYSEEQAVKEAARCIQC
FT                   KKPRCREGCPVEVLIPDFIKAVAARDFAGAAVKLKEKNALPAICGRVCPQESQCEEKCI
FT                   LGIKSEPVAIGRLERFVADWEMAQGASATEPAPAKGAKVAVIGAGPAGLTCAAELAKLG
FT                   YAVTVFEALHTAGGVLMYGIPEFRLPKAIVDKEIANLRQLGVDLQFNVVIGSSVTVEEL
FT                   MNERGYAAVFLGTGAGLPNFMGIPGENLCGVFSANEFLTRTNLMKGFRFPEYGTPVKLG
FT                   RKVAVLGAGNVAMDAARTAVRLGAEEVTIVYRRSDKEMPARAEEIEHAREEGVQFQLLT
FT                   NPVEIIGDENGWVKAMKCLRYELGEPDASGRRKPVAIANSEFVMDTDTVIIAIGTGPNP
FT                   LATKSTAGLELNRRGNIVADEAGRTSIPGVFAGGDIVTGAATVILAMGAGKKAAQAIDA
FT                   YITTKAAEAAN"
FT   gene            complement(495501..496355)
FT                   /locus_tag="HM1_0289"
FT   CDS_pept        complement(495501..496355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0289"
FT                   /product="fad/nad-binding oxidoreductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82908"
FT                   /db_xref="GOA:B0TEI9"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR012165"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR019480"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEI9"
FT                   /protein_id="ABZ82908.1"
FT                   /translation="MYPIVRKEILSASVKLFDLKAPLVAAKAKAGQFFILRADEKGERI
FT                   PLTIADFDREQGTITAIFQEIGAGTRLLGRLEAGDAVLDVVGPLGVPSEIERFDGPVAV
FT                   VGGGVGIAPIYPIARALKEAGNRVIAIIGARNKELLFWEEKMAAVSDALIVCTDDGSYG
FT                   RKGFVTDALKDLYEANKDLQRVWAIGPMPMMRAIANTTRPMGVPTIVSMNPLMLDGTGM
FT                   CGACRVLVGGETKFACVDGPEFDGHLVDFDLALKRLAIYRDEEKRALAALEHHREGGRC
FT                   GCH"
FT   gene            496374..496499
FT                   /locus_tag="HM1_0288"
FT   CDS_pept        496374..496499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0288"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82907"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEI8"
FT                   /protein_id="ABZ82907.1"
FT                   /translation="MPYCRTSQRKTPYKGRTATLGSLFMIREPLPISCKPGEGMF"
FT   gene            complement(496592..497749)
FT                   /locus_tag="HM1_0287"
FT   CDS_pept        complement(496592..497749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0287"
FT                   /product="o-sialoglycoprotein endopeptidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82906"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEI7"
FT                   /protein_id="ABZ82906.1"
FT                   /translation="MGADIIRGVLGIDTSCYTTSVAFASLDGRLLAQKRQLLPVKPGER
FT                   GLRQGDAFFLHGRQLPHVMEALFADLRCSGEAKAGREGLRVEAVAASTRPRPEEGAYLP
FT                   VFLAGEAVGRSVAAAQGVPFFATTHQEGHIMAGIASLEDREQAEALLKKGFLSVHLSGG
FT                   TTELLRVRFDGASAVFSIEKLGATTDLHAGQLVDRVGVALGLPFPAGPHLEALAAQCDG
FT                   GRCAAEGAAEGSTEAIEAIPFPASVKGYNVSFSGAEAQALRLIEKWRKANEAASPAAIA
FT                   TLPGDPAHPGIPALPAIARGIEGCLASTLEKILRRAIAETGCRDVLIVGGVAANGFLRR
FT                   RLRERLEHRAVGGRLAFATTALSGDNAAGVALLGAKFLSASMACR"
FT   gene            complement(497753..498373)
FT                   /gene="nusB"
FT                   /locus_tag="HM1_0286"
FT   CDS_pept        complement(497753..498373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusB"
FT                   /locus_tag="HM1_0286"
FT                   /product="transcription antitermination factor nusb"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82905"
FT                   /db_xref="GOA:B0TEI6"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TEI6"
FT                   /protein_id="ABZ82905.1"
FT                   /translation="MSRRQGRETALQTLFMADVGRMEPAYALQYASEEFGISEAAAAFA
FT                   RELVEGAVANRETIDGNIRRLAKEWNLERMPHVDRNLLRVAIFEMLFREDIPLNAAINE
FT                   AIELAKIYANEESAKFVNGILGQLARELREARGEKTSAQEGAPAAVTNRVTTPAPESTP
FT                   VPDPDATPATTPVTTTVISETAANRETRSMAEEETQPPGVNEV"
FT   gene            complement(498407..498952)
FT                   /locus_tag="HM1_0285"
FT   CDS_pept        complement(498407..498952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0285"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82904"
FT                   /db_xref="GOA:B0TEI5"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEI5"
FT                   /protein_id="ABZ82904.1"
FT                   /translation="MEGLSRLLAFLVALPPAALAIMIVVAAFSGGGGAGVVERYLTAWR
FT                   QGGVRAAWAVGAIFYLLLVGWFLFRAWSRPMKGMTLLARTPHGKVQISRLAVEGLIRGA
FT                   VAGFVGIRGLRVRIRTVSDGIAIGLHVASDLKVGLPALGEKIQQATRHVLESATGMEPK
FT                   EIQITFEPVEVERKSPLR"
FT   gene            complement(499033..499431)
FT                   /locus_tag="HM1_0284"
FT   CDS_pept        complement(499033..499431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0284"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82903"
FT                   /db_xref="InterPro:IPR005531"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEI4"
FT                   /protein_id="ABZ82903.1"
FT                   /translation="MPVHMDSITTKQDIGHVRIAQEVVATIAGLAATEVEGVAAMSGGL
FT                   GGGIAEMLGRKNLTRGVKVEVGEREAAIDMNIIVNFGSRIPEVAKRVQENVKRSIESMT
FT                   GLTVVEVNVHIQGVNFPTPETKEDDRVR"
FT   gene            complement(499616..500980)
FT                   /gene="accC"
FT                   /locus_tag="HM1_0283"
FT   CDS_pept        complement(499616..500980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accC"
FT                   /locus_tag="HM1_0283"
FT                   /product="acetyl-CoA carboxylase, biotin carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82902"
FT                   /db_xref="GOA:B0TEI3"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEI3"
FT                   /protein_id="ABZ82902.1"
FT                   /translation="MGHHHSLFNKILIANRGEIAVRIIRACKEMGIGTVAVYSEADKDA
FT                   LHVKLADEAYCVGPAPSNRSYLNIPNIISAATVSGAEAIHPGFGFLSENAYFAEICETC
FT                   KIKFIGPGSKAIESMGSKAVARETMIKAGVRVVPGSESIVTSEEEAEKIAEEIGYPVMI
FT                   KASAGGGGRGMRIAHSEKDLFNALQTAQAEAEAAFGNKAVYIEKFIEEPRHIEFQIMAD
FT                   QFGNTVYLGERDCSIQRRNQKLLEEAPSPALSPELRKEMGEQAVLAAKSVNYVNAGTVE
FT                   FLLDKHGHYYFIEMNTRIQVEHPVTEMITGIDLIKEQIRIAAGEPLGYTQDDIVIKGHA
FT                   IECRINAEDPARNFMPSPGKITAYHPPGGLGVRLDSAAYAGYTIPPTYDSMIGKLIVWG
FT                   RDRNEAIARMQRALDEFVIEGVKTTIPFQQKVLGNAFFQKGEVYTNFIQARMTGE"
FT   gene            complement(500993..502924)
FT                   /gene="oadA"
FT                   /locus_tag="HM1_0282"
FT   CDS_pept        complement(500993..502924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oadA"
FT                   /locus_tag="HM1_0282"
FT                   /product="oxaloacetate decarboxylase, alpha subunit"
FT                   /note="also has gene sym pycB"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82901"
FT                   /db_xref="GOA:B0TEI2"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEI2"
FT                   /protein_id="ABZ82901.1"
FT                   /translation="MQHERRVKITETTLRDGHQSLWATRMRLEDMLPIVEKMDKVGYHS
FT                   VEVWGGATFDVCMRYLNEDPWERLRILKKYFRRTPLQMLLRGQSLVGYTHYPDDVVEAF
FT                   VHKAVENGIDIIRIFDALNDIRNMEAPMRHAKKAGAHVQAAIVYTISPVHTMEHYVETA
FT                   LQLAEMGADSLCIKDMAGLLLPFKSRELVTLIKEKVNLPLQLHTHYIGGMAVGALLKGV
FT                   EAGADIIDCASLPLAFGPSQPPVETLVRAFSDTPYDPGLDIHRIFEITQYFEDLRKRLG
FT                   YKRGITGLNDMLVFDHQVPGGMITNLITQLEEQKARHRLNDVLHEMPKVRADFGYPPLV
FT                   TPTSQIVGTQAVLNVLTGERYKLVPGEVKGYVKGLYGKPPAPIRQDIVTKILKDDKQID
FT                   CRPADLLEPAMDRARRELGPLAKSEEDVLSYALFPQVALKFFEYRKNPQAHVVAPVVQN
FT                   QEGPPAPQPGASQSAPVRGNTQKEDAKVNVQEIKELIQVLNGTDIAELQVESDGVKLSI
FT                   RKGSAIHAPAAAAPVMVAAPASAAPAPAAEAAAPAPQPAADLSKNPNVVAITSPMVGTF
FT                   YRAPAPDARPYVEKGSKVDKGTTVCIIEAMKLMNEIEAEIKGTIVDILVENGAPVEYGQ
FT                   TLFLVEKA"
FT   gene            complement(503214..504017)
FT                   /gene="spoIIIAH"
FT                   /locus_tag="HM1_0281"
FT   CDS_pept        complement(503214..504017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoIIIAH"
FT                   /locus_tag="HM1_0281"
FT                   /product="stage iii sporulation protein ah domain protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82900"
FT                   /db_xref="InterPro:IPR024232"
FT                   /db_xref="InterPro:IPR038503"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEI1"
FT                   /protein_id="ABZ82900.1"
FT                   /translation="MKIRIIRKPSWMPGLPQWPNRKVLALLAGLLVTAAGFFGVYSVSD
FT                   LVFSVALRESDRIFGEPAPSGSTVSSAPPSPSAAKTPPAAAVPLGKRTGPNPSATAASD
FT                   AASASNAASTSDAASASDAASASNAVSTSDFSQRAGPALPNPGHFQNKGQDFFSEYRME
FT                   RERVRSQQIEILQEIVRNDQSSGETRKEAQRKLLEISEQIKKEMETERLLIANSYRDAV
FT                   VLIQNNTVSVIVAARELTQAEKGKIAELVARSTGVKTNVVSVMNR"
FT   gene            complement(504014..504613)
FT                   /gene="spoIIIAG"
FT                   /locus_tag="HM1_0280"
FT   CDS_pept        complement(504014..504613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoIIIAG"
FT                   /locus_tag="HM1_0280"
FT                   /product="stage iii sporulation protein ag, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82899"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEI0"
FT                   /protein_id="ABZ82899.1"
FT                   /translation="MNWLKQPKDKLLAVLAAVIFLGVALMTAEERRQGSGIWPGQEAAP
FT                   TSATAAAESAKTGRGSELAAQERLLSERVASAVSKIEGVGATEVVVSLAQGTQSEYATN
FT                   SNANNKKIEEKDKSGGTRVTSDNTDSRTVVVVKESTAAKEQPVVVRELRYQVAGVLVVA
FT                   EGARDANVRQNISRAVCTLLDIPAHKVSVFPREEKR"
FT   gene            complement(504668..505291)
FT                   /gene="spoIIIAF"
FT                   /locus_tag="HM1_0279"
FT   CDS_pept        complement(504668..505291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoIIIAF"
FT                   /locus_tag="HM1_0279"
FT                   /product="stage iii sporulation protein af, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82898"
FT                   /db_xref="GOA:B0TEH9"
FT                   /db_xref="InterPro:IPR014245"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEH9"
FT                   /protein_id="ABZ82898.1"
FT                   /translation="MVLIILVGTLLDMLLPNGRLQSLVRLVAGLFIMVAVLNPIMSWLN
FT                   RNDWAATLGGDMPAREVAGYDEIRRKGEALREEGLHQAREEAKNRLQRQVEALVGLKPG
FT                   VKAAAAQVELGKREENPSAIGQITVTLRPDEPAKGSKEATEAVAPVMVDDRDLQKGAGD
FT                   LANDPKAAPAQKGEIDREATAQSIVQTLSGFYGIPPERIRVFWE"
FT   gene            complement(505335..506528)
FT                   /gene="spoIIIAE"
FT                   /locus_tag="HM1_0278"
FT   CDS_pept        complement(505335..506528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoIIIAE"
FT                   /locus_tag="HM1_0278"
FT                   /product="stage iii sporulation protein ae, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82897"
FT                   /db_xref="GOA:B0TEH8"
FT                   /db_xref="InterPro:IPR014194"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEH8"
FT                   /protein_id="ABZ82897.1"
FT                   /translation="MLLLSVSQLSLAVPPAAAAPGASVTPSQGSSGDPSGGGSPAPAPT
FT                   VDLSEFQRVLEELERDKGKYLPSLNPRTIMEDIRNGRVSLSIGEVFRGVMGYLFQEVLA
FT                   NTALLGELIILAVVVAVLNHFQSSFESGAVSKTAFAVGYMVLITIAIHSFYAAVQTGRG
FT                   AIDDMVRFMQAILPVLLTLLTAMGGFASGALFHPVIFGAITLISTLIKDWIFPLILFSA
FT                   VLGILNHVSSQFKVKNLQNLIKDGYKLAMGLFITVFLGVISIYGAVGAVADGLTLRTAK
FT                   YATDALLPVVGGLVADSFELIVNSSLLLKNGIGLIGLVIIAILCVLPSLKILALVLIYR
FT                   LAGALLQPIGDSPVADSLETIGGSLTLVFGAVAAVGLMFFLALTIVVGAGNLTVMLR"
FT   gene            complement(506648..507049)
FT                   /gene="spoIIIAD"
FT                   /locus_tag="HM1_0277"
FT   CDS_pept        complement(506648..507049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoIIIAD"
FT                   /locus_tag="HM1_0277"
FT                   /product="stage iii sporulation protein ad, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82896"
FT                   /db_xref="GOA:B0TEH7"
FT                   /db_xref="InterPro:IPR014211"
FT                   /db_xref="InterPro:IPR025664"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEH7"
FT                   /protein_id="ABZ82896.1"
FT                   /translation="MEILQVVGVGIIATIFLVIVRKQRPELAVQLSIAAGVILFLFVLS
FT                   KISAVMQVLEDLANKAQINRYYLTTLLKIVGIAYIAEFGAQICRDAGESTIATKVEMAA
FT                   KIVVMVLALPILLALMDSLMSLLPRGGPS"
FT   gene            complement(507113..507310)
FT                   /gene="spoIIIAC"
FT                   /locus_tag="HM1_0276"
FT   CDS_pept        complement(507113..507310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoIIIAC"
FT                   /locus_tag="HM1_0276"
FT                   /product="stage iii sporulation protein ac, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82895"
FT                   /db_xref="GOA:B0TEH6"
FT                   /db_xref="InterPro:IPR009570"
FT                   /db_xref="InterPro:IPR025664"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEH6"
FT                   /protein_id="ABZ82895.1"
FT                   /translation="MNMLQIFQIAGIGIVVAIFYSILKEAKREELAQLLAISGVALVTL
FT                   MVLRLISDLFDQVRSVFSLY"
FT   gene            complement(507327..507845)
FT                   /gene="spoIIIAB"
FT                   /locus_tag="HM1_0275"
FT   CDS_pept        complement(507327..507845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoIIIAB"
FT                   /locus_tag="HM1_0275"
FT                   /product="stage iii sporulation protein spoab"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82894"
FT                   /db_xref="GOA:B0TEH5"
FT                   /db_xref="InterPro:IPR014198"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEH5"
FT                   /protein_id="ABZ82894.1"
FT                   /translation="MGKLVGAALIVGAFSAGGFMTARDLRRRRQILASLQSALAMLATE
FT                   VAFRATHLPEALVQVSRTAGPPVNALFAEAGNRLRRAEGQAASAIWLQSVGDWLPRTPL
FT                   HPSDGEELARLALGLGAAPREDQLHRIEEVKNRLAYLEQEARERETRMAKVWSYGGVLL
FT                   GAAVVLTIW"
FT   gene            complement(507818..508231)
FT                   /gene="spoIIIAA"
FT                   /locus_tag="HM1_0274"
FT   CDS_pept        complement(507818..508231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoIIIAA"
FT                   /locus_tag="HM1_0274"
FT                   /product="stage iii sporulation protein aa"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82893"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEH4"
FT                   /protein_id="ABZ82893.1"
FT                   /translation="MDERSEIAACYRGVPQNDVGPRTDVLDGCPKAEGLLRLLRSMGPQ
FT                   VLATDEIGREEDVLAIEEAVHSGVTLLATAHGRNREELLTRPGLERMLKRKVFQRLVVL
FT                   SRREGPGTVEGIFDAGGNRLKEGRVWGSWSAQR"
FT   gene            complement(508215..508958)
FT                   /gene="spoIIIAA"
FT                   /locus_tag="HM1_0273"
FT   CDS_pept        complement(508215..508958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoIIIAA"
FT                   /locus_tag="HM1_0273"
FT                   /product="stage iii sporulation protein aa"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82892"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEH3"
FT                   /protein_id="ABZ82892.1"
FT                   /translation="MRWLFSGGADGLTVLDDGAADKRADALKENRDSVRGVKECSSRDK
FT                   ASAQQAAEKEEADGHWTGRLLPYLAPTLRSLLTDVLAARPGLRHEITEIRLRAGRPLAL
FT                   CGRLDDLLLRAVTEEEIMQTMHLIAHCSVYALEQEFRQGFLTLPGGHRVGLAGRVVLDG
FT                   GRVKTIHPVSSLNIRIARQFLGVADPLLPQLLAVDEGIFFFHPDRLPSRWGEDDTAAGY
FT                   HPADQHRATGVRTGGQDGRVGGRAF"
FT   gene            complement(509139..509603)
FT                   /locus_tag="HM1_0272"
FT   CDS_pept        complement(509139..509603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0272"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82891"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEH2"
FT                   /protein_id="ABZ82891.1"
FT                   /translation="MQKLRQRISYLQGLAEGMNVGTSSREGRLLTEMLQVLGDMADSID
FT                   TVKAEQERLDEIVESMDDDLFQLEQDIYEDDDEDDDDIVEIACPSCQENVSFDAKLLDD
FT                   DDYLEVTCPSCRQGVFIREGDEDGEEQIVMGEEAERDGDCGDAACHRHTH"
FT   gene            complement(509687..510244)
FT                   /gene="efp"
FT                   /locus_tag="HM1_0271"
FT   CDS_pept        complement(509687..510244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="efp"
FT                   /locus_tag="HM1_0271"
FT                   /product="translation elongation factor p"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82890"
FT                   /db_xref="GOA:B0TEH1"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TEH1"
FT                   /protein_id="ABZ82890.1"
FT                   /translation="MISSNDFRTGSTIELDGDAYVVIEFQHVKPGKGAAFVRTKLKNIK
FT                   TGSVVERTFRAGEKVPKARLERRQMQYLYSDGDDYTFMDVENFEQITLQRDQIEEQLRF
FT                   LKENMNVHVLTWNGNLMGVELPNTVELKVVATEPGIRGDTATGGSKPATLETGAIVQVP
FT                   FFINEGEMLIIDTRTGAYVSRA"
FT   gene            complement(510359..511906)
FT                   /locus_tag="HM1_0270"
FT   CDS_pept        complement(510359..511906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0270"
FT                   /product="xaa-pro dipeptidase, putative"
FT                   /note="Member of 3-dehydroquinate dehydratase, type II
FT                   equivalog, TIGR01088"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82889"
FT                   /db_xref="GOA:B0TEH0"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEH0"
FT                   /protein_id="ABZ82889.1"
FT                   /translation="MLLNGPNLNLLGRREPARYGTTTLAEIEKAVSELGRSWGWEVVCF
FT                   QSNHEGALIDCIHNAFGRVDLIIINPGAYTHTSVALRDALAGVAIPVIEVHLSNIHARE
FT                   EFRHHSFIAPIAVGQIAGFGADGYRLAMEGARHYLTVRKGGEGQHRPEQSPVPLAQAAQ
FT                   SRVARLRQRWGDGIDAFLILSPENRRYLSGFTGSAGFLLVDREGQWLATDFRYWEQARE
FT                   QAPDWTLLRQKGAWTEALREAVADRGWRNIAVESDVVTLEQQQKLRTALPDVHWVPRQG
FT                   VVESLRMVKDEGEQLALSRAAALADRGFQHILGYMRPGMTERDVALELEFFLRREGAQG
FT                   VSFAFIVASGERSALPHGVASDKKIGTGELITLDFGCILEGYCSDMTRTVIFGPPTAEQ
FT                   RKVYDTVLDAQKRALDAIAPGKSGRAIDRIARDVIEAAGYGEHFGHGLGHGVGLLVHEN
FT                   PRLSALSEDVLEPGHVVTVEPGIYIPGWGGVRIEDLVIVTADGCRNLTTSPKELLVL"
FT   gene            complement(511980..513326)
FT                   /locus_tag="HM1_0269"
FT   CDS_pept        complement(511980..513326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0269"
FT                   /product="peptidase u62, modulator of DNA gyrase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82888"
FT                   /db_xref="GOA:B0TEG9"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEG9"
FT                   /protein_id="ABZ82888.1"
FT                   /translation="MSHLAMRELARRMVERAQAKGANLSEAYGLDAKELSIDVSKGIVE
FT                   TMKLAEDRGIGIRLFQGGKMGYSYTSDLSEKALEETVDRALANARWNAEDRFRGLPGKA
FT                   DRYPDVKTYDPSLAVVSVEQKIELAKAIEAAAKAVDGRIKIIERSSYTDTEYTVTIINS
FT                   QGVDVACRGAYCGGYAYLVAEENGESQTGFSLSYGLSFDGIDPEQIGREAAEKALRMLG
FT                   AKPVSSRRAPVVFDPYVATQFLAILAPSLTAEAVQKGKSLFAGKEGQPIAAPEVTVIDD
FT                   GRMEGRILSAPFDGEGVPTSRTVLIDKGTLAGYLHNTYTAAKAGAVSTGNGSRGSFRGT
FT                   PEVGTTNFYLQAGNCAPGELIGQIESGFYVTEVMGMHTANPISGDFSVGAAGLLIEQGR
FT                   LTRPVRGVALAGNLLDWLQGIDGVGSDLTFFIGKGAPTLRVKEMAISGP"
FT   gene            complement(513525..515069)
FT                   /locus_tag="HM1_0268"
FT   CDS_pept        complement(513525..515069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0268"
FT                   /product="modulator of DNA gyrase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82887"
FT                   /db_xref="GOA:B0TEG8"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEG8"
FT                   /protein_id="ABZ82887.1"
FT                   /translation="MLHRPAVDDLRDVLQIALRQGADFADIFIEKKSVNGIGCDDNKIE
FT                   RIHSGIDIGAGIRVIAGESTAYAYTNDLSLEGLGHAAQVASHAARGGAASRPIDLTKRS
FT                   SPVQMVIESRPDEVALEDKVEQVLRANRHARNIDDRIKQVTVGYGDVVQEVTIANSEGD
FT                   YIEDERIRTRFVVHAVAADGAVIQTGYEALGGTKGFEIFQERDPESLAQAAVDRALLML
FT                   TAKPAPSGKMPVVMSSAAGGTMVHEACGHGLEADLAQKGLSVYAGKEGQQVASPLVTVV
FT                   DDGTIAGKYGTLRFDDEGTPGQKNVLIEKGILKGFMHDRFTAGKEKRPSTGNGRRESYQ
FT                   HKPLPRMTNTLIASGDEIPEKIIRDTKRGLFVKKMGGGQVNTTNGDFVFDVAEGYLIEN
FT                   GEIGAAVRGATLTGNGPEVLRQIDRVGNDLGYAIGTCGKDGQGAPVSDAQPTLRITSLI
FT                   VGGTGAAERGDEEDGQAAPGGRGGAGTGAGGGVGGGLRRLSAFDLLNNHAGRIRRL"
FT   gene            complement(515089..515397)
FT                   /locus_tag="HM1_0267"
FT   CDS_pept        complement(515089..515397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0267"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82886"
FT                   /db_xref="InterPro:IPR019657"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEG7"
FT                   /protein_id="ABZ82886.1"
FT                   /translation="MIHNLMEGVVANFLDDLLTQHPEVCRCSQCRMDIMAAALNRLPPR
FT                   YVVTDKGEVYSKINLLANQFHVDIIGAIAHGMMLVAKNPRHARPEEAAEPAKADSDK"
FT   gene            complement(515484..516041)
FT                   /locus_tag="HM1_0266"
FT   CDS_pept        complement(515484..516041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0266"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82885"
FT                   /db_xref="GOA:B0TEG6"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEG6"
FT                   /protein_id="ABZ82885.1"
FT                   /translation="MLTMKKPLCPEAAVKRRRKGEGSSGMTLIEVLLAMTIAGILLLMG
FT                   LRLLNTGMAIVDVESHRMEGNSGVRWVLAWMAKDLRYGRDIRIYNGGTRVDCQVLVENS
FT                   GLLTWVDVRYTLEAGTVQRREGADTKPLASGIEGLHVTRLAAPAGSGESPIQVMVKQAG
FT                   HRRNSHSFVELSTIVVPRGVVP"
FT   gene            complement(516080..516604)
FT                   /locus_tag="HM1_0265"
FT   CDS_pept        complement(516080..516604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0265"
FT                   /product="pilin assembly protein, putative"
FT                   /note="Member of prepilin-type N-terminal
FT                   cleavage/methylation domain, TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82884"
FT                   /db_xref="GOA:B0TEG5"
FT                   /db_xref="InterPro:IPR022346"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEG5"
FT                   /protein_id="ABZ82884.1"
FT                   /translation="MGVPIQRGMAAVGTMRGYTLVEVCLVLVLLGSLLLASGPFLSRWY
FT                   GQLSLEAAARQVQTDLLSARDKAVLEQRNVALVFVIESPNYRITYSDDERKSESRTLPG
FT                   GVVVKTTSFNVTSNMYRNTFIFATDGRAGMPGMGGTVMLQGSNGRNRYVIVSRNGRVRI
FT                   DSMPPPSGEVS"
FT   gene            complement(516653..517102)
FT                   /locus_tag="HM1_0264"
FT   CDS_pept        complement(516653..517102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0264"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82883"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEG4"
FT                   /protein_id="ABZ82883.1"
FT                   /translation="MLYLFFIIAALATMAATVTAMGNYTWSSVRTQARAEQLLYSAESG
FT                   IEAALAAAEDWLKRRPDWESPPEAASLASHLAARLPGFSLGESKVRLTYRTVTGKPFSL
FT                   DVIASAEGDGGRFAMLARLGMEKREAGLWQVSSVERSLLRSVSAR"
FT   gene            complement(517111..517590)
FT                   /locus_tag="HM1_0263"
FT   CDS_pept        complement(517111..517590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0263"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82882"
FT                   /db_xref="GOA:B0TEG3"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEG3"
FT                   /protein_id="ABZ82882.1"
FT                   /translation="MSNRLSRGEQGSILTEVLIALLLLALTALPLYSVMVVAERLERRS
FT                   ERFAQMLTLARQVMELKGTAMKADPGQADSRLPAGVAIPDGFRCQVTVQDAADPAGLPL
FT                   KEVSVIVWDQANARPVEAGGGAETAPSEISAAETPSAAGSKCALAMLVALPDEAR"
FT   gene            complement(517587..518339)
FT                   /locus_tag="HM1_0262"
FT   CDS_pept        complement(517587..518339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0262"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82881"
FT                   /db_xref="GOA:B0TEG2"
FT                   /db_xref="InterPro:IPR007690"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEG2"
FT                   /protein_id="ABZ82881.1"
FT                   /translation="MEGLLDWLERRTRREQALFLIAALTLFAAFAYRLFFEPLWQQYRL
FT                   HAERLRSAQAMTEQLRRHQAEPGQADAPEAESLRALSACSDGAKQVTAIAEAAEATGVK
FT                   LRRVIGDHPAAEGRLRKGVFTIVLEGDEGDLREFLDQLGKRASAFYVQAFVWLRQDGQA
FT                   TADRDGLLTNLRWTEASALLQRLRETIRTDSAGSAGDKTVAAERSTSAMLAGLRLVFFS
FT                   VDGQREGAGANVPWQEAIQPAKRGEDEP"
FT   gene            complement(518323..518916)
FT                   /gene="pilN"
FT                   /locus_tag="HM1_0261"
FT   CDS_pept        complement(518323..518916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilN"
FT                   /locus_tag="HM1_0261"
FT                   /product="fimbrial assembly protein piln, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82880"
FT                   /db_xref="GOA:B0TEG1"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEG1"
FT                   /protein_id="ABZ82880.1"
FT                   /translation="MAEINLLPSPLRAKGRGVLRRLALSLVLCSLAAVLLYAGAERQMS
FT                   RLVERAEIVETEAGQLASRQAQEQEKKRNRQEESFLTALLRESPRWSERLRDLDDALSE
FT                   GPLRLTAIMMEGDALLLEGSGSRLCAVGDFMDKLKGTAGFSEVSLLDGTYEEDGAVTFR
FT                   LYCRLPGKISPSQWERLSEAGKAGKGGLNDGGAP"
FT   gene            complement(518938..519393)
FT                   /gene="xcpT"
FT                   /locus_tag="HM1_0260"
