(data stored in ACNUC7421 zone)

EMBL: CP000931

ID   CP000931; SV 1; circular; genomic DNA; STD; PRO; 5226917 BP.
XX
AC   CP000931;
XX
PR   Project:PRJNA20241;
XX
DT   13-FEB-2008 (Rel. 94, Created)
DT   11-SEP-2019 (Rel. 142, Last updated, Version 6)
XX
DE   Shewanella halifaxensis HAW-EB4 chromosome, complete genome.
XX
KW   .
XX
OS   Shewanella halifaxensis HAW-EB4
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Alteromonadales;
OC   Shewanellaceae; Shewanella.
XX
RN   [1]
RP   1-5226917
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Sims D., Brettin T., Detter J.C., Han C.,
RA   Kuske C.R., Schmutz J., Larimer F., Land M., Hauser L., Kyrpides N.,
RA   Kim E., Zhao J.-S., Richardson P.;
RT   "Complete sequence of Shewanella halifaxensis HAW-EB4";
RL   Unpublished.
XX
RN   [2]
RP   1-5226917
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Sims D., Brettin T., Detter J.C., Han C.,
RA   Kuske C.R., Schmutz J., Larimer F., Land M., Hauser L., Kyrpides N.,
RA   Kim E., Zhao J.-S., Richardson P.;
RT   ;
RL   Submitted (25-JAN-2008) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 3bfb4226cb196a63f9510e9b45acc5b0.
DR   BioSample; SAMN02598431.
DR   EnsemblGenomes-Gn; EBG00001248674.
DR   EnsemblGenomes-Gn; EBG00001248675.
DR   EnsemblGenomes-Gn; EBG00001248676.
DR   EnsemblGenomes-Gn; EBG00001248677.
DR   EnsemblGenomes-Gn; EBG00001248678.
DR   EnsemblGenomes-Gn; EBG00001248679.
DR   EnsemblGenomes-Gn; EBG00001248681.
DR   EnsemblGenomes-Gn; EBG00001248682.
DR   EnsemblGenomes-Gn; EBG00001248683.
DR   EnsemblGenomes-Gn; EBG00001248684.
DR   EnsemblGenomes-Gn; EBG00001248685.
DR   EnsemblGenomes-Gn; EBG00001248686.
DR   EnsemblGenomes-Gn; EBG00001248687.
DR   EnsemblGenomes-Gn; EBG00001248688.
DR   EnsemblGenomes-Gn; EBG00001248689.
DR   EnsemblGenomes-Gn; EBG00001248690.
DR   EnsemblGenomes-Gn; EBG00001248691.
DR   EnsemblGenomes-Gn; EBG00001248692.
DR   EnsemblGenomes-Gn; EBG00001248693.
DR   EnsemblGenomes-Gn; EBG00001248694.
DR   EnsemblGenomes-Gn; EBG00001248695.
DR   EnsemblGenomes-Gn; EBG00001248696.
DR   EnsemblGenomes-Gn; EBG00001248697.
DR   EnsemblGenomes-Gn; EBG00001248698.
DR   EnsemblGenomes-Gn; EBG00001248699.
DR   EnsemblGenomes-Gn; EBG00001248700.
DR   EnsemblGenomes-Gn; EBG00001248701.
DR   EnsemblGenomes-Gn; EBG00001248702.
DR   EnsemblGenomes-Gn; EBG00001248703.
DR   EnsemblGenomes-Gn; EBG00001248704.
DR   EnsemblGenomes-Gn; EBG00001248705.
DR   EnsemblGenomes-Gn; EBG00001248706.
DR   EnsemblGenomes-Gn; EBG00001248707.
DR   EnsemblGenomes-Gn; EBG00001248708.
DR   EnsemblGenomes-Gn; EBG00001248709.
DR   EnsemblGenomes-Gn; EBG00001248710.
DR   EnsemblGenomes-Gn; EBG00001248711.
DR   EnsemblGenomes-Gn; EBG00001248712.
DR   EnsemblGenomes-Gn; EBG00001248713.
DR   EnsemblGenomes-Gn; EBG00001248714.
DR   EnsemblGenomes-Gn; EBG00001248715.
DR   EnsemblGenomes-Gn; EBG00001248716.
DR   EnsemblGenomes-Gn; EBG00001248717.
DR   EnsemblGenomes-Gn; EBG00001248718.
DR   EnsemblGenomes-Gn; EBG00001248719.
DR   EnsemblGenomes-Gn; EBG00001248720.
DR   EnsemblGenomes-Gn; EBG00001248721.
DR   EnsemblGenomes-Gn; EBG00001248722.
DR   EnsemblGenomes-Gn; EBG00001248723.
DR   EnsemblGenomes-Gn; EBG00001248724.
DR   EnsemblGenomes-Gn; EBG00001248725.
DR   EnsemblGenomes-Gn; EBG00001248726.
DR   EnsemblGenomes-Gn; EBG00001248727.
DR   EnsemblGenomes-Gn; EBG00001248728.
DR   EnsemblGenomes-Gn; EBG00001248729.
DR   EnsemblGenomes-Gn; EBG00001248730.
DR   EnsemblGenomes-Gn; EBG00001248731.
DR   EnsemblGenomes-Gn; EBG00001248732.
DR   EnsemblGenomes-Gn; EBG00001248733.
DR   EnsemblGenomes-Gn; EBG00001248734.
DR   EnsemblGenomes-Gn; EBG00001248735.
DR   EnsemblGenomes-Gn; EBG00001248736.
DR   EnsemblGenomes-Gn; EBG00001248737.
DR   EnsemblGenomes-Gn; EBG00001248738.
DR   EnsemblGenomes-Gn; EBG00001248739.
DR   EnsemblGenomes-Gn; EBG00001248740.
DR   EnsemblGenomes-Gn; EBG00001248741.
DR   EnsemblGenomes-Gn; EBG00001248742.
DR   EnsemblGenomes-Gn; EBG00001248743.
DR   EnsemblGenomes-Gn; EBG00001248744.
DR   EnsemblGenomes-Gn; EBG00001248745.
DR   EnsemblGenomes-Gn; EBG00001248746.
DR   EnsemblGenomes-Gn; EBG00001248747.
DR   EnsemblGenomes-Gn; EBG00001248748.
DR   EnsemblGenomes-Gn; EBG00001248749.
DR   EnsemblGenomes-Gn; EBG00001248750.
DR   EnsemblGenomes-Gn; EBG00001248751.
DR   EnsemblGenomes-Gn; EBG00001248752.
DR   EnsemblGenomes-Gn; EBG00001248753.
DR   EnsemblGenomes-Gn; EBG00001248754.
DR   EnsemblGenomes-Gn; EBG00001248755.
DR   EnsemblGenomes-Gn; EBG00001248756.
DR   EnsemblGenomes-Gn; EBG00001248757.
DR   EnsemblGenomes-Gn; EBG00001248758.
DR   EnsemblGenomes-Gn; EBG00001248759.
DR   EnsemblGenomes-Gn; EBG00001248760.
DR   EnsemblGenomes-Gn; EBG00001248761.
DR   EnsemblGenomes-Gn; EBG00001248762.
DR   EnsemblGenomes-Gn; EBG00001248763.
DR   EnsemblGenomes-Gn; EBG00001248764.
DR   EnsemblGenomes-Gn; EBG00001248765.
DR   EnsemblGenomes-Gn; EBG00001248766.
DR   EnsemblGenomes-Gn; EBG00001248767.
DR   EnsemblGenomes-Gn; EBG00001248768.
DR   EnsemblGenomes-Gn; EBG00001248769.
DR   EnsemblGenomes-Gn; EBG00001248770.
DR   EnsemblGenomes-Gn; EBG00001248771.
DR   EnsemblGenomes-Gn; EBG00001248772.
DR   EnsemblGenomes-Gn; EBG00001248773.
DR   EnsemblGenomes-Gn; EBG00001248774.
DR   EnsemblGenomes-Gn; EBG00001248775.
DR   EnsemblGenomes-Gn; EBG00001248776.
DR   EnsemblGenomes-Gn; EBG00001248777.
DR   EnsemblGenomes-Gn; EBG00001248778.
DR   EnsemblGenomes-Gn; EBG00001248779.
DR   EnsemblGenomes-Gn; EBG00001248780.
DR   EnsemblGenomes-Gn; EBG00001248781.
DR   EnsemblGenomes-Gn; EBG00001248782.
DR   EnsemblGenomes-Gn; EBG00001248783.
DR   EnsemblGenomes-Gn; EBG00001248784.
DR   EnsemblGenomes-Gn; EBG00001248785.
DR   EnsemblGenomes-Gn; EBG00001248786.
DR   EnsemblGenomes-Gn; EBG00001248787.
DR   EnsemblGenomes-Gn; EBG00001248788.
DR   EnsemblGenomes-Gn; EBG00001248789.
DR   EnsemblGenomes-Gn; EBG00001248790.
DR   EnsemblGenomes-Gn; EBG00001248791.
DR   EnsemblGenomes-Gn; EBG00001248792.
DR   EnsemblGenomes-Gn; EBG00001248793.
DR   EnsemblGenomes-Gn; EBG00001248794.
DR   EnsemblGenomes-Gn; EBG00001248795.
DR   EnsemblGenomes-Gn; EBG00001248796.
DR   EnsemblGenomes-Gn; EBG00001248797.
DR   EnsemblGenomes-Gn; EBG00001248798.
DR   EnsemblGenomes-Gn; EBG00001248799.
DR   EnsemblGenomes-Gn; EBG00001248800.
DR   EnsemblGenomes-Gn; EBG00001248801.
DR   EnsemblGenomes-Gn; EBG00001248802.
DR   EnsemblGenomes-Gn; EBG00001248803.
DR   EnsemblGenomes-Gn; EBG00001248804.
DR   EnsemblGenomes-Gn; EBG00001248805.
DR   EnsemblGenomes-Gn; EBG00001248806.
DR   EnsemblGenomes-Gn; EBG00001248807.
DR   EnsemblGenomes-Gn; EBG00001248808.
DR   EnsemblGenomes-Gn; EBG00001248809.
DR   EnsemblGenomes-Gn; EBG00001248810.
DR   EnsemblGenomes-Gn; EBG00001248811.
DR   EnsemblGenomes-Gn; EBG00001248812.
DR   EnsemblGenomes-Gn; EBG00001248813.
DR   EnsemblGenomes-Gn; EBG00001248814.
DR   EnsemblGenomes-Gn; EBG00001248815.
DR   EnsemblGenomes-Gn; EBG00001248816.
DR   EnsemblGenomes-Gn; EBG00001248817.
DR   EnsemblGenomes-Gn; EBG00001248818.
DR   EnsemblGenomes-Gn; EBG00001248819.
DR   EnsemblGenomes-Gn; EBG00001248820.
DR   EnsemblGenomes-Gn; EBG00001248821.
DR   EnsemblGenomes-Gn; EBG00001248822.
DR   EnsemblGenomes-Gn; EBG00001248823.
DR   EnsemblGenomes-Gn; EBG00001248824.
DR   EnsemblGenomes-Gn; EBG00001248825.
DR   EnsemblGenomes-Gn; EBG00001248826.
DR   EnsemblGenomes-Gn; EBG00001248827.
DR   EnsemblGenomes-Gn; EBG00001248828.
DR   EnsemblGenomes-Gn; EBG00001248829.
DR   EnsemblGenomes-Gn; EBG00001248830.
DR   EnsemblGenomes-Gn; EBG00001248831.
DR   EnsemblGenomes-Gn; EBG00001248832.
DR   EnsemblGenomes-Gn; EBG00001248833.
DR   EnsemblGenomes-Gn; EBG00001248834.
DR   EnsemblGenomes-Gn; EBG00001248835.
DR   EnsemblGenomes-Gn; EBG00001248836.
DR   EnsemblGenomes-Gn; EBG00001248837.
DR   EnsemblGenomes-Gn; EBG00001248838.
DR   EnsemblGenomes-Gn; EBG00001248839.
DR   EnsemblGenomes-Gn; EBG00001248840.
DR   EnsemblGenomes-Gn; EBG00001248841.
DR   EnsemblGenomes-Gn; EBG00001248842.
DR   EnsemblGenomes-Gn; EBG00001248843.
DR   EnsemblGenomes-Gn; EBG00001248844.
DR   EnsemblGenomes-Gn; EBG00001248845.
DR   EnsemblGenomes-Gn; EBG00001248846.
DR   EnsemblGenomes-Gn; EBG00001248847.
DR   EnsemblGenomes-Gn; EBG00001248848.
DR   EnsemblGenomes-Gn; EBG00001248849.
DR   EnsemblGenomes-Gn; EBG00001248850.