FT   CDS_pept        complement(518938..519393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xcpT"
FT                   /locus_tag="HM1_0260"
FT                   /product="general secretion pathway protein g"
FT                   /note="Member of the prepilin-type N-terminal
FT                   cleavage/methylation domain, TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82879"
FT                   /db_xref="GOA:B0TEG0"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR013545"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEG0"
FT                   /protein_id="ABZ82879.1"
FT                   /translation="MGRQFRRGEMGFTLVEVMLVVTLIGLMLFLFAPRLSAAPEKAKLS
FT                   SVHNDFRALEMAVRHYFIDQGKLPSAADLQYANLLDKDLAAVAPTGLNIWKDPWGSAYQ
FT                   YEPKNVGAMPATARMVSYGPNRLPGGDDLSVTFAIADGKLVVTQSGF"
FT   gene            complement(519418..520644)
FT                   /locus_tag="HM1_0259"
FT   CDS_pept        complement(519418..520644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0259"
FT                   /product="type ii secretion system f domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82878"
FT                   /db_xref="GOA:B0TEF9"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEF9"
FT                   /protein_id="ABZ82878.1"
FT                   /translation="MPVFAYKARDRSGKAEEGLLQASSEKAAARTLQQLGRYVVDLRRK
FT                   DQPRRLPDIRLHGSLPWRRPVDARQLSGFCRQLAALVDAGIPMCTSLSMVARRLRPPAL
FT                   QRAAQQVALALSQGETLISALEQQRHVFPELFVRLVETGEAGGVLDQSLHRLADHYDKE
FT                   SAITRKIRAALLYPALVLATAGGSTVFFFLYVIPAYSALLTSLGMGLPEITRFVLALAK
FT                   WIGDYGLWMMLSAALGFFGLRRLMQKGGYRILLEKALLRAPVLGGLLHRAAIARVSRSL
FT                   SILVGSGVPIIQALAIVEKVALYRSLAEAVRGVRSGVGKGHPLHQMMERSPLFPPEFVH
FT                   LVYIGEESGALDVLLEKTAEYFEAEVDGAVHRLMILLEPMLLFLMAGVVGFLALSLLMP
FT                   LFEMINGTP"
FT   gene            complement(520648..521907)
FT                   /locus_tag="HM1_0258"
FT   CDS_pept        complement(520648..521907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0258"
FT                   /product="type ii/iv secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82877"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEF8"
FT                   /protein_id="ABZ82877.1"
FT                   /translation="MAGSEKGIIVPSRRPDSAFGDRDDATEGWSQLSVVELVEEMILRA
FT                   ARERATDIHIDPMETKSRVRFRVDGLLRDEQLLPKGLHGQVVSRIKVLAGMDIARRRIA
FT                   QDGRIQVTMPDKQIDLRVSTLPTLFGERCALRMLDKKQAPLNLDQLGFLPDALAAFQAL
FT                   MGNAYGMILVTGPTGAGKTTTLYAAVNAVKSPEKNIITIEDPVEYILSGINQVQVNAKS
FT                   GIDFTEGLRAILRHDPDVILIGEIRDKETADIAVKAATTGHLVFSTLHTGDAAEAAGRL
FT                   IDMGVEPFLVASAVSGIVAQRLVRRICRSCKTSYHPPRSSPERIFLEKAGMQTDILYRG
FT                   AGCNRCNQTGFDGRLAIHEVMVVRSSLRELIIAKASTEAIRAKAVEAGMIGLVADGLAK
FT                   AILGETTVQEVMRVAFRMDG"
FT   gene            complement(522022..522141)
FT                   /locus_tag="HM1_0257"
FT   CDS_pept        complement(522022..522141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0257"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82876"
FT                   /db_xref="GOA:B0TEF7"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEF7"
FT                   /protein_id="ABZ82876.1"
FT                   /translation="MAKAVDLRRQMFLSGMLCCLSEAFFYFSFKQITGFFKFR"
FT   gene            complement(522152..523285)
FT                   /locus_tag="HM1_0256"
FT   CDS_pept        complement(522152..523285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0256"
FT                   /product="type iv pilus assembly protein pilm"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82875"
FT                   /db_xref="InterPro:IPR005883"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEF6"
FT                   /protein_id="ABZ82875.1"
FT                   /translation="MRKMFGPTITLGVEIASTAVRMVEVSRRNQRFAIVAALKQPFSPP
FT                   AGEINSDAYYQALEAAIEKCLAGLRKKAKRAVLAFPSRHLISRQIRMPHMPDDEMRASL
FT                   RWELEKYVPLSADDYVYDYLHQGVIDVEGDRMAQLLLVALPKEEVLRHHACLKRVGLTV
FT                   TAVEISSFALSRLLNVMREKDLRTYGCLDMGYDRSTLTVFREGKVQFIRFIQMGAARLE
FT                   ESLAQTFPVETIRLRLAEAAVTTEATATYEGAPAAEEAAVTETAVAEAPEAYGAAAQMQ
FT                   FLLQSFFADLIVEVRRSLDFYNLQYRDDNFSHLVLCGGLSRLRGIDAYFTQEFKLPVSV
FT                   VDMQTSLVAQIKPACLEQLTPDMAVVTGLALRSAEED"
FT   gene            complement(523484..524503)
FT                   /locus_tag="HM1_0255"
FT   CDS_pept        complement(523484..524503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0255"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82874"
FT                   /db_xref="GOA:B0TEF5"
FT                   /db_xref="InterPro:IPR007690"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEF5"
FT                   /protein_id="ABZ82874.1"
FT                   /translation="MRLPKFPGLSFSFRRILSIPAFFSLSSPAETGGDNWWMARTKRER
FT                   VLLSLFGAAVAGAGLYLLVLEGQLDQFSTLSTELPVSKQQLESAKRRIQNRQGLEQELE
FT                   ASRNKYRDVISAYPAALSSGSMAVLIGEAAKASKVTIKYFVPQPKLDLPDSKGKLIAEI
FT                   PVDIVAEGTFDALVDFSSRLETLRGGALVRNFAITWETRDKDNKGKGSDGKKESGNVLS
FT                   ELIDSVVNTLSKSPNGDAAGQQKSVNNMTARLPRAEYRPGNKEKPPTTTINAAYRVCFF
FT                   EVGAGGGPDVVDLSQYRVGRPNPFEPHVWDQANPWLGELPELSPPVTEPPGLNPGGTP"
FT   gene            complement(524500..525123)
FT                   /gene="pilN"
FT                   /locus_tag="HM1_0254"
FT   CDS_pept        complement(524500..525123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilN"
FT                   /locus_tag="HM1_0254"
FT                   /product="fimbrial assembly protein piln, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82873"
FT                   /db_xref="GOA:B0TEF4"
FT                   /db_xref="InterPro:IPR007813"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEF4"
FT                   /protein_id="ABZ82873.1"
FT                   /translation="MQSINLLPLELRPKKLDKRALFIRSGLAVGLLACVAAYGAFLGKL
FT                   YLSRQESEGIAVEMAELQPELRRVEAVEKEIREIRQKAEILDKLRIARVPWSKVFTDVA
FT                   AMTPDGLWLATVTLNENNAEKATLRIEGETTAFEQVGLFILQLRQLPYFSDVELVDARD
FT                   KAVDRRWVTRFQVEAQLAPMPKELLPSNPNPAKTSGAAQGGERR"
FT   gene            complement(525195..525962)
FT                   /locus_tag="HM1_0253"
FT   CDS_pept        complement(525195..525962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0253"
FT                   /product="peptidase a24a, prepilin type iv peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82872"
FT                   /db_xref="GOA:B0TEF3"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="InterPro:IPR010627"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEF3"
FT                   /protein_id="ABZ82872.1"
FT                   /translation="MFFALSLGLLIGSFLNVCIYRIPRQMSVVYKRSRCVSCGRPLSPA
FT                   ELIPLLSFLLQRGRCRGCGEGISLQYPLVEGWTALTFAALAALYGGLTAAWAAAALMAA
FT                   FFIVIAVIDLQHKIIPNRVLGAAFVAIALRQAGKVWTGQDGGLALLLDSLAGGVFGAAL
FT                   LFAVFWFSKGGLGLGDVKFAFVFGLLLGWPGALWAITLSALCGSVVGLAGIASGRWTGK
FT                   SQIPFGPFLAFGYFTVYLLLESSAAAAIRDFLG"
FT   gene            complement(525973..526449)
FT                   /locus_tag="HM1_0252"
FT   CDS_pept        complement(525973..526449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0252"
FT                   /product="type ii secretory pathway protein"
FT                   /note="Matches prepilin-type N-terminal
FT                   cleavage/methylation domain, TIGR02532, and prokaryotic
FT                   N-terminal methylation motif PFAM, PF07963"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82871"
FT                   /db_xref="GOA:B0TEF2"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR013545"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEF2"
FT                   /protein_id="ABZ82871.1"
FT                   /translation="MLRYFQKKFKKMKEQKGFSLIELMIVVSIIGILFAVLVPRLGNSV
FT                   DKAKIAGVKSDMRSFETAVRQYYIEKSELPTADKLAPSSGPKYLDADPTSVYDPWKGKY
FT                   KYKPVNNNKTILIYSTGINKADDTEDGTTIANDDMGIEIDFSSGSPVVTPKGLD"
FT   gene            complement(526485..527732)
FT                   /locus_tag="HM1_0251"
FT   CDS_pept        complement(526485..527732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0251"
FT                   /product="type ii secretion system protein, putative"
FT                   /note="Member of bacterial type II secretion system protein
FT                   F domain PFAM, PF00482"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82870"
FT                   /db_xref="GOA:B0TEF1"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEF1"
FT                   /protein_id="ABZ82870.1"
FT                   /translation="MASYRFRARNKQGALREGVLQEESEKAVAMTLREQGWFVIEVRPE
FT                   RGLSAKGQSSAAGAVGGSFALFRRSVPAKDLAVFCRQLSTLVNAGVAIHSALSILIQQS
FT                   RNAALRQALIDLSGDLQRGFTLSQAVGRHPKVFPEVFVHMIEAGELGGVLEEVLQRLAG
FT                   HFEKDNETRNKVKAALTYPAVVLLIGMAAVAFLLGFVIPRFAGVLGELGAELPALTKQM
FT                   LELAELVKAYWWTSFIAAFLGFYGFRQLLKTPEIRLLVDTYVLKVPVFGDMLLKVSVAR
FT                   FSRTLGTLIRSGVPMLQALEVVEKTAGNMAVSKGVMGTRESIRKGQGLAEPLQKTGIFP
FT                   PMVVQMVAVGEETGALDTMLEKVSDYYEMEVDGVVTRLSTIIEPMMLVFLGGLVALMVL
FT                   AMLLPIFDVIGSVGGR"
FT   gene            complement(527968..529059)
FT                   /gene="pilT"
FT                   /locus_tag="HM1_0250"
FT   CDS_pept        complement(527968..529059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilT"
FT                   /locus_tag="HM1_0250"
FT                   /product="twitching motility protein pilt, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82869"
FT                   /db_xref="GOA:B0TEF0"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEF0"
FT                   /protein_id="ABZ82869.1"
FT                   /translation="MQIHDILMLATEKRASDVHITVGRPPLFRINGKLMPMQELGVPID
FT                   SPWLRPLMPPDTDALVRQVLNEKQLASFEQKGEVDLSYAVPAIGRFRVNAFRQRGSSAM
FT                   VLRIIPLKPPSFHELGLPEVLATLARRPNGLVLVTGPTGSGKSTTLAAMIDLINTERAE
FT                   HIITLEDPIEFLHRHNKSIVNQREIGIDSHSFAGALRAAMREDPDVILVGEMRDLETIA
FT                   TAITAAETGHLVMATLHTNDVAQTIDRIIDVFDVGQQAQIRIQLATVLQGVVCQQLLPR
FT                   ADGKGRVVAQEIMVCTTAIRNLIREGKTHQIATAIQTGGKLGMQTMFAAIKTLVTKGIV
FT                   SREEAVKKVADPDALMRYMMDMY"
FT   gene            complement(529077..530789)
FT                   /locus_tag="HM1_0249"
FT   CDS_pept        complement(529077..530789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0249"
FT                   /product="type ii secretion system protein e, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82868"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="InterPro:IPR042181"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEE9"
FT                   /protein_id="ABZ82868.1"
FT                   /translation="MASTNRRKLGDLLLEYNLITDEQLQQALAEQKKRGERLGQTLVRL
FT                   GFVTRQMINEVLEFQLGIPTISLLQYPLHPEVFKLLPESLCRRHKCLPVKRSGNRLTVA
FT                   MVDPLNLPALDDIKMTTNLEIDAAIVAEDELEQVFEKIYGLNEEQEADIKRLEVEANRA
FT                   EEERSIIDLGELERMTAVGDAPIIRVVNTILQQAAKEGASDIHLEPQEGGVRVRYRADG
FT                   ILRHVLTLPKAAHPALLSRIKLLAKMNIAEKRLPQDGRIQTKLGDKMIDMRVSTLPAIH
FT                   GEKCVIRLLDKSNVRFDLRQLGFRDEVLRAYEKIVRNPYGMILITGPTGSGKTTTLYAS
FT                   IHELNTPEKNIVTVEDPVEYVLDGVNQVQVNMRAGLDFASGLRSILRQDPDVILVGEIR
FT                   DRETAEIGVRAATTGHLVFSTLHTNDAAGSVNRLVDMGVEPFLVASSLVGVVAQRLVRR
FT                   VCANCKRPYTPERGSPERIYLGVADDAPLTLFRGRGCVACNHTGYKGRLAIHEVLTVTA
FT                   AQRKLILERASADAITAQAICDGMIPIRQDGMSKVLQGLTTVQEILRVADVNE"
FT   gene            complement(530896..532029)
FT                   /gene="aroB"
FT                   /locus_tag="HM1_0248"
FT   CDS_pept        complement(530896..532029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroB"
FT                   /locus_tag="HM1_0248"
FT                   /product="3-dehydroquinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82867"
FT                   /db_xref="GOA:B0TEE8"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEE8"
FT                   /protein_id="ABZ82867.1"
FT                   /translation="MMGARTAKDATPVTRLEVGLGDRAYPIDIGAGLLRQAGALLAERL
FT                   QGKQILIVTNAAVNALWGEPLRCSLAEAGFSVTTKEIPDGEAHKRIETVAALYDACVEA
FT                   RLHRTSAVVALGGGIVGDVAGFLAATYMRGIDFIQVPTTLLSQVDSSVGGKVGVNHREG
FT                   KNLIGAFYQPKRVIIDTDTLSTLPDREVRAGYGEVIKTALLGDGDLFAFLETSGSDVLR
FT                   LDAGALRHVVAACCRTKAAVVEQDEREAGLRAILNLGHTFGHALETLTSYQTYRHGEAV
FT                   AVGLIAACRLAASVLGLPDKVTARVARLVEAAGLPTWFPPFPADAWRKALALDKKNRDD
FT                   AVTFVLPEGIGQCRVLADVPLTEALAVIEAMTKGRTK"
FT   gene            complement(532026..532628)
FT                   /gene="aroK"
FT                   /locus_tag="HM1_0247"
FT   CDS_pept        complement(532026..532628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroK"
FT                   /locus_tag="HM1_0247"
FT                   /product="shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82866"
FT                   /db_xref="GOA:B0TEE7"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEE7"
FT                   /protein_id="ABZ82866.1"
FT                   /translation="MDQHQSGKEESCSHKKNVVLIGFMGTGKSTVGRRLAARLGCPFVD
FT                   TDGEVEKVTGMTIAQIFDRYGEARFRSEERQMARKVAALEGVVVATGGGIVLNPENVAA
FT                   LRSSGVLIGLEATAEVIWSRVTRRNHRPLLQKDSSVDHLREMMAKRRPYYACADMTVDT
FT                   SSLSVNEIVEVILTYLRGCSEERQDSRAAGDLGGEAR"
FT   gene            complement(532653..533834)
FT                   /gene="aroC"
FT                   /locus_tag="HM1_0246"
FT   CDS_pept        complement(532653..533834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroC"
FT                   /locus_tag="HM1_0246"
FT                   /product="chorismate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82865"
FT                   /db_xref="GOA:B0TEE6"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEE6"
FT                   /protein_id="ABZ82865.1"
FT                   /translation="MAALRYLTAGESHGPALTVIVEGMVAGLPLKAEDLDEQLARRQKG
FT                   HGRGGRMAIEKDRAAILSGIRGGKTLGSPICLQIENRDWKNWSTIMAAGAEADLMGRRV
FT                   TQPRPGHADLAGAIKYAQRDIRNILERSSARETAARVAAGAVARRFLAELGIGVCSHVT
FT                   AIGDAAAVGGIIDRTESDWVRLAAQAEQSTVRCADSALEQAMISAIDRAKSAGDSLGGV
FT                   IELAVLGLPVGVGSHVQSDRRLDGRIAGAMMAIPAIKGVEIGLGFAAALRPGSQVHDEI
FT                   GYDRESGYGRRTNRAGGIEGGISNGAPVVVRIAMKPIPTLYQPLMTVDIDSRQPVAASV
FT                   ERSDTCAVPAAAVVAEAVLALVVADSLLETTGGDTLAQVRERVAAMREQALRF"
FT   gene            complement(533955..534806)
FT                   /gene="aroE"
FT                   /locus_tag="HM1_0245"
FT   CDS_pept        complement(533955..534806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroE"
FT                   /locus_tag="HM1_0245"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82864"
FT                   /db_xref="GOA:B0TEE5"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEE5"
FT                   /protein_id="ABZ82864.1"
FT                   /translation="MALLGYPVKHSFSPAMHNAAFERLGLNWRYSAHAVKPEDLGKAVA
FT                   GLAALGYRGANVTVPHKEQVVSLLDRVDPSAKRLGAVNTIVMAGDGKTVGYNTDGIGFL
FT                   HGLRQDGFAVAGAAALLLGSGGAARAVAFALLDGGVRSLVVVNRTPEKAEALLDALRRS
FT                   GAAEGAALRAGRWEEAFLRECAKEVDLVVNATASGMGKGEGSIAYPLSPKRWLSPGPFV
FT                   CDLVYHPPETELLSVARSLGCRCQNGLPMLLHQGAAAFALWTGQEPPLTVMAEALRQAN
FT                   GG"
FT   gene            535065..535205
FT                   /locus_tag="HM1_0244"
FT   CDS_pept        535065..535205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0244"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82863"
FT                   /db_xref="UniProtKB/TrEMBL:B0TEE4"
FT                   /protein_id="ABZ82863.1"
FT                   /translation="MDKQMPFADLNEDQLQALYKVEQQLNAQRNGDDEVILLAYKKENH
FT                   R"
FT   gene            complement(535225..535764)
FT                   /gene="yqeG"
FT                   /locus_tag="HM1_0243"
FT   CDS_pept        complement(535225..535764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqeG"
FT                   /locus_tag="HM1_0243"
FT                   /product="had superfamily (subfamily iiia) phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82862"
FT                   /db_xref="GOA:B0TDZ9"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR010021"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDZ9"
FT                   /protein_id="ABZ82862.1"
FT                   /translation="MKILKPARRVDAVPQVNVADLAAQGVQGVIIDLDNTLTEWNQNHL
FT                   CPEIARWLEELERYGIKLCILSNNKKHRVQSFAEACGVPYISNARKPWRRGFRRAMNLL
FT                   GTRPEQTVVIGDQIFTDVLGGNRSGLYTILVNPISRREFLGTRLVRQLERWVLRERSPR
FT                   RGHKQLFRSKTKEGQP"
FT   gene            complement(535833..536408)
FT                   /gene="pyrE"
FT                   /locus_tag="HM1_0242"
FT   CDS_pept        complement(535833..536408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="HM1_0242"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82861"
FT                   /db_xref="GOA:B0TDZ8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR006273"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TDZ8"
FT                   /protein_id="ABZ82861.1"
FT                   /translation="MSQDQVLDIFRNSEALLEGHFRLTSGRHSNRYVQCAQVLQHPPYT
FT                   ERLSRHLAALLRKGVGLPDVVIGPAMGGILVAYEVGRALGVRAIFTEREKGLMTLRRNF
FT                   VVRPGETVVVCEDVVTTGGSVREVIDVATAAGGRVAAVAALVDRSNGQVDFGVPFFAAL
FT                   SMEVLSWPPEECPLCKEGTPAIKPGSRT"
FT   gene            complement(536549..537280)
FT                   /gene="pyrF"
FT                   /locus_tag="HM1_0241"
FT   CDS_pept        complement(536549..537280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrF"
FT                   /locus_tag="HM1_0241"
FT                   /product="orotidine 5'-phosphate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82860"
FT                   /db_xref="GOA:B0TDZ7"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TDZ7"
FT                   /protein_id="ABZ82860.1"
FT                   /translation="MEAKDRLIVALDVDTRDEAISIVNAVGEHCGLFKVGMQLHNSAGF
FT                   AVTEEILSMGFPVFLDLKFHDIPNTVGKAATVVSRRGVKMFTVHAAGGREMLRQAVKGA
FT                   REGQGERRSGGPLVLAITVLTSVSQAVLHDEVGLPGSVEENVVRFARLAQAAGVQGVVA
FT                   SPQEIRPIRAACGDDFVIVTPGVRPLWAGTDDQARIMTPAKAMEAGATYLVVGRPITAA
FT                   PSRAEAAKRIVEEMAEGLARR"
FT   gene            538179..538841
FT                   /locus_tag="HM1_0240"
FT   CDS_pept        538179..538841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82859"
FT                   /db_xref="GOA:B0TDZ6"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDZ6"
FT                   /protein_id="ABZ82859.1"
FT                   /translation="MLSNPFFEVYEMNEPSYWEKGSVPLALIVLIVLITTSTSLAGYIF
FT                   REITLAKANAETIQMRYVAEAGAEHFIHRIKELLRQREPLQVPHHHYSVEENQVFWIPA
FT                   TQEYLSFKDINQIIDDWNREPPEISTSQFRAKYNISDVSWEPSSSFQSLESPSLTDVFT
FT                   VNFTVTAECLTGEKRTQSLQVTAEFRVSFEPSDDTLVMKMNPADPEPVISIKTWRWI"
FT   gene            539007..540917
FT                   /locus_tag="HM1_0239"
FT   CDS_pept        539007..540917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0239"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82858"
FT                   /db_xref="InterPro:IPR003343"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDZ5"
FT                   /protein_id="ABZ82858.1"
FT                   /translation="MKLFPNWRNSSGMTLLEVLISLALFSIVTAGIFSLLNGNNNVFFR
FT                   ETLNAHLRQESRTSVNQILKTIQEAHDEDIEVDPRGLWMRIDSPGKPETLYELTASADD
FT                   PSYYDLYINKTRLPVKVLSSGNKFFIKDDLTKMVTVNLTYLDDATQTADTGPTLALKAS
FT                   VLPRLSKPISDITKTLWKIITCPEEISLQVGETVGFPFQAFSVYSNGAVEDITSAVTPV
FT                   ISDPTIVTLTSGSITGLTPGTATIYVSYQGFSASTKVNVTGASIEAISIEPQTVHLQVG
FT                   QTIDFSIEVKAKYADGRITDITSQVEPTVSDQSIIALEQGKITGKKSGIAYVIVSYQGL
FT                   SAQTTVTVTGDPLKEYILRQEAPLFLFGNKLSVTGSSRVNGTDATALIKDQIDNKNTSV
FT                   PFGDAVDVNTKIIFIDDHLYFDGGSNKIGLQDNTSKTYIKGNLTTWNGRHELYGDIYVA
FT                   GNYRLKDAIVYGNIYVNGNLELGWTPTIKGTIYYTGTLTVPNNYDSSIVKKTKKVTGLD
FT                   DFQIPNFSIPNLQQDSWYFSRGYTSDPTMKNNMKYFGNSISFKNWGDPYCNNVTIASKG
FT                   NITLQGNLHFSGILFAPNGKVTIEDSCTFQGIIVANQVSVTGNAGVTFQRIIDDESKLP
FT                   F"
FT   gene            complement(541048..541557)
FT                   /locus_tag="HM1_0238"
FT   CDS_pept        complement(541048..541557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0238"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82857"
FT                   /db_xref="InterPro:IPR014099"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDZ4"
FT                   /protein_id="ABZ82857.1"
FT                   /translation="MPEMAPGPMTGPIAAPGPCPMPGMMPEMPGMMPQMPGMMPGMVSP
FT                   IGAYPMPTVPYPPSGGMIPGGPVVEEGPQVPGMLPLEQSYIENILRLNRGKVATIYMTF
FT                   ENNVQWNAKCFRGCIEAAGRDHIILSDPKTGKRYLLLMVNVDYVTFDEPIAYDYPGYLA
FT                   PPVRQR"
FT   gene            complement(541696..542127)
FT                   /gene="cwlJ"
FT                   /locus_tag="HM1_0237"
FT   CDS_pept        complement(541696..542127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cwlJ"
FT                   /locus_tag="HM1_0237"
FT                   /product="cell wall hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82856"
FT                   /db_xref="GOA:B0TDZ3"
FT                   /db_xref="InterPro:IPR011105"
FT                   /db_xref="InterPro:IPR042047"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDZ3"
FT                   /protein_id="ABZ82856.1"
FT                   /translation="MAVIKAPTDQVKTLARLMRAEAEGEGELGMLMVGNVGVNRVRANC
FT                   LDFRGIRSIQRMIFQSPGGFEAVQRPYFYQRARERDLQLARRVVRGERRHPASNALWFF
FT                   RPGGAGCPGTWYRQPNTGKFKKHCFFAPLRRNCPDVYRG"
FT   gene            542140..542283
FT                   /locus_tag="HM1_0236"
FT   CDS_pept        542140..542283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0236"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82855"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDZ2"
FT                   /protein_id="ABZ82855.1"
FT                   /translation="MFLLCAPIVFGREKKGADRRNQCGGTSRCPRGIERGGNGTAFRLL
FT                   FP"
FT   gene            complement(542444..542656)
FT                   /locus_tag="HM1_0235"
FT   CDS_pept        complement(542444..542656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0235"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82854"
FT                   /db_xref="InterPro:IPR021377"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDZ1"
FT                   /protein_id="ABZ82854.1"
FT                   /translation="MALIIDRFEGQFAVVEVDGKGTIDIPRKELPVQTREGDVIRLING
FT                   RYEIDLAETKRLRAEANKRTDDFWS"
FT   gene            complement(542824..543525)
FT                   /gene="spoIIIC"
FT                   /locus_tag="HM1_0234"
FT   CDS_pept        complement(542824..543525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoIIIC"
FT                   /locus_tag="HM1_0234"
FT                   /product="RNA polymerase sigma-k factor, putative"
FT                   /note="5' end is spoIVCB. Also known as sigK"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82853"
FT                   /db_xref="GOA:B0TDZ0"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014209"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDZ0"
FT                   /protein_id="ABZ82853.1"
FT                   /translation="MIPTLVGALIVPFIKGITALLSYISNNAFPQPLSDTEEAYCLARL
FT                   KEGDEQARNKLIEHNLRLVAHLVKKFDGTGENNDDLISIGTIGLIKAINTFDASKGTKL
FT                   ATYAARCIENEILMHLRAMKKMRGEVSLYDPIGVDKEGNEITLIDILGTDPEAVSDIVE
FT                   NALEQARLLSKLKKLSKRERYVIELRYGLLSGCRQTQREIAKNLGISRSYVSRIEKRAI
FT                   MKLMSDLASKA"
FT   gene            543920..545452
FT                   /locus_tag="HM1_0233"
FT   CDS_pept        543920..545452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0233"
FT                   /product="exopolyphosphatase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82852"
FT                   /db_xref="GOA:B0TDY9"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="InterPro:IPR022371"
FT                   /db_xref="InterPro:IPR030673"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDY9"
FT                   /protein_id="ABZ82852.1"
FT                   /translation="MEKIGIIDLGSNSVRLMIVGIAPDGSYKLIDEAKESVRLSEHMGP
FT                   EATLKPIAIERTIEALRLFQHLCRAHGITRTDCVATAAVRQAVNQKEFLQQVKTATGLD
FT                   FRVLTGWEEAQAAYNGVINTIDIDRGVIVDIGGGSTEVIRIEDRRMVQAISLPFGAVTL
FT                   TENRIDSARGPNKPSEEQLKALESFLADQFAAIDWLKDMESPTIVGLGGTVRNLSKIDR
FT                   KRKKYSLDITHNYRMTPKDVHEIYRSVKTVNLEQRKKIPGLSKDRADIIVAGLAIISAL
FT                   INTARGAQLVVSGSGLRDGLFYQYLLREQPIPVVDDVVRHCVNNLMRYYSLERDHSRHV
FT                   AALTLSMFDQLTALHEMGPFERRILEVASLLHDIGIHVNYYDHHKHSFYLITSTRLNGL
FT                   THREILMAAFVAMAHTKTFSGNLLPYKDILSDDDGRTIRKLGVILRIAEALERSEAGVV
FT                   SAVRLHHHVENVHLVAHTRHSADLEICDAYKVAPDFKKVFGRNLLVSAQSGA"
FT   gene            complement(545565..547778)
FT                   /gene="ppk"
FT                   /locus_tag="HM1_0232"
FT   CDS_pept        complement(545565..547778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppk"
FT                   /locus_tag="HM1_0232"
FT                   /product="polyphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82851"
FT                   /db_xref="GOA:B0TDY8"
FT                   /db_xref="InterPro:IPR003414"
FT                   /db_xref="InterPro:IPR024953"
FT                   /db_xref="InterPro:IPR025198"
FT                   /db_xref="InterPro:IPR025200"
FT                   /db_xref="InterPro:IPR036830"
FT                   /db_xref="InterPro:IPR036832"
FT                   /db_xref="InterPro:IPR041108"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDY8"
FT                   /protein_id="ABZ82851.1"
FT                   /translation="MCQKNLEADANANGPSLDNRPERKSFNRAEYYINRELSWLEFNQR
FT                   VLEEAIDKTNPLLERLKFLAIVSSNLDEFFMVRVAGVQDQKEAGLLKRDPSGLTPAAQL
FT                   KLIAERTHRMVQDQYAHLMNNLLPELEAKGIRFLRCEELNHNQKSFVENYFDEVIYPVL
FT                   TPLAVDQSRPFPLLANKSLNIAVFLEPKNNLAVKRQLFAVVQVPSVLPRFIEVPCASGK
FT                   AFVYLEDVIKSQLEVLFRGNRILESSTFRITRNADLTVDEEGAEDLLEAIEKELQKRKW
FT                   GAEVRLELEAGAGPSIGEYLKADLELDDEDIYAIPGPLDLTAFMRIVDLPGYDNLRHEK
FT                   MTPQEPEDLVGEKDLFAAIAKKDILLHHPYESFHPVVEFVSQAARDPRVLAIKQTLYRV
FT                   SGDSSIVKALAEAARKGKQVTVLVELKARFDEEKNIAWAKTLEKAGCHVIYGLVGLKTH
FT                   AKIILVVRQEEGRIRRYVHLGTGNYNDATARFYTDFGLLTSAESFGADATDFFNEVTGY
FT                   AVPAKWREIEAAPLGLRKKFFELIEREIEASTPEKPGRIIAKMNSLTDEHMIQMLYKAS
FT                   CAGVQIDLIVRGICCLRPGIPGVSENVRVTSIVGRFLEHHRAYYFQNGGSEEIYLSSAD
FT                   WMDRNLDRRVELLFPVKAPALAQRVKAILEIMLKDNVKARRLLPDGTYVRVAQEGGEVL
FT                   QSQVYFLKQSRRRGGRGSRRNRAVAATPVERENEKDDGKNLLH"
FT   gene            complement(548116..549066)
FT                   /locus_tag="HM1_0231"
FT   CDS_pept        complement(548116..549066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0231"
FT                   /product="2-nitropropane dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82850"
FT                   /db_xref="GOA:B0TDY7"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDY7"
FT                   /protein_id="ABZ82850.1"
FT                   /translation="MKTKLTALLGIQYPVIQGGMAWVSEANLTAAVSNAGGAGIIATGG
FT                   RPTEWVREEIRKARSLTDKPFGVNIMLMAPNKDEIVEVVCEEKVAFVTLGAGNPVPFFE
FT                   KLKSAGIKVIPVVPNVKLAKRVEAAGADAVVIEGMEAGGHIGTLTTMALLTNVIPEMNI
FT                   PVIAAGGIADGRGIAAALLMGASGVQMGSRFLLAEECALHPNAKKRIIEAVDTDSIVTG
FT                   YSRGHGVRGLRNRMTEKYLELERAGAPQDELDKLAIGTNRLAAIEGDIENGLVQVGQSL
FT                   HPLKEIKPTRAIMDELMSQTREALAGAARLAAMLA"
FT   gene            complement(549267..550817)
FT                   /locus_tag="HM1_0230"
FT   CDS_pept        complement(549267..550817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0230"
FT                   /product="drug resistance transporter, emrb/qaca family,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82849"
FT                   /db_xref="GOA:B0TDY6"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDY6"
FT                   /protein_id="ABZ82849.1"
FT                   /translation="MTSRENGHPGVLVVTMVVVIGTFMAVLDTSILNVALPKLMVLFSV
FT                   DTKEIQWILTAYMLVSGAVIPIMSYLGDTYGYRSLYAYCLAAFTAGSLLCGLAWNNESL
FT                   IVFRVIQALGGGLIQPASMALMFRFVPKEKMGMAMGLFGLSIAVAPSIGPSLGGFIVED
FT                   FSWRWLFMINVPLGVLGFVLCQTLLPETEKIPSAHFDFWGLLLSSGSAFLYLLALDKGQ
FT                   DWGWSSYTVVMLLLTATAMAALLVVVELNHTHPMLDLRLFKIPQFTYSVVISSCLYIIL
FT                   ISGVLLWPIYLQNIRGYSAVQTGLILMPQAIAMGLMMPVAGKLYDKIGARPIVMVGLPL
FT                   IGVSTYLMHTLTVDTPQSVFNLWLILRGLGLGLTFMPVNTAGVSAVPLMKAGAASTLNN
FT                   LVRAVAGSFGIAITTSMLENRQAFHAHRLVEGLDLFSPSWTMMQQSADGILGATGDRSP
FT                   LQPTTLTLMYGQIQLHSNTWAMADVFFVFALLVILVIPMALLLKKRGGKLGGPPVVAE"
FT   gene            complement(550824..551471)
FT                   /locus_tag="HM1_0229"
FT   CDS_pept        complement(550824..551471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0229"
FT                   /product="biotin-requiring domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82848"
FT                   /db_xref="GOA:B0TDY5"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDY5"
FT                   /protein_id="ABZ82848.1"
FT                   /translation="MKAKKLIVFIIGSYLLATALISAYYGYEHLYFVRTDDAKVAVDLA
FT                   VARAPIAGRITDLKIRENETVAKDDIVAVVEGSPAPNQPKLRAPVFVPSSGQVLRLEAR
FT                   EGEAVTAGQPLAAVADRAAAYVEARFAEVDSSRIRVGQTVEVKLDGAAGQVFTGIVSSI
FT                   NRNTEQITWPIIPLTPAQQHPREDQLLSVNIEVPGAPLILGTGAAVKIRVKE"
FT   gene            complement(551476..552129)
FT                   /locus_tag="HM1_0228"
FT   CDS_pept        complement(551476..552129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0228"
FT                   /product="multidrug resistance efflux pump, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82847"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDY4"
FT                   /protein_id="ABZ82847.1"
FT                   /translation="MKKKIAKIAGAVLLLSALGYAGYSYVDSVRYVTTDDARIDADIIK
FT                   VGPEIAGRVMEIRVKEGDQVQAGETMVRLEEKNTTLQNRDAALVRAPGTGMVIKKNVND
FT                   GELVSPGQRLFLLADFRNLYVSARIEETKIHRLAVGEPVTLTVDAFPGRKLQGVVEQVG
FT                   FAADSVFSLLPSSNVSGNFIKVTQRIPIKIKILDDQGLRILPGMNVIAKIATGG"
FT   gene            complement(552126..553397)
FT                   /locus_tag="HM1_0227"
FT   CDS_pept        complement(552126..553397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0227"
FT                   /product="hlyd family secretion protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82846"
FT                   /db_xref="GOA:B0TDY3"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDY3"
FT                   /protein_id="ABZ82846.1"
FT                   /translation="MPNQQIHRKIGVKAIALGCVVATAITLTGCSGGAAPDPKVHKVVV
FT                   ETVGEQGLNKARVVAGRVMGETESAVMSKLNARIVKVLVDVGQEVTAGQPLIQLDDRDY
FT                   RVALAQAEANLRAARARLADAEKGARPQERQQMEQKVTAAAASLDIAKKTMERTQSLFD
FT                   AGAASKQQLESAQLALIQAQTTYEQLLQQQSQLLEGATAQTLESLRAAVDQMSAVVDQA
FT                   RLNVEATVITAPVNGRIASKLAHEGEMAATAPAANTLLTIVSSEPVVEASVPEEYIKQI
FT                   QVGQTMKVRIEQVSSEVFEAKVIAVSPIANSASKEYPVKLRLPQSGRWKSGMYAEVTLP
FT                   DGQAQSPIVVPKDAVVKRGSERVIMVTDGSTVTSRPVLTGRSDGSNIEILSGLKGGEKI
FT                   ITVGQEDLQDGDAIQVIAEKGAAQ"
FT   gene            complement(553418..554011)
FT                   /locus_tag="HM1_0226"
FT   CDS_pept        complement(553418..554011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0226"
FT                   /product="transcription regulator, tetr family, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82845"
FT                   /db_xref="GOA:B0TDY2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039536"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDY2"
FT                   /protein_id="ABZ82845.1"
FT                   /translation="MTDLCGSERRDMFKAAAMELACQYGYEGATIKRIAQKCGVTVGTI
FT                   YHYFENKEELFREALRERTFTTVLKKLIGEIEEKPIDEGLFQVATGFVGFLRERRNLIS
FT                   ILVSEGLHNGEFGSLFADIVRQNTELMKSYFDRKIAAGELAPIDSRIAVQMFFGHFFTA
FT                   YLHKERMQMEHLPPLDEAFVRGSIALLLHSWRQP"
FT   gene            553959..554099
FT                   /locus_tag="HM1_0225"
FT   CDS_pept        553959..554099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0225"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82844"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDY1"
FT                   /protein_id="ABZ82844.1"
FT                   /translation="MAAALNMSRRSEPQRSVNPVSPPAPAALAPSAPYATYAPYAPYAT
FT                   V"
FT   gene            complement(554257..555381)
FT                   /locus_tag="HM1_0224"
FT   CDS_pept        complement(554257..555381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0224"
FT                   /product="iron-sulfur cluster-binding protein"
FT                   /note="Has a 4Fe-4S binding domain. which is similar to a
FT                   ferredoxin COG. Other protiens with this domain include
FT                   bacterial ferredoxins, various dehydrogenases, and various
FT                   reductases"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82843"
FT                   /db_xref="InterPro:IPR007160"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDY0"
FT                   /protein_id="ABZ82843.1"
FT                   /translation="MAITACRSYEPGEIEAAVGRLLERLGGLAVTIRPGMRVALKPNLV
FT                   MGKDPAAAVTTHPALVEAVAKTVIALGATPFIVDSPGGPSANAAGLRMVYKKTGMAAVA
FT                   ERLGIEVSYDTAEVEVPLTERSPLRKVSILKVLYEADAIINLPKIKTHAQTGYTGAVKN
FT                   LYGAIPGMRKAEYHFRVQERKPFGELLVELNLALRPVLTVMDGVIGMEGDGPTAGEPKP
FT                   FGYLLAARCPFTLDHYALSLIAVKDIEMDRVAQARGLVGPLLLLDDGETIEPVPFRPAS
FT                   HRRVNFVENHLPPFLARPISRSLRPLPAFDRDKCIGCRICLQSCPADALRMERIPQLDK
FT                   DKCIGCLCCQEMCPERAVEVRQTGLSRLLFGSRR"
FT   gene            complement(555536..556195)
FT                   /locus_tag="HM1_0223"
FT   CDS_pept        complement(555536..556195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0223"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82842"
FT                   /db_xref="GOA:B0TDX9"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDX9"
FT                   /protein_id="ABZ82842.1"
FT                   /translation="MEAFWASTIFVVLAEMGDKTQLLGMAFATRYKAATVLAGVFVATL
FT                   LNHFLAVALGDYLTAFVPMETVQLAAAISFIFFGLWTIRGDELEGEDEKEYFGPFLTVT
FT                   IAFFIAEMGDKTQLASVALAAKYHNLIPVWMGTTTGMMISNVIGILIGVVLGKKIPERI
FT                   VKYASAAIFILFGYAGIIATVFDPATRYGVLAVVTVLTGIAVYMLTREEKKPSRSE"
FT   gene            complement(556261..556512)
FT                   /locus_tag="HM1_0222"
FT   CDS_pept        complement(556261..556512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0222"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82841"
FT                   /db_xref="GOA:B0TDX8"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDX8"
FT                   /protein_id="ABZ82841.1"
FT                   /translation="MLSGLTGPDFWITIILPEGSSFTGKVNKLASAPGLAGQDEPYLPF
FT                   RLNETLDTFFGVSKVFLFCCFSLLSLFFLLPFSLRPFL"
FT   gene            complement(556497..557186)
FT                   /gene="trmB"
FT                   /locus_tag="HM1_0221"
FT   CDS_pept        complement(556497..557186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmB"
FT                   /locus_tag="HM1_0221"
FT                   /product="tRNA (guanine-n(7)-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82840"
FT                   /db_xref="GOA:B0TDX7"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDX7"
FT                   /protein_id="ABZ82840.1"
FT                   /translation="MRLRRIPGTREKILQYTPWLVTEPTAWQGRWQDYIAGRLGSQQAE
FT                   PMEIHLELGTGRGRFINEMARDCSDHFWIGAELREEVLLNALELAKKGETPNLAFLWIN
FT                   VEQTVDIFGVGEVDGIYLNFSDPWPKARHAKRRLTHRRFLERYRRYLKVGGKIRFKTDN
FT                   EDLFRFSLEEFEANGFALQEVTFDLHNDPALSSMELSARVMTEYERRFSRRGMPIYRCE
FT                   AVLCSRD"
FT   gene            complement(557251..558270)
FT                   /locus_tag="HM1_0220"
FT   CDS_pept        complement(557251..558270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0220"
FT                   /product="pseudouridine synthase, rlua family"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82839"
FT                   /db_xref="GOA:B0TDX6"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDX6"
FT                   /protein_id="ABZ82839.1"
FT                   /translation="MAVSKEWLAHRVKPEEEGRRIGSILQFCLGFSRRRLQILTRTDGF
FT                   RLNGKRAHLDRRVKEGDLLEVCLHQEEEGNLAPVAMELKVLYEDADLLILDKPPGIEVH
FT                   PPEQRARFRPTLAHGVAHYFAEKGIKARVRPLHRLDKDTTGICVFAKNAFAHQALDRQL
FT                   RNGSLQRGYLAILRGLPAELVGVIDAPIGRDPEHHMRRMVRDDGERAITRYRVTQVIEP
FT                   SGLEMKGAAESEGHWALAEVILETGRTHQIRVHFRHLGTPLLGDRLYGGDSPRIDRQAL
FT                   HSAWVTLLQPRSGEAVKVTAELPEDMARLLGGKANDGSKNEDRKTEDGKTEDGKTEDG"
FT   gene            558708..558836
FT                   /locus_tag="HM1_0219"
FT   CDS_pept        558708..558836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0219"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82838"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDX5"
FT                   /protein_id="ABZ82838.1"
FT                   /translation="MLAKAALYSHRFADPNPLAARSNRPDEEPPARKQRLIALYKS"
FT   gene            complement(558975..560642)
FT                   /gene="glgP"
FT                   /locus_tag="HM1_0218"
FT   CDS_pept        complement(558975..560642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgP"
FT                   /locus_tag="HM1_0218"
FT                   /product="alpha-glucan phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82837"
FT                   /db_xref="GOA:B0TDX4"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011834"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDX4"
FT                   /protein_id="ABZ82837.1"
FT                   /translation="MNAFCSGTELPHVAYFCMEYGLNASIPIYSGGLGILAGDYIKAAR
FT                   ELGRPMVAVGILWRQGYTEQHIDSNGQPYDVYRDYAFPDLRDTGVTVSVRIWEHDVVCK
FT                   VWVLDNQGNVPLYLLDAGFPGSPHGWMTQRLYGGGRQERIAAEMILGIGGIRALRALGL
FT                   LIDVYHFNEGHAVFAGLELIREKMSQGQSFERAWHNTRQEIVFTTHTPVAAGNEVHDHD
FT                   TLGRMGAYNGLDYNQMRDLGGDPFSMTVAGLRLSYMANGVSKLHGRTVHRMWGHLESIP
FT                   LIFSITNGVHPGTWQDPRIKQAFETRGDLWSIHMDNKRKLIEYVKEKGLGNLREDTLLI
FT                   GFARRAASYKRGDLIFRNPEVIDPYLKTGKIQIIFSAKAHPADMMGKEIIARLVEFQKR
FT                   YPDNVVFIENYNMDIATLLVRGCDIWLNNPRRPQEASGTSGMKAAMNGVLNLSVEDGWV
FT                   GEGVQHGINGWLLDFHPGENLSPQEQDELDMKSLYRVLLEEVLPMYYHNRKHWVEMMML
FT                   SIDMSRWQFSSHRMCREYYDLMYTPVTTNKRQLLNQSV"
FT   gene            complement(560824..561000)
FT                   /locus_tag="HM1_0217"
FT   CDS_pept        complement(560824..561000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0217"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82836"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDX3"
FT                   /protein_id="ABZ82836.1"
FT                   /translation="MIKRFTAVCTECGTVRNVIVPACSQAELAVDMLGEIERTRTCPYC
FT                   EQEGLRELRDHVA"
FT   gene            561123..562346
FT                   /locus_tag="HM1_0216"
FT   CDS_pept        561123..562346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0216"
FT                   /product="metal-dependent phosphohydrolase, hd subdomain"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82835"
FT                   /db_xref="GOA:B0TDX2"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDX2"
FT                   /protein_id="ABZ82835.1"
FT                   /translation="MASYTPVDLSRLLGALSMALDFTTHGLSRHHRRVAYMAVTLGRAI
FT                   ALPVKTLKTLYCAASIHDIGAVTFAQKNALSRFEIHSPKSHCQLGRQMLASSPQLREVA
FT                   IIIEHHHDHWDEPGRQDSPVDPTLLLLGDLIHLADRIEVLLTPAHILSQRRQVMDTINS
FT                   LFGTVFRPEWKDLLNELAERESFWLDLDSPFIDELTRQAVGADEHIIQLPYCELKGLAS
FT                   IFARIIDSKSRFTLRHSRLVSASATLLSQLAGFSPADAARMEVASLLHDIGKLSIPEEI
FT                   LEKPAQLTPEEYLIIKQHTYHSYHILNQVPGFSEIAQWAAYHHERLDGKGYPFHIPGEE
FT                   LSVGSRIVAVADIFSALVEDRPYRDGLSREKVESILKKMVLEKAIDGDLADLLCQHYDD
FT                   FEALKQTT"
FT   gene            complement(562422..562793)
FT                   /gene="speD"
FT                   /locus_tag="HM1_0215"
FT   CDS_pept        complement(562422..562793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speD"
FT                   /locus_tag="HM1_0215"
FT                   /product="s-adenosylmethionine decarboxylase proenzyme
FT                   (adometdc)(samdc)"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82834"
FT                   /db_xref="GOA:B0TDX1"
FT                   /db_xref="InterPro:IPR003826"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="InterPro:IPR017716"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDX1"
FT                   /protein_id="ABZ82834.1"
FT                   /translation="MDYSTFGRHVTVDTWGVDFEKLNDARFLEEQMIEAARAAGATVLS
FT                   SQKQQFEPQGATVLVLLSESHISIHTYPEKGFAALDCYTCGETVDPEVAISHMIKVLVP
FT                   KKTSVKLLKRGDGPIEVLK"
FT   gene            563301..563444
FT                   /locus_tag="HM1_0214"
FT   CDS_pept        563301..563444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0214"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82833"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDX0"
FT                   /protein_id="ABZ82833.1"
FT                   /translation="MLPTETGADNLSLGFKAMTGIGEPANMRLWFLAHIRSDTAGDATI
FT                   GL"
FT   gene            563569..564243
FT                   /gene="cbiM"
FT                   /locus_tag="HM1_0213"
FT   CDS_pept        563569..564243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiM"
FT                   /locus_tag="HM1_0213"
FT                   /product="cobalamin biosynthesis protein cbim"
FT                   /note="also named cobalt transport protein CbiM"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82832"
FT                   /db_xref="GOA:B0TDW9"
FT                   /db_xref="InterPro:IPR002751"
FT                   /db_xref="InterPro:IPR018024"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDW9"
FT                   /protein_id="ABZ82832.1"
FT                   /translation="MHIMEGYLPLSHAVAWTAASTPFVVHGLRSIQKTVRANPEAKMLL
FT                   GVTGAFSFVLSALKLPSVTGSSSHPTGTGLGAVLFGPTVMAVIGAIVLLFQALLLAHGG
FT                   ITTLGANVFSMGIVGPFAAYGLYRLGQRLSLPSNISLFAAAAIGDLATYFTTSLQLALA
FT                   FPDTATGIAGSFAKFASIFLVTQLPLALAEGLLTLVIFNALSKYSADELSALNIFSKEV
FT                   KA"
FT   gene            564240..564482
FT                   /gene="cbiN"
FT                   /locus_tag="HM1_0212"
FT   CDS_pept        564240..564482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiN"
FT                   /locus_tag="HM1_0212"
FT                   /product="cobalt transport protein cbin"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82831"
FT                   /db_xref="GOA:B0TDW8"
FT                   /db_xref="InterPro:IPR003705"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDW8"
FT                   /protein_id="ABZ82831.1"
FT                   /translation="MSWLRNKSVLIVAALFLTGVPLIMHFTQDFAGADDQAGEMIQSVA
FT                   PSYTPWFESLWEPGESAEPLLFGLQAAAGAAFIAY"
FT   gene            564621..566243
FT                   /locus_tag="HM1_0211"
FT   CDS_pept        564621..566243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0211"
FT                   /product="transposase, is4 family"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82830"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B0TAA0"
FT                   /protein_id="ABZ82830.1"
FT                   /translation="MFRFDVDPQVSFYDFAALWDQLVPADSVFRLFRELAPLLIQPEDF
FT                   TGLYCLDNGRPSHAARQMTMACMLQEMLGETDRGMEAQTRVNIEVKFALGMALDEPGID
FT                   HANFGVHRQRLIQKELDKVYLDRFIRLMYYLGVLTGKEPWITDTTHVIAPISAPTTIEL
FT                   IRQAMRLLVRLLAKQYSVPWHAIPHAPRAVRYLETVTEVKEHNLDDKAKMERLVEVVSE
FT                   ADELLAYVESSEASWKKKPDVIHYALLLCRILRERIIRKDDGTLEIAPGGSVKDMIVSA
FT                   VDSEARFGCKGKTKWRGYKMAIVEVGNSGFIAAAEAMKANDYDGSSLVPLADQLPTDCV
FT                   ENPTIIGDTHYGAGDDRVTLKEKGIDVVAPLSPKTKCDILAGEGFQVSEDQTQLICPRG
FT                   KVITTYSEVADGKNFVLRAKDHDCKHCPRYTTCFKEKKHRRTIFIHNAYGVMLEAAKHS
FT                   QTKIYKEQMRLRSRIEAKQNELVNRYGLRRVRRIGKRNLAYAARLSALAANFQKLNRLR
FT                   NDKNATMVLEVSALRGVAFKKAA"
FT   gene            566345..566473
FT                   /locus_tag="HM1_0210"
FT   CDS_pept        566345..566473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82829"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDW6"
FT                   /protein_id="ABZ82829.1"
FT                   /translation="MLLQGLAREFAYFLDGLYYFSRRHSNGAGANSGMGRKPAEDA"
FT   gene            566684..567403
FT                   /gene="cbiQ"
FT                   /locus_tag="HM1_0209"
FT   CDS_pept        566684..567403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiQ"
FT                   /locus_tag="HM1_0209"
FT                   /product="cobalt abc transporter, permease protein cbiq"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82828"
FT                   /db_xref="GOA:B0TDW5"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR012809"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDW5"
FT                   /protein_id="ABZ82828.1"
FT                   /translation="MLFTIDQWAWANKLRDKPPTLKGLIALAGLLVSMIAPTPWLSGAI
FT                   TLLYGALLAFAARIPLSLFLTLMTVPGLFLFTGCFTVAFSPSPLDPVVQVTFGPYSPGI
FT                   SAAGLKQAGVLFFRSLGATASLYFLVLTTPMVDVIELVSRLRAPRLVTELMLLIYRFIF
FT                   VLMETTQAIVVAQESRLGYSTRANSLRALGILAANLFVRSLIRSRELYIALSARGYEEE
FT                   LRVLPRARTPKNSAGTL"
FT   gene            567424..568296
FT                   /gene="cbiO"
FT                   /locus_tag="HM1_0208"
FT   CDS_pept        567424..568296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiO"
FT                   /locus_tag="HM1_0208"
FT                   /product="cobalt transport protein ATP-binding subunit
FT                   cbio"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82827"
FT                   /db_xref="GOA:B0TDW4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005876"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDW4"
FT                   /protein_id="ABZ82827.1"
FT                   /translation="MTALLETEQVEYNYPDGNSGLRGINFSLLAGRKIAVVGANGAGKS
FT                   TLFLHLNGLLKPRRGVVRFRGKPIDYSRRGLRELRSHVGLVFQDPDAQLFSASVEQDIS
FT                   FGPLNMGLPEAEVRRRVNAAMAATGITELRHRPVHALSYGQKKRVCIAGVAAMRPQVII
FT                   LDEPLAWLDPAGAKSILDLLEQLNQEGTTIVMSLHQMDIVARWSDEVVLLDQGQRLFQG
FT                   APRELFARQDLLTQAGLELPWPMALYQALAERSILPPPNELKGAELPMDQESLLPLIEQ
FT                   AWLSHKESK"
FT   gene            complement(568354..569037)
FT                   /gene="cybH"
FT                   /locus_tag="HM1_0207"
FT   CDS_pept        complement(568354..569037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cybH"
FT                   /locus_tag="HM1_0207"
FT                   /product="ni/fe-hydrogenase, b-type cytochrome subunit,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82826"
FT                   /db_xref="GOA:B0TDW3"
FT                   /db_xref="InterPro:IPR000516"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDW3"
FT                   /protein_id="ABZ82826.1"
FT                   /translation="MRDSKDLKCLNTVYVWELPVRIYHWINALCIVLLMVSGLYIGNPM
FT                   LRPAVVTGEAVTHFFMGYAFMIHIAAGYVFIANYLFRLYWAFVGNEYARSHHWPWQKAF
FT                   WLEFFDVLLSYLFLKHHKDEHLGHNPVANLAYFGFIMVGSVFMALTGFAMYGELHPNGF
FT                   FGNLQWVFQVFGPSYTIHMLHRLMAWGIAGFVVVHLYLSLRHDMFARNGTLSSMVSGYK
FT                   FRCEE"
FT   gene            complement(569050..570786)
FT                   /locus_tag="HM1_0206"
FT   CDS_pept        complement(569050..570786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0206"
FT                   /product="uptake [ni/fe] hydrogenase, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82825"
FT                   /db_xref="GOA:B0TDW2"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR018194"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDW2"
FT                   /protein_id="ABZ82825.1"
FT                   /translation="MAERIVVDPITRIEGHLRVEAKVEGGKIIDAASSGTMIRGIEIIA
FT                   RDRDPRDVWALVQRICGVCTTTHALTSIRAVEEALQIRVPKNAELIRKIMLAVIHIHDH
FT                   VVHFYHLHAPDWVDVPKALQADPRRTAELAQSISRWPKSTAGYFRDVQDKLKAFVANGQ
FT                   LGIFANAYWGHPAYKLPPEANLMAVAHYLEALDWQKEIVKIHTVFGGKNPHPNYLVGGM
FT                   ASAINIDGDNAINIERFNLVGKLIDEALEFVLEVYLPDLLAIAAFYKDTAAYGGGLGNY
FT                   LCFGDFSTAPNNDPSGFLLPRGAILNKNLSEVLDVDPRDPQQILEYTDHSWYEKAPKGL
FT                   HPWEGETNLKYTGPKAPYETLDETGAFDKPYSWIKSPRWKGHAMEVGPLARMLVGYAKK
FT                   DAPSHALIKDEIDKALQGLGVGVEALFSTLGRTAARGIESKLCALWLKQFFNELIANVK
FT                   GGDRKTFNQEKWEPSTWPKESKGVGLTEAPRGALGHWVRIKDGKVTNYQCVVPSTWNAS
FT                   PKDLKGQHGAYEASLLGVPMAKADQPVELLRTIHSFDPCLACAAHIIDTESQQTTKVEI
FT                   LR"
FT   gene            complement(570794..571981)
FT                   /locus_tag="HM1_0205"
FT   CDS_pept        complement(570794..571981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0205"
FT                   /product="uptake [ni/fe] hydrogenase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82824"
FT                   /db_xref="GOA:B0TDW1"
FT                   /db_xref="InterPro:IPR001821"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR027394"
FT                   /db_xref="InterPro:IPR037024"
FT                   /db_xref="InterPro:IPR037148"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDW1"
FT                   /protein_id="ABZ82824.1"
FT                   /translation="MDKAKRGTLFTVLSEKTEYWRWRLMASQDSFYQYLRNRGVSRRDF
FT                   IKFCTVMAASLGLEPGAAGAIAEALETKRRMPVIWRNFQECTCCTESFIRTQHPKASDI
FT                   IMTMISLDYHETLMVAAGHQAEEAVAKAIEDNRGNYILAVEGAIPVKDGGIYCCIAGRT
FT                   AVDMLKEEAKHAKAIIAWGSCAVNGCVQAANPNPTGAVPVQDIIKDKPIINVPGCPAIA
FT                   EVMAGVITHVLTFERLPELDSQGRPKAFYGHRIHDKCNRRAYFDAGMFVENFDDQGAKE
FT                   GWCLYKLGCKGPNTYNSCSNLEWNGGLSYPIKSGHPCIGCSEFGFWDNTGGTSMYAHLS
FT                   EVPGLKIGVNVDAFGAAAVGAAIAGAAVHAGLSAVTKKQMDRQENEKNCKNKVEG"
FT   gene            complement(572205..573077)
FT                   /gene="thiD"
FT                   /locus_tag="HM1_0204"
FT   CDS_pept        complement(572205..573077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiD"
FT                   /locus_tag="HM1_0204"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82823"
FT                   /db_xref="GOA:B0TDW0"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDW0"
FT                   /protein_id="ABZ82823.1"
FT                   /translation="MKLPKVVTIAGSDPSGGAGIQADLKVLAQFGVYGGAAVTALTRQT
FT                   SAGVLGLFPLPAAWVLEQISDVLWDLRPPVVKTGMLQQPAVISGLGRLWGAYLQEYRDT
FT                   AAQVLPPASSTTPAPTLPILVVDPVLSSGAGVSLVDGGGLAAFREDLLPVTTVLTPNVP
FT                   EAEALTGMAIRDSGDMIGAAERLLQFGPQWVLLKGGHLPEWEGDRIADLLISREERRWL
FT                   WGQRVPRADLHGTGCSLASALAACLALGLPVPVAAARAVEWLRQRIGSPLFVGQGRGVV
FT                   CQKLEEKRE"
FT   gene            complement(573226..574347)
FT                   /gene="thiL"
FT                   /locus_tag="HM1_0203"
FT   CDS_pept        complement(573226..574347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiL"