DR   EnsemblGenomes-Gn; EBG00001248851.
DR   EnsemblGenomes-Gn; EBG00001248852.
DR   EnsemblGenomes-Gn; EBG00001248853.
DR   EnsemblGenomes-Gn; EBG00001248854.
DR   EnsemblGenomes-Gn; EBG00001248855.
DR   EnsemblGenomes-Gn; EBG00001248856.
DR   EnsemblGenomes-Gn; EBG00001248857.
DR   EnsemblGenomes-Gn; EBG00001248858.
DR   EnsemblGenomes-Gn; EBG00001248859.
DR   EnsemblGenomes-Gn; Shal_R0001.
DR   EnsemblGenomes-Gn; Shal_R0002.
DR   EnsemblGenomes-Gn; Shal_R0003.
DR   EnsemblGenomes-Gn; Shal_R0004.
DR   EnsemblGenomes-Gn; Shal_R0005.
DR   EnsemblGenomes-Gn; Shal_R0006.
DR   EnsemblGenomes-Gn; Shal_R0007.
DR   EnsemblGenomes-Gn; Shal_R0008.
DR   EnsemblGenomes-Gn; Shal_R0009.
DR   EnsemblGenomes-Gn; Shal_R0010.
DR   EnsemblGenomes-Gn; Shal_R0011.
DR   EnsemblGenomes-Gn; Shal_R0012.
DR   EnsemblGenomes-Gn; Shal_R0013.
DR   EnsemblGenomes-Gn; Shal_R0014.
DR   EnsemblGenomes-Gn; Shal_R0015.
DR   EnsemblGenomes-Gn; Shal_R0016.
DR   EnsemblGenomes-Gn; Shal_R0017.
DR   EnsemblGenomes-Gn; Shal_R0018.
DR   EnsemblGenomes-Gn; Shal_R0019.
DR   EnsemblGenomes-Gn; Shal_R0020.
DR   EnsemblGenomes-Gn; Shal_R0021.
DR   EnsemblGenomes-Gn; Shal_R0022.
DR   EnsemblGenomes-Gn; Shal_R0023.
DR   EnsemblGenomes-Gn; Shal_R0024.
DR   EnsemblGenomes-Gn; Shal_R0025.
DR   EnsemblGenomes-Gn; Shal_R0026.
DR   EnsemblGenomes-Gn; Shal_R0027.
DR   EnsemblGenomes-Gn; Shal_R0028.
DR   EnsemblGenomes-Gn; Shal_R0029.
DR   EnsemblGenomes-Gn; Shal_R0030.
DR   EnsemblGenomes-Gn; Shal_R0031.
DR   EnsemblGenomes-Gn; Shal_R0032.
DR   EnsemblGenomes-Gn; Shal_R0033.
DR   EnsemblGenomes-Gn; Shal_R0034.
DR   EnsemblGenomes-Gn; Shal_R0035.
DR   EnsemblGenomes-Gn; Shal_R0036.
DR   EnsemblGenomes-Gn; Shal_R0037.
DR   EnsemblGenomes-Gn; Shal_R0038.
DR   EnsemblGenomes-Gn; Shal_R0039.
DR   EnsemblGenomes-Gn; Shal_R0040.
DR   EnsemblGenomes-Gn; Shal_R0041.
DR   EnsemblGenomes-Gn; Shal_R0042.
DR   EnsemblGenomes-Gn; Shal_R0043.
DR   EnsemblGenomes-Gn; Shal_R0044.
DR   EnsemblGenomes-Gn; Shal_R0045.
DR   EnsemblGenomes-Gn; Shal_R0046.
DR   EnsemblGenomes-Gn; Shal_R0047.
DR   EnsemblGenomes-Gn; Shal_R0048.
DR   EnsemblGenomes-Gn; Shal_R0049.
DR   EnsemblGenomes-Gn; Shal_R0050.
DR   EnsemblGenomes-Gn; Shal_R0051.
DR   EnsemblGenomes-Gn; Shal_R0052.
DR   EnsemblGenomes-Gn; Shal_R0053.
DR   EnsemblGenomes-Gn; Shal_R0054.
DR   EnsemblGenomes-Gn; Shal_R0055.
DR   EnsemblGenomes-Gn; Shal_R0056.
DR   EnsemblGenomes-Gn; Shal_R0057.
DR   EnsemblGenomes-Gn; Shal_R0058.
DR   EnsemblGenomes-Gn; Shal_R0059.
DR   EnsemblGenomes-Gn; Shal_R0060.
DR   EnsemblGenomes-Gn; Shal_R0061.
DR   EnsemblGenomes-Gn; Shal_R0062.
DR   EnsemblGenomes-Gn; Shal_R0063.
DR   EnsemblGenomes-Gn; Shal_R0064.
DR   EnsemblGenomes-Gn; Shal_R0065.
DR   EnsemblGenomes-Gn; Shal_R0066.
DR   EnsemblGenomes-Gn; Shal_R0067.
DR   EnsemblGenomes-Gn; Shal_R0068.
DR   EnsemblGenomes-Gn; Shal_R0069.
DR   EnsemblGenomes-Gn; Shal_R0070.
DR   EnsemblGenomes-Gn; Shal_R0071.
DR   EnsemblGenomes-Gn; Shal_R0072.
DR   EnsemblGenomes-Gn; Shal_R0073.
DR   EnsemblGenomes-Gn; Shal_R0074.
DR   EnsemblGenomes-Gn; Shal_R0075.
DR   EnsemblGenomes-Gn; Shal_R0076.
DR   EnsemblGenomes-Gn; Shal_R0077.
DR   EnsemblGenomes-Gn; Shal_R0078.
DR   EnsemblGenomes-Gn; Shal_R0079.
DR   EnsemblGenomes-Gn; Shal_R0080.
DR   EnsemblGenomes-Gn; Shal_R0081.
DR   EnsemblGenomes-Gn; Shal_R0082.
DR   EnsemblGenomes-Gn; Shal_R0083.
DR   EnsemblGenomes-Gn; Shal_R0084.
DR   EnsemblGenomes-Gn; Shal_R0085.
DR   EnsemblGenomes-Gn; Shal_R0086.
DR   EnsemblGenomes-Gn; Shal_R0087.
DR   EnsemblGenomes-Gn; Shal_R0088.
DR   EnsemblGenomes-Gn; Shal_R0089.
DR   EnsemblGenomes-Gn; Shal_R0090.
DR   EnsemblGenomes-Gn; Shal_R0091.
DR   EnsemblGenomes-Gn; Shal_R0092.
DR   EnsemblGenomes-Gn; Shal_R0093.
DR   EnsemblGenomes-Gn; Shal_R0094.
DR   EnsemblGenomes-Gn; Shal_R0095.
DR   EnsemblGenomes-Gn; Shal_R0096.
DR   EnsemblGenomes-Gn; Shal_R0097.
DR   EnsemblGenomes-Gn; Shal_R0098.
DR   EnsemblGenomes-Gn; Shal_R0099.
DR   EnsemblGenomes-Gn; Shal_R0100.
DR   EnsemblGenomes-Gn; Shal_R0101.
DR   EnsemblGenomes-Gn; Shal_R0102.
DR   EnsemblGenomes-Gn; Shal_R0103.
DR   EnsemblGenomes-Gn; Shal_R0104.
DR   EnsemblGenomes-Gn; Shal_R0105.
DR   EnsemblGenomes-Gn; Shal_R0106.
DR   EnsemblGenomes-Gn; Shal_R0107.
DR   EnsemblGenomes-Gn; Shal_R0108.
DR   EnsemblGenomes-Gn; Shal_R0109.
DR   EnsemblGenomes-Gn; Shal_R0110.
DR   EnsemblGenomes-Gn; Shal_R0111.
DR   EnsemblGenomes-Gn; Shal_R0112.
DR   EnsemblGenomes-Gn; Shal_R0113.
DR   EnsemblGenomes-Gn; Shal_R0114.
DR   EnsemblGenomes-Gn; Shal_R0115.
DR   EnsemblGenomes-Gn; Shal_R0116.
DR   EnsemblGenomes-Gn; Shal_R0117.
DR   EnsemblGenomes-Gn; Shal_R0118.
DR   EnsemblGenomes-Gn; Shal_R0119.
DR   EnsemblGenomes-Gn; Shal_R0120.
DR   EnsemblGenomes-Gn; Shal_R0121.
DR   EnsemblGenomes-Gn; Shal_R0122.
DR   EnsemblGenomes-Gn; Shal_R0123.
DR   EnsemblGenomes-Gn; Shal_R0124.
DR   EnsemblGenomes-Gn; Shal_R0125.
DR   EnsemblGenomes-Gn; Shal_R0126.
DR   EnsemblGenomes-Gn; Shal_R0127.
DR   EnsemblGenomes-Gn; Shal_R0128.
DR   EnsemblGenomes-Gn; Shal_R0129.
DR   EnsemblGenomes-Gn; Shal_R0130.
DR   EnsemblGenomes-Gn; Shal_R0131.
DR   EnsemblGenomes-Gn; Shal_R0132.
DR   EnsemblGenomes-Gn; Shal_R0133.
DR   EnsemblGenomes-Gn; Shal_R0134.
DR   EnsemblGenomes-Gn; Shal_R0135.
DR   EnsemblGenomes-Gn; Shal_R0136.
DR   EnsemblGenomes-Gn; Shal_R0137.
DR   EnsemblGenomes-Gn; Shal_R0138.
DR   EnsemblGenomes-Gn; Shal_R0139.
DR   EnsemblGenomes-Gn; Shal_R0140.
DR   EnsemblGenomes-Gn; Shal_R0141.
DR   EnsemblGenomes-Gn; Shal_R0142.
DR   EnsemblGenomes-Gn; Shal_R0143.
DR   EnsemblGenomes-Gn; Shal_R0144.
DR   EnsemblGenomes-Gn; Shal_R0145.
DR   EnsemblGenomes-Gn; Shal_R0146.
DR   EnsemblGenomes-Gn; Shal_R0147.
DR   EnsemblGenomes-Gn; Shal_R0148.
DR   EnsemblGenomes-Gn; Shal_R0149.
DR   EnsemblGenomes-Gn; Shal_R0150.
DR   EnsemblGenomes-Gn; Shal_R0151.
DR   EnsemblGenomes-Gn; Shal_R0152.
DR   EnsemblGenomes-Gn; Shal_R0153.
DR   EnsemblGenomes-Gn; Shal_R0154.
DR   EnsemblGenomes-Gn; Shal_R0155.
DR   EnsemblGenomes-Gn; Shal_R0156.
DR   EnsemblGenomes-Gn; Shal_R0157.
DR   EnsemblGenomes-Gn; Shal_R0158.
DR   EnsemblGenomes-Tr; EBT00001594478.
DR   EnsemblGenomes-Tr; EBT00001594479.
DR   EnsemblGenomes-Tr; EBT00001594480.
DR   EnsemblGenomes-Tr; EBT00001594481.
DR   EnsemblGenomes-Tr; EBT00001594482.
DR   EnsemblGenomes-Tr; EBT00001594483.
DR   EnsemblGenomes-Tr; EBT00001594484.
DR   EnsemblGenomes-Tr; EBT00001594485.
DR   EnsemblGenomes-Tr; EBT00001594486.
DR   EnsemblGenomes-Tr; EBT00001594487.
DR   EnsemblGenomes-Tr; EBT00001594488.
DR   EnsemblGenomes-Tr; EBT00001594489.
DR   EnsemblGenomes-Tr; EBT00001594490.
DR   EnsemblGenomes-Tr; EBT00001594491.
DR   EnsemblGenomes-Tr; EBT00001594492.
DR   EnsemblGenomes-Tr; EBT00001594493.
DR   EnsemblGenomes-Tr; EBT00001594494.
DR   EnsemblGenomes-Tr; EBT00001594495.
DR   EnsemblGenomes-Tr; EBT00001594496.
DR   EnsemblGenomes-Tr; EBT00001594497.
DR   EnsemblGenomes-Tr; EBT00001594498.
DR   EnsemblGenomes-Tr; EBT00001594499.
DR   EnsemblGenomes-Tr; EBT00001594500.
DR   EnsemblGenomes-Tr; EBT00001594501.
DR   EnsemblGenomes-Tr; EBT00001594502.
DR   EnsemblGenomes-Tr; EBT00001594503.
DR   EnsemblGenomes-Tr; EBT00001594504.
DR   EnsemblGenomes-Tr; EBT00001594505.
DR   EnsemblGenomes-Tr; EBT00001594506.
DR   EnsemblGenomes-Tr; EBT00001594507.
DR   EnsemblGenomes-Tr; EBT00001594508.
DR   EnsemblGenomes-Tr; EBT00001594509.