FT                   /locus_tag="HM1_0203"
FT                   /product="thiamine-monophosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82822"
FT                   /db_xref="GOA:B0TDV9"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDV9"
FT                   /protein_id="ABZ82822.1"
FT                   /translation="MDVKRQAGTPLASIGEFGLIGRLARAWQGAASQGERGGLSPVIPS
FT                   QGLRLGIGDDAAVIDVPGGKPLLVTTDMLVEGVHFLWSPIRRRLLGRKALAVNISDIAA
FT                   MGGIPAWAFLSIGVPASAKVEEVEGLYAGMGEMAAQFGVELAGGDTVRSDKWVINVTLL
FT                   GLAVKAPIGRSGGRPGDLILVTGTVGDAAAGLHLLLMETKMSQAEKMDAQMREAPIGEA
FT                   DRQALLLRHLDPIPRVAEARALVDYGGVTAMMDVSDGVSSEVHHLCRNSGCGARIDLAN
FT                   LPISPAVRRLARREGREVFAWALSGGEDYELIFTAPEERVPGLIDHVRRETGTGVTVIG
FT                   RLTDGTAGVMAVYPDEMGGDAVPLAAKGYNHFR"
FT   gene            574307..574549
FT                   /locus_tag="HM1_0201"
FT   CDS_pept        574307..574549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0201"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82821"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDV8"
FT                   /protein_id="ABZ82821.1"
FT                   /translation="MDAKGVPACRLTSTFSSPASAYSRVHLPSRTASTPDRQFSCQARA
FT                   NRGRHRNSSSGLFSKENTRRAYTASRDPPLSPGNH"
FT   gene            complement(574512..575822)
FT                   /gene="thiC"
FT                   /locus_tag="HM1_0202"
FT   CDS_pept        complement(574512..575822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiC"
FT                   /locus_tag="HM1_0202"
FT                   /product="thiamine biosynthesis protein, thic"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82820"
FT                   /db_xref="GOA:B0TDV7"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDV7"
FT                   /protein_id="ABZ82820.1"
FT                   /translation="MQRGRHYGTQMERALRGEVTPEMVQVAESEGWQPEALMAEIAAGR
FT                   IVIPANNRRPRESYCGVGRGLRTKVNANIGTSKGTSGIDFEKRKLDISIECGADAVMDL
FT                   STGPDIDGVRRALIDGCPIAFGTVPIYQATVEAQEMKGAIINMTEEDILRAVQKQAEDG
FT                   VDFMTIHCGLTMEAVERLRKHPRIADIVSRGGSFLTGWMLHHQRQNPFYAQFDRILEIA
FT                   REYDITLSLGDALRPGCLADATDRGQVQELMILGELVQRCRAAGVQVIVEGPGHVPMDQ
FT                   VEMNIKLQKRLCEEAPFYVLGPLVTDVAPGYDHITSAIGGAIAAAAGADFLCYVTPAEH
FT                   LGLPDEQDVRQGVIASRIAAHAADLAKGIKGAMDWDKAMGKARKDLDWGEQRRLAMDPT
FT                   VFDKHPHTRDKTGCSMCGPYCAMRIVSDYLGRAVGPC"
FT   gene            complement(576010..576189)
FT                   /locus_tag="HM1_0200"
FT   CDS_pept        complement(576010..576189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0200"
FT                   /product="fad linked oxidase, c-terminal:fad linked
FT                   oxidase, n-terminal, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82819"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDV6"
FT                   /protein_id="ABZ82819.1"
FT                   /translation="MIVTYHAPADDELRAMEQFKAICECCINFGGSDWMEKGISLFLSN
FT                   RSNSRQSQLHKVYR"
FT   gene            576365..577480
FT                   /locus_tag="HM1_0199"
FT   CDS_pept        576365..577480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0199"
FT                   /product="metal dependent phosphohydrolase domain protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82818"
FT                   /db_xref="GOA:B0TDV5"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDV5"
FT                   /protein_id="ABZ82818.1"
FT                   /translation="MRKVSIDFVEPGMILARSIYSADGRTLLGAGITLSMPFIRRLKEL
FT                   GVPAVLIKDQVIGELTVPDVLSEQVRLAAVQTIRRSFARVQLHPDGGLEPVAVKRATSA
FT                   IIDEVLRNRHVMYHVADIRTFDDYTFGHSVNVCLLSVLTGIAMGYNELELYDLACGAIL
FT                   HDIGKMLVPHEVLNKPGRLTPEEFAEIRRHCEYGFEIIRHQSEFSLAAAHVALQHQERF
FT                   DGSGYPRQLKGEEIHEYARIVAIADMYDALVADRVYRKGYLPYQAHEIILAASCRELDP
FT                   RISQIFLQNIAIYPIGSTVQLNTGDIGVVVDVNKAFQSRPVVRLLYDADGTPLKRPYEL
FT                   DLTRHLTVFVDKVLFEEHIRALTASEHRKAT"
FT   gene            complement(577854..579146)
FT                   /gene="hcp"
FT                   /locus_tag="HM1_0198"
FT   CDS_pept        complement(577854..579146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hcp"
FT                   /locus_tag="HM1_0198"
FT                   /product="hydroxylamine reductase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82817"
FT                   /db_xref="GOA:B0TDV4"
FT                   /db_xref="InterPro:IPR004137"
FT                   /db_xref="InterPro:IPR010048"
FT                   /db_xref="InterPro:IPR011254"
FT                   /db_xref="InterPro:IPR016099"
FT                   /db_xref="InterPro:IPR016100"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDV4"
FT                   /protein_id="ABZ82817.1"
FT                   /translation="MFCYQCAQTVKGGCTKIGVCGKNEDIASLQDTILFGLKGVAAYAT
FT                   HARELGYSDPEVDAITQEALYSTLTNSNFNLGEHVAMALKVGTATVKVMDLLDRAHTDK
FT                   FGIPVPVTVSSDKVEGKCILVTGHNLHALLELLKQTEGKGINVYTHSEMLPAHGYPELK
FT                   KYPHLKGNVGKAWHDQRKLFASFPGAILGTTNCVMPIRGSYSDRMWTYGCAGLEGVPKI
FT                   VNDDFSALIEKALSLPEANWASDKTMTTGYHHVNVLALAPQIIEAVKSGRIRRFFVIAG
FT                   CDAPIKEQEYYRELALALPKDCVIITTSCGKFRFNDIDFGDIDGIPRYIDLGQCNNSGS
FT                   AVKIALALADAFGCGVNDLPLSIVLSWFEQKACAILLGLFSLGVKNIFLGGRAPEFLTA
FT                   NVVDVLVQNFGLNLIDNVEADLKKMLGESPR"
FT   gene            579428..580921
FT                   /gene="fadD"
FT                   /locus_tag="HM1_0197"
FT   CDS_pept        579428..580921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadD"
FT                   /locus_tag="HM1_0197"
FT                   /product="long-chain-fatty-acid-coa ligase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82816"
FT                   /db_xref="GOA:B0TDV3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDV3"
FT                   /protein_id="ABZ82816.1"
FT                   /translation="MKERDLPVLVHELIRQGTPEKTALIEKHSRYSYAALQETVDRYRR
FT                   CLYARGVRPGERVGLFCRNSADFIFAYMAIASLGAVVIPLNIMFRPREIGYILSDAGSR
FT                   HVVTDRLLELASAELNDSDLPAQHLLSELRETAPAYSHHPAPDVPITPEDPCVILYTSG
FT                   TTGRPKGAVLSHRNLISNARSYTETIGAAEADNYLCVLPLFHSFAWTCCVTTALLNGAT
FT                   ITIMEAFQPKEALAMIQTHGVNVVTGVPAMYGIYTSVARPEDLAGVRLFVSGGASLPVE
FT                   TLNSFKEKTGQPIVEGYGLSEASPVVTFNPIGRTKPGSIGLQIPAVSVKIVDAEGRELP
FT                   PGEVGELICQGPNVMSGYLGLPQETAAAIRDGWLHTGDLAYKDDEGYLFIVDRKKDLII
FT                   VGGLNVYPREVEEVLYSHPSVKEAAVIGTPDKTRGEAVRAFVVVREGMALNRKELMAYL
FT                   RTNLATYKLPREIVELEALPRNATGKVLKKELRTYQPLQ"
FT   gene            complement(580989..584762)
FT                   /locus_tag="HM1_0196"
FT   CDS_pept        complement(580989..584762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0196"
FT                   /product="sensory transduction histidine kinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82815"
FT                   /db_xref="GOA:B0TDV2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDV2"
FT                   /protein_id="ABZ82815.1"
FT                   /translation="MEERNRDNEQALWVLAIGASAGGLRAIQEVLNRLSPDKNLAVFVV
FT                   QHLSPRYPSHLTAILKRTSLMDVKEAVQDEVICGGTIYVATPNHHLVLHGNRIHLDAES
FT                   EKVKFARPSIDVLFESAAEAFGSRVIGVVLSGTGSDGSNGIISIKEHGGFTIAQDSSNS
FT                   HYNAMPQNAINTGAIDFVLPLNEIPKIVSQILKEPDTVRRELTLDEHMEIADMLRRRLN
FT                   IDVINYRRSTFKRRVRKRMSQLHYASVQEYIEHLKQYPEELDELHDDLLINVTQFLRDE
FT                   AAYESLRLNCLEPLIARAKDGDTLRVWSVGCSTGEEPYSVAFMIADMLEASQKKLELKI
FT                   YATDLDEAAILEARRGLYNESKVRSLPEAYREKYMIACGDFYKVKKHIRSCVIFGVQDI
FT                   VHSAPIAKVDLLICRNLLIYFDKELQKKVLTMFHYALNPGGFLFLGKSETTSVVPELFD
FT                   FVDRRWKIYRARPVPTRRVPYLRPRNSWIHLSESDNRLNRRFVADSVLENLAAPVIVLN
FT                   EQMKIVLINRRADELLTNDIAEADKAELEREPLLFRLLGGTMQAEMQECFQSGLVPPSR
FT                   DISATWREMPRHYVLSFFLDADEDRKPVLILTFTPVIRRTAGPVLLTEREIDSMEKELS
FT                   DALSLAEELQSTNEELETTNEELQAANEELETTNEELESANEELETTNEELEAANEELE
FT                   TINEELEVRTLELLAVSALKNSVLTSINVAVIAIDLEGRVLEWNPAATKLFDIPSYKAV
FT                   NNNLFGLQVPPFFEELKPHLTRLIEGENETVSRTVIPWRNKSFNVDYVPLYNEEQQIVG
FT                   LLIVAYDITEQHELQRQLQAALEKEHNLAEELAMAKADAERANHMKTRFIAELSHDLRG
FT                   SLNVILGVTQLGVETTSQPAQEGKGRQEGKGLSEGEALPEREAFREEIATYFDMIRKAA
FT                   ENLNNLLTQVLELSSIELGKKAVENKVFSIPQLADQVSAVIAYKARRARVDYNVDNRVP
FT                   PRLLVESDFSKLCQILLNLLDNAVKYSQAGGEVTFRISRDGDRLQLIIADRGIGMSPET
FT                   VAHIFDPFYRAKGVSKITGSGLGMAITQQLVQTLKGEIHVESREGVGTTVTVAMPVRYL
FT                   EMPAEADARGPIDMERLKASMTGRRVLIVDEDATSLLLLSRVITVLGGQPAVARGTEEA
FT                   IAASTVQPPDLILTEAELPDGYAADMISAITKLMGASPPVVLVTSDIFQVNQTGHWRAY
FT                   ADELTAKPVALNELYACLWRVLERSGSENRMA"
FT   gene            complement(584826..584984)
FT                   /locus_tag="HM1_0195"
FT   CDS_pept        complement(584826..584984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82814"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDV1"
FT                   /protein_id="ABZ82814.1"
FT                   /translation="MESATLSPKGEAFFFETAGNFAREKNRIIRAIEIAITIYRAGRKK
FT                   VASSPLA"
FT   gene            complement(585058..586098)
FT                   /locus_tag="HM1_0194"
FT   CDS_pept        complement(585058..586098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0194"
FT                   /product="metal-dependent phosphohydrolase, hd subdomain,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82813"
FT                   /db_xref="GOA:B0TDV0"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDV0"
FT                   /protein_id="ABZ82813.1"
FT                   /translation="MMRISVSLVEPGNVLAKPVYDGRGNVLLARGVELTGGYIRRLKDL
FT                   NIQSVFIESPFDDLINYETALSDPVFTEVMKNTRHLVKLLASPRANMDLSSAQKSVEML
FT                   VDELIRNRGVLLDVSALHDYDEYTFTHCVSVCVISIIIGMSVGLSRNELALLGMGALLH
FT                   DIGKTRIPVEILNKPGKLTAEEYAIMKEHTRFGYDLLRKSTTLLAAHVAFQHQEKFDGT
FT                   GYPRGVKGADIHLFGRISAVADVYDALTSRRPYRQPMPGNKAYEYIWSQSGTHFDPAMV
FT                   RHFCGTVAIYPNGSLVELCDGKKGLVVKQNAGWPLRPVICLLEDNRVSKIIDLMDEAQS
FT                   GLVIVA"
FT   gene            complement(586262..587413)
FT                   /gene="garK"
FT                   /locus_tag="HM1_0193"
FT   CDS_pept        complement(586262..587413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="garK"
FT                   /locus_tag="HM1_0193"
FT                   /product="glycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82812"
FT                   /db_xref="GOA:B0TDU9"
FT                   /db_xref="InterPro:IPR004381"
FT                   /db_xref="InterPro:IPR018193"
FT                   /db_xref="InterPro:IPR018197"
FT                   /db_xref="InterPro:IPR036129"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDU9"
FT                   /protein_id="ABZ82812.1"
FT                   /translation="MRIVVAPDSYKESLSALEVAEIIDRAARAVWPSAVVDLVPLADGG
FT                   EGFVEAMVKGAGGRIVEREVTGPLGEPVSAHYGILKDGKSAVIEMAAASGLHLVPRDKR
FT                   DPRNTTTFGTGELIAAAIDAGCHTVYIGIGGSATNDGGAGMAEALGVRLLDAEGKGIPR
FT                   GGAGLARLQRIDMTGLHPAIASGEVTVVAACDVTNPLCGPTGASAVFGPQKGATPEMVE
FT                   LLDANLRLLATVVERDLGRQTAEKPGAGAAGGLGAGLMAFLDARLERGFSLVSEITGLE
FT                   AKVAAADLVVTGEGKTDRQTAYGKVPYGVAKIAEEHGKPVIVISGGIDDHGELESAFSV
FT                   LVSCTRLPVDVTTAMARAESFLSAAAKAAFRLVALGAGLNKTC"
FT   gene            complement(587535..587696)
FT                   /locus_tag="HM1_0192"
FT   CDS_pept        complement(587535..587696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0192"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82811"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDU8"
FT                   /protein_id="ABZ82811.1"
FT                   /translation="MDGIRVVPVFSPQYFPQKERGRAKEVLPTTKGKPKGFSQLLMEAI
FT                   RKEQRKAR"
FT   gene            587660..587785
FT                   /locus_tag="HM1_0190"
FT   CDS_pept        587660..587785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82810"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDU7"
FT                   /protein_id="ABZ82810.1"
FT                   /translation="MERKRGRRGCHPWPSLPSGTPTQVPHRYYRLPLEPGLAVHT"
FT   gene            complement(587776..587910)
FT                   /locus_tag="HM1_0191"
FT   CDS_pept        complement(587776..587910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0191"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82809"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDU6"
FT                   /protein_id="ABZ82809.1"
FT                   /translation="MSIKSQEQMIGNGMQRLYGGRKKSAGDAGAAKEKKRENNDKFYV"
FT   gene            587930..588751
FT                   /locus_tag="HM1_0189"
FT   CDS_pept        587930..588751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0189"
FT                   /product="amino acid abc transporter, amino acid-binding
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82808"
FT                   /db_xref="GOA:B0TDU5"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDU5"
FT                   /protein_id="ABZ82808.1"
FT                   /translation="MSKANAKGRTYQMNKWMRIGCTAALAAGLLVSLAGCGGNAPATTA
FT                   TAKKKIVVGTEATYRPFEWKDEQGEIIGFDVDLAREIGKEIGVEVEIKNTPFDNLIAEL
FT                   QNQSIDMIASAMTITEKRKESIGFSKPYYDSVQAIIVKEGSPIKTLADLKDKNVGVQNG
FT                   TTGMGVAEKLLGERSTRIKRFETLPDALNTLRIDGLDAVIADKPVAQNYLVNNPDAKLL
FT                   ILEDTSLEKEQFGFAVRKGDRELQQQINDALDKLEKNGKIKELSLKYFGAK"
FT   gene            588917..589036
FT                   /locus_tag="HM1_0188"
FT   CDS_pept        588917..589036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0188"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82807"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDU4"
FT                   /protein_id="ABZ82807.1"
FT                   /translation="MFHRLGRKYRPYLLVELNECRGVDVNPFCSLQFIFYKEH"
FT   gene            589116..589781
FT                   /locus_tag="HM1_0187"
FT   CDS_pept        589116..589781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0187"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82806"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDU3"
FT                   /protein_id="ABZ82806.1"
FT                   /translation="MRQFNEFSPHDKALLQLDADYQRYRQSVEFAFQLAQDLVNRALEP
FT                   VMNELTALRQALEELKATVKEESERQASAASATPEAATEAVETISGLVGETPRRGRRRR
FT                   AAGPVAVKPPRIRWGNSEDEIKATIFEQLRLLEERGKEITVTNIKEEVPSMMRFLYGKD
FT                   AMFQGISALFEEYQRRKSASELPVQTAAEADDATVPEGGVMDELVEAEDLAVEQGAAE"
FT   gene            complement(590403..591335)
FT                   /gene="cas1"
FT                   /locus_tag="HM1_0186"
FT   CDS_pept        complement(590403..591335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cas1"
FT                   /locus_tag="HM1_0186"
FT                   /product="crispr-associated protein cas1"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82805"
FT                   /db_xref="GOA:B0TDU2"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="InterPro:IPR019851"
FT                   /db_xref="InterPro:IPR033641"
FT                   /db_xref="InterPro:IPR042206"
FT                   /db_xref="InterPro:IPR042211"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDU2"
FT                   /protein_id="ABZ82805.1"
FT                   /translation="MRDLHELPRLTDSISYLYVEHAVVEQEAKAIALWREDGKVQVPCA
FT                   SLSVLMLGPGTKVSHAAMRTLADCGCSVLWVGEGGLRVYGQGMGETRSSSNLLRQVSLW
FT                   SNPDTRMAVVRRMYELRFREPVSPEMTLRQIRGMEGGRVRQIYARLAKEHGVVWTGRNY
FT                   DRGNWNSADPVNRALSAANACLYGVCHAAIVSMGYSPAVGFIHTGKQLSFVYDVADIYK
FT                   TDTTIPVAFTVAGKNDVANIEREVRLACRQQFHDKRLLERVAKDLSMLFSGINLPEVIE
FT                   GYDGSDDKPGGIWDDQDGIVSGGKNYSDE"
FT   gene            complement(592011..592703)
FT                   /gene="cas5"
FT                   /locus_tag="HM1_0185"
FT   CDS_pept        complement(592011..592703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cas5"
FT                   /locus_tag="HM1_0185"
FT                   /product="crispr-associated protein cas5"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82804"
FT                   /db_xref="GOA:B0TDU1"
FT                   /db_xref="InterPro:IPR010147"
FT                   /db_xref="InterPro:IPR013422"
FT                   /db_xref="InterPro:IPR021124"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDU1"
FT                   /protein_id="ABZ82804.1"
FT                   /translation="MGIPILALRLEGPLQSWGSRSRWDYRDSALEPTKSGIIGLLGCAL
FT                   GWSRNDKRLESLDAALRLTVRIDKPGTPLIDFHTVQGYLLMAEGKQKKSGNDMYTVVSR
FT                   RVYLQEASFLALLTGEQGALHQCKKALNDPVWPVFLGRKSCPPARPLFDSFYEGDFRDV
FT                   LEAMRSIPWSSAPAAGPIRLRYVMEDEGGREWRQDVLRINGARMYGRRRVSVGWVDLDR
FT                   RRDPDVSK"
FT   gene            complement(592706..593863)
FT                   /locus_tag="HM1_0184"
FT   CDS_pept        complement(592706..593863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0184"
FT                   /product="crispr-associated protein, ct1973 family,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82803"
FT                   /db_xref="InterPro:IPR010148"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDU0"
FT                   /protein_id="ABZ82803.1"
FT                   /translation="MVEIHVLQNHAPANLNRDESGSPKDCMFGGVRRGRISSQCQKRTI
FT                   RCSPLFQDSIGESRLGMRTRKLPFLVKEELMRLGLSEELAKIGARKASGLGNKDGKERD
FT                   DEITAQAIFLTQEDVSVIARCLFRHLKDKTVKQAKAIKAQELQKDPELVGWRPVTVDVA
FT                   LFGRMTTSTAFNDVEASVQVGHAISTHRVDSEFDYFTAVDDLMGDGDSGADMIGDTEFN
FT                   SCCYYKYFNVDMDELKRNLAGPDRLKKLTAEERQDLARDAAHIVKAFIESLVFCSPDGK
FT                   QNSFAARQLPSAVLVEVKKRKIPVSYANAFVKPVTARGEMDLVQASVNAFLDHVKETEK
FT                   CFGLTPNRRWLLLMGCESPKMTTDQVSTFPALVEELTAALQQGEE"
FT   gene            complement(593866..594429)
FT                   /locus_tag="HM1_0183"
FT   CDS_pept        complement(593866..594429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0183"
FT                   /product="crispr-associated protein, ct1973 family,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82802"
FT                   /db_xref="InterPro:IPR013382"
FT                   /db_xref="InterPro:IPR038287"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDT9"
FT                   /protein_id="ABZ82802.1"
FT                   /translation="MNDANRGDAIRNKAEDFIQRVKSLTPGERALLKRNAGCRLSESRG
FT                   ALPLFYRLCPRSIPEWEEDIWFLIACLCCLDRSEKEAEERSFARSLLDFLGKDGFEADG
FT                   ANGWQRKVTKLLDASQEELFYRLPQVVKRLVDNRVPIDWAGLLTDLRIWHWKSRIVQKR
FT                   WAREFFGSKSNGTGEEQENDGGDN"
FT   gene            complement(594439..596010)
FT                   /locus_tag="HM1_0182"
FT   CDS_pept        complement(594439..596010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0182"
FT                   /product="crispr-associated protein, ct1972 family,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82801"
FT                   /db_xref="InterPro:IPR013381"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDT8"
FT                   /protein_id="ABZ82801.1"
FT                   /translation="MQPAFDLLTEPWVTVRDVKGRICVVHLRDVLAKAHEWSEVIDESP
FT                   LIQFGLYRFLQALIIDIFPLKGQRGRLELMEEGQFDETKLNAYWEKYGVYFDLFDAERP
FT                   FLQVPPREQEKVKRKSVAELFHQLPTGTNVIHFHHRLQDEYVLAPDVCARIMTTLSPFT
FT                   TAGGQGLSPSINGNPPYYVWRKGDNLFETLLLNYWITDQDRGIPAWRDRRPSRGETRSE
FT                   ARLLEGLTWQPRRVTLIPEMGPFQCTYSGRSCQWGVRQMVFEAGFQARVDTWRDPNVAV
FT                   VNTDKGRSFVRPRWGRQTWRDVGPLALIDGAGKGVQEKNSYERAPILNQASIYLECEQQ
FT                   TTTIEVYGLQTDGNMKYLDWRYEELQLPAGLEQVPNGEEFALQAMNNAEKAAWALRKAV
FT                   NMCVQIKQKKGKKEQKIWPGEWGQRVEDAYWLSLEAPYLAFLSVLAGTAKEEDPDKHLE
FT                   TLMEAWTKEIRNKASDYFTEATKENVSDAEAMRRQIQAEQYLRRSLRFIGVKSPSKDED
FT                   AAKKGR"
FT   gene            complement(595994..598258)
FT                   /gene="cas3"
FT                   /locus_tag="HM1_0181"
FT   CDS_pept        complement(595994..598258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cas3"
FT                   /locus_tag="HM1_0181"
FT                   /product="crispr-associated helicase cas3"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82800"
FT                   /db_xref="GOA:B0TDT7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006474"
FT                   /db_xref="InterPro:IPR006483"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035011"
FT                   /db_xref="InterPro:IPR038257"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDT7"
FT                   /protein_id="ABZ82800.1"
FT                   /translation="MGLALQGHHGSFVVPCKRVDDGSASINELWKQLRLQVVEELLRFF
FT                   QMDIWKQQDFPDHSTFGMLLSGITVLADWIASSEAFFGGDIPDWHQAKQKNFEVLALQF
FT                   LDQVGLSGKKPINAEMTEEDSFLRFWRHLHLPSLRPLQALCEQIARSEKTGGLAIIEAP
FT                   MGEGKSEAGIYLLNCWVAGSGGDGMYVALPTAATANQMYSRVQELLSNQGTEKGLRLVH
FT                   GMAWLLDLQKQYWEEDEREDWFRPKKRALLAPYGVGTVDQAMLAAMRVKFGCLRLLGLA
FT                   GKGLLIDEVHAYDTYMNTIIDQLLAWCGHLSIPVVLLSATLPVKRRKQLLEAYGGDVIE
FT                   GAVNQQYPLVTVAVDAKTCEFPVLPSRPNQEYNLRMLPGALENAEAIVNAVLDWADAHD
FT                   SGCAGVVVNTVYMAQQVFRKLKKLHRKGRLPSDVELLLYHARFTAGRRKAIEDKVLRWL
FT                   DKGSLQDPARRPKRAVLVATQVVEQSLDIDFDVLFTELAPIDLLLQRIGRLWRHERPRR
FT                   LNHAESKANVSIFAPEIAERFYWGKTGAVYEPLVLLKTLAVLQKRNQFQLPQDFRPLIE
FT                   SVYDDEIANVPDEWLYSLASVREEYRKNQVEQQQRARESLYPKPLKSELAVTPIFAVNE
FT                   EVSEGEVSSHLHAVTRIGSETRSVLAVPKDEWERVGQGLVSHEQLHHWMKYHVSLPEKW
FT                   LSGCELPALKPYRQWSVMPMHPGSPSFWEGTSKGGNVIRIEYDDELGFRLGKEEPNATS
FT                   L"
FT   gene            598355..598546
FT                   /locus_tag="HM1_0180"
FT   CDS_pept        598355..598546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82799"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDT6"
FT                   /protein_id="ABZ82799.1"
FT                   /translation="MWEKLSFNPILDNGQPYAFYLKLRMTLSNIMHSSEKSSANNRFFF
FT                   RPTGSTLQFVDQTGKWAT"
FT   gene            598684..600306
FT                   /locus_tag="HM1_0179"
FT   CDS_pept        598684..600306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0179"
FT                   /product="transposase, is4 family"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82798"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B0TAA0"
FT                   /protein_id="ABZ82798.1"
FT                   /translation="MFRFDVDPQVSFYDFAALWDQLVPADSVFRLFRELAPLLIQPEDF
FT                   TGLYCLDNGRPSHAARQMTMACMLQEMLGETDRGMEAQTRVNIEVKFALGMALDEPGID
FT                   HANFGVHRQRLIQKELDKVYLDRFIRLMYYLGVLTGKEPWITDTTHVIAPISAPTTIEL
FT                   IRQAMRLLVRLLAKQYSVPWHAIPHAPRAVRYLETVTEVKEHNLDDKAKMERLVEVVSE
FT                   ADELLAYVESSEASWKKKPDVIHYALLLCRILRERIIRKDDGTLEIAPGGSVKDMIVSA
FT                   VDSEARFGCKGKTKWRGYKMAIVEVGNSGFIAAAEAMKANDYDGSSLVPLADQLPTDCV
FT                   ENPTIIGDTHYGAGDDRVTLKEKGIDVVAPLSPKTKCDILAGEGFQVSEDQTQLICPRG
FT                   KVITTYSEVADGKNFVLRAKDHDCKHCPRYTTCFKEKKHRRTIFIHNAYGVMLEAAKHS
FT                   QTKIYKEQMRLRSRIEAKQNELVNRYGLRRVRRIGKRNLAYAARLSALAANFQKLNRLR
FT                   NDKNATMVLEVSALRGVAFKKAA"
FT   gene            complement(600853..602214)
FT                   /locus_tag="HM1_0178"
FT   CDS_pept        complement(600853..602214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0178"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82797"
FT                   /db_xref="GOA:B0TA98"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:B0TA98"
FT                   /protein_id="ABZ82797.1"
FT                   /translation="MQSVAQPLEEVQKIFCRTPGGKKAGRLIQHFTQYASKVYGFSQMV
FT                   RQAKDGRKQPRIKAPAIFTVAFFGAFFCMESMEQMDRWQKTGVFRQLVPKNIRLPSHDT
FT                   VRQALMKWDLKEQRKQHNCVIQRYKEQRGPQKESINGWRVTAIDGVELFHTKAYRCPEC
FT                   LTREHRDKTTDYYHAVVVAQQVGGNANLIYDWEMRKPQDGVDKDEGETTVAQRLIRRMA
FT                   ETYGKITDVYTLDALFAKAPVIHAALDAGAHVVVRMKEERRRIMKEANACFANRLPDST
FT                   WEERDGKGNTVYVQAWDEEGLAQWPQVRVPMRIVKIIRHTNKTVIEANKEVFVTDVVER
FT                   WIATTCSSEKADTQTIAQIAAARWDIENIGFRNLKTFNALDHCFVHDSVAIKAMIGFQV
FT                   LAFNLKRLFFFHHLPASRHRDVPLRYLIDEMREATRWVSLHLYRWVWEWGLSTA"
FT   gene            complement(603809..605350)
FT                   /gene="spoVR"
FT                   /locus_tag="HM1_0177"
FT   CDS_pept        complement(603809..605350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVR"
FT                   /locus_tag="HM1_0177"
FT                   /product="stage v sporulation protein r"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82796"
FT                   /db_xref="InterPro:IPR007390"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDT3"
FT                   /protein_id="ABZ82796.1"
FT                   /translation="MDRLSRSIPRLIEIAKNFGLDFYDMRFEVVPADVLYTFGAYGMPT
FT                   RFSHWSFGKSFHRLKMSYDYNLSRIYELVINASPCYAFLLEGNTPIQNELVAAHVLAHC
FT                   DFFKNNAAFRGTSRHMVESMASSAERIREYEIRYGREKVEAFLDAAMAIQEHIDPHVHT
FT                   IKEAMPKEPKVQPDSPFEDLFALDNLLDGGGGVASGSGSGSGRASGSSGSGSGSGFGGS
FT                   GGSGGMGANSGGSGNSSGRTVSSSKGATAQTAGAKKPADNGRTIGEERKIPERPEKDLL
FT                   LFIMEHGRFLDDWQRDILTILREEMLYFWPQMRTKIMNEGWASYWHLRIMREMEMEEED
FT                   AWEFAKMHAQVIQPSRSAINPYHLGLKIFEDIEKRYGRDRIFEVREVDTDQSFIRNYLT
FT                   KELVDSADLYLYKKVGNQWQIIEKNWEVIRNELVNRMTNGGLPMLFVEDGDYNRAGELL
FT                   IRHAYEGVELDIPYLEKTLPYLFTLWGRTVYLETVVDGKRIQFSYSGEKVQRKYL"
FT   gene            complement(605407..605544)
FT                   /locus_tag="HM1_0176"
FT   CDS_pept        complement(605407..605544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0176"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82795"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDT2"