DR   EnsemblGenomes-Tr; EBT00001594510.
DR   EnsemblGenomes-Tr; EBT00001594511.
DR   EnsemblGenomes-Tr; EBT00001594512.
DR   EnsemblGenomes-Tr; EBT00001594513.
DR   EnsemblGenomes-Tr; EBT00001594514.
DR   EnsemblGenomes-Tr; EBT00001594515.
DR   EnsemblGenomes-Tr; EBT00001594516.
DR   EnsemblGenomes-Tr; EBT00001594517.
DR   EnsemblGenomes-Tr; EBT00001594518.
DR   EnsemblGenomes-Tr; EBT00001594519.
DR   EnsemblGenomes-Tr; EBT00001594520.
DR   EnsemblGenomes-Tr; EBT00001594521.
DR   EnsemblGenomes-Tr; EBT00001594522.
DR   EnsemblGenomes-Tr; EBT00001594523.
DR   EnsemblGenomes-Tr; EBT00001594524.
DR   EnsemblGenomes-Tr; EBT00001594525.
DR   EnsemblGenomes-Tr; EBT00001594526.
DR   EnsemblGenomes-Tr; EBT00001594527.
DR   EnsemblGenomes-Tr; EBT00001594528.
DR   EnsemblGenomes-Tr; EBT00001594529.
DR   EnsemblGenomes-Tr; EBT00001594530.
DR   EnsemblGenomes-Tr; EBT00001594531.
DR   EnsemblGenomes-Tr; EBT00001594532.
DR   EnsemblGenomes-Tr; EBT00001594533.
DR   EnsemblGenomes-Tr; EBT00001594534.
DR   EnsemblGenomes-Tr; EBT00001594535.
DR   EnsemblGenomes-Tr; EBT00001594536.
DR   EnsemblGenomes-Tr; EBT00001594537.
DR   EnsemblGenomes-Tr; EBT00001594538.
DR   EnsemblGenomes-Tr; EBT00001594539.
DR   EnsemblGenomes-Tr; EBT00001594540.
DR   EnsemblGenomes-Tr; EBT00001594541.
DR   EnsemblGenomes-Tr; EBT00001594542.
DR   EnsemblGenomes-Tr; EBT00001594543.
DR   EnsemblGenomes-Tr; EBT00001594544.
DR   EnsemblGenomes-Tr; EBT00001594545.
DR   EnsemblGenomes-Tr; EBT00001594546.
DR   EnsemblGenomes-Tr; EBT00001594547.
DR   EnsemblGenomes-Tr; EBT00001594548.
DR   EnsemblGenomes-Tr; EBT00001594549.
DR   EnsemblGenomes-Tr; EBT00001594550.
DR   EnsemblGenomes-Tr; EBT00001594551.
DR   EnsemblGenomes-Tr; EBT00001594552.
DR   EnsemblGenomes-Tr; EBT00001594553.
DR   EnsemblGenomes-Tr; EBT00001594554.
DR   EnsemblGenomes-Tr; EBT00001594555.
DR   EnsemblGenomes-Tr; EBT00001594556.
DR   EnsemblGenomes-Tr; EBT00001594557.
DR   EnsemblGenomes-Tr; EBT00001594558.
DR   EnsemblGenomes-Tr; EBT00001594559.
DR   EnsemblGenomes-Tr; EBT00001594560.
DR   EnsemblGenomes-Tr; EBT00001594561.
DR   EnsemblGenomes-Tr; EBT00001594562.
DR   EnsemblGenomes-Tr; EBT00001594563.
DR   EnsemblGenomes-Tr; EBT00001594564.
DR   EnsemblGenomes-Tr; EBT00001594565.
DR   EnsemblGenomes-Tr; EBT00001594566.
DR   EnsemblGenomes-Tr; EBT00001594567.
DR   EnsemblGenomes-Tr; EBT00001594568.
DR   EnsemblGenomes-Tr; EBT00001594569.
DR   EnsemblGenomes-Tr; EBT00001594570.
DR   EnsemblGenomes-Tr; EBT00001594571.
DR   EnsemblGenomes-Tr; EBT00001594572.
DR   EnsemblGenomes-Tr; EBT00001594573.
DR   EnsemblGenomes-Tr; EBT00001594574.
DR   EnsemblGenomes-Tr; EBT00001594575.
DR   EnsemblGenomes-Tr; EBT00001594576.
DR   EnsemblGenomes-Tr; EBT00001594577.
DR   EnsemblGenomes-Tr; EBT00001594578.
DR   EnsemblGenomes-Tr; EBT00001594579.
DR   EnsemblGenomes-Tr; EBT00001594580.
DR   EnsemblGenomes-Tr; EBT00001594581.
DR   EnsemblGenomes-Tr; EBT00001594582.
DR   EnsemblGenomes-Tr; EBT00001594583.
DR   EnsemblGenomes-Tr; EBT00001594584.
DR   EnsemblGenomes-Tr; EBT00001594585.
DR   EnsemblGenomes-Tr; EBT00001594586.
DR   EnsemblGenomes-Tr; EBT00001594587.
DR   EnsemblGenomes-Tr; EBT00001594588.
DR   EnsemblGenomes-Tr; EBT00001594589.
DR   EnsemblGenomes-Tr; EBT00001594590.
DR   EnsemblGenomes-Tr; EBT00001594591.
DR   EnsemblGenomes-Tr; EBT00001594592.
DR   EnsemblGenomes-Tr; EBT00001594593.
DR   EnsemblGenomes-Tr; EBT00001594594.
DR   EnsemblGenomes-Tr; EBT00001594595.
DR   EnsemblGenomes-Tr; EBT00001594596.
DR   EnsemblGenomes-Tr; EBT00001594597.
DR   EnsemblGenomes-Tr; EBT00001594598.
DR   EnsemblGenomes-Tr; EBT00001594599.
DR   EnsemblGenomes-Tr; EBT00001594600.
DR   EnsemblGenomes-Tr; EBT00001594601.
DR   EnsemblGenomes-Tr; EBT00001594602.
DR   EnsemblGenomes-Tr; EBT00001594603.
DR   EnsemblGenomes-Tr; EBT00001594604.
DR   EnsemblGenomes-Tr; EBT00001594605.
DR   EnsemblGenomes-Tr; EBT00001594606.
DR   EnsemblGenomes-Tr; EBT00001594607.
DR   EnsemblGenomes-Tr; EBT00001594608.
DR   EnsemblGenomes-Tr; EBT00001594609.
DR   EnsemblGenomes-Tr; EBT00001594610.
DR   EnsemblGenomes-Tr; EBT00001594611.
DR   EnsemblGenomes-Tr; EBT00001594612.
DR   EnsemblGenomes-Tr; EBT00001594613.
DR   EnsemblGenomes-Tr; EBT00001594614.
DR   EnsemblGenomes-Tr; EBT00001594615.
DR   EnsemblGenomes-Tr; EBT00001594616.
DR   EnsemblGenomes-Tr; EBT00001594617.
DR   EnsemblGenomes-Tr; EBT00001594618.
DR   EnsemblGenomes-Tr; EBT00001594619.
DR   EnsemblGenomes-Tr; EBT00001594620.
DR   EnsemblGenomes-Tr; EBT00001594621.
DR   EnsemblGenomes-Tr; EBT00001594622.
DR   EnsemblGenomes-Tr; EBT00001594623.
DR   EnsemblGenomes-Tr; EBT00001594624.
DR   EnsemblGenomes-Tr; EBT00001594625.
DR   EnsemblGenomes-Tr; EBT00001594626.
DR   EnsemblGenomes-Tr; EBT00001594627.
DR   EnsemblGenomes-Tr; EBT00001594628.
DR   EnsemblGenomes-Tr; EBT00001594629.
DR   EnsemblGenomes-Tr; EBT00001594630.
DR   EnsemblGenomes-Tr; EBT00001594631.
DR   EnsemblGenomes-Tr; EBT00001594632.
DR   EnsemblGenomes-Tr; EBT00001594633.
DR   EnsemblGenomes-Tr; EBT00001594634.
DR   EnsemblGenomes-Tr; EBT00001594635.
DR   EnsemblGenomes-Tr; EBT00001594636.
DR   EnsemblGenomes-Tr; EBT00001594637.
DR   EnsemblGenomes-Tr; EBT00001594638.
DR   EnsemblGenomes-Tr; EBT00001594639.
DR   EnsemblGenomes-Tr; EBT00001594640.
DR   EnsemblGenomes-Tr; EBT00001594641.
DR   EnsemblGenomes-Tr; EBT00001594642.
DR   EnsemblGenomes-Tr; EBT00001594643.
DR   EnsemblGenomes-Tr; EBT00001594644.
DR   EnsemblGenomes-Tr; EBT00001594645.
DR   EnsemblGenomes-Tr; EBT00001594646.
DR   EnsemblGenomes-Tr; EBT00001594647.
DR   EnsemblGenomes-Tr; EBT00001594648.
DR   EnsemblGenomes-Tr; EBT00001594649.
DR   EnsemblGenomes-Tr; EBT00001594650.
DR   EnsemblGenomes-Tr; EBT00001594651.
DR   EnsemblGenomes-Tr; EBT00001594652.
DR   EnsemblGenomes-Tr; EBT00001594653.
DR   EnsemblGenomes-Tr; EBT00001594654.
DR   EnsemblGenomes-Tr; EBT00001594655.
DR   EnsemblGenomes-Tr; EBT00001594656.
DR   EnsemblGenomes-Tr; EBT00001594657.
DR   EnsemblGenomes-Tr; EBT00001594658.
DR   EnsemblGenomes-Tr; EBT00001594659.
DR   EnsemblGenomes-Tr; EBT00001594660.
DR   EnsemblGenomes-Tr; EBT00001594661.
DR   EnsemblGenomes-Tr; EBT00001594662.
DR   EnsemblGenomes-Tr; Shal_R0001-1.
DR   EnsemblGenomes-Tr; Shal_R0002-1.
DR   EnsemblGenomes-Tr; Shal_R0003-1.
DR   EnsemblGenomes-Tr; Shal_R0004-1.
DR   EnsemblGenomes-Tr; Shal_R0005-1.
DR   EnsemblGenomes-Tr; Shal_R0006-1.
DR   EnsemblGenomes-Tr; Shal_R0007-1.
DR   EnsemblGenomes-Tr; Shal_R0008-1.
DR   EnsemblGenomes-Tr; Shal_R0009-1.
DR   EnsemblGenomes-Tr; Shal_R0010-1.
DR   EnsemblGenomes-Tr; Shal_R0011-1.
DR   EnsemblGenomes-Tr; Shal_R0012-1.
DR   EnsemblGenomes-Tr; Shal_R0013-1.
DR   EnsemblGenomes-Tr; Shal_R0014-1.
DR   EnsemblGenomes-Tr; Shal_R0015-1.
DR   EnsemblGenomes-Tr; Shal_R0016-1.
DR   EnsemblGenomes-Tr; Shal_R0017-1.
DR   EnsemblGenomes-Tr; Shal_R0018-1.
DR   EnsemblGenomes-Tr; Shal_R0019-1.
DR   EnsemblGenomes-Tr; Shal_R0020-1.
DR   EnsemblGenomes-Tr; Shal_R0021-1.
DR   EnsemblGenomes-Tr; Shal_R0022-1.
DR   EnsemblGenomes-Tr; Shal_R0023-1.
DR   EnsemblGenomes-Tr; Shal_R0024-1.
DR   EnsemblGenomes-Tr; Shal_R0025-1.
DR   EnsemblGenomes-Tr; Shal_R0026-1.
DR   EnsemblGenomes-Tr; Shal_R0027-1.
DR   EnsemblGenomes-Tr; Shal_R0028-1.
DR   EnsemblGenomes-Tr; Shal_R0029-1.
DR   EnsemblGenomes-Tr; Shal_R0030-1.
DR   EnsemblGenomes-Tr; Shal_R0031-1.
DR   EnsemblGenomes-Tr; Shal_R0032-1.
DR   EnsemblGenomes-Tr; Shal_R0033-1.
DR   EnsemblGenomes-Tr; Shal_R0034-1.
DR   EnsemblGenomes-Tr; Shal_R0035-1.
DR   EnsemblGenomes-Tr; Shal_R0036-1.
DR   EnsemblGenomes-Tr; Shal_R0037-1.
DR   EnsemblGenomes-Tr; Shal_R0038-1.
DR   EnsemblGenomes-Tr; Shal_R0039-1.
DR   EnsemblGenomes-Tr; Shal_R0040-1.
DR   EnsemblGenomes-Tr; Shal_R0041-1.
DR   EnsemblGenomes-Tr; Shal_R0042-1.
DR   EnsemblGenomes-Tr; Shal_R0043-1.
DR   EnsemblGenomes-Tr; Shal_R0044-1.
DR   EnsemblGenomes-Tr; Shal_R0045-1.
DR   EnsemblGenomes-Tr; Shal_R0046-1.
DR   EnsemblGenomes-Tr; Shal_R0047-1.
DR   EnsemblGenomes-Tr; Shal_R0048-1.
DR   EnsemblGenomes-Tr; Shal_R0049-1.
DR   EnsemblGenomes-Tr; Shal_R0050-1.
DR   EnsemblGenomes-Tr; Shal_R0051-1.
DR   EnsemblGenomes-Tr; Shal_R0052-1.
DR   EnsemblGenomes-Tr; Shal_R0053-1.
DR   EnsemblGenomes-Tr; Shal_R0054-1.
DR   EnsemblGenomes-Tr; Shal_R0055-1.
DR   EnsemblGenomes-Tr; Shal_R0056-1.
DR   EnsemblGenomes-Tr; Shal_R0057-1.
DR   EnsemblGenomes-Tr; Shal_R0058-1.
DR   EnsemblGenomes-Tr; Shal_R0059-1.
DR   EnsemblGenomes-Tr; Shal_R0060-1.
DR   EnsemblGenomes-Tr; Shal_R0061-1.
DR   EnsemblGenomes-Tr; Shal_R0062-1.
DR   EnsemblGenomes-Tr; Shal_R0063-1.
DR   EnsemblGenomes-Tr; Shal_R0064-1.
DR   EnsemblGenomes-Tr; Shal_R0065-1.
DR   EnsemblGenomes-Tr; Shal_R0066-1.
DR   EnsemblGenomes-Tr; Shal_R0067-1.
DR   EnsemblGenomes-Tr; Shal_R0068-1.
DR   EnsemblGenomes-Tr; Shal_R0069-1.
DR   EnsemblGenomes-Tr; Shal_R0070-1.
DR   EnsemblGenomes-Tr; Shal_R0071-1.
DR   EnsemblGenomes-Tr; Shal_R0072-1.
DR   EnsemblGenomes-Tr; Shal_R0073-1.
DR   EnsemblGenomes-Tr; Shal_R0074-1.
DR   EnsemblGenomes-Tr; Shal_R0075-1.
DR   EnsemblGenomes-Tr; Shal_R0076-1.
DR   EnsemblGenomes-Tr; Shal_R0077-1.
DR   EnsemblGenomes-Tr; Shal_R0078-1.
DR   EnsemblGenomes-Tr; Shal_R0079-1.
DR   EnsemblGenomes-Tr; Shal_R0080-1.
DR   EnsemblGenomes-Tr; Shal_R0081-1.
DR   EnsemblGenomes-Tr; Shal_R0082-1.
DR   EnsemblGenomes-Tr; Shal_R0083-1.
DR   EnsemblGenomes-Tr; Shal_R0084-1.
DR   EnsemblGenomes-Tr; Shal_R0085-1.
DR   EnsemblGenomes-Tr; Shal_R0086-1.
DR   EnsemblGenomes-Tr; Shal_R0087-1.
DR   EnsemblGenomes-Tr; Shal_R0088-1.
DR   EnsemblGenomes-Tr; Shal_R0089-1.
DR   EnsemblGenomes-Tr; Shal_R0090-1.
DR   EnsemblGenomes-Tr; Shal_R0091-1.
DR   EnsemblGenomes-Tr; Shal_R0092-1.
DR   EnsemblGenomes-Tr; Shal_R0093-1.
DR   EnsemblGenomes-Tr; Shal_R0094-1.
DR   EnsemblGenomes-Tr; Shal_R0095-1.
DR   EnsemblGenomes-Tr; Shal_R0096-1.
DR   EnsemblGenomes-Tr; Shal_R0097-1.
DR   EnsemblGenomes-Tr; Shal_R0098-1.
DR   EnsemblGenomes-Tr; Shal_R0099-1.
DR   EnsemblGenomes-Tr; Shal_R0100-1.
DR   EnsemblGenomes-Tr; Shal_R0101-1.
DR   EnsemblGenomes-Tr; Shal_R0102-1.
DR   EnsemblGenomes-Tr; Shal_R0103-1.
DR   EnsemblGenomes-Tr; Shal_R0104-1.
DR   EnsemblGenomes-Tr; Shal_R0105-1.
DR   EnsemblGenomes-Tr; Shal_R0106-1.
DR   EnsemblGenomes-Tr; Shal_R0107-1.
DR   EnsemblGenomes-Tr; Shal_R0108-1.
DR   EnsemblGenomes-Tr; Shal_R0109-1.
DR   EnsemblGenomes-Tr; Shal_R0110-1.
DR   EnsemblGenomes-Tr; Shal_R0111-1.
DR   EnsemblGenomes-Tr; Shal_R0112-1.
DR   EnsemblGenomes-Tr; Shal_R0113-1.
DR   EnsemblGenomes-Tr; Shal_R0114-1.
DR   EnsemblGenomes-Tr; Shal_R0115-1.
DR   EnsemblGenomes-Tr; Shal_R0116-1.
DR   EnsemblGenomes-Tr; Shal_R0117-1.
DR   EnsemblGenomes-Tr; Shal_R0118-1.
DR   EnsemblGenomes-Tr; Shal_R0119-1.
DR   EnsemblGenomes-Tr; Shal_R0120-1.
DR   EnsemblGenomes-Tr; Shal_R0121-1.
DR   EnsemblGenomes-Tr; Shal_R0122-1.
DR   EnsemblGenomes-Tr; Shal_R0123-1.
DR   EnsemblGenomes-Tr; Shal_R0124-1.
DR   EnsemblGenomes-Tr; Shal_R0125-1.
DR   EnsemblGenomes-Tr; Shal_R0126-1.
DR   EnsemblGenomes-Tr; Shal_R0127-1.
DR   EnsemblGenomes-Tr; Shal_R0128-1.
DR   EnsemblGenomes-Tr; Shal_R0129-1.
DR   EnsemblGenomes-Tr; Shal_R0130-1.
DR   EnsemblGenomes-Tr; Shal_R0131-1.
DR   EnsemblGenomes-Tr; Shal_R0132-1.
DR   EnsemblGenomes-Tr; Shal_R0133-1.
DR   EnsemblGenomes-Tr; Shal_R0134-1.
DR   EnsemblGenomes-Tr; Shal_R0135-1.
DR   EnsemblGenomes-Tr; Shal_R0136-1.
DR   EnsemblGenomes-Tr; Shal_R0137-1.
DR   EnsemblGenomes-Tr; Shal_R0138-1.
DR   EnsemblGenomes-Tr; Shal_R0139-1.
DR   EnsemblGenomes-Tr; Shal_R0140-1.
DR   EnsemblGenomes-Tr; Shal_R0141-1.
DR   EnsemblGenomes-Tr; Shal_R0142-1.
DR   EnsemblGenomes-Tr; Shal_R0143-1.
DR   EnsemblGenomes-Tr; Shal_R0144-1.
DR   EnsemblGenomes-Tr; Shal_R0145-1.
DR   EnsemblGenomes-Tr; Shal_R0146-1.
DR   EnsemblGenomes-Tr; Shal_R0147-1.
DR   EnsemblGenomes-Tr; Shal_R0148-1.
DR   EnsemblGenomes-Tr; Shal_R0149-1.
DR   EnsemblGenomes-Tr; Shal_R0150-1.
DR   EnsemblGenomes-Tr; Shal_R0151-1.
DR   EnsemblGenomes-Tr; Shal_R0152-1.
DR   EnsemblGenomes-Tr; Shal_R0153-1.
DR   EnsemblGenomes-Tr; Shal_R0154-1.
DR   EnsemblGenomes-Tr; Shal_R0155-1.
DR   EnsemblGenomes-Tr; Shal_R0156-1.
DR   EnsemblGenomes-Tr; Shal_R0157-1.
DR   EnsemblGenomes-Tr; Shal_R0158-1.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00018; CsrB.
DR   RFAM; RF00021; Spot_42.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00101; SraC_RyeA.
DR   RFAM; RF00111; RyeB.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00506; Thr_leader.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01707; JUMPstart.
DR   RFAM; RF01731; TwoAYGGAY.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01859; Phe_leader.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF02194; HPnc0260.
DR   SILVA-LSU; CP000931.
DR   SILVA-SSU; CP000931.
DR   StrainInfo; 674959; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4002760
CC   Source DNA and bacteria available from Jian-Shen Zhao
CC   (Jian-shen.zhao@cnrc-nrc.gc.ca)
CC   Contacts: Jian-Shen Zhao (Jian-shen.zhao@cnrc-nrc.gc.ca)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfmpageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5226917
FT                   /organism="Shewanella halifaxensis HAW-EB4"
FT                   /strain="HAW-EB4"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:458817"
FT                   /type_material="type strain of Shewanella halifaxensis"
FT   gene            81..1466
FT                   /locus_tag="Shal_0001"
FT   CDS_pept        81..1466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: shm:Shewmr7_0001 chromosomal replication
FT                   initiator protein DnaA; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA domain; Chromosomal replication initiator
FT                   DnaA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74577"
FT                   /db_xref="GOA:B0TLA4"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TLA4"
FT                   /protein_id="ABZ74577.1"
FT                   /translation="MAVSLWQQCIARLQDELSAQQFSMWIRPLQVEMEGDTLVIYAPNR
FT                   FVLDWVRDKYLNIINQFFTEQMGSDAPNLRFDIGSRPSARPIVQATAAIRTSRPVSREV
FT                   VKPSFNTPHADPIANANHRSNINPTYQFDNFVEGKSNQLGKAAAMQVAENPGGAYNPLF
FT                   LYGGTGLGKTHLLHAVGNGIIKNNPNAKVVYMHSERFVQDMVKALQNNAIEEFKRYYRS
FT                   VDALFIDDIQFFANKDRSQEEFFHTFNALLEGNHQIILTSDKYPKEIDGVEDRLKSRFG
FT                   WGLTVAIEPPELETRVAILMRKAQESGINLPDEVAFFIAKRLRSNVRELEGALNRVIAN
FT                   ANFTGRPITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKMADMLSKRRSRSVAR
FT                   PRQVAMALSKELTNQSLPEIGDAFGGRDHTTVLHACRKIAQLREESHDIKEDYANLIRT
FT                   LSS"
FT   gene            1486..2586
FT                   /locus_tag="Shal_0002"
FT   CDS_pept        1486..2586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: slo:Shew_0002 DNA polymerase III, beta
FT                   subunit; TIGRFAM: DNA polymerase III, beta subunit; PFAM:
FT                   DNA polymerase III beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74578"
FT                   /db_xref="GOA:B0TLA5"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:B0TLA5"
FT                   /protein_id="ABZ74578.1"
FT                   /translation="MKFSIDRDALLKPLQLVSGAVERRHNLPILANLLVEVSGHSLKMT
FT                   GTDLEVELVGEVQLEGEVVEGRTTVPAKKFLDIVKSLPDQVELKIEQQENRLLLRSGRS
FT                   RFTLATLPAEEYPNVDAFEAEIEFTLKQGTMKSLIDATQFSMANQDVRYYLNGLLLETE
FT                   GNVLRAIATDGHRLALSHRMIEASLPEKQVIVPRKGVLELMRSFEADDLDVTIAIGDNA
FT                   IRATTATAVFTSKLVDGRFPDYRRVLPKGGDKIVIASRLQLKQALLRASILSNEKFRGV
FT                   RVQLENNLIKITANNPEQEEAEEILDVEYENTPLEIGFNVSYLLDVLNNLPSDDVRITL
FT                   IDGNSSALIDNHIEQDSMYVVMPMRL"
FT   gene            2806..3903
FT                   /locus_tag="Shal_0003"
FT   CDS_pept        2806..3903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: shm:Shewmr7_0003 DNA
FT                   replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74579"
FT                   /db_xref="GOA:B0TLA6"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TLA6"
FT                   /protein_id="ABZ74579.1"
FT                   /translation="MSLTRLHIETFRNISLAQLDPGDGLNLIYGQNGSGKTSILEAIYF
FT                   LGMGRSFRSHLSQRVIQHNDDKLTLFANLSVCEQESKIGLRRFRNGETEVKINGDNIKR
FT                   LSTLAETLPIQVITPESFSLLFEGPKSRRQFIDWGAFHSDKSFHLAWANVRRILKQRNQ
FT                   LLKNQVSYSQIQYWDKELVRYSEQVTEIRKQYVDSLNEQLKGIIGEFLPLVEVKVSFTR
FT                   GWDSKTDFGQLLETQYLRDVAAGNTGSGPHKADLRLRVGVLPVQDALSRGQLKLLVCAL
FT                   RIAQGKLLKQQTDKNSIYLVDDLPSELDAQHRKLLLQQLMDTGAQVFVTAIEPAAIVDS
FT                   LATPPSKMFHVEQGCVTVIDKPTRE"
FT   gene            3881..6322
FT                   /locus_tag="Shal_0004"
FT   CDS_pept        3881..6322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0004"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.6.2.3"
FT                   /note="KEGG: shw:Sputw3181_0004 DNA gyrase, B subunit;
FT                   TIGRFAM: DNA gyrase, B subunit; PFAM: DNA gyrase subunit B
FT                   domain protein; ATP-binding region ATPase domain protein;
FT                   TOPRIM domain protein; DNA topoisomerase type IIA subunit B
FT                   region 2 domain protein; SMART: DNA topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74580"
FT                   /db_xref="GOA:B0TLA7"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:B0TLA7"
FT                   /protein_id="ABZ74580.1"
FT                   /translation="MINRRENNMSENSYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGL
FT                   HHMVFEVVDNSIDEALAGHCNDVIITIHADGSVSVRDDGRGIPVSIHEEEGISAAEVIM
FT                   TVLHAGGKFDDNSYKVSGGLHGVGVSVVNALSSKLQMTIRRDGKVYEQFYTHGVPDAPI
FT                   APIGEATKTGTEIRFWPSTETFTDVLFHFDILAKRVRELSFLNSGVGIRLVDERDNRDE
FT                   FFKYEGGISAFVDYLNVNKTPVNKEVFHFCQEREDGITVEVAMQWNDGFQENIFCFTNN
FT                   IPQRDGGTHLAGFRGALTRNLNNYMEREGYNKKGKTAATGDDAREGLTAVISVKVPDPK
FT                   FSSQTKDKLVSSEVKSAVEQTMGEQLGDYLMEHPNEAKMIVGKIIDAARAREAARKARE
FT                   MTRRKGALDLGGLPGKLADCQEKDPGLSEIYIVEGDSAGGSAKQGRNRKNQAILPLKGK