FT                   /protein_id="ABZ82795.1"
FT                   /translation="MGIARNGFDALTIARTFRPDVTLSDTGLWRFVFLPEKKASPPHRL
FT                   "
FT   gene            complement(605846..606634)
FT                   /locus_tag="HM1_0175"
FT   CDS_pept        complement(605846..606634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0175"
FT                   /product="conserved hypothetical protein"
FT                   /note="Member of COG0489, ATPases involved in chromosome
FT                   partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82794"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDT1"
FT                   /protein_id="ABZ82794.1"
FT                   /translation="MTCEVIIAVMSGKGGTGKSTVTAFLAAGLAKAGLAVAVVDGDVAG
FT                   SAIPTLFGLKAPLRRQGDRRMPAVTRRGIAVWSAGLLPDEGQSLLADSGARRRDTLGEW
FT                   IGSAAQGEWDVVLIDMPSGLGEVHAAVVDAFAGLSIQSDGEPDGAGPRKPVTGALLVTS
FT                   LRELDRRVVRRTAAWLKEKGVPIVGVVENGGEIECPHCENLLPLSDGDEAWAEEGGVIA
FT                   CFPWSAKLIEFARKGRLEEYDHPLVFQMALNIWESSHKEG"
FT   gene            complement(606798..607460)
FT                   /locus_tag="HM1_0174"
FT   CDS_pept        complement(606798..607460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0174"
FT                   /product="glutamine abc transporter, glutamine-binding
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82793"
FT                   /db_xref="GOA:B0TDT0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDT0"
FT                   /protein_id="ABZ82793.1"
FT                   /translation="MDWSKWTVLFEPKNVKFLMTGLQWTIELALISIALSFFFGIVICA
FT                   LRISRYPFLRYPAFLYVESLRNLPLILLIFFTYFALPKIGLGLPKFWAAVVAFTIFTSA
FT                   LVAEIIRGGIQSVPKGQWEAARAQGFTYLETMVYIILPQALRKMIPPLISQFITLTKDT
FT                   SYASIIGLTELTEHGKLIFIEHNNPVQVFFFVACIYFVVNFTLSRLGMYMEKRMAIG"
FT   gene            complement(607476..608129)
FT                   /locus_tag="HM1_0173"
FT   CDS_pept        complement(607476..608129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0173"
FT                   /product="glutamine abc transporter, glutamine-binding
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82792"
FT                   /db_xref="GOA:B0TDS9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDS9"
FT                   /protein_id="ABZ82792.1"
FT                   /translation="MEQWNDLLAYGPQFFSGLKVTIEVTLYSLLLSMVIGVAIAILRVS
FT                   GFKVLNAFGVAYVEFFQNTPLLIQVFFIYFGTPAMGIKLSGFACGTIGLAMYTGAYIGE
FT                   VFRAGIQAVPKGQMEAARSSGMNYLQAMGYVVLPQAVKIILPPLTNQVVNMVKNSAILS
FT                   TIVVADLMYETYRIASETFIIFEVFIFAALLYLVITVPLSTVANLLEQRLRRSS"
FT   gene            complement(608223..609650)
FT                   /locus_tag="HM1_0172"
FT   CDS_pept        complement(608223..609650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0172"
FT                   /product="reverse transcriptase (RNA-dependent DNA
FT                   polymerase)"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82791"
FT                   /db_xref="GOA:B0TA92"
FT                   /db_xref="InterPro:IPR000123"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:B0TA92"
FT                   /protein_id="ABZ82791.1"
FT                   /translation="MMEGEATMRSRDAQRQPNIPKGNCQREEAVNPQGTGGVPSALPAQ
FT                   EAKQPREETYDLMEKVVERGNMTEAYKRVMANKGAAGIDGMGLESLRPYLKEEWSRIKQ
FT                   ELLEGTYRPQPVRRVEIPKPQGGTRKLGIPTVVDRLIQQALNQILMPIFDPDFSTNSYG
FT                   FRPGKSAHQAVKKAKEYIADGYRWVVDMDLAQFFDRVNHDILMARVARKVKDKRILKLI
FT                   REYLKAGVMLNGIRVKSEEGTPQGGPLSPLLANIILDDLDKALESRGHRFCRYADDCNV
FT                   YVRSRRAGQRVMEGMAKFLEGRLKLQVNWEKSAVDRPWNRKFLGFSFTWHKAAKIRLAP
FT                   QTVKRVKEKIRQFTGRNRSIAMEDRLVTLNQYLKGWMGYFRLIDTPSVLKELDEWLRRR
FT                   LRMCLLKQWKRPKTRRRNLVALGIPEEWACNISGSRKGYWRLSLTPQMNKALGLAYWRE
FT                   QGLVSLVETYQSHRQPA"
FT   gene            609751..609972
FT                   /locus_tag="HM1_0171"
FT   CDS_pept        609751..609972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0171"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82790"
FT                   /db_xref="UniProtKB/TrEMBL:B0TA91"
FT                   /protein_id="ABZ82790.1"
FT                   /translation="MVPRQASPGKNVAFPSIYPPHLLSAAFGDKDFALFGKLIQLPLAS
FT                   PGVRGPRAGGLPLASFRFRLAADTLALS"
FT   gene            complement(610084..610932)
FT                   /locus_tag="HM1_0170"
FT   CDS_pept        complement(610084..610932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0170"
FT                   /product="glutamine abc transporter, glutamine-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82789"
FT                   /db_xref="GOA:B0TDS6"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDS6"
FT                   /protein_id="ABZ82789.1"
FT                   /translation="MFKKWTKGIALCCTAALLGTLAVGCGGSAPTGGEKKAAENQTQTS
FT                   GDYIQTIKNRGYLIAGVKNDVPLFGQLKSGADKPEGFEVDIMKELAKKLFGDESKVKLE
FT                   KVESQTRIPMLQNGQIDIVAGTTTITEERKKQIDFSDVYFKAGQSLLVKKGSPIKSVTD
FT                   LKGKTVSTVRGSTSAKNIREKAPDAKVDEYATYTEAFQALKLGRSDAMTTDNSILMGFA
FT                   NEDPNFELVGGLFTEEPYGFGFQKGHPEWVNYVNDFLKELKANGKYDELYKKWFKEDPP
FT                   K"
FT   gene            complement(611044..611760)
FT                   /gene="glnQ"
FT                   /locus_tag="HM1_0169"
FT   CDS_pept        complement(611044..611760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnQ"
FT                   /locus_tag="HM1_0169"
FT                   /product="glutamine abc transporter, ATP-binding protein
FT                   glnq"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82788"
FT                   /db_xref="GOA:B0TDS5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDS5"
FT                   /protein_id="ABZ82788.1"
FT                   /translation="MNKWFGKLHVLRDIDLHIREGEVVVVIGPSGSGKSTLLRCINKLE
FT                   TVTEGRLTVDGFRIDDPKTNINLLRQEIGMVFQHFNLYPHKTVLENITLAPIKVRKVAK
FT                   EEAEKTAMFYLNKVGIPEKAQAYPSQLSGGQQQRVAIARGLAMKPKIMLFDEPTSALDP
FT                   EMINEVLDVMKTLAKEGMTMVVVTHEMGFAREVADRVIFMDNGAIVEEGTPEHFFINPR
FT                   EDRTKLFLSKILTSAR"
FT   gene            complement(611837..612946)
FT                   /locus_tag="HM1_0168"
FT   CDS_pept        complement(611837..612946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0168"
FT                   /product="hd domain protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82787"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDS4"
FT                   /protein_id="ABZ82787.1"
FT                   /translation="MYSARTGKVSEQYAIGDVLAADVFTVDGRLLIPKGTVLTDGIYRQ
FT                   ILKWEEIGILTGQKPKTVSTVEMQYESLKKVGQEQILFQQSIETVRDVFLDMREGHGFN
FT                   EGAIRSTTSDIVSTIARDEKIGLRLSRLWDSDDYTFHHSVDVCLLSTMIGMSLGLSKTE
FT                   LESLAIGAILHDIGKIYIPDAILNKRGKLTDEEFALIRTHPEAGMKVFQESGIRLPEEQ
FT                   MACILQHQEWCNGKGYPNGLRYAHIHLFARIVAVADVYSALTTNRSYRVRLDHINAVSI
FT                   ISSHARDHLDKHIVFVFIDRLRDLMLNTRVRLSTGEEGYVVQFYEESPLQPTVLVTETA
FT                   DGRKLVSPYLVHLKEKTDIFIQQVLYGKI"
FT   gene            613377..613817
FT                   /locus_tag="HM1_0167"
FT   CDS_pept        613377..613817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0167"
FT                   /product="cbs domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82786"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDS3"
FT                   /protein_id="ABZ82786.1"
FT                   /translation="MNIAFFLIPKKDVIHLPINATMRQAAEKMEYHRYTAVPLIDSQGR
FT                   YVGTLTEGDLLWKWKNTPGLSFDNMHKVSLNDVPRRMNIKPVHIYAEMEELITLASEQN
FT                   FVPVLDDRGVFIGIVRRREIIEYCAGLLQAGRPAVRVAANQG"
FT   gene            complement(614018..615157)
FT                   /gene="yhbH"
FT                   /locus_tag="HM1_0166"
FT   CDS_pept        complement(614018..615157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhbH"
FT                   /locus_tag="HM1_0166"
FT                   /product="stress response protein yhbh, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82785"
FT                   /db_xref="InterPro:IPR006698"
FT                   /db_xref="InterPro:IPR014230"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDS2"
FT                   /protein_id="ABZ82785.1"
FT                   /translation="MAGDFSISREDWSLHRKGFIDQTRHQEKVREAIKKNLPQIISEEA
FT                   LILNNGQKTVKVPIRSLEEYRIRYDYNKQKHIGQGNGDSKVGDVLGRELQPAPGQGNGG
FT                   AGSEPGLDYFEAEVDIDELEDILFADLHLPNMEEKAAPELETESYRFNDIRKKGLQGNI
FT                   DRKRTLIEAFKRNALKGTPGFFPVLPEDLRYKTWEIHHERHSNAVVLAMMDTSGSMGNF
FT                   EKYIARTFFFWMTRFLRSKYHAVQIVFVAHHTEAKEVTEEEFFTKGESGGTRCSSAYQL
FT                   ANEIIDKRFPPQDYNIYAFHFSDGDNLSTDNEQCVRLVNDLLGKCNQFGYGEIVRSHFS
FT                   STLMNAFRKIQSLKFSTVTIRDKSEVYGALKTFFKPVEM"
FT   gene            complement(615170..617065)
FT                   /locus_tag="HM1_0165"
FT   CDS_pept        complement(615170..617065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0165"
FT                   /product="serine protein kinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82784"
FT                   /db_xref="GOA:B0TDS1"
FT                   /db_xref="InterPro:IPR010650"
FT                   /db_xref="InterPro:IPR013153"
FT                   /db_xref="InterPro:IPR016230"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDS1"
FT                   /protein_id="ABZ82784.1"
FT                   /translation="MEFLDKLENYRQRERELAWEGTFRDYLHLVKERPFITQLAHSRIY
FT                   NMIVSEGVEEINGIRRYKFFSHELFGMDKTLETLVEEYFHSAARRTEVRKRILLLMGPV
FT                   SGGKSTIVMMLKRGLERFSRTELGALYAIKGCPMHEEPLHLIPKELREDFQREYNVYIE
FT                   GSLCPHCRMRLETEWKGRIEDVPVERIFFSEENRVGVGTFSPSDPKSQDIADLTGSIDF
FT                   STISEYGSESDPRAYRFDGELNKANRGMMEFQEMLKADEKFLWNLLSLSQEGNFKAGRF
FT                   ALISADELICAHTNESEYKAFVSNKKNEALISRMIVVRVPYNLKVSDEVRIYEKLISQS
FT                   DLRHIHIAPHALRAAAMFSVLSRLKESKKQGMDLVKKMRLYDGEDVEGFKQKDLVELQN
FT                   EALDEGMSGADPRYVINRLSSALIRKDTVCINALDVLRAIKDGLDQHPSISKEERDRLL
FT                   NYIAIARKEFDDIAKKEVQKAFVYAYEESARTMLNNYLDNVESYCNGTKLQDPITDEEM
FT                   DPDEKLMRSIEEQIGISENAKKAFREEILIRLSTYARKGKSFDYTSHERLKEAIEKKLF
FT                   ADLKDVVKITTSSRTPNAEQLKRMNEVTARLIEDHGYCHVCANELLRYTGSLLNR"
FT   gene            complement(617249..619306)
FT                   /locus_tag="HM1_0164"
FT   CDS_pept        complement(617249..619306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0164"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82783"
FT                   /db_xref="GOA:B0TDS0"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDS0"
FT                   /protein_id="ABZ82783.1"
FT                   /translation="MAMKSIKALLVGFTLLLTVAIFAVQTVVSFLYTKDNVDASALSRM
FT                   RLQAEMEAARLESQIAITGTMSQTIANDVGALGPQHSEDLLRMTREHLKSLPMSVGAGF
FT                   WLEPGVYPEKGNYCGPYLYKAGDEIKLTWEYSNAEYDYFQYDWYKNGLTSPGGVVWSEP
FT                   YVDTVTGVPMLTASHPISLAGKRIGVSTVDIGLKELTDRVRQIRVGQEGRAFIVTRQGF
FT                   YLAHPDESKNLRTKILDEQDPQMQQFGRQIVEAKEVGLAHLTMNGVAQHALFVPIGNTG
FT                   MKLVAAIPEAEVAAPAKRLLWTNLSIFLLAVALFALLMVLLIERRVARPLRHLKEQAER
FT                   VAQGDLSVTEKEVVSQDEFGQLAQSFATMTVNLRGIVSQVLAESKQLDESSAHLAESAN
FT                   QVGEAATQIAEAVGGLAEGAGKQVAEVARFRDHVQVSELHVHEGEAASHALAQDARQST
FT                   AAATRCHDTIEKASQHLQGVSQSVDASTAAIRRLNGLSEEIGAITTSITGIAEQTNLLA
FT                   LNAAIEAARAGEHGRGFHIVADEVRKLAEESARAAAQITSLVSKMQQETSGMVDMMNAQ
FT                   VTSIGEQVGLIRQGAAALEQVIGSAMRTEGSVRQMQEAVKMIAASVKAMNASAEVIEGV
FT                   AGEFSALSQQLAASTQEQAAVAEEMAERSGHLSQSSQALREKAKQFRLDR"
FT   gene            complement(619598..620773)
FT                   /locus_tag="HM1_0163"
FT   CDS_pept        complement(619598..620773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0163"
FT                   /product="2-hydroxyglutaryl-coa dehydratase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82782"
FT                   /db_xref="InterPro:IPR010327"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDR9"
FT                   /protein_id="ABZ82782.1"
FT                   /translation="MEMSIIAEERPYAMAFFDVAIPKAAGSIMAEKEKGKKVMGHYCVF
FT                   APQELAIAAGAVPVALCATKEEPIAEGEKVLPRNFCPLIKSSYGFAITDKCPFFLHSDL
FT                   VMGETTCDGKKKMFELMGKFKPMHVMSLPAGSQSEADRSYWMAEMERAKGALEEFFQTT
FT                   ITDEALADAIKELNAERRLMQRLAGYLKHDPVPLSGQDMLKVLWSRNFCFDRAAFAEQV
FT                   EELMAELDERIARGVGAAAKGAKRIIVTGVPTGVGTEKVIRIIEESGAAVVFLENCAGM
FT                   KQFLVTVDEMKPPMEAIGDKYLATPCSCMSPNTDRLELLLRLVDEYKADGVVDITWQGC
FT                   HTYNVEARIVRDYLREHREIPVLHIETDYSEGDSQQIRTRVQAYLEMLGGV"
FT   gene            complement(620828..621682)
FT                   /gene="hgdC"
FT                   /locus_tag="HM1_0162"
FT   CDS_pept        complement(620828..621682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hgdC"
FT                   /locus_tag="HM1_0162"
FT                   /product="activator of (r)-2-hydroxyglutaryl-coa
FT                   dehydratase domain protein"
FT                   /note="Synonym: 2-hydroxyglutaryl-CoA dehydratase component
FT                   A"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82781"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="InterPro:IPR008275"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDR8"
FT                   /protein_id="ABZ82781.1"
FT                   /translation="MDSKGISATPATLQRSAAPFVAGIDAGSTAVKLVLYDENRFGFWQ
FT                   RPSGWSPGETARELLREALAEWERTKEELAYICGTGYGRVNLPFLDSAVTEIACHARGA
FT                   VHLRPDVQLVIDIGGQDAKGILVSSTGRVIDFVMNDKCAAGTGRFLAVMAHALGMEVAE
FT                   MGACQPESVTVQPQPINAMCTVFAESEVIGLLNQGIDRRAIIAGLHQSVARRVSAMVAR
FT                   LGATGPVLFTGGVARNAAVRAALEKELGCPVGVAEQSPFAGAIGAALIAREKAAGRTPS
FT                   ESS"
FT   gene            621938..622804
FT                   /locus_tag="HM1_0161"
FT   CDS_pept        621938..622804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0161"
FT                   /product="vanw domain protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82780"
FT                   /db_xref="InterPro:IPR007391"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDR7"
FT                   /protein_id="ABZ82780.1"
FT                   /translation="MNLIARRAALCAAMVAGALTLQGLQSATLTGTEACAPADSTAQAQ
FT                   PQWQPQPAVKTPKAGTITFLIGKERFTFVPGQGADYLEPGKWSYLPTLDLETARQTAVL
FT                   FADALPKDLRLRDGGLDRITSAILEGEDATVAVPSWVIAAEIVIPLTYVSYNGGRNAST
FT                   ALDYLDGYVLKANETFSFNEVVGPRSAERGFITGMSLIDNRFVQEQGGGICFASTIVHQ
FT                   AVSRTDVEIVEQNHHSRPVAYVPRGGDATVYYGELDYRFRNGDALLAFEKLQRPNGLGL
FT                   RLWKSMH"
FT   gene            623582..623788
FT                   /locus_tag="HM1_0160"
FT   CDS_pept        623582..623788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82779"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDR6"
FT                   /protein_id="ABZ82779.1"
FT                   /translation="MVNHFLGCLLSIAKRFGHASAEERSGLPESALQRIWRYVGDACGW
FT                   LARVVRPVANSNLWRHTCFAFLS"
FT   gene            623840..625195
FT                   /locus_tag="HM1_0159"
FT   CDS_pept        623840..625195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0159"
FT                   /product="transposase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82778"
FT                   /db_xref="GOA:B0TDR5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR015378"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDR5"
FT                   /protein_id="ABZ82778.1"
FT                   /translation="MKDARKAEDIASQRVQLLSPLLAEGLDAARARLMKQQICEQAGIS
FT                   ERTLRRYLSQYREKGFSGLKPKGKGRSRSEEAIPHALLEEAILLRREVPRRSIAQIIQI
FT                   LEWEGKAEPGKLKRSTLQEKLAERGYSTRHMQMYANTGVAARRFQQKHRNQLWHSDIKY
FT                   GPYLPIGPDGAKKQVYLVTFFDDATRFVLHGQFYPTLDQVIVEDCFRQAILKYGAPEAV
FT                   FFDNGKQYRTKWMHRACAKMGIRLLFAKPYSPESTGKVERFNRTVDAFLQEAALEKPHT
FT                   LDRLNQLFWVWLDECYQNKPHSALAGNVSPDTAYRSDKKAVKFLDPDVVANAFLHCESR
FT                   KVDKSGCISFEGRKYEVGLSFIGCTVDVIYDPADIAELTIEYADHAPWKARQLVIGERT
FT                   GPRPKLPERLSPQSADSSRLLAAATQQKEQRKARQAPVVSYRTVRKEGNNGV"
FT   gene            625188..625988
FT                   /locus_tag="HM1_0158"
FT   CDS_pept        625188..625988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0158"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82777"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDR4"
FT                   /protein_id="ABZ82777.1"
FT                   /translation="MFESFYGFTQTPFARDIPTEQLYSSIMLEETLGRLEYAASRQLFA
FT                   VVTGDCGTGKTTTIRRFKDMLDSARFHVMYLADSKLTPRHFYKGLLEQLGAESKFYRGD
FT                   AKRQLHREVELMRGIHRLQIVVIVDEAHLLDREMLEEVRFLLNFKMDAQSPMALILVGQ
FT                   SELEEKLQLQAYAAIRQRIDLQCRLMHYDRAQVGEYVKRHLAYAGAVHDIFSDGAIYEI
FT                   YRFSSGAARLINKVCTHCLLYGAQNGRRIIDDHMVKLVVQGELN"
FT   gene            complement(626700..626855)
FT                   /locus_tag="HM1_0157"
FT   CDS_pept        complement(626700..626855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0157"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82776"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDR3"
FT                   /protein_id="ABZ82776.1"
FT                   /translation="MVKEIVNLFVNLSLSDIEKAIKLAQKIETEQISESDYLKLANYII
FT                   KSDGLK"
FT   gene            627020..627136
FT                   /locus_tag="HM1_0156"
FT   CDS_pept        627020..627136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0156"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82775"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDR2"
FT                   /protein_id="ABZ82775.1"
FT                   /translation="MKDYIASFSELSYFDSVMKEQYSILVMNALNPIKGLAY"
FT   gene            628424..628750
FT                   /locus_tag="HM1_0155"
FT   CDS_pept        628424..628750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0155"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82774"
FT                   /db_xref="GOA:B0TDR1"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDR1"
FT                   /protein_id="ABZ82774.1"
FT                   /translation="MRRNRYPKELKEQLIQEAMEVGNATQVARRHGIDPKRLYYWIRES
FT                   QHKGFQEAPADAKQIAPYVPSAQEFKRLESENIALKKLLGEKTLEIQILQDLIKKKNPS
FT                   YRKN"
FT   gene            628801..629076
FT                   /locus_tag="HM1_0154"
FT   CDS_pept        628801..629076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0154"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82773"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDR0"
FT                   /protein_id="ABZ82773.1"
FT                   /translation="MRVIGIHEATYYARRQRLQREPKERAYNGGRPQPGYSWTQDGKRI
FT                   SDEQIKEYLRGRLENKQIPSQPLQKHDFLIQTAKNQSLFIGLTSPF"
FT   gene            complement(629115..630737)
FT                   /locus_tag="HM1_0153"
FT   CDS_pept        complement(629115..630737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0153"
FT                   /product="transposase, is4 family"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82772"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDQ9"
FT                   /protein_id="ABZ82772.1"
FT                   /translation="MFRFDVDPQVSFYDFAALWDQLVPADSVFRLFRELAPLLIQPEDF
FT                   TGLYCLDNGRPSHAARQMTMACMLQEMLGETDRGMEAQTRVNIEVKFALGMALDEPGID
FT                   HANFGVHRQRIIQKELDKVYLDRFIRLMYYLGVLTGKEPWITDTTHVIAPISAPTTIEL
FT                   IRQAMRLLVRLLAKQYSVPWHAIPHAPRAVRYLETVTEVKEHNLDDKAKMERLVEVVSE
FT                   ADELLAYVESSEASWKKKPDVIHYALLLCRILRERIIRKDDGTLEIAPGGSVKDMIVSA
FT                   VDSEARFGCKGKTKWRGYKMAIVEVGNSGFIAAAEAMKANDYDGSSLVPLADQLPTDCV
FT                   ENPTIIGDTHYGAGDDRVTLKEKGIDVVAPLSPKTKCDILAGEGFQVSEDQTQLICPRG
FT                   KVITTYSEVADGKNFVLRAKDHDCKHCPRYTTCFKEKKHRRTIFIHNAYGVMLEAAKHS
FT                   QTKIYKEQMRLRSRIEAKQNELVNRYGLRRVRRIGKRNLAYAARLSALAANFQKLNRLR
FT                   NDKNATMVLEVSALRGVAFKKAA"
FT   gene            630896..631666
FT                   /locus_tag="HM1_0152"
FT   CDS_pept        630896..631666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0152"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82771"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDQ8"
FT                   /protein_id="ABZ82771.1"
FT                   /translation="MKDYTDEEILEQFHFNFQVMYALGIRNLGEVYLAERTLYEFRRRL
FT                   YEYTIGHPEQEDLIFHQFRKLTEHFMAIAGIGSREQRMDSTQVQTNIKLAGRLSLAFDI
FT                   VEKAVRECTSAHLPAALKPFAEPGFRNQFLYRCKTKETLGRIQELLNQCVLLLDIAKAH
FT                   PESLQKETVALLQRFLQEQATYPAEKKQWIAKANKDIAADSIQSAHDPDVTYRKKGRQG
FT                   HVGLVANVTETCANENPVQMITHYQVEKNSGSTP"
FT   gene            complement(631914..632798)
FT                   /locus_tag="HM1_0151"
FT   CDS_pept        complement(631914..632798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0151"
FT                   /product="integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82770"
FT                   /db_xref="GOA:B0TDQ7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDQ7"
FT                   /protein_id="ABZ82770.1"
FT                   /translation="MRVIGIHEATYYARRQRLQREPKERTNNGGRPQPGYSWTQDGKRI
FT                   SDEQIKEYLIELIAGEESIYGYRKLGICLHKQHQLIINHKKTYRLCKELDILSPQRQIK
FT                   AKHPRRMARNRTITASNELWEMDIKYGYIAGEDRFFYLMSLIDVYDRSIVDYHIGLNCE
FT                   GADAANTLKRALWKRNCFEKEKKPIVRTDNGSQFISRVFEETCEQYQVEHERIPPKTPN
FT                   KNAHIESFHANLERECYIKHTFESYQDAYQVVGEYIDFYNQRRIHGSLYNMPPAEFCRQ
FT                   LADGNVPAFIVTL"
FT   gene            complement(632849..633175)
FT                   /locus_tag="HM1_0150"
FT   CDS_pept        complement(632849..633175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0150"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82769"
FT                   /db_xref="GOA:B0TA95"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B0TA95"
FT                   /protein_id="ABZ82769.1"
FT                   /translation="MRRNRYPKELKEQLIQEAMEAGNATQVARRHGIDPKRLYYWIRES
FT                   QHKGFQEAPADAKQIAPYVPSAQEFKRLESENIALKKLLGEKTLEIQILQDLIKKKNPS
FT                   YRKN"
FT   gene            633259..633423
FT                   /locus_tag="HM1_0149"
FT   CDS_pept        633259..633423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0149"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82768"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDQ5"
FT                   /protein_id="ABZ82768.1"
FT                   /translation="MLTLIVSRRILGLLREQFPEHAHRMKPLRWARVFTVIADDILRNV
FT                   LIYQRPSRK"
FT   gene            complement(633556..635178)
FT                   /locus_tag="HM1_0148"
FT   CDS_pept        complement(633556..635178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0148"
FT                   /product="transposase, is4 family"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82767"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B0TAA0"
FT                   /protein_id="ABZ82767.1"
FT                   /translation="MFRFDVDPQVSFYDFAALWDQLVPADSVFRLFRELAPLLIQPEDF
FT                   TGLYCLDNGRPSHAARQMTMACMLQEMLGETDRGMEAQTRVNIEVKFALGMALDEPGID
FT                   HANFGVHRQRLIQKELDKVYLDRFIRLMYYLGVLTGKEPWITDTTHVIAPISAPTTIEL
FT                   IRQAMRLLVRLLAKQYSVPWHAIPHAPRAVRYLETVTEVKEHNLDDKAKMERLVEVVSE
FT                   ADELLAYVESSEASWKKKPDVIHYALLLCRILRERIIRKDDGTLEIAPGGSVKDMIVSA
FT                   VDSEARFGCKGKTKWRGYKMAIVEVGNSGFIAAAEAMKANDYDGSSLVPLADQLPTDCV
FT                   ENPTIIGDTHYGAGDDRVTLKEKGIDVVAPLSPKTKCDILAGEGFQVSEDQTQLICPRG
FT                   KVITTYSEVADGKNFVLRAKDHDCKHCPRYTTCFKEKKHRRTIFIHNAYGVMLEAAKHS
FT                   QTKIYKEQMRLRSRIEAKQNELVNRYGLRRVRRIGKRNLAYAARLSALAANFQKLNRLR
FT                   NDKNATMVLEVSALRGVAFKKAA"
FT   gene            635294..635446
FT                   /locus_tag="HM1_0147"
FT   CDS_pept        635294..635446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0147"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82766"
FT                   /db_xref="UniProtKB/TrEMBL:B0TDQ3"
FT                   /protein_id="ABZ82766.1"
FT                   /translation="MRGFLDRLYQGIHPKGYNLLLGIFVAEAIDPNVLRKENFRALITS
FT                   FAKGY"
FT   gene            complement(636095..637438)
FT                   /locus_tag="HM1_0146"
FT   CDS_pept        complement(636095..637438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0146"
FT                   /product="transposase, is4 family"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ82765"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B0TCH3"
FT                   /protein_id="ABZ82765.1"
FT                   /translation="MTMKKFIIEQSNEELTPVTGLALVGALLRKTSLKLRLDKSTVPTC
FT                   LTPDISHGTVALSYLGLLCQGKNDFDAIELARGDDFFRYAMGVDIVPSSPTLRQRFEKV
FT                   VETDLKWNDIIMEESARLIKKAKAPLTPVRVGATDYLTVDVDVTPLDNSGSKKEGVTRT
FT                   YKGHDGFAPILAYLGQEGYCINVELRPGKDHSQKGTPQFLTKSINYARQCGAEKLLVRM
FT                   DSGFDSVDNIRVLRAENVDYIIKRNLRQETPEMWRDIALKNGQARIVREGKVEYMGSVM
FT                   WKVGNMEQRERVVFHVVERTILSNGQQLLLPELEVATYWTSLPVSPEELIHLQRDHGTS
FT                   EQFHSELKTDLDLERLPSGKFKVNDLVFHFGALAYNLLRIVGQMSLHHPDSPLKRKAHT
FT                   QRRRIRTVLQNVITIASRLVRHARQVKLRLGAHSPWYATFKDLYLAFS"
FT   gene            complement(637801..639144)
FT                   /locus_tag="HM1_0640"
FT   CDS_pept        complement(637801..639144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_0640"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83245"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B0TCH3"
FT                   /protein_id="ABZ83245.1"
FT                   /translation="MTMKKFIIEQSNEELTPVTGLALVGALLRKTSLKLRLDKSTVPTC
FT                   LTPDISHGTVALSYLGLLCQGKNDFDAIELARGDDFFRYAMGVDIVPSSPTLRQRFEKV
FT                   VETDLKWNDIIMEESARLIKKAKAPLTPVRVGATDYLTVDVDVTPLDNSGSKKEGVTRT