FT                   ILNVEKARFDKMLSSQEVATLITALGCGIGRDEYNPDKTRYHNIVIMTDADVDGSHIRT
FT                   LLLTFFFRQMPELIERGYVYIAQPPLYKVKKGKQEQYLKDDPALTEYLTTQALDNANIY
FT                   PSQGAPGMSGQPLERLVNQYREVESVIARLEQRYPTNITDLMLYHPAITNEMLSDEAQI
FT                   KAWTDVFVADLIDKESGGILYSAEPVLDPERQVYLPKITIRKHGIDTHYMFSYDFFQST
FT                   DYQRIVKMGAEINGMVEASGYVQRGERTKDVTSFVEALDWLMNESKRGLYIQRYKGLGE
FT                   MNPEQLWETTMDPESRRMLQVTIEDAIGADQLFTCLMGDQVEPRRDFIEANALNVANLD
FT                   V"
FT   gene            6360..7463
FT                   /locus_tag="Shal_0005"
FT   CDS_pept        6360..7463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0005"
FT                   /product="putative signal transduction protein"
FT                   /note="PFAM: Metal-dependent hydrolase HDOD; KEGG:
FT                   shw:Sputw3181_0005 putative signal transduction protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74581"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:B0TLA8"
FT                   /protein_id="ABZ74581.1"
FT                   /translation="MLYAPIFFNNSGVVISKLFSKALRKLFNIREQVVIERPKSFSGSM
FT                   DQFQAKQSHAAPITQNQPPLQSNDPVIAIDLSALFYSLLFPSTQLNGTANELEKSVFRR
FT                   VEAALTSPKAIAERVLKLPTQVAALDQQLADENSDTKALLALIERDPVLSVEVLKLCNS
FT                   PLFKRSDKEVTSLQQALVQLGREQMRRFVTTAMMRKVIEVKPIYFRRFGSQIWRHSMQV
FT                   AYLSSELTQDDPDSAFLLGLLHDVGKIAIFKLLLEAFKQAEPGEQPCSSLFRQVMTTKS
FT                   LSLSALLARYWELPSLFEAELSRLAIIDSKPAGGLAEVVWRANLISECSMLFEAGKLQT
FT                   QQLDRLLFDAAIDRETFEQLHQKLILF"
FT   gene            complement(7531..9600)
FT                   /locus_tag="Shal_0006"
FT   CDS_pept        complement(7531..9600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0006"
FT                   /product="glycyl-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="KEGG: slo:Shew_0009 glycine--tRNA ligase; TIGRFAM:
FT                   glycyl-tRNA synthetase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74582"
FT                   /db_xref="GOA:B0TLA9"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TLA9"
FT                   /protein_id="ABZ74582.1"
FT                   /translation="MNFENLLIEVGTEELPPKSLRKLAESFLANFTEELTKAELSFDSA
FT                   VWHASPRRLAICINQLALAQADKVVEKRGPAIAQAFDADGNPTKAAQGWARGNGISVEQ
FT                   AERLKTDKGEWLLHQARVVGVETKSLIADMAQRSLDKLPIPKPMRWGSNTTQFIRPVHT
FT                   VTMLLGSEVVEGELLGIKSDRVIRGHRFMGESSFELDHADNYLVALKEKGKVLADYQAR
FT                   KAIIKTDAEAAAAKIGGVADLEDDLLEEVTSLVEWPVVLTASFEEKFLDVPAEALVYTM
FT                   KGDQKYFPVFDNAGQLLPNFIFVTNIESKDPQQIISGNEKVVRPRLADAEFFFETDKKE
FT                   SLEARLASLETVVFQKQLGTIKQRVERISALAGYIATSINANSEEAARAGLLSKSDLMT
FT                   NMVMEFTDLQGTMGMHYARLNGETEAVAVALAEQYKPKFSGDTVPTAPISICVALAEKL
FT                   DTLVGIFGIGQAPKGAADPFALRRAAIGVLRICLENNLPLDLVDLIAKAQELHGENLTN
FT                   ENVAEQVLEFFMGRFRAWYQDQGVSVDVILAVLARRPTAPADFESRIKAVAHFRTLEQA
FT                   SALAAANKRVSNILAKVEGELPAAIDDKLLVEEAEKALAAKLAELQPQLAPLFAAANYQ
FT                   EALALLASLRESVDTFFEDVMVMADDEALKNNRLALLSSLREQFLHAADISLLQ"
FT   gene            complement(9612..10517)
FT                   /locus_tag="Shal_0007"
FT   CDS_pept        complement(9612..10517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0007"
FT                   /product="glycyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="KEGG: slo:Shew_0010 glycine--tRNA ligase; TIGRFAM:
FT                   glycyl-tRNA synthetase, alpha subunit; PFAM: glycyl-tRNA
FT                   synthetase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74583"
FT                   /db_xref="GOA:B0TLB0"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TLB0"
FT                   /protein_id="ABZ74583.1"
FT                   /translation="MTTKHDVKTFQGFIMTLQEYWAQQGCAIVQPLDMEVGAGTFHPMT
FT                   FLRSLGPEPMSSAYVQPSRRPTDGRYGENPNRLQHYYQFQVVLKPSPSNMQELYLGSLE
FT                   ALGVDMNVHDVRFVEDNWESPTLGAWGLGWEIWLNGMEVSQFTYFQQVGGLECKPVTGE
FT                   ITYGLERLAMYIQEVDSVYDLVWTDGPLGKVMYGDIFHQNEVEQSTYNFEHADVDVQFK
FT                   MFDDCEQACQRLLALEKPLPLPAYEQVMKASHAFNLLDARHAISVTERQRYILRVRTMA
FT                   KGVAEAYYQAREALGFPMCK"
FT   gene            10636..11196
FT                   /locus_tag="Shal_0008"
FT   CDS_pept        10636..11196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0008"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /EC_number="3.2.2.20"
FT                   /note="KEGG: slo:Shew_0011 DNA-3-methyladenine glycosylase
FT                   I; TIGRFAM: DNA-3-methyladenine glycosylase I; PFAM:
FT                   methyladenine glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74584"
FT                   /db_xref="GOA:B0TLB1"
FT                   /db_xref="InterPro:IPR004597"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:B0TLB1"
FT                   /protein_id="ABZ74584.1"
FT                   /translation="MEVTRCDWVGADPIYQEYHDKLWGKPVFDSLELFEKLCLDGQQAG
FT                   LSWITILKKQQNYEAAFANFDPKIIVTFDDEKIEELMLNPGIVRNRLKINSIIKNARAY
FT                   LEFIEQGNDFSAFLWEFVGGEPKLNHFTSMSELPAQTPESEAMSKALKKLGFNFVGPTI
FT                   CYAFMQAVGMVNDHTTDCFCYQK"
FT   gene            complement(11215..11880)
FT                   /locus_tag="Shal_0009"
FT   CDS_pept        complement(11215..11880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0009"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: slo:Shew_0012 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74585"
FT                   /db_xref="UniProtKB/TrEMBL:B0TLB2"
FT                   /protein_id="ABZ74585.1"
FT                   /translation="MNASRVIALVIVSITLSVSASLLFLNSPDPITQTIEDTAEKILPL
FT                   ENEKSSATYAKAKKPEETTTTQEHQITPQQAENPKSKYANLIDETSINSFFISNQGTVN
FT                   GVAITDVLTIGMTDFIEQASSLHTSSEIAIKRQDKLSQQLLQLKDMAIYDQQLICSGQI
FT                   CALSLTTNELSEENRMLVSEFDSNISFVNTSDNAAGEVEFKAIYLHSEDPSQLVMTQP"
FT   gene            complement(12121..15315)
FT                   /locus_tag="Shal_0010"
FT   CDS_pept        complement(12121..15315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0010"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase; WD40 domain protein beta
FT                   Propeller; KEGG: slo:Shew_0013 amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74586"
FT                   /db_xref="GOA:B0TLB3"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B0TLB3"
FT                   /protein_id="ABZ74586.1"
FT                   /translation="MLNNKFTPLYAAIALSFSTPTIAEEDKQAWQVNAPAKAPLEQIKI
FT                   DVSEGTWMNVSVSPNGKHVVFDLLGDIYQMPIDGGEAKPLAEGIAWQMQPVYSPDGKYI
FT                   AFTSDEDGGDNIWIMQADGSNPRPVTNETFRLLNSPAWSPDGQYLVARKHFTGSRSLGA
FT                   GEVWMYHVAGGDGVKLTERPNEQKDLGEPAYSPDGRYIYFSQDATPGKTFHYSKDSVKG
FT                   IYKIKRYDTQTGDIEVLIQGTGGAIRPTPSPDGKKLAYIKRDGFQSSLYLLDLKSGETE
FT                   KLYGDLDRDMQETWAIHGVYPTMSWTADNEEILFWANGKINKLDVESKSVAQIPFTVKS
FT                   ERAVQPAVRFTQDLDKDVFDVKMLRMAQVSPDGKKVAFEALGKIWVKSLPDGKMSRLTK
FT                   LDSDLRELFPQWSRDGKRIVFTTWDDQEQGTVSLATVRNKRVKALTNEPGKYVEPTFSP
FT                   DGETVVYRKAKGGYITPRTWSQETGLYQVDIDGDKNTKITAAGYQPQFGADNDRVYFME
FT                   SGETPQLASIGLNGFEKRVHYTSKHATEFRVSPDGKQLAFAERFKVFVTPFAKHGETIQ
FT                   IGPKASNLPVEQLSVRAGESISWNTNSNQLYWTLGPELYQVNVDTQYKEQAEDDKAKPI
FT                   ITDLGFSQKADVPRGTVAFVGGNIITMENDEVIKNGTVIVKDNHIVSVGSAADIEIPDD
FT                   AKVIDIKGKTLMPGLFDAHAHGAQGENEIIPQQNWELYSNLSLGVTAIHDPSNDTTEIF
FT                   AASEQQKAGNIAGPRIFSTGTILYGANAPGYTSHIDSLDDAKFHLERLKKVGAFSVKSY
FT                   NQPRRNQRQQVIAAARELEMMVVPEGGSLLQHNLTMIADGHTGIEHSLPAANVYSDIKQ
FT                   FWGQTDVGYTPTLVVAYGGISGENYWYDKTDVWAHPRLSMYVPSDILDARSMRRPTAPD
FT                   EHYNHFNVARVANELNEVGIKANIGAHGQREGLAAHWEMWMFAQGGMSNLEVLKTATIN
FT                   PAKHFAMDHQIGSIKQGKLADLIVIDGNPLEDIRVTDRVSYTMVNGKLFNAETMDQLNG
FT                   GSKNKGKQREAFFFEK"
FT   gene            complement(15903..16085)
FT                   /locus_tag="Shal_0011"
FT   CDS_pept        complement(15903..16085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0011"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74587"
FT                   /db_xref="UniProtKB/TrEMBL:B0TLB4"
FT                   /protein_id="ABZ74587.1"
FT                   /translation="MAKLIGIAFKAEKRAAMISVAQAEVTQARGVEEDIFGRPSNRHIN
FT                   QSAHIQLNDYVSLTG"
FT   gene            complement(16120..16365)
FT                   /locus_tag="Shal_0012"
FT   CDS_pept        complement(16120..16365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0012"
FT                   /product="SirA family protein"
FT                   /note="PFAM: SirA family protein; KEGG: slo:Shew_0015 SirA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74588"
FT                   /db_xref="GOA:B0TLB5"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR022931"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TLB5"
FT                   /protein_id="ABZ74588.1"
FT                   /translation="MNDQFSAAQHQLDALGLRCPEPVMMVRKSVRRMNDGETLLIIADD
FT                   PATTRDIPSFCEFMDHTLIASQTESTPYQYLIKKGL"
FT   gene            complement(16512..16979)
FT                   /locus_tag="Shal_0013"
FT   CDS_pept        complement(16512..16979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0013"
FT                   /product="ybaK/ebsC protein"
FT                   /note="TIGRFAM: ybaK/ebsC protein; PFAM: YbaK/prolyl-tRNA
FT                   synthetase associated region; KEGG: vfi:VF1792 regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74589"
FT                   /db_xref="GOA:B0TLB6"
FT                   /db_xref="InterPro:IPR004369"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:B0TLB6"
FT                   /protein_id="ABZ74589.1"
FT                   /translation="MTPAIDLLVKHKIAHQVHEYHHDPACQAYGLEAAEKIGVAPELVF
FT                   KTLVVKLDAKQLAVAIIPVAEKLSMKAIAKAAKAKKAVMAEAAEVQRSSGYVLGGVSPL
FT                   GQKRLLLTVIDASASQLEQMYVSGGRRGLDIALAPEDIKQLLKANFAPLTA"
FT   gene            complement(17018..17479)
FT                   /locus_tag="Shal_0014"