FT                   YKGHDGFAPILAYLGQEGYCINVELRPGKDHSQKGTPQFLTKSINYARQCGAEKLLVRM
FT                   DSGFDSVDNIRVLRAENVDYIIKRNLRQETPEMWRDIALKNGQARIVREGKVEYMGSVM
FT                   WKVGNMEQRERVVFHVVERTILSNGQQLLLPELEVATYWTSLPVSPEELIHLQRDHGTS
FT                   EQFHSELKTDLDLERLPSGKFKVNDLVFHFGALAYNLLRIVGQMSLHHPDSPLKRKAHT
FT                   QRRRIRTVLQNVITIASRLVRHARQVKLRLGAHSPWYATFKDLYLAFS"
FT   gene            639616..640812
FT                   /locus_tag="HM1_1332"
FT   CDS_pept        639616..640812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_1332"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1332"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83246"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGI5"
FT                   /protein_id="ABZ83246.1"
FT                   /translation="MSRTAESFSKPKHNKIMNILAEATGGKSYKAHKYPIDYADRPSID
FT                   YGDSEIIWKRRAETTQHRTYINLLGLSKKLASRDDQILSYFLDGSRRVFKVDDIAYVQS
FT                   GGRSIIYPVIAGQIGVGCCHRVNKKVVPVQLKREFVLSMPDVADADGKPGFWPATAKKL
FT                   SECDELKRLGIEFAAILPYKTSKNDDKKFEDRATACVQDRMIESEKKLVADLVREGKLN
FT                   QNNYLVKDGSLEYRPTKEDKADKRRYQTFKNNYNWVIGVSKNFNPEVCEDINGKPNPGF
FT                   IADLPLYHRTPVVEYENPMLGDIKFAVWYIRLRDKEKTRTPFDGVLKVEKILVTEEETE
FT                   VGIDSEQVDTLSAYLINERNPVCYGSDLRWANHIYPIYLTESFVKSRYLSAESFLHLF"
FT   gene            640827..642539
FT                   /locus_tag="HM1_1331"
FT   CDS_pept        640827..642539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_1331"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1331"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83247"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGI6"
FT                   /protein_id="ABZ83247.1"
FT                   /translation="MSKLIGRVLATEKNPTTMDEFNFWTNSDLKLHAFDIVKVVHIEGS
FT                   YTFGVIENISHITDAQSFLTNFISSDFGDVDIDEPTLRVGMNYAKAKVSFNSKNLYTPV
FT                   HNNAKVYLATADEITTALGLKVIQNPLVCGSLKMYEGTSEEVTLPVFLNSKFLLGPEGA
FT                   HLNISGISGLASKTSYAMFLMKAIQDQYLKADTDDSVAFVIFNVKGKDLMAIDRPNDFS
FT                   TDNPGEKERVLAEYKALGLSTEPFKNVKYYIPYTSNTSAKQSTYLSIDDVKSYTEYGQL
FT                   KKFKYSYEDDKESLEMLFADIDDPQQTMEAIISKIIDDNDQDFGGGRVNTWTEFREKVD
FT                   ELSQRSQPAGRSSQQRVSNEISVLSWRKFKRIINKATKNDDMFANRPDPSKHECRLADE
FT                   LKKIRENEVYVIDIAKLPEDKQAFVFGDAVRTIYNLKLGEYDAESGVEPPSRIIIFIDE
FT                   LNKYASKEIPKSSPILREILDITERGRSLGVVLFAAEQFRSAIHPRVTGNCATHAYGRT
FT                   NSIETSTADYRSLPSTYQNMLTRLEQGDYLVQNPIFRSLLKIRFPKPIYKQFK"
FT   gene            642550..644130
FT                   /locus_tag="HM1_1330"
FT   CDS_pept        642550..644130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_1330"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Chaperone protein htpG (Heat shock
FT                   protein htpG)"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1330"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83248"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGI7"
FT                   /protein_id="ABZ83248.1"
FT                   /translation="MRDMKDYVFGANILENLTTGMYQDSKVIYREYIQNACDQIDKAVK
FT                   DEILKQDEGTIKIWLDRDQRTIVIEDNATGIPAASFQQTLGNIADSDKKIGEDKGFRGI
FT                   GRLCGLAYCKELIFISSAKGEDTVSLMVCDAKKMRGLIDENTRGKKHTANEVLNAINRF
FT                   EQKKTNDIDSHFFRVELIDINPENTDLLDFQQVKDYLSFVAPVPYQSSFYYRTDVYKHA
FT                   QELGVKIDEYNITLNGEPIFKKYTTILKDSSTGTKYDDIFGVHFQDFYKNGELFAWMWV
FT                   GVSRFQKAIPKINQMRGLRLRKENIQIGGEDALQKLFKEDRGNSYFIGEVFAVNKDLIP
FT                   NSQRDYFNENPARAYFELELRRYFNEELRKIYYTGSTINSSYKKIDAYEKKNTEFKEKD
FT                   KAGVFVDKEHRERELKVVLESKKEAENALEKIDKIKDKADGLMQKVIQRIEVERPKPVI
FT                   AVVVPPIKPPKDDEEESEKSGMFRRTDRLSQYNKAERKLISKIFSIITSVTDSKTAEMI
FT                   ISKIEEGLQ"
FT   gene            644127..645932
FT                   /locus_tag="HM1_1329"
FT   CDS_pept        644127..645932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_1329"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1329"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83249"
FT                   /db_xref="GOA:B0TGI8"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGI8"
FT                   /protein_id="ABZ83249.1"
FT                   /translation="MNQKILLIEPNYKNKYPPMGLMKLATYYRNRGDDVRFFKGDLKVF
FT                   AAKLLCEEFLAEVKDPKLGKYVPKFIEHIKTGKFAPLDTIPNFRNSEQDVILKEYRLRY
FT                   RNGMFPQFDVIGITTLFTFYWRETIDTINYAKKFCSEDGRIIVGGIAASILHDKILQET
FT                   GIDPLCGLLNKPGMLDADNEYIIDELPLDYSILEEIDYQYPVNNAYLAYMTRGCHRKCA
FT                   FCAVPSLEPEYKDYIGLKEQIRLATERFGPQKNLLLMDNNVFASKHFEKIIDEIKECGF
FT                   ERGATYIPESEYDIAMKNIREGYNVRAYTRKLIKLYDRISDRLSEAEQADFYLEREKRN
FT                   LLYAEVASPDAIIEFDEKARPLYEKYFKPIKRMRIIDFNQGVDARLVTEKKMKKLAEIN
FT                   IRPLRIAFDHYSMKDTYEAAIRTAVKHGITDLSNYLLYNFEDQPDDLYYRMKINIDLCD
FT                   ELGVTIYSFPMKFHPIDDPKYFQNRDYIGKHWNRKFIRAVQAVLNSTKGKIGRGKSFFE
FT                   EAFGKDIDEFHKILWMPEAFIIHRFKYKDNLTAEWWEKFNSLDEMQLNRLKAIVAANVF
FT                   DENIATGDPSVDEVLRYYQVRRDPK"
FT   gene            complement(646331..646683)
FT                   /locus_tag="HM1_3156"
FT   tmRNA           complement(646331..646683)
FT                   /locus_tag="HM1_3156"
FT                   /product="ssra"
FT                   /note="10sa RNA (tmRNA)"
FT   gene            647009..648202
FT                   /gene="aspB"
FT                   /locus_tag="HM1_1327"
FT   CDS_pept        647009..648202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspB"
FT                   /locus_tag="HM1_1327"
FT                   /product="aspartate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1327"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83250"
FT                   /db_xref="GOA:B0TGI9"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGI9"
FT                   /protein_id="ABZ83250.1"
FT                   /translation="MNLSKKGLSIHPSPTLSIDAKAKKMRSEGVDVIGFGAGEPDFDTP
FT                   DHVKQAAIAAIEAGFTKYTPASGTLELKQAICDKLKAENGVDYAPANIIVSNGAKHSLV
FT                   NAFEAICNPGDEVIIPAPYWVSYPEMVKLVDAVPVFVYTTEESRFKFTVEQIKQALTSK
FT                   TKALVLNSPSNPTGMVYSKEELAEIADLAVEYGIFVISDEIYEKLIYDDFEHVSIASIN
FT                   DKIKEQTIIVNGVSKAYSMTGWRIGYTASNAPIAKIMANIQSHATSNPNSIAQKAALAA
FT                   ITGPQDIVGTMVGEFVRRRDYMVERINAIPGLSCLKPNGAFYVMMNISKIIGSTFAGRR
FT                   INGSDDFADLLLEQAQVALVPGSGFGIDTHVRLSYATSMENITEGLNRIENFLLSLT"
FT   gene            complement(648373..648489)
FT                   /locus_tag="HM1_1326"
FT   CDS_pept        complement(648373..648489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_1326"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1326"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83251"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGJ0"
FT                   /protein_id="ABZ83251.1"
FT                   /translation="MTIEHLLMFAPSYANTVKKVPPGGETCTRLWNEFQRIR"
FT   gene            648488..649258
FT                   /locus_tag="HM1_1325"
FT   CDS_pept        648488..649258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_1325"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1325"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83252"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGJ1"
FT                   /protein_id="ABZ83252.1"
FT                   /translation="MDRKPPTGYPKVPYTPIAPERIIPPPPPPPPPPPPPPPPPPPPPP
FT                   PPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRP
FT                   CPPPPPARPCPPPCPPKHECGLPEPCPQVEPIAGEPMPIPPCAPMPMPMPMEPIGRQPL
FT                   PIPMPMPPCAPMPVEPVAREPMEHRPAPCDPCESYDPAITVPPEMMKPGWKLAQAFVPY
FT                   QQYCPPFYPPAEALCKGTIFPGLYRPYCHDRHRR"
FT   gene            649279..649539
FT                   /gene="cotJB"
FT                   /locus_tag="HM1_1324"
FT   CDS_pept        649279..649539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cotJB"
FT                   /locus_tag="HM1_1324"
FT                   /product="spore coat protein cotjb"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1324"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83253"
FT                   /db_xref="InterPro:IPR016571"
FT                   /db_xref="InterPro:IPR024207"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGJ2"
FT                   /protein_id="ABZ83253.1"
FT                   /translation="MDRHQLELLRRIQELEFVAVDLNLFLDTHPNDKAALRDFTRVTDE
FT                   LKKLKHAYEQRYALLTVEGYCPGRYPWNWIETPWPWEIDYC"
FT   gene            649567..650139
FT                   /locus_tag="HM1_1323"
FT   CDS_pept        649567..650139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_1323"
FT                   /product="manganese-containing, non-heme catalase"
FT                   /note="Similar to protein cotJC; Sometimes known as
FT                   ''pseudocatalase''"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1323"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83254"
FT                   /db_xref="InterPro:IPR007760"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR039377"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGJ3"
FT                   /protein_id="ABZ83254.1"
FT                   /translation="MWIYEKKLQYPVRVEKCDIGMAKFLFAQYGGPDSELAAALRYLTQ
FT                   RYTMPTKKAKGLLTDIGTEELAHLEVIATLIYKLIDGVPAEKLRETGLGGFYAQHDNAL
FT                   YYADANGVPWTAAYIQATGDPITDLHENLAAEQKARVTYEHLINLTDDPGVKDVLRFLR
FT                   EREVVHFQRFGEALDDVQFFMDRKSCY"
FT   gene            complement(650363..650830)
FT                   /gene="smpB"
FT                   /locus_tag="HM1_1322"
FT   CDS_pept        complement(650363..650830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smpB"
FT                   /locus_tag="HM1_1322"
FT                   /product="ssra-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1322"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83255"
FT                   /db_xref="GOA:B0TGJ4"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGJ4"
FT                   /protein_id="ABZ83255.1"
FT                   /translation="MGDGHKVLCENRRARHDYHIDETYEAGMALKGTEIKSLRQGKGNL
FT                   KDAFARVENGEVLLYNMHISPFEQGHSFNHEPTRTRKLLLHRNEIRKLSAATYQKGLTL
FT                   VPLRVYLKRGYAKLELAIARGKKLYDKRDAIARRDAEREMARAMRQREKGE"
FT   gene            complement(650934..651515)
FT                   /locus_tag="HM1_1321"
FT   CDS_pept        complement(650934..651515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_1321"
FT                   /product="hdig domain protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1321"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83256"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGJ5"
FT                   /protein_id="ABZ83256.1"
FT                   /translation="MDSPSNLPSREAALKLLARYNSNRNLFNHMLACEAVMGALAQRFG
FT                   ADEAKWRLAGLLHDIDYDQTKDDPLRHSQVGADILAEAGYPDDVVYAVRVHNDVHGLPR
FT                   LSRMDKALYAVDPLTGLIVAGALIKKEKDVRLIDTDFLLKRFKEKSFARGARRDQIEAC
FT                   SEIDLSLEVFISIGLEAMQAIAPELGIAGK"
FT   gene            complement(651587..652015)
FT                   /locus_tag="HM1_1320"
FT   CDS_pept        complement(651587..652015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_1320"
FT                   /product="thioesterase family protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1320"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83257"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGJ6"
FT                   /protein_id="ABZ83257.1"
FT                   /translation="MTISLTDDGMCFCCGQNNPIGLKLAFAWEGDDYVTYFTPGAVHQS
FT                   YAGITHGGIVSTVLDEVMGRIMSSRGIPAVTARMEVRFRHAVPTGERVRFAARIVRERG
FT                   KVIDASATAVLADGRIAAEATGRFLVHAAPASSEETAM"
FT   gene            complement(652012..652629)
FT                   /locus_tag="HM1_1319"
FT   CDS_pept        complement(652012..652629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_1319"
FT                   /product="twin-arginine translocation protein tatb"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1319"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83258"
FT                   /db_xref="GOA:B0TGJ7"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="InterPro:IPR006970"
FT                   /db_xref="InterPro:IPR018448"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGJ7"
FT                   /protein_id="ABZ83258.1"
FT                   /translation="MFNIGFPELLLIFIVALIVLGPGKLPEVGRSVGKALGEFRRAADG
FT                   LTSQLKEAMAPVKEIKSAVDDVAAPVREVRSAVTDPKGYVADKAKERLLGRATEIRTEQ
FT                   TAVQSTDRATDQPTDQPTDQSTDQSTDQSTDQSTDRATDQSTGQPTDQPKEQSKEQSKD
FT                   RSKDQSISPTFDPAGKTAEKSIETDKPAQPAAKIEQKDGERR"
FT   gene            complement(652825..654882)
FT                   /locus_tag="HM1_1318"
FT   CDS_pept        complement(652825..654882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_1318"
FT                   /product="v-type h(+)-translocating pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1318"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83259"
FT                   /db_xref="GOA:B0TGJ8"
FT                   /db_xref="InterPro:IPR004131"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGJ8"
FT                   /protein_id="ABZ83259.1"
FT                   /translation="MNYPLIAAVAGVVGLLFAAYLAVSVLKEDQGTQRMKEISQAIFEG
FT                   AMAFLNRQYKTLIPFAVVIFGALLAGNWGNQKLAWGQAISFLVGAGFSAVAGYVGMTIA
FT                   TKSNARTTAAAMRGLNEALSVAFRGGAVMGMSVAGLGLLGVSVLYIVFEDAVIINSFAF
FT                   GASVIALFARVGGGIYTKAADVGADLVGKVEAGIPEDDPRNPAVIADNVGDNVGDTAGM
FT                   GADLYESYAATTIAAMLIGVTVFPGRLEGLYYPLLIGAAGIIAAIIASFLVRTTEDGDP
FT                   QMALNKGLWGTNFLTAIATYFIAASLFEGVTADPKVFPSGVPIGLTISVVAGLLVNVAV
FT                   GWVTEYYTSYNYKPAQHIASSSLTGPATNIIAGIGVGLKSTALPIIVIVIAIAVSYQFA
FT                   GIYGIAMAAMGMLCTAGMVVAIDSFGPVADNAGGIAEMAELGPEVRKKTDKLDAVGNTT
FT                   AAVAKGFAIGSAALTALALFTAFAEEVIKSPGVASALAGGHFVLNLLEPKIIIGLFIGG
FT                   TVPFLFCAFAMEAVGKAAFDMIGEVRRQFREIPGLMEGKAKPDYARCVDISTRAAIRQM
FT                   IAPGLLAVITPLIVGFSFGAQALGGMLAGVTVAGVLLAIFMANAGGAWDNAKKYIESGK
FT                   HGGKGTEAHAAAVIGDTVGDPFKDTAGPSLNALIKVTGTISLIIAPFLNL"
FT   gene            complement(654955..655179)
FT                   /gene="secG"
FT                   /locus_tag="HM1_1317"
FT   CDS_pept        complement(654955..655179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secG"
FT                   /locus_tag="HM1_1317"
FT                   /product="preprotein translocase, secg subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1317"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83260"
FT                   /db_xref="GOA:B0TGJ9"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGJ9"
FT                   /protein_id="ABZ83260.1"
FT                   /translation="MTTFIIIVHIIASIGLMASVVMQSGKSAGLSGAIAGGAESFFGKK
FT                   KGLDDLLSKLTVVFAAIYLLSALGLSMVG"
FT   gene            complement(655661..656950)
FT                   /gene="eno"
FT                   /locus_tag="HM1_1316"
FT   CDS_pept        complement(655661..656950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eno"
FT                   /locus_tag="HM1_1316"
FT                   /product="enolase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1316"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83261"
FT                   /db_xref="GOA:B0TGK0"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGK0"
FT                   /protein_id="ABZ83261.1"
FT                   /translation="MSVIAEIYAREILDSRGNPTVEVDVVLEDGTRGRAAVPSGASTGA
FT                   YEAVELRDGDKERYLGKGVQNAVDNVNLEIAPELIGWDVTRQMEIDRRMIELDGTPNKG
FT                   RLGANAILGVSMACAKAAAQFVGLPLYQYLGGVFARELPVPMMNILNGGKHADNNVDIQ
FT                   EFMVMPVGATSFSEGLRMGVEVFHALKKVLKGKGMNTAVGDEGGFAPNLSSNEEALQVI
FT                   IEAVKAAGYNPGTDILLAVDAAASEMYKDGKYHLEGEGKVKSSAEMVDYWEDLVNRYPI
FT                   ISIEDGLNEDDWDGWKLLTDRLGKRVQLVGDDLFVTNTEKLEKGMEMGVGNSILIKVNQ
FT                   IGTITETLAAIEMARRAGYTSVISHRSGETEDATIADLAVAVNAGQIKTGAPSRTDRVA
FT                   KYNQLLRIEEELDEQALYRGKKTFFNLERR"
FT   gene            complement(657094..658647)
FT                   /gene="gpmI"
FT                   /locus_tag="HM1_1315"
FT   CDS_pept        complement(657094..658647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpmI"
FT                   /locus_tag="HM1_1315"
FT                   /product="2,3-bisphosphoglycerate-independent
FT                   phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1315"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83262"
FT                   /db_xref="GOA:B0TGK1"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGK1"
FT                   /protein_id="ABZ83262.1"
FT                   /translation="MLSSTQQKPVMLIVLDGWGLREDVEGNTLKIASLPNYQRLLETYP
FT                   HTSIQASGEYVGLPKGQIGNSEVGHLNIGAGRVVYQELTRISKAVETGELEKNQVLAAA
FT                   MDRLKGTDKGLHLMGLLSDGGVHSHIDHLFALLDMAAARGVEQIFVHAFLDGRDVPPAN
FT                   AQEYIDSLEKKLGQLGRGQLATVSGRYYAMDRDQRWERVEKAWDAMVYGRGEKATLGRS
FT                   AVEAAYHARVTDEFVPPTVIVDGKGEPKGTIKDGDSVIFFNFRADRARQLTRAFVDADF
FT                   SGFDRGPLAPQVHFCCLTQYDATIDAPVAFMPQNLENTFGEVIAKAGLRQLRIAETEKY
FT                   AHVTFFFNGGVEEPNVGEERILVPSPKVATYNLQPEMSAREVTDRVLAEIEAEKYDVII
FT                   LNYANPDMVGHTGMLPAAIQAVEAVDKCLGRVAAAVLAKGGALLITADHGNVEMMIDPH
FT                   DGGPHTAHTTDLVPVILVSDRHKDRQLRPAGALEDIAPTLLALLGLEAPPEMTGKSLIL
FT                   "
FT   gene            658847..660469
FT                   /locus_tag="HM1_1314"
FT   CDS_pept        658847..660469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_1314"
FT                   /product="transposase, is4 family"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1314"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83263"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B0TAA0"
FT                   /protein_id="ABZ83263.1"
FT                   /translation="MFRFDVDPQVSFYDFAALWDQLVPADSVFRLFRELAPLLIQPEDF
FT                   TGLYCLDNGRPSHAARQMTMACMLQEMLGETDRGMEAQTRVNIEVKFALGMALDEPGID
FT                   HANFGVHRQRLIQKELDKVYLDRFIRLMYYLGVLTGKEPWITDTTHVIAPISAPTTIEL
FT                   IRQAMRLLVRLLAKQYSVPWHAIPHAPRAVRYLETVTEVKEHNLDDKAKMERLVEVVSE
FT                   ADELLAYVESSEASWKKKPDVIHYALLLCRILRERIIRKDDGTLEIAPGGSVKDMIVSA
FT                   VDSEARFGCKGKTKWRGYKMAIVEVGNSGFIAAAEAMKANDYDGSSLVPLADQLPTDCV
FT                   ENPTIIGDTHYGAGDDRVTLKEKGIDVVAPLSPKTKCDILAGEGFQVSEDQTQLICPRG
FT                   KVITTYSEVADGKNFVLRAKDHDCKHCPRYTTCFKEKKHRRTIFIHNAYGVMLEAAKHS
FT                   QTKIYKEQMRLRSRIEAKQNELVNRYGLRRVRRIGKRNLAYAARLSALAANFQKLNRLR
FT                   NDKNATMVLEVSALRGVAFKKAA"
FT   gene            complement(660726..661481)
FT                   /gene="tpiA"
FT                   /locus_tag="HM1_1313"
FT   CDS_pept        complement(660726..661481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tpiA"
FT                   /locus_tag="HM1_1313"
FT                   /product="triosephosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1313"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83264"
FT                   /db_xref="GOA:B0TGK3"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGK3"
FT                   /protein_id="ABZ83264.1"
FT                   /translation="MRTPVLAGNWKMYLTPAEGRQMIEALRPLVEGVADREIVLCPPFT
FT                   ALAAAADAIEGSNISIGGQNVHPAREGAFTGEIAPPMLKALGCRYVIIGHSERRQYFGE
FT                   TDATVAEKVRAALAEELIPIVCVGETLEQREKGVTNPVVEIQVRQGLDGLSPEELSGLI
FT                   IAYEPIWAIGTGRTASPDDAQQVCAFIRSVMARLAGEGAQKTRILYGGSVKPDNIKELM
FT                   NQPDIDGALVGGASLKAESFARIVRFEEQ"
FT   gene            complement(661622..662809)
FT                   /gene="pgk"
FT                   /locus_tag="HM1_1312"
FT   CDS_pept        complement(661622..662809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgk"
FT                   /locus_tag="HM1_1312"
FT                   /product="phosphoglycerate kinase"
FT                   /note="Also known as gerG"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1312"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83265"
FT                   /db_xref="GOA:B0TGK4"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGK4"
FT                   /protein_id="ABZ83265.1"
FT                   /translation="MNKQTVRDIDVRGKGVLVRVDFNVPVNEAGVITDDTRIRAALPTI
FT                   QYLIQEGAKVILASHFGRPKGKVNDKYRLTAVGIRLAELLGRPVKKLDDCIGPETEAAV
FT                   RAMEAGDVVLLENVRFYLEEEQNDPAFARKLAALADVYVNDAFGTAHRAHASTAGVAAY
FT                   LPAVAGFLMDKEISIMGKALASPERPFVAIMGGAKVADKIAVIDNLLTKVDTLIIGGGM
FT                   ANTFFYALGREVGRSLCEKDKADTARQLLNKAKASGVRFLLPVDVVVAETLAAGVPTAV
FT                   VPADAIPADKAALDIGPESIALFEQALAKARTVLWNGPMGAFEIAPFDRGTLGVAKAMA
FT                   KVQGLSIIGGGDSVAAVEKAGLADQMTHVSTGGGASLEFLEGRELPGVAALSDKS"
FT   gene            complement(662959..663966)
FT                   /gene="gapA"
FT                   /locus_tag="HM1_1311"
FT   CDS_pept        complement(662959..663966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gapA"
FT                   /locus_tag="HM1_1311"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1311"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83266"
FT                   /db_xref="GOA:B0TGK5"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGK5"
FT                   /protein_id="ABZ83266.1"
FT                   /translation="MAVRIGINGFGRIGRLAARVAIANPEVEIVAINDLTDAKTNAHLF
FT                   KYDSVHGTFQGQVAVSNDSIEIDGKAIKVFAQKDPALIPWGDVGVDIVIESTGFFVDGE
FT                   KASAHLRGGAKKVIISAPAKNEDITVVMGVNEDTYDPAAHRIISNASCTTNCLAPVAKV
FT                   LNDQFGIVKGLMTTVHAYTNDQKILDQTHKDLRRARAAAMSIVPTSTGAAKAIGKVIPE
FT                   LAGKLNGFAMRVPTPNVSVVDLVVDVQKKTTAEEVNAALKTASEGAMKGFLGFSELPLV
FT                   SRDFNGTTFSSIVDALSTMVIDGDMVKIVAWYDNEYGYSCRLIDLAAYVAGKGL"
FT   gene            complement(664127..665428)
FT                   /gene="rpoN"
FT                   /locus_tag="HM1_1310"
FT   CDS_pept        complement(664127..665428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoN"
FT                   /locus_tag="HM1_1310"
FT                   /product="RNA polymerase sigma-54 factor"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1310"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83267"
FT                   /db_xref="GOA:B0TGK6"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGK6"
FT                   /protein_id="ABZ83267.1"
FT                   /translation="MQVGLGQQIEQSQRLVMTPELRQALAILQMNTLELSLFIGRELVQ
FT                   NPLLESPDPPREREMAERRESPFGREIQAEGPTLQEHLELQLGLALSDGLRRSVGRYII
FT                   GNIDDKGYLRSDPAEIAAATGVGEEIVGEVLATIQSFDPPGVGARDLAECLRIQLCRQG
FT                   KLTPHLERILEDHLPDVAAGRLHRIAQRLKVTVGEVQAMVDRLKELAPKPGTPFGREGD
FT                   NRPILPDVIIEQIDGEYLVLVNDGLLPRLTINRTYRHILNEEGAPGEAKAYVEERLHSA
FT                   LSLIRAIEQRRLTLHKVVSAIVERQRPFLEQGLAGLKPMTLRDVALKTGVHESTVSRSV
FT                   AGKYAQTPRGIFELKFFFGSGVRTATGEEKATAGAIKPLIRQLIDGEDKHHPLSDQQIA
FT                   ESLHEQGIPLSRRTVAKYREELGIPPTAQRRRYR"
FT   gene            complement(665472..665975)
FT                   /locus_tag="HM1_1309"
FT   CDS_pept        complement(665472..665975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_1309"
FT                   /product="acetyltransferase"
FT                   /note="may contain bacterial transferase hexapeptide (three
FT                   repeats)"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1309"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83268"
FT                   /db_xref="GOA:B0TGK7"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGK7"
FT                   /protein_id="ABZ83268.1"
FT                   /translation="MARRTVAYPVHGKNSLRHVYSHVPFWRVFRNVLIILLARYVPFLE
FT                   WKNRLYRLLGMRVGKDASVAFMVMMDILHPELITIGNDCVIGYNTTILAHEYLLREYRL
FT                   GEVRIGDGVVIGANSTILPGVSIGDYAIVAAGAVVTADVPPNTFVAGVPARVIRQPAYP
FT                   TLPE"
FT   gene            complement(665979..666938)
FT                   /locus_tag="HM1_1308"
FT   CDS_pept        complement(665979..666938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_1308"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1308"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83269"
FT                   /db_xref="GOA:B0TGK8"
FT                   /db_xref="InterPro:IPR003802"
FT                   /db_xref="InterPro:IPR004042"
FT                   /db_xref="InterPro:IPR018478"
FT                   /db_xref="InterPro:IPR023054"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039518"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TGK8"
FT                   /protein_id="ABZ83269.1"
FT                   /translation="MSFSVETKEELARIQPRRRCCQLAELAALFRMDGSLQISGEQGLS
FT                   LTVSTESASSARKIFRLIKAVFGVQTQILVRRKRRLKKSNVYVISLPARIGGRDVLQEM
FT                   GITDSQGGFSFEPPSELLKRQCCRRAYLRGAFLGGGSVNSPEGTYHLEIITNDETHARI
FT                   LSELLHRFGLTAKVSQRKGWFIVYLKESEQIVEMLSIIGAHSALLNFENVRIVKGMRNQ
FT                   VNRLVNCETANLNKTVDAALRQTEMIRFVQNRIGFANLPSQLREVAELRLQYPDASLKE
FT                   LGQMLNPPVGKSGVNHRLRRLESLAEAFSRQGGVPRED"
FT   gene            complement(666961..668334)
FT                   /locus_tag="HM1_1307"
FT   CDS_pept        complement(666961..668334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_1307"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1307"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83270"
FT                   /db_xref="GOA:B0TGK9"
FT                   /db_xref="InterPro:IPR002882"
FT                   /db_xref="InterPro:IPR010119"
FT                   /db_xref="InterPro:IPR038136"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGK9"
FT                   /protein_id="ABZ83270.1"
FT                   /translation="MKWLMWFYPGLKVKRWMALSFFGLILTGTSVSLFFDGEFFGYLEN
FT                   SLRQLSRAYDYRTMAGLGALIFLIGLFLHIYGFMAMVRSIFEVLAPEMDARLVEVLYRR
FT                   RSLERGPKIVVIGGGTGLSVLLRGLKEYTSNLTAIVTVSDDGGSSGRLRDELGMVAPGD
FT                   IRNCLVALADTESDMDRVLNYRFVQGDGLTGHNLGNLLLAGAAQTAGGFEKAVDLMSRI
FT                   LAIRGRVLPSTLHNVVLCAERLDGTHLRGETAITADGEGIRRVYLDPPNCEPLPQTLQA
FT                   IDEADAIILGPGSLFTSVIPNLLVDGIVQALRRTGAPKIYVCNVMTQPGETDGYTASRH
FT                   VAAIHRHCGGKLVDAIIVNTEPISKALLRKYEEKNQKPVIIDSKYLEKQGCKVIRARLI
FT                   NKENFVRHDPARLALAIMNVVFRAKERQRRVGIVDRLLYRRKLARSPLHRSWQNRVEG"
FT   gene            complement(668331..669236)
FT                   /locus_tag="HM1_1306"
FT   CDS_pept        complement(668331..669236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_1306"
FT                   /product="ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1306"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83271"
FT                   /db_xref="GOA:B0TGL0"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TGL0"
FT                   /protein_id="ABZ83271.1"
FT                   /translation="MEKGFDKSAIQMVIITGLSGAGKSQAIRALEDLGFFCVDNLPPNL
FT                   LPKFGELIVHSKGKINKIALVIDIRGGEFFDSLSDGLHQLGAQGIRCEILFLEASDEVL
FT                   IRRYKESRRRHPLSGDARIFDSIQLERQMLADLRGRADKVIDTSDLSARQLKNQVFELF
FT                   GKDARHSQLRITIVSFGYKYGTPRDADLLMDVRFLPNPFYEPALRNLTGNDEPVQEYVL
FT                   SSPTTKVFMRKYYSLLRFLLPHYTKEGKSHLVVGIGCTGGKHRSVTLANRLAAALVDED
FT                   YAITVKHRDIDKDRGGGESA"
FT   gene            complement(669361..670857)
FT                   /gene="malQ"
FT                   /locus_tag="HM1_1305"
FT   CDS_pept        complement(669361..670857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malQ"
FT                   /locus_tag="HM1_1305"
FT                   /product="4-alpha-glucanotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1305"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83272"
FT                   /db_xref="GOA:B0TGL1"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGL1"
FT                   /protein_id="ABZ83272.1"
FT                   /translation="MSTLFPRRSSGVLLHPTSLPGRHGSGTLGWEARRFVDFLEASGQS
FT                   LWQVLPLGPTGFGHSPYSALSAFAGNPLLISPELLLEEGLLEKDDLPPESPSSPQKADF
FT                   ERAEGESERFLRKAYERFLRLACDSTEFHRFCEAQRDWLEAYALYRALKGRFGEQSWLD
FT                   WPAEYARPEAEALARFRREQAKEIDFHRFVQYLFFRQWRQIRQYANRRGIRIIGDLPIY
FT                   VAMDSADTWGQRDIFQLDERFRPREVGGVPPDYFNENGQLWGNPVYDWERIEQTGYAWW
FT                   IRRLRHALSLVDIVRIDHFRGFASYYAIPYGEETAKKGRWRKGPGADLFTALEAALGDL
FT                   PIIVEDLGLITDEVIELREQFGFPGIKLLQFAFDSGDEHGNDFIPYRYRQHCVVYTGTH
FT                   DNDTTLGWFQSASPEDRKKALEYMNVDGSDIVWDFIRLGLASVADAFIVPMQDVLGLGT
FT                   EHRMNYPGSPEGNWLWRFQWDQLPESTVSKLAYLTKLYGR"
FT   gene            complement(670854..672383)
FT                   /locus_tag="HM1_1304"
FT   CDS_pept        complement(670854..672383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_1304"
FT                   /product="alpha amylase catalytic region, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1304"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83273"
FT                   /db_xref="GOA:B0TGL2"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGL2"
FT                   /protein_id="ABZ83273.1"
FT                   /translation="MGRPKWFTSAIIYQIYPRVYGMTDRRFGTLRDIQRDLPRIKSLGV
FT                   NTLYLLPIHPITQKYRKGLSGSPYAVRDYLAVAPELAEWEGKGCDGSRDSARGLRSEAA
FT                   LAEAARQQFRELVREAHGNGLRVLLDFVGNHCAPDNVLLDPANPPEKGGYHPEWFLWDD
FT                   DSRPLAPSPDWWDTADLNYGIPVEGKPNAHRLVYGHDENRRALWQFMAGVLEHWVREFD
FT                   IDGYRCDFAHWVPLDFWRETIPRVKAIKADVVFIAEAYERMAELLAAGFDGIYAFELYN
FT                   QLKSLHKDVRHNDPYYEVQYIRNKIEWENSRYLPGHRMVRYTENHDEPRTVVTYGGIER
FT                   AKPPVLLALTLPGVPMLYAGQENGASIRPPLFEGNFEATFSPIDFSANASLESWYRHVL
FT                   AIRSAKGFLHSDEIRFLPVSSRKVTAFLRREGEAMAIVIINFNAEPPGEWVEWELPPEV
FT                   LQACAAGGGELVDLLAEGPPIPIAPYPVQDRRVAVYLRPLQSLILEMREKG"
FT   gene            672444..672638
FT                   /locus_tag="HM1_1302"
FT   CDS_pept        672444..672638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_1302"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1302"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83274"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGL3"
FT                   /protein_id="ABZ83274.1"
FT                   /translation="MNRFRRRKRKILPTPWIDSAGEREKSFPLHGSIPPEKEKTGHFPQ
FT                   GLPCFPAIMCSKTSSSEVC"
FT   gene            complement(672601..672945)
FT                   /locus_tag="HM1_1303"
FT   CDS_pept        complement(672601..672945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_1303"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1303"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83275"
FT                   /db_xref="GOA:B0TGL4"
FT                   /db_xref="InterPro:IPR007165"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGL4"
FT                   /protein_id="ABZ83275.1"
FT                   /translation="MNSLILRWLFNTLALVLAALFIPGIKVAGIVPALFAALLLGVVNA
FT                   VIRPIILVLTLPINLLTLGTFTLVINGLMLWMVSGLVRGFEVSGFGAAFFGALLLSLFS
FT                   TLLSWKFSNT"
FT   gene            complement(673002..674909)
FT                   /gene="uvrC"
FT                   /locus_tag="HM1_1301"
FT   CDS_pept        complement(673002..674909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrC"
FT                   /locus_tag="HM1_1301"
FT                   /product="excinuclease abc, c subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1301"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83276"
FT                   /db_xref="GOA:B0TGL5"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGL5"
FT                   /protein_id="ABZ83276.1"
FT                   /translation="MHIALQEKLKSLPEKPGVYLYKDEAGQVIYVGKAINLKNRVRSYF
FT                   QSSRNLNAKTQALVARICDLETIVTDSELEALILECNLIKEHKPRYNIMLRDDKTYPYL
FT                   KVTLQETYPRLLITRRLEKDGAKYFGPYTSAGAVRETVELLRTLFPLRTCSRREPDRRQ
FT                   RPCLNHHIGRCLAPCAGRVPRREYMALIGSIVAFLEGKEEELRKRLQGEMEEAAENLEF
FT                   ERAATLRNRIRALDQVMEKQKVFSTDLADQDVIAMARGFNQVCVQIFFIRGGKLLGREH
FT                   YILEGTDEMDRSEVITAFVKQYYSRSDFVPREILLQEPLESAEEEELINRFLREKRQGR
FT                   VELRVPKRGDKLKLVEMVAKNALLTLEQLQNEQQRKKSMTEEAVLDLQRYLGLDEPPWR
FT                   IECFDISNTMGKESVASMVVFEGGAPKKSDYRRFRIKTVEGPNDFASMAEVLTRRFNRA
FT                   REEAREVDAGHLDPMSAKFATLPDLVIVDGGKGQLSSAREAMARTGYDNIATYGLAKEN
FT                   EWLFHESNPDPIILPRGSRALYLIQRIRDEAHRFAITYHRQLRTRAQTASALDGIAGIG
FT                   PKRRTALLRHFGSVKAIAAATVAQLAAVEGMTEALAEQVLSALKPLRENGQAGNAEKSV
FT                   "
FT   gene            675087..676430
FT                   /gene="pgi"
FT                   /locus_tag="HM1_1300"
FT   CDS_pept        675087..676430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgi"
FT                   /locus_tag="HM1_1300"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1300"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83277"
FT                   /db_xref="GOA:B0TGL6"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TGL6"
FT                   /protein_id="ABZ83277.1"
FT                   /translation="MSSLRLDLAYATVESAISTMEDPIRQAHDLLHNRTGAGSEFTGWL
FT                   QLPKTYDRAEFARIIDAADRIRASSDVLLVIGIGGSYLGARAAIDMLSHSFHNQLPRSR
FT                   RPGCAVLFAGHNISSAYLSDLFDILDGKDVSVNVISKSGTTTEPAIAFRLIRRWMEKKY
FT                   SPDEVRRRIFATTDRAKGALKRLADEQGYETFVVPDDVGGRFSVLTTVGLLPIAAAGID
FT                   ITALLAGARDAMAEYANPSLATNACYRYAAARNLLYRQGKQVELFVAYEPSLQHLAEWW
FT                   KQLYGESEGKEGKGIFPASVLFSTDLHSMGQYIQEGQRMLMETVVRFDKPRRELTIPPA
FT                   EDDSDGLNFLAGKTVDFVNQKAFAGTLLAHVDGQVPNMIISVPEQNAYHLGQLFYFFEK
FT                   ACGVSGYLLGVNPFDQPGVESYKRNMFALLGKPGFEKEKAALEARLPR"
FT   gene            676434..676736
FT                   /locus_tag="HM1_1299"
FT   CDS_pept        676434..676736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_1299"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1299"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83278"
FT                   /db_xref="InterPro:IPR003832"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGL7"
FT                   /protein_id="ABZ83278.1"
FT                   /translation="MQAVPIRATATAAIGAVVIFDAMAIGRSAGEHARTSNWLLVFSQI
FT                   RRGKKVPWQERPGHSPPEVSPAPSWGCSSLGPSADDGQPALFVKEISTKFRATAL"
FT   gene            676785..677063
FT                   /locus_tag="HM1_1298"
FT   CDS_pept        676785..677063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_1298"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1298"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83279"
FT                   /db_xref="GOA:B0TGL8"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGL8"
FT                   /protein_id="ABZ83279.1"
FT                   /translation="MDRLTEIFLALRSAFTEPLEEKIRFESLHVELTSAEFFYLAITAY
FT                   FIGGMVIGYLWAKSKYAPSRQTSSTDGAKPSYLDSGENPSDGNRIDE"
FT   gene            complement(677137..679971)
FT                   /gene="uvrA"
FT                   /locus_tag="HM1_1297"
FT   CDS_pept        complement(677137..679971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrA"
FT                   /locus_tag="HM1_1297"
FT                   /product="excinuclease abc, a subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1297"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83280"
FT                   /db_xref="GOA:B0TGL9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGL9"
FT                   /protein_id="ABZ83280.1"
FT                   /translation="MDQIRVRGARAHNLKNIDVDIPRDRLVVVTGLSGSGKSSLAFDTI
FT                   YAEGQRRYVESLSAYARQFLGQMDKPDVDYIEGLSPAISIDQKTTSKNPRSTVGTVTEI
FT                   YDYLRLLFARVGRPHCPKCGRPIRQQTVEQMVDQILAHPEGTRLQILAPLVRGKKGEHV
FT                   KVIEDIRKNGYVRMRVNGQVMDATEEVKLEKNKKHTIEIVVDRIILKADIATRLADSLE
FT                   TALNLSEGLAVVDFMGEKEFIFSQNFACADCGISVGEIEPRIFSFNAPYGACPHCTGLG
FT                   VQMEVDPDLVVPDPTKSIDEGAIVPWARMNSAYIPQMLKALAELHGFSTETPFKDLPPE
FT                   IQKLILYGGSKEKIRLQFTNYDGERRSFETTYEGVVTNLERRYKETQSDWSREEIEEYM
FT                   TQKPCPACKGARLKPESLAVLVGGKNIHEVTEMSVAAALRFFTDLDLSEREMIIARQIV
FT                   KEIRERLGFLVNVGLTYLTLARPAGSLSGGEAQRIRLATQIGSGLMGVLYILDEPSIGL
FT                   HQRDNERLLATLQRLRDLGNTLIVVEHDEDTMLAADHIIDIGPGAGAHGGQIIAEGPLS
FT                   VIMEEPRSLTGQYLSGRKFIPVPEKRREPNGKWIEVLGACENNLKEIDVSFPLGVFICV
FT                   TGVSGSGKSTLVNEILHKALASQLNGARSKPGAHRAIRGLEHLDKVIDIDQSPIGRTPR
FT                   SNPATYTGVFDAIRDLFSQTAESKMRGYRPGRFSFNVRGGRCEACKGDGIIKIEMHFLP
FT                   DVYVPCEVCKGKRYNRETLEVRYKGCSIADVLDMTVDESLAFFRNIPKVARKLQTLQDV
FT                   GLGYIRLGQPATTLSGGEAQRVKLATELSRRSNGKTFYILDEPTTGLHIADIDRLLGVL
FT                   QRLVDAGDTVLVIEHNLDVIKTADYIVDLGPEGGDGGGTVVAAGTPEEITQVAASHTGR
FT                   FLKKVLQRKPGSAL"
FT   gene            679936..680049
FT                   /locus_tag="HM1_1296"
FT   CDS_pept        679936..680049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_1296"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1296"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83281"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGM0"
FT                   /protein_id="ABZ83281.1"
FT                   /translation="MGAGPADPDLIHHSLPASPFGSVKKCDGGRRPALLLR"
FT   gene            680253..680582
FT                   /locus_tag="HM1_1295"
FT   CDS_pept        680253..680582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_1295"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1295"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83282"
FT                   /db_xref="InterPro:IPR024307"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGM1"
FT                   /protein_id="ABZ83282.1"
FT                   /translation="MRCKPKPPYDDGDCGFHTHDYHFESCLSEGHRHMLSGQTEPSVNK
FT                   RDHAHRYAGVTSFNDNHVHYYCGCTGPAIYRPGCGHYHCMEGTTTCDDGHVHRYEDKTC
FT                   NRSKL"
FT   gene            680579..680719
FT                   /locus_tag="HM1_1294"
FT   CDS_pept        680579..680719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_1294"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1294"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83283"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGM2"
FT                   /protein_id="ABZ83283.1"
FT                   /translation="MSFEPAKSPILSVEGSRWGSFFSVIAMLAGTRHSAEQGKRWYAAA
FT                   A"
FT   gene            complement(680739..683231)
FT                   /gene="uvrB"
FT                   /locus_tag="HM1_1293"
FT   CDS_pept        complement(680739..683231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrB"
FT                   /locus_tag="HM1_1293"
FT                   /product="excinuclease abc, b subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1293"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83284"
FT                   /db_xref="GOA:B0TGM3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGM3"
FT                   /protein_id="ABZ83284.1"
FT                   /translation="MEQRLFQLKSEFVPKGDQPQAIARLVEGIEKGMRYQTLLGATGTG
FT                   KTFTMASVIEKVQRPTLVLAHNKTLAAQLCAEFKEFFPDNAVEYFVSYYDYYQPEAYVP
FT                   QSDTYIEKDASINDEIDKLRHAATAALIERRDVIIVASVSCIYGLGSPEEYLDQMISLR
FT                   KGQIYDRDAVLRRLVDIQYSRNNINFTRGTFRVRGDVVEVFPASYSDRAVRLEFFGDEL
FT                   ERISEIDTLTGEVYGERYHISIFPNTHYVTNWDKLELSIANIEAELEERLAWFKEQGKL
FT                   VEAQRLAQRTRYDIEMLREMGFCTGIENYSRHLTFRPPGEPPYTLMHFFPKDFLLMVDE
FT                   SHVTIPQVGAMYQGDRSRKMTLIEHGFRLPSAADNRPLKFHEFEQMLNQVVFVSATPAD
FT                   YELQRSEQVVEQIIRPTGLIDPVIDVRPVKGQIDDLLGEIRERIKKDQRVLVTTLTKKM
FT                   AEDLTAYLRNVGVRVRWMHSDVDAIERMQIIRDLRLGEFDVLVGINLLREGLDLPEVGL
FT                   VAILDADKEGFLRSDRSLIQTIGRAARNVEGTVIMYGDRLTRSMQKAIDETNRRRAIQI
FT                   AYNEQQGITPQTVKKAVRNVIEMTISGGDRKEAAGAATTGGGVLARAAAFLKKRTGKKG
FT                   AESAVDAWTTQAAAPGEGAYGTGYAGDDGARVLREGGHGGGAGTYEVSSDRSADRVAEG
FT                   LPPEEGFEAAAPERVASSEAMAPEQLAALIADLEGEMRQAAKELDFERAALLRDVIIEL
FT                   KGAAPAKSKTGGGMASGAATGAAKAARGGRKPSANDGNGTARAKGRGRGKSQAPQDPGL
FT                   DFFPPSAGPSRPRGRKKG"
FT   gene            683223..683453
FT                   /locus_tag="HM1_1292"
FT   CDS_pept        683223..683453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_1292"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1292"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83285"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGM4"
FT                   /protein_id="ABZ83285.1"
FT                   /translation="MFHIATNLQFPKKQAPINLTIYYIRRKPSAPNLILSVINRFSDIF
FT                   VSKGRLGARVLQDLQNEKWNRIGKTAPDSRL"
FT   gene            683494..683796
FT                   /locus_tag="HM1_1291"
FT   CDS_pept        683494..683796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_1291"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1291"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83286"
FT                   /db_xref="GOA:B0TGM5"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGM5"
FT                   /protein_id="ABZ83286.1"
FT                   /translation="MSKNKPNSKASSQKETAATATAPATTTVKKYGPDNPNEELLKSPA
FT                   VKLVAIAFGTAVSYIVGRMVQGGGPQEVPLGLYAAGFFLSTSLFLFVRSLLKKKK"
FT   gene            684130..685530
FT                   /locus_tag="HM1_1290"
FT   CDS_pept        684130..685530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_1290"
FT                   /product="sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1290"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83287"
FT                   /db_xref="GOA:B0TGM6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGM6"
FT                   /protein_id="ABZ83287.1"
FT                   /translation="MTASLPLPVRLLLSLLAATAAILLAASYYNYQRSMEVKRVLLQNK
FT                   AAGIAQTIEALARKSPSRTPEELQSLIAAWPDDPDLFDLTVFDRNGMIIAHRDPARLGK
FT                   EDVASLFLVRQVLAEQQMSFRYLKGHTPSASSTGAASGIPESPNHTPPASPLFEAFLPL
FT                   HLGGFDGEGPRMAGDYQPRFKVLRVQLRESAAGDVSRAALWQLFLIGLVLLGTLTVTAY
FT                   LVQTLRRYFTLEAQAREQARMASLGQVATWVAHEVRNPLGAIKGLLQLIQETIEERDPD
FT                   GQSRRYCETAVRESERLERFVGDLLAYSRLPQPTITEWPLANLVQEITALLEPELARQD
FT                   AAIVTQIEPPGLIVRADREQMHRLLLNLIQNALAAMPSGGDIHLRALSSPTEEGLSIIV
FT                   EDEGIGLPPGAEHRLFEPFFTTREKGSGLGLAICRDIANRHGGTIRAEGAPGGGARFIV
FT                   NLPEKGEL"
FT   gene            685530..687080
FT                   /locus_tag="HM1_1289"
FT   CDS_pept        685530..687080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_1289"
FT                   /product="sigma-54 dependent response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1289"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83288"
FT                   /db_xref="GOA:B0TGM7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGM7"
FT                   /protein_id="ABZ83288.1"
FT                   /translation="MERPLRLLVADDEEAMRLFLSAALERAGHRVDAVEDGQSALEKIV
FT                   AAERSKAPYALALIDLQMPRLPGMDLLSHIRREWPRLPVIILTAHGSIPTAVEAMKLGA
FT                   ADFLVKPLPSPGHLRAAVSRVLAQSALNAAAGHNDADRDAVRSDTDPVGIAMTPLGPPT
FT                   APAASPSGKVSAQRESGRLSTPAGGVEALRRPNPELAVNDLIACDPATCAVLEQARLVA
FT                   ETDTTVLLLGESGVGKEVFAGVIHRLSKRSAGPFVAVNCAALPTSLIESELFGHERGAF
FT                   TGAHTMKIGRFEQATGGTLFLDEIGELEATVQAKLLRVLQEKRFERIGGTRSIAADCRI
FT                   IAATNRDLKAAVQERQFRSDLYYRLAVFPIEIPPLCRRPADILPLATHFLTRFAGKNGR
FT                   DLPQLTEAALAALQEHPWPGNVRELANAIERALILCAGGPIEPRHLGLAHREKARADQG
FT                   VKALADSTDDGILKQQERDTILRVLAANGNNRQKTAQQLGISVRTLRNKLKEYRIQTD"
FT   gene            687257..688105
FT                   /locus_tag="HM1_1288"
FT   CDS_pept        687257..688105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_1288"
FT                   /product="iron-sulfur binding protein"
FT                   /note="C-terminal frameshift induces homology to
FT                   gram-negative strains"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1288"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83289"
FT                   /db_xref="GOA:B0TGM8"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGM8"
FT                   /protein_id="ABZ83289.1"
FT                   /translation="MTRKSILHPSRRVTLVRWLSLLFFVGLTSYIGLRHQIVGGGPQGA
FT                   APLDTFCIFGGIETLWSYATTGKFLAKTNMANLVLLAAGMLLLLVTGAGFCGWICPLGA
FT                   IQEWLGGLGKKLFGKTFTVPPSVDRPLRALRYLFLALILYMTIADNKLWFEPYDPFKVL
FT                   FHFDFETTTSIVVLALFVAFSLPIERFWCRYLCPLSAVYSLVSPLSIFKLKRQPHACIG
FT                   CGVCTLNCPMGIDVQHCGTIPDGRCIKCLQCMESCPKPDALVLEAGKSRPATSIPPSLS
FT                   R"
FT   gene            688162..688479
FT                   /locus_tag="HM1_1287"
FT   CDS_pept        688162..688479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_1287"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1287"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83290"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGM9"
FT                   /protein_id="ABZ83290.1"
FT                   /translation="MRIKPLHYGLLVLALFWGVIGGAMASNLWVTKQSLPPVGTVTSTE
FT                   EIKGWMTLEQIGETLSLPTPEVIRRLGLPPESDPNKKLKDLAAEQGKTPDQLKEGLLDH
FT                   K"
FT   gene            688525..688806
FT                   /locus_tag="HM1_1286"
FT   CDS_pept        688525..688806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_1286"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1286"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83291"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGN0"
FT                   /protein_id="ABZ83291.1"
FT                   /translation="MTDRDVTEGFPSPSHPLRFVQPGREGASQALSPDEEGQNRQSRAA
FT                   AWSVDRFRSLSSDEEGQITRESGSEIQSWGDFALQRELHRSSDDDLLT"
FT   gene            complement(688891..689133)
FT                   /locus_tag="HM1_1285"
FT   CDS_pept        complement(688891..689133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_1285"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1285"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83292"
FT                   /db_xref="GOA:B0TGN1"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGN1"
FT                   /protein_id="ABZ83292.1"
FT                   /translation="MILRPVCYRTVSPHCGKPAQMRLNCGRVLRGRIQRVTPNGVWFYS
FT                   SNPGLFFYPFFAISVLALTLPFWAGFGYGYGRGYR"
FT   gene            689092..689271
FT                   /locus_tag="HM1_1284"
FT   CDS_pept        689092..689271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_1284"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1284"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83293"
FT                   /db_xref="GOA:B0TGN2"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGN2"
FT                   /protein_id="ABZ83293.1"
FT                   /translation="MGRDGAIAYWPQDHVALPPLVGNFWILYSMPIFTFAIPLLTGYQQ
FT                   SAAVKGALFRRSKK"
FT   gene            689357..690349
FT                   /locus_tag="HM1_1283"
FT   CDS_pept        689357..690349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_1283"
FT                   /product="sodium/bile acid symporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1283"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83294"
FT                   /db_xref="GOA:B0TGN3"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGN3"
FT                   /protein_id="ABZ83294.1"
FT                   /translation="MGKTALFWPSKNPVLSIPITLALGFTAGLFVDTSSLGNFILICTF
FT                   LMIYPTMIGVKLKEAFDFSHAKVVGISLIINFLLIPLLAWGLGTTFLSGDPSMMAGLAI
FT                   AGLLPTSGMTISWTMMFKGNVPAAIKMTALSLIIGSILAPFYLLIMVGKYVPIDLMKTF
FT                   TTIAVIVFLPLVLGHVTFLQLKKKYSQEHFQKVIKPYLPAVSFWAMLAIIFASISMKSK
FT                   MVLARPDLLGGILLALAVFYLINFTLSTVIARLFLNRADGVALIYGTVMRNLSIALGLA
FT                   ITAFGPQAALVVTLAFILQVQAAAWYGKMADRFGFFGKTPSDSLAVKQA"
FT   gene            complement(690485..690796)
FT                   /locus_tag="HM1_1282"
FT   CDS_pept        complement(690485..690796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_1282"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1282"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83295"
FT                   /db_xref="GOA:B0TGX0"
FT                   /db_xref="InterPro:IPR037208"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGX0"
FT                   /protein_id="ABZ83295.1"
FT                   /translation="MAVTLSLFQRYTIARQLMKRLAERYGHDDNRVLCQSVKVDKLVVA
FT                   LYRSKITKKVILYEKNSKTGAELPQKAVPNQQRAKRWKRQIRCKQACEEKQTLLVHCQ"
FT   gene            691042..691401
FT                   /locus_tag="HM1_1281"
FT   CDS_pept        691042..691401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_1281"
FT                   /product="helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1281"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83296"
FT                   /db_xref="GOA:B0TGX1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGX1"
FT                   /protein_id="ABZ83296.1"
FT                   /translation="MDSIGNRIKHLRKQRGLTQPQLAKLLNVSPQVISNWERGYTPTIA
FT                   PESIDKLASILETTSDFLLGRSTASISSSLEALEKSWPEGIKVLRRANEKLTPEKKRVI
FT                   LELIDTYVRTEGNHD"
FT   gene            complement(691412..691585)
FT                   /locus_tag="HM1_1280"
FT   CDS_pept        complement(691412..691585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_1280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1280"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83297"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGX2"
FT                   /protein_id="ABZ83297.1"
FT                   /translation="MGKLSLSFGVALYTIEKKRRLCLPNKQVSTGWLARVTALAAEFSK
FT                   MAQPVNQCFSRE"
FT   gene            691637..692143
FT                   /locus_tag="HM1_1279"
FT   CDS_pept        691637..692143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_1279"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1279"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83298"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGX3"
FT                   /protein_id="ABZ83298.1"
FT                   /translation="MIARHFRGSSALPLGFDPTCHALSQQARLFWDKRVDDGITFYHSH
FT                   SGSYTVILNPSLPRGRLHWTMAHELGHILLGHFTDYNTNRLTAHEEKILDREADEFTKE
FT                   FLMPAATVIGAVRRPLTVAKIGRVKNLFQVSWEATGNRLIELALIHPLELHRLYHHHQK
FT                   QLHRE"
FT   gene            692392..695061
FT                   /locus_tag="HM1_1278"
FT   CDS_pept        692392..695061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_1278"
FT                   /product="conserved hypothetical protein"
FT                   /note="Member of S-layer homology domain, PF00395"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1278"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83299"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGX4"
FT                   /protein_id="ABZ83299.1"
FT                   /translation="MSKNQEAKATKGGYSLRRRLISACVALSIVLSPTAGLAAVRQFGD
FT                   VSTVMPEYRPIMKLSAQGTIKGRGDGNFGPSDPVKQLEALVMVQRFFGMEATATAAASR
FT                   LTPDMEKKFGGNVPAWGKGYLVTAVNQNLLDANEYFPWHQGATRAWVARLLVRLLNKEQ
FT                   EAQSRMNAPLTFADATLIPASLRGHIAVATDLGLIRGRENGCFDPNSIVTRGEMAIFLD
FT                   RAERKMDRLPPGIDEATFISGRDAILSVLDEENRLSSLTLDANARIFGTERAVALSDLN
FT                   PQDKIRYIQDGDKVVYLEVVQGSGQKANVLRGEVIASLPEQGLLTLKDDAGKPFTYSLA
FT                   TSVSVIDLAGQMLSTSHVGPGSKAQLRLNNEGKIAEILLESVGQQGLYGTIVDINLTAK
FT                   LLILSDGANHYSSYYLADNTTVEYNGKRFASLEDLAKGDLVSVEVDGSYVVNKIILQKP
FT                   KSTVTVKGTVSLISRDSRLVTIKGDDGQLYAFELPETTALQFSDGTSAAIENLYLQDTV
FT                   TLQLENGTVKKLVIVRAGNTKGLTGKIASIDANRRLLIVKDARDRLQSYEINDPVILDI
FT                   EGNTKPTISNLGIDTSIEFELNADNKITYIKSKNTIEGVVTRVDADRHLITLRDAAGTE
FT                   KIYTVETNAECQIFRRSGEDLDDIDVDDRVKVRVSGDKINRIQVHTQLTGEIIDKTSER