FT   CDS_pept        complement(17018..17479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0014"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   ppr:PBPRB1061 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74590"
FT                   /db_xref="GOA:B0TLB7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B0TLB7"
FT                   /protein_id="ABZ74590.1"
FT                   /translation="MKFVLLADNQPALPQVAKWYSDQWGYIGEGRSTKELELKLRDYLN
FT                   RDKLPLIILAQDGNEVIAAAQLRYHEMDIYPEREYWLGGVYVNSKHRGKGVAQALISAI
FT                   IDKAKILGVGSINLQTEYLSGGLYRDLGWQPIEQVVNHGINVLVMEKSL"
FT   gene            complement(17651..18814)
FT                   /locus_tag="Shal_0015"
FT   CDS_pept        complement(17651..18814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0015"
FT                   /product="acetyl-CoA C-acyltransferase FadA"
FT                   /EC_number="2.3.1.16"
FT                   /note="KEGG: slo:Shew_0018 acetyl-CoA C-acyltransferase
FT                   FadA; TIGRFAM: acetyl-CoA acetyltransferase; acetyl-CoA
FT                   C-acyltransferase FadA; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74591"
FT                   /db_xref="GOA:B0TLB8"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012805"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:B0TLB8"
FT                   /protein_id="ABZ74591.1"
FT                   /translation="MKNAVIVDCIRTPMGRSKAGVFRNVRAETLSAELMKSLLERNPKL
FT                   DPNTIEDVMWGCVQQTLEQGFNIARNAALLAGIPKQVGAVTVNRLCGSSMDALHQAARA
FT                   IMTGQGDTFIVGGVEHMGHVPMNHGVDFHPGLANNVAKGSAMMGLTAEMLGKMHGITRE
FT                   QQDAFAVRSHQRAHAATVEGRFANEIVAIEGHDADGALIRVDHDEVIRPETSMESLSGL
FT                   RPAFDPANGTVTAGTSSALSDGASAMLVMEEEKAKALGLPIRARIRSMAIAGCDAAIMG
FT                   YGPVPATQKALKRAGLTVDDLDVIELNEAFAAQSLPCVKDLGLMDVVDEKVNLNGGAIA
FT                   LGHPLGCSGTRISTTLINLMEAKDAKYGLATMCIGLGQGIATIFERP"
FT   gene            complement(18833..20986)
FT                   /locus_tag="Shal_0016"
FT   CDS_pept        complement(18833..20986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0016"
FT                   /product="fatty oxidation complex, alpha subunit FadB"
FT                   /note="TIGRFAM: fatty oxidation complex, alpha subunit
FT                   FadB; PFAM: Enoyl-CoA hydratase/isomerase;
FT                   3-hydroxyacyl-CoA dehydrogenase domain protein;
FT                   3-hydroxyacyl-CoA dehydrogenase NAD-binding; KEGG:
FT                   shn:Shewana3_0024 fatty oxidation complex, alpha subunit
FT                   FadB"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74592"
FT                   /db_xref="GOA:B0TLB9"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR012799"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TLB9"
FT                   /protein_id="ABZ74592.1"
FT                   /translation="MIYQSPTIEVELLEDNIAHLCFKAQGSVNKFDRETIDSLNAALDS
FT                   IKQDTSIKALMLSSAKDAFIVGADITEFLGLFAEEDAVLQSWLEQANVVFNKLEDLPFP
FT                   TLSAINGFALGAGCETILATDFRIADTTARIGLPETKLGIIPGFGGTVRLPRVIGADNA
FT                   LEWITSGKDQRPDAALKVGAIDAVVAPEQLRPAALRMLKDAMAEKLDWQTRRAKKLAPL
FT                   TLPKLEAMMSFATAKGMVFKIAGKHYPAPMAVISVIEQAAQCGRAEALQIEHQAFIKLA
FT                   KTEVAQALIGIFLNDQLVKGKAKKAGKLAKKVNSAAVLGAGIMGGGIAYQSASKGTPIV
FT                   MKDIAQPALDLGLGEAAKLLTAQVKRGRSTPAKMATVLNNITPALDYAPVKDTDIIVEA
FT                   VVEHPKVKSMVLAEVEEHVSEDAIITSNTSTISINLLAKSLKKPERFCGMHFFNPVHKM
FT                   PLVEVIRGENSSDETVASVVAYASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSGLLADG
FT                   ADFAAIDKVMEKQFGWPMGPAYLLDVVGLDTGHHAQAVMAEGFPDRMGKSGKDAIDVMF
FT                   EAERFGQKNNKGFYQYSVDHRGKPKKDLDPTSYELLQAEFGEQKAFESDEIIARTMIPM
FT                   IIETVRCLEEGIIASPAEADMGLVYGLGFPPFRGGVFRYLDTIGVANFVALADKYAHLG
FT                   GLYQVTDTMRELAANNGSYYQQA"
FT   gene            21349..22671
FT                   /locus_tag="Shal_0017"
FT   CDS_pept        21349..22671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0017"
FT                   /product="peptidase M24"
FT                   /note="PFAM: peptidase M24; KEGG: son:SO_0022 prolidase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74593"
FT                   /db_xref="GOA:B0TLC0"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR022846"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TLC0"
FT                   /protein_id="ABZ74593.1"
FT                   /translation="MEQLARLYHDHLRVLNQRVCEILSRENLSGLVIHSGQPHRQFLDD
FT                   LDYPFKVNPHFKAWLPVIDNPNSWLVVNGTDKPLLIFYRPVDFWHKVADEPNEFWAEHV
FT                   DIKFLTKADKVAEYLPADIDEWAYIGEHLDVADVLGFARRNPDSVLSYLNYHRATKTEY
FT                   ELACMRKANEIAVTGHQAAKTAFYNGASEFEILQVYLSAISQGENQVPYSSIVALNENS
FT                   AILHYTALEHTAPAQRRSFLIDAGANFNGYASDITRSYAFEKNIFDDLITAIDNMQLQI
FT                   INLMQPGVSYAQLHVETHYKLAQILLDFDIVSGDVQGLVEQGITSVFFPHGLGHMLGIQ
FT                   VHDMGGFLGDDKGAHIAVPEAHPFLRCTRELDVNQVLTIEPGVYIIDSLLNELKQDKRQ
FT                   SQINWNTVEVLRPFGGIRIEDNVIVHRDRIENMTRNWGLNR"
FT   gene            22740..23354
FT                   /locus_tag="Shal_0018"
FT   CDS_pept        22740..23354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0018"
FT                   /product="protein of unknown function UPF0029"
FT                   /note="PFAM: protein of unknown function UPF0029; Domain of
FT                   unknown function DUF1949; KEGG: slo:Shew_0021 protein of
FT                   unknown function UPF0029"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74594"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR015796"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:B0TLC1"
FT                   /protein_id="ABZ74594.1"
FT                   /translation="MSESYLIPAAELLIEEEIKHSRFISFLFHCQSSEELKCVLTNLKV
FT                   EYPGANHYCYAFVAGAPNDSINIGSSDDGEPSGSAGRPMLAALQGANIGEIGAVVIRYF
FT                   GGTKLGVGGLVRAYSSGIKQAIPQIETQLKQIRYPGKLLCEYHQLKDVEHIFAQFDVLI
FT                   EDKQFSDKIVIQFAIPKIFKEPLNLDLATMSKGQLKALFDD"
FT   gene            23478..24935
FT                   /locus_tag="Shal_0019"
FT   CDS_pept        23478..24935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0019"
FT                   /product="potassium uptake protein, TrkH family"
FT                   /note="TIGRFAM: potassium uptake protein, TrkH family;
FT                   PFAM: cation transporter; KEGG: slo:Shew_0022 potassium
FT                   uptake protein, TrkH family"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74595"
FT                   /db_xref="GOA:B0TLC2"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:B0TLC2"
FT                   /protein_id="ABZ74595.1"
FT                   /translation="MQYRTIIRITGLLMGLFSLSLLPPALVAVIYKDGGGMAFIQAFVL
FT                   CLILGFTLWYPNRSHRKDLRTREGFLLVVMFWVVLGSIGAVPFIFSGQPSLSLTDSFFE
FT                   SFSALTTTGATVIVGLDSLPKAILFYRHLLQWLGGMGIIVLAVAILPVLGVGGMQLYRA
FT                   EMPGPVKDSKMTPRIAETAKALWYIYLALTVACAVAYWLAGMDVFDAICHSFSTIAIGG
FT                   FSTHDASMGYFNSPTINLICVVFLLIAALNFSLHFAAFSRRGINLRVYFKDAEFKVLIA
FT                   IQLVLTAICFVTLYGSGIYDSAEETFDYALFQAVSISTTAGFGTESFHAWPLFLPILLI
FT                   FSSFIGGSGGSTAGGIKVIRVILLLLQGSRELKRLVHPRGMFSIRISGNALPDRVIDAV
FT                   WGFFSAYALVFVVCMLILMALGMDAITAFSATAACLNNLGPGLGEVASNYASIGDGEKW
FT                   VLLFAMLFGRLEVFTLLILFTPTFWKN"
FT   gene            25075..25602
FT                   /locus_tag="Shal_0020"
FT   CDS_pept        25075..25602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0020"
FT                   /product="Protoporphyrinogen oxidase"
FT                   /EC_number="1.3.3.4"
FT                   /note="KEGG: slo:Shew_0023 protoporphyrinogen oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74596"
FT                   /db_xref="GOA:B0TLC3"
FT                   /db_xref="InterPro:IPR026816"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B0TLC3"
FT                   /protein_id="ABZ74596.1"
FT                   /translation="MNNTLIIYSTVDGQTKAICEQIKKINQAQNAKVTLASLDEAESLG
FT                   LAQFDKILIAASIRYGKHRPELYQFINRHHAVLDAKQNAFFTVNVVARKPEKNTPETNP
FT                   YMKKFLQLSLWQPQQLAVFAGKIDYPKYRLFDKVMIRFIMWMTKGPTDTRGTFEFTDWN
FT                   KVDEFAHAFAER"
FT   gene            complement(25667..25972)
FT                   /locus_tag="Shal_0021"
FT   CDS_pept        complement(25667..25972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0021"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; KEGG:
FT                   shw:Sputw3181_0018 regulatory protein, ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74597"
FT                   /db_xref="GOA:B0TLC4"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0TLC4"
FT                   /protein_id="ABZ74597.1"
FT                   /translation="MQKEIDASAMVTNAESAAKWLKAIANPYRLMILCLLLDKELSVTE
FT                   LNKTVPLSQSALSQHLAVLRSEDLVATRKSSQIVYYTLKNEQVTEVISILHRKYCA"
FT   gene            26185..26724
FT                   /locus_tag="Shal_0022"
FT   CDS_pept        26185..26724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0022"
FT                   /product="Protoporphyrinogen oxidase"
FT                   /EC_number="1.3.3.4"
FT                   /note="KEGG: slo:Shew_0025 protoporphyrinogen oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74598"
FT                   /db_xref="GOA:B0TLC5"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR026816"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B0TLC5"
FT                   /protein_id="ABZ74598.1"
FT                   /translation="MKSVLVLYYSRGGHTARISRAISDHLASQGHQCDMMHISEAKAEG
FT                   VDWAKYDVVALGACVLYGSYHKSVFEFAAAHQAELSAKASSFFSVNVVARNPEKCVPEN
FT                   NKYLQKFIELSAWKPNDVKVIAGKVDYPAWRWYDRMMIQLIMKITNGPTDPKAVIDYTD
FT                   WDDVKVYADHLVSLAK"
FT   gene            complement(26783..28225)
FT                   /locus_tag="Shal_0023"
FT   CDS_pept        complement(26783..28225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0023"
FT                   /product="potassium uptake protein, TrkH family"
FT                   /note="TIGRFAM: potassium uptake protein, TrkH family;
FT                   PFAM: cation transporter; KEGG: slo:Shew_3740 potassium
FT                   uptake protein, TrkH family"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74599"
FT                   /db_xref="GOA:B0TLC6"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:B0TLC6"
FT                   /protein_id="ABZ74599.1"
FT                   /translation="MLNYRPLLFILGVFLSTLTAFMLIPGAFALYYGEETVGAFMVSSL
FT                   VAGSAASFCMHQGQSSKLHLNIRDMFLLTCLTWIIVSLFAAMPFTLYHGINYTDAFFET
FT                   MSGITTTGSTVLSGLDSMDHSILIWRSLLQWLGGIGFIVMAVAVLPFLNVGGMRLFRTE
FT                   SSDWSDKTTPRTQHMAKNLFIVYCLLTFLCFLAYHSSGMNWFDAINHAMTTLSTGGYST
FT                   SDKSMAAFSNEAHWVGTIFMIAGGLPLLMFVYMVQQRSVNVWNDAQVKGFLKFVVFVSC
FT                   ALALWLWSSKDIAPLDALRLASFNVVSVVTTTGYGLTDYTAWGALANIAFLFLMFVGSC
FT                   SGSTSGGIKIFRFQIAGVIMREQLKQQFHPNGVFRERYNHHIIRGDIVRSLVTFILLFV
FT                   LVIVVLSIILVLTGLDPVTSFTGAITAVTNVGPGLGSTIGPAGNFSSLPDVAKWALAIG
FT                   MLLGRLEILTVAVLFHPSFWKY"
FT   gene            complement(28246..29655)
FT                   /locus_tag="Shal_0024"
FT   CDS_pept        complement(28246..29655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0024"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; TrkA-C domain protein;
FT                   KEGG: slo:Shew_3739 TrkA-N domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74600"
FT                   /db_xref="GOA:B0TLC7"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:B0TLC7"
FT                   /protein_id="ABZ74600.1"
FT                   /translation="MKIIILGAGQVGGTLAENLVGENNDITIVDHDKNRLRSLQDKYDL
FT                   RVVVGHGAHPSVLKEAGAEDADMLIAVTNSDECNMAACQIAYSLYGTPTKIARIRSEQY
FT                   LGLRDKLFIDSETKNADNRPRGGFIIDELIAPEQLVTAYIGRLVEYPGALQVLEFAEGR
FT                   LSLVAVRAYYGGPLVGNALAALREHMPNIDTRVAAIFRQGRPIMPRGTTIIEADDEVFF
FT                   VADSRHVRAVMSEMQKLDNSYRNIMIAGGGNIGLGLAKQLQRNHSVKLIERKQERAEEL
FT                   SERLENTTVFCGDASDQELLLEEHIDQTDVFIAVTNDDEANIMAALLAKRMGAKKVMVL
FT                   IQREAYVDIVQEANIDIAISPQQATISALLTHIRQGDICNVYSLRRGAAEAIEAIAHGD
FT                   SNTSKVVGKQISEIKLPPGTTIGAIVRDEEVLMAHDKTVIEQGDHVILFLVNKKFIGEV
FT                   EKLFQPSAFFF"
FT   gene            complement(29663..30943)
FT                   /locus_tag="Shal_0025"
FT   CDS_pept        complement(29663..30943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0025"
FT                   /product="sun protein"
FT                   /note="TIGRFAM: sun protein; PFAM: Fmu (Sun) domain
FT                   protein; NusB/RsmB/TIM44; KEGG: slo:Shew_3738 sun protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74601"
FT                   /db_xref="GOA:B0TLC8"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:B0TLC8"
FT                   /protein_id="ABZ74601.1"
FT                   /translation="MNLRALAAKVVFQVLEKGISLSVALPVQQKHLDSGKDKALLAELC
FT                   YGVMRHLPQLDKQVSDCMSKQMKGKQRIVHQLLLVGCYQLYFTRIPSHAAISETAEACR
FT                   QLKFEGLVKVVNGVLRNIQRQEKPLSTDNDTLAYNTPAWIIKRLQAAYPDNWQTVIEQS
FT                   HERPPMWLRNNQQSQTRETYLQALAGLDIEAQAGNSPDSILLSSPRDVMQLPGFESGAA
FT                   SVQDGAAQWAATLLAPQGDELVLDACAAPGGKSCHLLELAPDIKLVAVDFDAKRLERVQ
FT                   QNLDRLSLKAELVHGDAANIDSWWQGDKFDRILLDAPCSATGVIRRHPDIKWLRKNNDI
FT                   EELAQLQSQIFDHCWKWLKPGGTLLYATCSILPQENKDQVSAFLARTPDATLVPIEQQA
FT                   NPDDIGWQIVPGQDNMDGFYYARLVKD"
FT   gene            complement(30950..31915)
FT                   /locus_tag="Shal_0026"
FT   CDS_pept        complement(30950..31915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0026"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /note="TIGRFAM: methionyl-tRNA formyltransferase; PFAM:
FT                   formyl transferase domain protein; KEGG: shm:Shewmr7_0026
FT                   methionyl-tRNA formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74602"
FT                   /db_xref="GOA:B0TLC9"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TLC9"
FT                   /protein_id="ABZ74602.1"
FT                   /translation="MKPLNVIFAGTPDFAARHLQALIDSEHNVIAVYTQPDRPAGRGKK
FT                   LQASPVKALALENGIAVFQPKSLRDEDAQAELTALNADIMVVVAYGLILPKVVLDTPRL
FT                   GCINVHGSILPRWRGAAPIQRALWAGDSETGVTIMQMDIGLDTGDMLLKTQLKIEDSDT
FT                   SATLYEKLAEQGPSALIEALAGIAQDSLPAEKQDESLANYAEKLSKEEARLDWSKSATA
FT                   LWREIRAFNPWPVSHYEHEGNTIKVWQSHVSDETSSKLPGTILSADKNGISIATGEGVL
FT                   IITQMQLPGKKPLSVADILNSRADWFTPGTVLTSTDNQEA"
FT   gene            complement(31920..32519)
FT                   /locus_tag="Shal_0027"
FT   CDS_pept        complement(31920..32519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0027"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="KEGG: slo:Shew_3736 peptide deformylase; TIGRFAM:
FT                   peptide deformylase; PFAM: formylmethionine deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74603"
FT                   /db_xref="GOA:B0TLD0"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:B0TLD0"
FT                   /protein_id="ABZ74603.1"
FT                   /translation="MPLTTKIEPLAKVSITNWLRFDRLVKSLGMSLLKVLQFPDERLRT
FT                   VAKPIAEFNAALQTQIDDMFETMYEEKGIGLASTQVNYHHQLIVMDLQDDVERPKVFIN
FT                   LEIVAKSGDFCNEEGCLSVPGVYAKVDRAEFVTIKALDRDGNEFSLEADGLFAICLQHE
FT                   LDHLSGKLFVDYLSPLKRQRIKQKLEKAARLEAKQG"
FT   gene            32569..33669
FT                   /locus_tag="Shal_0028"
FT   CDS_pept        32569..33669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0028"
FT                   /product="Peptidoglycan-binding LysM"
FT                   /note="PFAM: Peptidoglycan-binding LysM; KEGG:
FT                   slo:Shew_3735 peptidoglycan-binding LysM"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74604"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:B0TLD1"
FT                   /protein_id="ABZ74604.1"
FT                   /translation="MDTLMKRLILLASLIVGCTSVFADTLTLKSGHPDSYVVEKGDTLW
FT                   DISAFFLKDPWRWPKLWGANPQVANPHLIYPGDKLTLVFIDGEPRLVVKPHVRKSPQGR
FT                   ISPKDGAIPAIDLSLIQPYLLQNRVVEADWFELQPKVMGGESPSKFHVVSDIIYVQGEL
FT                   TVGDKLGVYLDGRTFKNTDGENLGLEVILSASGRVVESGSISKVELLSSLQETAAGYRV
FT                   LPIEDDSLMSAYFMPRAAELKEPATVLASGKDIREMGKLDVVYLDRGATDGLETGHVFS
FT                   IFKNGEVVVIDGDGVPVQPHDRNRYEKMLANISSDSAVKMPDLYRGKLMVFKVFDKTSM
FT                   GIILVNERPVRVADKLAIPDSLISSE"
FT   gene            33823..34842
FT                   /locus_tag="Shal_0029"
FT   CDS_pept        33823..34842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0029"
FT                   /product="DNA protecting protein DprA"
FT                   /note="TIGRFAM: DNA protecting protein DprA; PFAM: SMF
FT                   family protein; KEGG: slo:Shew_3734 DNA protecting protein
FT                   DprA"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74605"
FT                   /db_xref="GOA:B0TLD2"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:B0TLD2"
FT                   /protein_id="ABZ74605.1"
FT                   /translation="MDVAELRQRLAHEPQALPLPESLLQSNLSPDYALVDAALTWQQAA
FT                   DNHHLVCLGDPLYPPLLKQINDPPAVLFLKGNLDALLFPGIAVVGSRNATLGGKKVAYE
FT                   LAIQLALHSLAITSGMALGIDGAAHQAAIDIEKPSVAVLGTGADVIYPKRHRSIYHDIQ
FT                   KDGCILSEFWPDVKPFAGNFPKRNRIISGLTIGTLVVEASLKSGSLITARLANEQGREV
FT                   FAVPGSVLSGQSEGSHQLLRDGAKLVESVADILEEVTALSQFHLEELRSRHHIGGESAS
FT                   DLPFSSLLASVGYETTTINDVVEHSGKTIELVLEQLLELELQGWITAVPGGYIRLKRS"
FT   gene            34845..35318
FT                   /locus_tag="Shal_0030"
FT   CDS_pept        34845..35318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0030"
FT                   /product="protein of unknown function DUF494"
FT                   /note="PFAM: protein of unknown function DUF494; KEGG:
FT                   shw:Sputw3181_0027 protein of unknown function DUF494"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74606"
FT                   /db_xref="InterPro:IPR007456"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TLD3"
FT                   /protein_id="ABZ74606.1"
FT                   /translation="MFDILMYLFENYVHSEVELLVDQDELTKELTRAGFHQSEIIKALS
FT                   WLERLADIQEAGTPYLCNHDQQSFRIYTKAEMEKIDVESRGFLLFLEQIKVLSVETREM
FT                   VIDRVMEIDEPTLNLDDLKWVILMVLFNAPGHESAYEQMEDLIFEQPDGRLHS"
FT   gene            complement(35594..37366)
FT                   /locus_tag="Shal_0031"
FT   CDS_pept        complement(35594..37366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0031"
FT                   /product="Microbial collagenase"
FT                   /EC_number="3.4.24.3"
FT                   /note="PFAM: Peptidase M9A collagenase domain protein;
FT                   KEGG: slo:Shew_3732 microbial collagenase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74607"
FT                   /db_xref="GOA:B0TLD4"
FT                   /db_xref="InterPro:IPR002169"
FT                   /db_xref="UniProtKB/TrEMBL:B0TLD4"
FT                   /protein_id="ABZ74607.1"
FT                   /translation="MNTPSKFAITIIASLLASLSGCASVKQQNANPQLVNQINAASETA
FT                   LFDAQSPLLTTDAFTQASFALASSKDIAVIDKLLYYFRAFSYYGPVDDLSDADIAALAE
FT                   ALEEISDSGLLDVQVRLQEQYAVTLYRYFANNDAAPALAPLLPQLEVQLKQLAASTPNK
FT                   ANDYALLETLKAYGFLLNKSRKEVDGELNKVLLATDLNSALIDFAASAESIRANNDWPR
FT                   TNAYWALALYRLALPSSEDGEDTEQELALDAAVAAIAKADVTLRGDAAKDAYTAGFHVN
FT                   VFAGQELCEENSDICRIPELKTALPIEHHCSDSLFILTQDLNEQELAESCKKLTSQESN
FT                   FHSVLKTQLKPAPNDFNTALRVVAFKNWSQYHLNGQLIFDINTDNGGMYIEGTPSKPGN
FT                   QATFFAYRQWWIEPEFKVWNLNHEYVHYLDGHFVKYAGFGHFPEKMVWWSEGLAEYISK
FT                   GDDNPSALRVIKRDIGEAPTLEEIFATEYKDGQDRTYKWSYMAIRFLVENYHSEFVQLS
FT                   HYLKTDYFEGYDQLMASLTQHQAQFSTWLDTQVGEFDDNEEKTKPRLHKQGRYDYRDYL
FT                   QPQHLAHGENHLKF"
FT   gene            37503..38066
FT                   /locus_tag="Shal_0032"
FT   CDS_pept        37503..38066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0032"
FT                   /product="DNA topoisomerase type IA zn finger domain
FT                   protein"
FT                   /note="PFAM: DNA topoisomerase type IA zn finger domain
FT                   protein; KEGG: sbm:Shew185_0031 DNA topoisomerase type IA
FT                   zn finger domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74608"