FT                   IYIKDIDNNERSYTVNSTLKLIVPNIIKPSLSDVTIRQWAVVSYWGDEPYQIAVQTPVA
FT                   GEVTGVDTGRDKLVIRQYDGSSRTLEKASPFKVDKGGTTSYGLSAISIGDRIQAFTDEQ
FT                   NRIMRAFVASKVSGKIDGINRTTKDIYIGTTVGYHIDSNTIITLNGVRKNFDDIQQKQS
FT                   ATIYYTGGYNAIEVNLSN"
FT   gene            695246..699307
FT                   /locus_tag="HM1_1277"
FT   CDS_pept        695246..699307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_1277"
FT                   /product="dynamin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1277"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83300"
FT                   /db_xref="GOA:B0TGX5"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027094"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGX5"
FT                   /protein_id="ABZ83300.1"
FT                   /translation="MKLTTNPLPASAIIPMLIERLQTLADRFRQSRDEHAAYAAETLIG
FT                   KLRRRQLRIAFCGHVSGGKSALINALIGDDILPTSPIPSSANIVTVRSGPASARARLKS
FT                   GETVELDLFANLSGVQEHCLDGTDTHSVDIAIPIDLFGCAVDLVDTPGVDSAEAARRLA
FT                   EDPAIVAADVIFYVMDYNHVQSEINFSFTKRLKERGKPVFLIVNQIDKHCDFELDFDYF
FT                   RRSSAASFAAWDIQPEGIFFTSLSDPSHPENELPRLKARLRDLFRHEEELLVASVLPAT
FT                   RQLIDDHCRRLAEADREERQRLQALLDAAEDLEEALQSYGQVSRRIDELQRAPQRLKEE
FT                   LDREIRRVVENARITPHTTSELARRYLESRSSGFKVGFLFSSEKTKKEIATRLAAVYAD
FT                   FRQHVSTQLEWHLRDVLARVAERHGVTDGEYIQRANSLTVHWGADLLARLVREGAVVGN
FT                   EYVHNYTRDIAAEVKSLYRREALALAEEAVQLAKRAAARQIEQLTRQLEPLQPLVDAIK
FT                   TLDKMEQAERKSRNELLAALHRGLPEVVPMESLLSPPPETADSAAGGTGGTAAAVSGTA
FT                   PDPLAGLGQALREQSAPERAASGRSDFDLAADLLAAPALNAATGLSDGATPPILQHTAQ
FT                   RLRRCAAAVAPLPGFAHIAEELASRAERLEKNIFTVALFGAFSAGKSSVANALLGRPVL
FT                   PVSPNPTTAAINKILPPNEENPHGTVRVRLKTAADIESDVLHSLSACDVAASNMAEALR
FT                   RLHEISPGDIHPTAKPHYSFLRAVARGIGAVESRLGEEQIIDLDAFQDYVASEEKACFV
FT                   EWIELYYRCPLTARGVMLVDTPGADSINARHTGVAFDYIKKADAILFVTYFNSAFSHAD
FT                   RDFLFQLGRVKDSFGLDKMFFLINAADLARSAGELAEVQRHVAERITACGISKPRLYTV
FT                   SSQTALLARLGELGLLTASQKKTYRQRTNSLAAVRKAGTAREGIGGIGGGIGAGIEGGI
FT                   EGGIEGSIEGSIEGSIEGSIEGSIADSAGLLPWSAAFSLSGYDRFEADFYGFTLHELTQ
FT                   IAVSAAEGDIQRCLAGLDDMIEAARLDASARRRQRVACETSRLEAERAVSAVSVDADGD
FT                   LLDKEADELIYYVNQRIFYRFGDLYDRYFNPSVLQDSRGNITKQSMQHCLEELLQTLEK
FT                   ELAQEIRATSLRLEQFVHKRAGQYRNKLAQSIGAIDSRCALPAYEPVALPALEIPEQLS
FT                   LSRSEALRVLPNGFGNPKDFFEGSGRNRLRSQLEESLRTPVQNYLSDASVVVKAIYAPL
FT                   LAQRLEEARHRALQAVADHYAGLLAALDADFDLAAAEGIRADLAMHAGLGDESRFRQPA
FT                   TATAATSAWR"
FT   gene            complement(699412..700722)
FT                   /locus_tag="HM1_1276"
FT   CDS_pept        complement(699412..700722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_1276"
FT                   /product="conserved domain protein"
FT                   /note="Matches methyl-accepting chemotaxis protein (MCP)
FT                   signaling domain, PF00015"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1276"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83301"
FT                   /db_xref="GOA:B0TGX6"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR039379"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGX6"
FT                   /protein_id="ABZ83301.1"
FT                   /translation="MFWRKSADESEPRPYRGPKPTISLQDPSFQLSVRFIKLTPEQLEL
FT                   LQEIRPILEQNVDAAVEAFYGHLGAMAEMREFIDRTTTVDRLKKTMRNYILSLAPMKID
FT                   DNYVFERYKIGKAHDRIALPPYWFTSAYQLHYNFLIPKIMDAYKDKERAKQAVTALLTI
FT                   TNLDQQLAMSSYIESYTSGLSKKEELERILNDLTSLQQQVNDASQSLAATAEETAASAA
FT                   HMSTSVERITRNVTEAAKHSAEVVTLAKGGEGQLKEAVQAIRELSQLMLDMKQKIAALD
FT                   VSSEKISSIAEVIQGIASQTNLLALNAAIESARAGEQGRGFNVVAQEVKKLAGSSEQSV
FT                   KEIAEMIQQSRHHTADVSGSMEQNAKSMERVNELVDKVVQGFSQIIQSIALNQEQMRQI
FT                   SDEVVTLSTTAHEIENASESVAHSAEELAMMAQEIKQ"
FT   gene            701072..701701
FT                   /gene="rex"
FT                   /locus_tag="HM1_1275"
FT   CDS_pept        701072..701701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rex"
FT                   /locus_tag="HM1_1275"
FT                   /product="redox-sensing transcriptional repressor rex"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1275"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83302"
FT                   /db_xref="GOA:B0TGX7"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR009718"
FT                   /db_xref="InterPro:IPR022876"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGX7"
FT                   /protein_id="ABZ83302.1"
FT                   /translation="MKMLKIPEPTVVRLSLYSRFLNQASSKGIDIISSDEIGAAVGIPS
FT                   AQVRKDLSYFGEFGIRGVGYRVRELCSQVDKLLCVNQTWPVIIIGAGHLGLAMSGYRGL
FT                   QDRGFDVIALFDANPAKQGELPNGLSVLPMERLAETVREKDIRIGIITVPADAAQQVAE
FT                   ALIAAGITAIINFAPTVLNVPPEVKVRNIDLTVNLEVLSFNLGMRG"
FT   gene            complement(701757..703034)
FT                   /locus_tag="HM1_1274"
FT   CDS_pept        complement(701757..703034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_1274"
FT                   /product="conserved hypothetical protein, putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1274"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83303"
FT                   /db_xref="GOA:B0TGX8"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGX8"
FT                   /protein_id="ABZ83303.1"
FT                   /translation="MAPWDLIRLVLEAMEVLLLQPQEYPSFWVFLFIIALLYRRQSRLK
FT                   AELFQLEREGWWRPVLYSAVYGVIAGFFGSLLMLFFGITIVAAGFIYLLPVALLLALIN
FT                   VRYMCYAYAGGLISLAALFMGWREVSAAQIMGLVAILHLVEALLIYLSGHLSRLPVFIA
FT                   HRKGMTVGAFNLQSFWPIPLLVLTLLPVPVDSGLPWQEIATPDWWPLIAQPPFDYDAAK
FT                   EIAVLFPLPIVALLGYGDLAVTRLPAAHARRSAAHLALYSAILLALAVVASNVPALAAL
FT                   PALFGPLGHEALILWSRRREMKGVPIFTPSLRGLRVLDIGAGSPADRLGLRAGDVVGRI
FT                   NGMTVLSKRDMAIALSWSPSDVDVEYLPGGQGTVWKRGSVVKGWKEPLGLIAAPDPEEP
FT                   PLVKLETGGILARPLAWLLGLWRGRR"
FT   gene            complement(703178..704350)
FT                   /locus_tag="HM1_1273"
FT   CDS_pept        complement(703178..704350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_1273"
FT                   /product="carboxyl-terminal-processing protease"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1273"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83304"
FT                   /db_xref="GOA:B0TGX9"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGX9"
FT                   /protein_id="ABZ83304.1"
FT                   /translation="MAGRRSGPILFIVLVLLSSLLLTGSLAMAALGDAQNVGNLIKVVR
FT                   LVTTEYLEPVSVNDLVNGAMKGMVAALKDPYSVYMEPKEYKHLTEQIEGAFTGIGVYIN
FT                   KKDTNQMVVVSPIKGGPAERAGLKSGDVIVKVNGEDVADMDVDVAVSKIKGPEGTEVNL
FT                   TVFREASKSLLEFKINREKVNIPVVTAEIAKKDSHVGVLRISQFNMTASSEVDRAIQDF
FT                   KDKKVKGIIMDLRDNPGGELRAAVNIASHFVPKGRVVSVVDREGRSENYETTREYINIP
FT                   VVVLINGGSASASEIVAGAIKDSGTGALVGTKTFGKGVVQSLIELSGGAGVKLTTAKYL
FT                   TPKGNDIHKIGIEPDVKVEAEKANGASAHGGEEADVQFDKGLETLRTMMR"
FT   gene            complement(704424..705599)
FT                   /locus_tag="HM1_1272"
FT   CDS_pept        complement(704424..705599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_1272"
FT                   /product="peptidase m23, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1272"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83305"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGY0"
FT                   /protein_id="ABZ83305.1"
FT                   /translation="MRQRLLIRGLSAGLATALLLGIATPGVRLFPLNAAVADELQSKQQ
FT                   ELDEVRSMIEKTRRELKEKERQHQGVLGKLAAVKSEMNRTEVALYDLNRKVKDVEGRIG
FT                   TAEREIADAQKRQASQTEALKTRLKDMYINGSVSYLDVILQASSFTDFLTRMDLMEKIV
FT                   ESDARLIAKIEAEEKRIAERKAELERRRAELAQLREQTAAQKVLLAQQAQETQQVLAQV
FT                   VNEKESIERMLDEEEAASRQLEAVIRSLQMKQNRPKMGSGPMAHPVPNNTAVSSPYGNR
FT                   IHPVLKKARFHTGVDFPAPTGTPIHAAQTGVVAMAGYYGAYGNTVIIDHGGGTATLYGH
FT                   MSVINVSDGQTVQKGDIIGQVGSTGWSTGPHLHFEVRVNGNHTNPMPYIGG"
FT   gene            complement(705641..706522)
FT                   /gene="ftsX"
FT                   /locus_tag="HM1_1271"
FT   CDS_pept        complement(705641..706522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsX"
FT                   /locus_tag="HM1_1271"
FT                   /product="cell division protein ftsx, putative"
FT                   /note="Also a member of the putative permease domain,
FT                   PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1271"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83306"
FT                   /db_xref="GOA:B0TGY1"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGY1"
FT                   /protein_id="ABZ83306.1"
FT                   /translation="MKVQTFGYFFREAFRSMWQNGWMSVASISTVAISLLILGISLLLV
FT                   MNSHYAAAAIESDLEIVLSLKNDIDAKQTQAVADRLRGNSRVAEVIFVSKQEAMSAMRK
FT                   QVRPELLRALGEDNPFPDQFRVKAKDPNDVASLADEFGKIPGVELVKYGQGVVERLLRL
FT                   TQWVRIVGLSVMGLIGLAAVFLISTTIRLTVFARRREINIMKFVGATNWFIRWPFLLEG
FT                   TFLGLIGSLLAIVLVYALYTPVAEYVRTSLPFVPLRADSGFLLTISQILLASGVFIGAL
FT                   GSSISLRKFLKV"
FT   gene            complement(706519..707217)
FT                   /locus_tag="HM1_1270"
FT   CDS_pept        complement(706519..707217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_1270"
FT                   /product="cell division ATP-binding protein"
FT                   /note="Member of ABC transporter PFAM, PF00005, and
FT                   predicted ATPase involved in cell division COG, COG2884"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1270"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83307"
FT                   /db_xref="GOA:B0TGY2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGY2"
FT                   /protein_id="ABZ83307.1"
FT                   /translation="MIQMFNVSKTYANGVQALVDVNVRIQKGSFVFLVGPSGAGKSTFI
FT                   KLIFREEVPTRGQILFDGRSLVRMRESEVPYLRRQIGVVFQDFRLLPNKSVYDNVAFAM
FT                   EIVEASSKRIRQRVPQVLEMVGLGKKSDLLPNQLSGGEQQRVSIARAIVNDPMLIIADE
FT                   PTGNLDPETAQEIMNLLLEINRRGTTIIMATHAKDIVDSMRKRVIAIEGGRIVRDEERG
FT                   SYEQERGLPR"
FT   gene            complement(707323..708264)
FT                   /gene="tktC"
FT                   /locus_tag="HM1_1269"
FT   CDS_pept        complement(707323..708264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tktC"
FT                   /locus_tag="HM1_1269"
FT                   /product="transketolase, c-terminal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1269"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83308"
FT                   /db_xref="GOA:B0TGY3"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGY3"
FT                   /protein_id="ABZ83308.1"
FT                   /translation="MKKIATRDAYGRALARLGGEKADLVVLDADLAKSTKTIDFAKVYP
FT                   ERFFDMGIAEQNLMGTAAGLAAVGKIPFASTFAMFATGRAFEQIRNSIAYPKLNVKIAA
FT                   THAGITVGEDGASHQTVEDIALMRVLPNMTVIVPADGPETEGAIRWAAEHEGPVYIRLG
FT                   RLGVPVINDEESYRFTPGKAVTLRQGRDVSLIATGLMVSIALEAAAALAAEAIEAEVLN
FT                   IHTIKPIDAESILDSAVRTGCVVTAEEHSVIGGLGSAVAEVLGEGQPVPLERVGLKDTF
FT                   GESGKPDLLLKKYGLTAEAVADAARRAMARKG"
FT   gene            complement(708278..709096)
FT                   /gene="tktN"
FT                   /locus_tag="HM1_1268"
FT   CDS_pept        complement(708278..709096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tktN"
FT                   /locus_tag="HM1_1268"
FT                   /product="transketolase, n terminal half"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1268"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83309"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGY4"
FT                   /protein_id="ABZ83309.1"
FT                   /translation="MSEAIIQRLEATARQIRRHIIAMTHAAGSGHPGGSLSAADMVTAL
FT                   FFKEMRIDPQNPRWPDRDRFVLGKGHAAPVLYAALAERGFFPAEELKGLRQTGHFLQGH
FT                   PDMKKVPGVDMSTGSLGQGLSAAVGMALGLRLDKKDARVWALLGDGELQEGQVWEAAMA
FT                   AAHYKLDKLAIFIDDNGLQIDGPVKEVMSSYPIVDKFRAFGWNVIEIDGHAMPAILEAI
FT                   ERAKAATGRPTCIVAHTVKGKGVSFMEDQVGWHGTAPNAEEAAIALKELQ"
FT   gene            complement(709326..710327)
FT                   /gene="prfB"
FT                   /locus_tag="HM1_1267"
FT   CDS_pept        complement(709326..710327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfB"
FT                   /locus_tag="HM1_1267"
FT                   /product="peptide chain release factor 2"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1267"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83310"
FT                   /db_xref="GOA:B0TGY5"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGY5"
FT                   /protein_id="ABZ83310.1"
FT                   /translation="MIQEPGFWDDTERAQKTMQELTGLKDKVKAYRDLRSQWEDLCVLR
FT                   ELGAEENDAEILAEIEAGIQTITAELDRWHLELLLNGPYDRNNALLTLHAGAGGTEAMD
FT                   WNEMLLRMYIRWGEKRGYKVELLDSLPGDEAGIKSATLSVVGENAYGYLKGEMGVHRLV
FT                   RISPFDSSGRRHTSFASLEVLPEVSDGAEIQIRPEDLKVDTFRAGGAGGQHVNKTESAV
FT                   RITHIPTGIVVACQSERSQIQNRATAMRMLQAKLFERQRQEQEAEVNRLKGDQQDIAFG
FT                   SQIRSYVFHPYNLVKDHRTNTEVGNVHAVMDGELDEFISAYLVWSTKQDNRL"
FT   gene            complement(710562..713093)
FT                   /gene="secA"
FT                   /locus_tag="HM1_1266"
FT   CDS_pept        complement(710562..713093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="HM1_1266"
FT                   /product="preprotein translocase, seca subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1266"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83311"
FT                   /db_xref="GOA:B0TGY6"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TGY6"
FT                   /protein_id="ABZ83311.1"
FT                   /translation="MFGFLKNLLDDNARDIRRLQKTVDRINSMEPEWQRLSDADLQHKT
FT                   VEFRQRLENGESLDDLLPEAFATVREASRRVLGMRHFDVQLIGGMVLHQGRIAEMRTGE
FT                   GKTLVATLPSYLNALTGRGVHVVTVNDYLAKRDAEWMGRIHRFLGLQVGLIIHGLDFAE
FT                   RREAYAADITYGTNNEFGFDYLRDNMVIQPQHMVQRELHYAIVDEVDSILIDEARTPLI
FT                   ISGQANKPTEKYYAVARIIPRLTKDVDYKVDEKAHSVVLTEEGVSRVEKMLGIDNLADS
FT                   LDWAHHVNQGLKAHALMRRDRDYVVKDGEVIIVDEFTGRLMFGRRYSEGLHQAIEAKEG
FT                   LEIQNESQTLATITLQNYFRMYDKLSGMTGTAKTEEPEFMQIYKMDVVQIPTNKPMQRK
FT                   DLPDVVYRTEEGKFNAVVEEIVQSFRRGQPVLVGTVSIEKSEQLSDKLKRRGVPHQVLN
FT                   AKHHEKEAEIVKNAGQRGMVTIATNMAGRGTDIILGEGVAELGGLYVIGTERHEARRID
FT                   NQLRGRSGRQGDPGQTRFYVSLEDDLMRLFGAENIQGVMDRLGMDDSMPIESGMITRAI
FT                   ENAQRRVEARNFDIRKHVLQYDDVMNQQREVIYDQRKKVLNGENLRDTVFDFIDTLVEN
FT                   MVNRFAGEEKYVENWDLPAMLAYAEETFQIAVTAEDLHEMEKEEVIAFFQEKAQERYSQ
FT                   REQELGLETIRELERIILLRVVDSHWMDHLDAMDHLRHGIGLRAYGQKDPLVEYKYEAY
FT                   SMFQEMIASVQEEFLRYMFRVNVVVAQAEEEKQEAEAEAEAETVLKNAVENRSDDSLPK
FT                   QPVKAEPRVGRNDPCPCGSGKKYKKCCGVKG"
FT   gene            complement(713335..713859)
FT                   /locus_tag="HM1_1265"
FT   CDS_pept        complement(713335..713859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_1265"
FT                   /product="sigma 54 modulation protein/ribosomal protein
FT                   s30ae"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1265"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83312"
FT                   /db_xref="GOA:B0TGY7"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGY7"
FT                   /protein_id="ABZ83312.1"
FT                   /translation="MNIQVRGKNIEVTNALKEYVVKRLSKLEKYFHNIGGARTTLAVEG
FT                   DMAKVEVTVPAGDLLLRAEESHPDMYAAIDLVFEKLEKQVDAYKTKLSRRLKGQGFKEF
FT                   AAAEKNGATEPRVVRSKRFALKPMPVDEAIMQMNLIGHSFFVFSNAETEQVNVVYLRKD
FT                   GNYGLIEPEFD"
FT   gene            complement(713981..715924)
FT                   /locus_tag="HM1_1264"
FT   CDS_pept        complement(713981..715924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_1264"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1264"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83313"
FT                   /db_xref="InterPro:IPR002826"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGY8"
FT                   /protein_id="ABZ83313.1"
FT                   /translation="MQRRLPPYVQYLSDEIFAGNIQALATVQPPLAERMARYKPPYNQP
FT                   FQVEPAQSGDLTLLVDTGRERLFLLSPVDPCKQAREWVAEVAGAPSSLLVVFGFGLGYT
FT                   IEVLRQIIPSQGKMVVFERSIDLFWLALWTVDLRHVLADSRIRFAIDVDAASVGPIMHR
FT                   LNLSASDALTAQLYEFHYLTALFDGYYDQVKGALQEYFQTQQIAVATENYFSLTWTLNF
FT                   LQNLPAVLSACPVQHLYGRFPALPAVVIAAGPSLEKNLEGLREFARYGLLIATAPTLRV
FT                   LQQRGIRPHLLLSIDGGAPNYSHFQGLAVDDVPLVFDATLYPPILKAYGGGGKRFALLA
FT                   YDKAELYGILDGAVDVAAASVNVGASVANLGLVLAYRSGCDPIVFVGQDLAFTGNHSHI
FT                   SGSAFDSAVDEAGMSRYIEMDDIYGQKTYTQETWLAFREWFRWFIKGHPDRRYINATEG
FT                   GIGIPGTEVATLAAVIGQLRETKASQGRNASDQAIAAAFLQGVQAASQGAAQRDAQIVK
FT                   KLKNLHGHLRRILEGCEKGQELIAKYQRFVTSRVDIDKPFAQYYRKLDKIRRQIEGDHE
FT                   AMGFLRLAFRPIVNQLEQSAILADVTDKREALAHDLMRGQLFFIEVGRRSGAILAQVER
FT                   TMAVLQSPDRGS"
FT   gene            complement(715945..716682)
FT                   /locus_tag="HM1_1263"
FT   CDS_pept        complement(715945..716682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_1263"
FT                   /product="glutamine abc transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1263"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83314"
FT                   /db_xref="GOA:B0TGY9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGY9"
FT                   /protein_id="ABZ83314.1"
FT                   /translation="MLMAAMIEIKGLHKKFGALHVLRGVDMKVQEREVVCIIGPSGSGK
FT                   STLLRCINHLEEPTEGYITVDEILLTHKETDINRVRAEVGMVFQRFNLFPHMTVLQNIT
FT                   LAPVQVRKMAKGEAESLARELLAKVGLSEKEQAYPEQLSGGQQQRVAIARALAMRPKIM
FT                   LFDEPTSALDPEMVGEVLNVMKDLAREGMTMVVVTHEMGFAREVGDRVIFMDEGVIVEE
FT                   GTPEQLFGQAQQERTRAFLSKVL"
FT   gene            complement(716766..717431)
FT                   /locus_tag="HM1_1262"
FT   CDS_pept        complement(716766..717431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_1262"
FT                   /product="glutamine abc transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1262"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83315"
FT                   /db_xref="GOA:B0TGZ0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGZ0"
FT                   /protein_id="ABZ83315.1"
FT                   /translation="MDFKWKIVQDYADLFLMGGWTTVKVTAISVMIGTVIGLFIALARL
FT                   SHWRLLRWVAAIYTDVIRGTPLLVQIFIVHLGAPKLIGQSLPAMTSGLIALSVNSGAYV
FT                   AEIFRAGIQSIDKGQMEASRSLGMSYGQAMRFVILPQAFRRVIPPLGNEFIAMLKDSSL
FT                   VSVISLPELTMAGRTVLGSTARVWEAWLPVAAIYLTLTLLFSRLVAWYEQKLSVKSHR"
FT   gene            complement(717623..718426)
FT                   /locus_tag="HM1_1261"
FT   CDS_pept        complement(717623..718426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_1261"
FT                   /product="glutamine abc transporter, glutamine-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1261"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83316"
FT                   /db_xref="GOA:B0TGZ1"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGZ1"
FT                   /protein_id="ABZ83316.1"
FT                   /translation="MKKWVKTGLMGMLALGMLITAAGCGGGEKAAQAPTGDKSSAKKTI
FT                   KVATDAAYAPFEWKDEKGEIVGFDIDLIKAVGKELNADIELIDTPFDGIIAALTNKNVD
FT                   MLISAMTITEKRKESIDFSKPYFVAVQAIAVKEGSPVKKFDDIKGLKVGVQNSTTGQYV
FT                   VEKLLGEKSDKIFRYDTTPMAMNMLSNGDVDVVVADKPVVQHFLKNNPNAKMTLIDDAS
FT                   FEKEEYGIAVRKGETELLKQVNDALDKLEKSGKIKEISEKYLTGK"
FT   gene            complement(718599..719714)
FT                   /gene="spsG"
FT                   /locus_tag="HM1_1260"
FT   CDS_pept        complement(718599..719714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spsG"
FT                   /locus_tag="HM1_1260"
FT                   /product="spore coat polysaccharide biosynthesis protein
FT                   spsg/glycosyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1260"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83317"
FT                   /db_xref="GOA:B0TGZ2"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGZ2"
FT                   /protein_id="ABZ83317.1"
FT                   /translation="MPVAFYFDAGPGVGLGHAMRSAALAEAFAERGYRVLAVGRRDGAV
FT                   EALTKGLFLWRQPQGTGSLDAAPESWAAWLLAQGASILVVDSYRILPQTLGALRSAGLF
FT                   VVYLDDKNSFPMDCQLVINAGLAASGERYRFLRPGRALLGPAYTPLRRAVTAVGLLREQ
FT                   KRRRGAIGQIVVTLGGGDPLGHLPRTLQALEQVAATGRLFEAHVIIGPYMDFPAAYGRV
FT                   AWFRPYRPPADMATLLPTADLAVTAAGVTLQELLAAGVPAAVVIQADNQVPAALTVCRR
FT                   QAAVPLFAVDRLDDRADTTGGNAGRTLLPAPLPVDEVARQLAALLDDPDRAQAAAERGR
FT                   RLVDGQGARRCCDEILRDACAQVACGGSASD"
FT   gene            complement(719884..721104)
FT                   /locus_tag="HM1_1258"
FT   CDS_pept        complement(719884..721104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_1258"
FT                   /product="conserved hypothetical protein"
FT                   /note="Member of the DegT/DnrJ/EryC1/StrS aminotransferase
FT                   PFAM, PF01041, and also Predicted pyridoxal
FT                   phosphate-dependent enzyme apparently involved in
FT                   regulation of cell wall biogenesis COG, COG0399"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1258"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83318"
FT                   /db_xref="GOA:B0TGZ3"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020026"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGZ3"
FT                   /protein_id="ABZ83318.1"
FT                   /translation="MSNGKDVDGPIPYARQWIDDDDVAAVAAVLRGDYLTTGPVVDAFE
FT                   SRLAQQVQAPYGVAFSSGTAALHGAYAAAGIGPGDEVIVPANTFAATANAALYLGAKPV
FT                   FADVELDTGNLNGNRLESCISRRTKAIVAVHFAGLPASMETIHQVAARWGLIVIEDGAH
FT                   ALGAEYRGKPVGALSPLTCFSFHPVKHIATGEGGMVVTADQELARRLRRFRSHGITRLR
FT                   DELGSDDGGWYYEMQELGYNYRLTDIQAALGMSQLAKLDRFLRRRRELAARYDEALADL
FT                   KGQIRLPGRRADCLSAWHLYVIGLRDDGDGFRRKQLFDHLRARGILVNVHYLPVYRHPY
FT                   YQRLGYRAGSLSRGGAALSPGPFAAPLLWPDRWAAGAGDRCPAGRDRKDLPLSWSAALR
FT                   EGGANWR"
FT   gene            complement(721101..721880)
FT                   /gene="spsF"
FT                   /locus_tag="HM1_1257"
FT   CDS_pept        complement(721101..721880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spsF"
FT                   /locus_tag="HM1_1257"
FT                   /product="spore coat polysaccharide biosynthesis protein f,
FT                   putative"
FT                   /note="Member of cytidylyltransferase domain, PF02348"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1257"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83319"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGZ4"
FT                   /protein_id="ABZ83319.1"
FT                   /translation="MSTAIIVQARMGSTRLPGKVLAPLAGQPALWHTLERLKRVREAQV
FT                   LAVATGDGTADDPIADAARQWGVFVFRGSETDVLARYVGCAQKVDAAVIVRITADCPLI
FT                   DPDVVGAAIGEFRNRSLDYLSVEGGPRGLDTEVFTREALERAHRQGRYPAAREHVTFHL
FT                   YHSGLFRTGSWQLPGPYRRSRYRLCVDEPLDYQLLAEIYERFYRPGRIIAVPEVLAWLD
FT                   EHPQWALLNQSVRQKAVSDEELLPQGEDDRWEAQHLR"
FT   gene            complement(721940..722068)
FT                   /locus_tag="HM1_1256"
FT   CDS_pept        complement(721940..722068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_1256"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1256"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83320"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGZ5"
FT                   /protein_id="ABZ83320.1"
FT                   /translation="MLRKRHPTRLRFAPAKKSPKKPGAPDRTLLEVMSAKDLAVGA"
FT   gene            722568..726623
FT                   /locus_tag="HM1_1255"
FT   CDS_pept        722568..726623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HM1_1255"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HM1_1255"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ83321"
FT                   /db_xref="UniProtKB/TrEMBL:B0TGZ6"
FT                   /protein_id="ABZ83321.1"
FT                   /translation="MEQPLELRQGDVYTGTIKKITASQEGIVQIRGQEQQVRFEGALPK
FT                   SDRFTLQVTAVDGDVARIKVIEDLPSGAAATRHSEGNIGRLLRTFGVSPSEELSQAARQ
FT                   IIERGRPLTQETVQELNAFFEKTPGPAADKIDTVQALLRKNLEITAPQLKAVHEALHGR
FT                   PIGQVLTDLVKQLDPTWQLPATVRQEPDLAKAIRQLQSTVAANRDIATDLASKVQQQLD
FT                   SARQLQQQGYESLARENLARSLEQLARQLPDRTAAPAAATDHAQTLQTQPMQPPQGAPT
FT                   PAAFAAAFAAPTTQPQPAPPAQQPPTTPAALPSAIVPPTTTPTAATTAATTAATAAATA
FT                   TATTAATAATTTAATTATAANTAAATTATTTAATTAATAIATTATTTAAATATAATTAA
FT                   ATTAATTATTTAATATEQIAQVLSRLSPHSPINEVIETVQELSRQWAADDKIPRPAITT
FT                   LERSLSEARIYAAMGRQSDSLERLQQALSATAKAIAPTVPATTTPPTTATPTTSTNPTT
FT                   TTTPTTPPASAQVGATRPSLPQGILTDAAATVRQEPDLAKAIRQLQSTVAANRDIATDL
FT                   ASKVQQQLDSARHLQQQGYESLARENLARSLEQLARQLPDRTAAPAAATGQAQTLQTQP
FT                   MQPPQGAPTPAASTAAFAAPTTQPQPAPPAQQPPTTPAALPSAIVPPTTTPTAATTAAT
FT                   TATTATTTAAATATAAATTATTTAATTATTAAATAATTTAATTATTTAAATATAAATTA
FT                   TTTAATTATTAAATATEQIAQILSNLSPHSPINEVISATQTLSRQLSTGTPKEGALASS
FT                   LNRALSEAQILATIGQEQKGKERLSQGLTQTLHALLRLAPTPSPSSAAPSPMTDKATTL
FT                   PTPPTAGTFDPPEAPLPPAPLTEENDSTAIVNKAYKDALAMGGIALPAKNYMITEITRQ
FT                   LNQAAQDFRDLKREVTRNIDNIRQIVQNHRNNVLPMVKPLLESTIDLLDNAIL