FT                   /db_xref="GOA:B0TLD5"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="UniProtKB/TrEMBL:B0TLD5"
FT                   /protein_id="ABZ74608.1"
FT                   /translation="MAKIDQQLFTTHEHALEKEFELCPKCGCELSVKHSKHGGFIGCNN
FT                   YPSCDYTRPLVQHESIETQVIQGSVCPDCGNELAVKSGRFGIFIGCTNYPACSHIEKHD
FT                   KADAEDEIACPKCKKGHIEHRTSRFGKSFYACSAYPKCKFLVNYPPVAETCPDCGCGIL
FT                   VERKGAAGMRLECPEKTCKYKRPV"
FT   gene            38154..38717
FT                   /locus_tag="Shal_0033"
FT   CDS_pept        38154..38717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0033"
FT                   /product="SUA5/yciO/yrdC domain"
FT                   /note="PFAM: SUA5/yciO/yrdC domain; KEGG: sbm:Shew185_0032
FT                   SUA5/YciO/YrdC/YwlC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74609"
FT                   /db_xref="GOA:B0TLD6"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR023535"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TLD6"
FT                   /protein_id="ABZ74609.1"
FT                   /translation="MLEVLPADVAELVEQGGVIAYPTEAVYGLGCDPDNDDAIERLLEI
FT                   KLRPWQKGLILVAGDYQQLLPYIDESQLSAEQLAFVHSKWPGPFTFIMPVKPGLSNLLS
FT                   GSFDSIAVRVTAHEGVKALCAAINKPIVSTSANLTGQDPALSGAAVKQQFEGIIAGLVI
FT                   GDLGIQASPSTIIDAKSGQVIRKG"
FT   gene            38739..39653
FT                   /locus_tag="Shal_0034"
FT   CDS_pept        38739..39653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0034"
FT                   /product="Coproporphyrinogen oxidase"
FT                   /EC_number="1.3.3.3"
FT                   /note="PFAM: coproporphyrinogen III oxidase; KEGG:
FT                   son:SO_0038 coproporphyrinogen III oxidase, aerobic"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74610"
FT                   /db_xref="GOA:B0TLD7"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TLD7"
FT                   /protein_id="ABZ74610.1"
FT                   /translation="MNAPDSTLVKAFLLDLQHRICNGLEALDGSAKFAEDAWKREEGGG
FT                   GQSRVLTGGTVFEQAGVNFSHVMGASMPASATAHRPELAGRSFEAMGVSLVIHPNNPHI
FT                   PTTHANVRFFIAHKDGADPVWWFGGGFDLTPYYPYLEDVVEWHQSAKSLCEPFGDEIYP
FT                   EYKQWCDEYFFLPHRNETRGVGGLFFDDLNKQGFDTSFAFMQAVGNGFLTAYAPIVERR
FT                   KDTVYGEHERQFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSMPPLVRWEYAYT
FT                   PEAGSAEAALYSDYLKPRDWLTL"
FT   gene            39744..40583
FT                   /locus_tag="Shal_0035"
FT   CDS_pept        39744..40583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0035"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /note="TIGRFAM: shikimate 5-dehydrogenase; PFAM:
FT                   Shikimate/quinate 5-dehydrogenase; Shikimate dehydrogenase
FT                   substrate binding domain protein; KEGG: slo:Shew_3727
FT                   shikimate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74611"
FT                   /db_xref="GOA:B0TLD8"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TLD8"
FT                   /protein_id="ABZ74611.1"
FT                   /translation="MARVENMTERYAVFGNPIGHSKSPKIHTMFAKETGQSLSYEAILA
FT                   PIDAFEASFKEFAANEGYGANVTVPFKEQAFSLCDELSEQAQLAGAVNTLSVLADGKIR
FT                   GDNTDGLGLVADLKRNLGDLCGLQVLLIGAGGAARGSVLPLLHSGIAKLTIVNRTQAKA
FT                   EALVEIFTSYGDVTSLPITHVGQSYDVIINSTSSSLSGEVPNISPDTIAPHTVCYDMMY
FT                   GKQSTAFNLWAKSLGAGQTIDGLGMLVGQAAASFSIWRKVTPSVEPVLAQLRSELIG"
FT   gene            40614..40892
FT                   /locus_tag="Shal_0036"
FT   CDS_pept        40614..40892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0036"
FT                   /product="protein of unknown function DUF1488"
FT                   /note="PFAM: protein of unknown function DUF1488; KEGG:
FT                   shn:Shewana3_0044 protein of unknown function DUF1488"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74612"
FT                   /db_xref="InterPro:IPR009962"
FT                   /db_xref="InterPro:IPR036692"
FT                   /db_xref="UniProtKB/TrEMBL:B0TLD9"
FT                   /protein_id="ABZ74612.1"
FT                   /translation="MNQSILFPDLQDWDQQSQTIIFPAQVQGANVECRISLAKLTSLSS
FT                   ATIKPDEQDIESKVLALFDEYRFDIEEEVEALIEQEAFDEQGKVILL"
FT   gene            complement(40938..41495)
FT                   /locus_tag="Shal_0037"
FT   CDS_pept        complement(40938..41495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0037"
FT                   /product="carbonic anhydrase, family 3"
FT                   /note="KEGG: sbm:Shew185_0037 carbonic anhydrase, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74613"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:B0TLE0"
FT                   /protein_id="ABZ74613.1"
FT                   /translation="MPSSRNHNSLRPYKGIVPTLKSNVYVDEACVLVGDITLDDDASVW
FT                   PLVAARGDVNHIYIGKRSNIQDGTVLHVTRKSPSLPDGHPLIIGDDVTIGHKAMLHGCR
FT                   VGNRILVGMGAIILDGAILEDDVILGAGSLVPPGKVLKSGFLYVGSPAKQARPLTDAEL
FT                   AFLPQSADNYVRLKNEYLQEGE"
FT   gene            42149..43683
FT                   /locus_tag="Shal_R0001"
FT   rRNA            42149..43683
FT                   /locus_tag="Shal_R0001"
FT                   /product="16S ribosomal RNA"
FT   gene            44074..46968
FT                   /locus_tag="Shal_R0002"
FT   rRNA            44074..46968
FT                   /locus_tag="Shal_R0002"
FT                   /product="23S ribosomal RNA"
FT   gene            47111..47226
FT                   /locus_tag="Shal_R0003"
FT   rRNA            47111..47226
FT                   /locus_tag="Shal_R0003"
FT                   /product="5S ribosomal RNA"
FT   gene            47327..47403
FT                   /locus_tag="Shal_R0004"
FT                   /note="tRNA-Asp1"
FT   tRNA            47327..47403
FT                   /locus_tag="Shal_R0004"
FT                   /product="tRNA-Asp"
FT   gene            47722..47976
FT                   /locus_tag="Shal_0038"
FT   CDS_pept        47722..47976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0038"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="PFAM: protein of unknown function UPF0153; KEGG:
FT                   slo:Shew_3811 protein of unknown function UPF0153"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74614"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:B0TLE1"
FT                   /protein_id="ABZ74614.1"
FT                   /translation="MNCRLGCGACCIAPSITTPIPGMPDGKPAGIRCIQLDDSNLCKLF
FT                   GQQQRPAVCGLFAATEDACGKTNAEALWLIGSLEMATSA"
FT   gene            48028..48477
FT                   /locus_tag="Shal_0039"
FT   CDS_pept        48028..48477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0039"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="TIGRFAM: putative transcriptional regulator, Rrf2
FT                   family; PFAM: protein of unknown function UPF0074; KEGG:
FT                   shn:Shewana3_0047 transcriptional regulator, BadM/Rrf2
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74615"
FT                   /db_xref="GOA:B0TLE2"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0TLE2"
FT                   /protein_id="ABZ74615.1"
FT                   /translation="MQLTRYTDYGLRTLMYLAVNSERESLFRISEITEVFDLSANHISK
FT                   VVHHLGKLGYLQTVRGKSGGFKLAKPAAEINIGQVVRALENSLAPIDCSKPYCLFTPAC
FT                   KLKGALGDAVNAYLAVLDAYTLDMIVTNKQELKSLLPDLSISILQ"
FT   gene            complement(48463..49155)
FT                   /locus_tag="Shal_0040"
FT   CDS_pept        complement(48463..49155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0040"
FT                   /product="protein of unknown function DUF610 YibQ"
FT                   /note="PFAM: protein of unknown function DUF610 YibQ; KEGG:
FT                   sbl:Sbal_4335 protein of unknown function DUF610, YibQ"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74616"
FT                   /db_xref="GOA:B0TLE3"
FT                   /db_xref="InterPro:IPR006837"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:B0TLE3"
FT                   /protein_id="ABZ74616.1"
FT                   /translation="MAIIIDDLGYRQSDKAVLSLPANITLSILPHTPLGQSLAREAYLQ
FT                   GNEVLVHLPMQALNGKAIGPGALTNTMSETELKTQIADSINSVPNASGANNHMGSLLTQ
FT                   LNSPMRWVMESLQQHNLYFIDSMTTKYTRAGAIAESMGVPLLRREIFLDNDRSPAGLEK
FT                   QFNYAISLAHTKRNIVVIAHPYPETIEFLNENLHRLQSSNIDLVPTSQLLPQRVATKSL
FT                   ADQALLQD"
FT   gene            complement(49225..50430)
FT                   /locus_tag="Shal_0041"
FT   CDS_pept        complement(49225..50430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0041"
FT                   /product="carboxyl-terminal protease"
FT                   /EC_number="3.4.21.102"
FT                   /note="KEGG: slo:Shew_3808 carboxyl-terminal protease;
FT                   TIGRFAM: carboxyl-terminal protease; PFAM: peptidase S41;
FT                   SMART: PDZ/DHR/GLGF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74617"
FT                   /db_xref="GOA:B0TLE4"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:B0TLE4"
FT                   /protein_id="ABZ74617.1"
FT                   /translation="MSQCIRYFCCLAVGLALGLSVTLSGQEHTQEYKSHLSYPVLLDII
FT                   DTVETYYVQKFTEEELIEAAIEGIFNKLDPYSSFLDKQTFTSMQELNSGEYFGFGVEIA
FT                   TDNDQITIVTPFAESPAEAAGIKPGDRVIKLNKQRVTAEKLESILNEIKQHSLDNQPIE
FT                   LEMVRANSDVHYSVTISPSLIAINSVEAEILDNQIGYIRLSSFQENTTQELVKQLSAWQ
FT                   SEKLNGIILDLRNNPGGLLDQAITVADIFLDKGRIVATEGRFFDANSDYYASPQTMATN
FT                   IPLSVLINKGSASASEVLAAALQENGRAKLIGQTSFGKGTIQSLIPTLMDGNAIKLTIA
FT                   KYTTPNGKDINSKGIEPDIKIELEAVSDEESMPIIEKNSLRESVAQDKLVSSAIAWIQA
FT                   EK"
FT   gene            complement(50464..51597)
FT                   /locus_tag="Shal_0042"
FT   CDS_pept        complement(50464..51597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0042"
FT                   /product="peptidase M23B"
FT                   /note="PFAM: peptidase M23B; KEGG: slo:Shew_3807 peptidase
FT                   M23B"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74618"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:B0TLE5"
FT                   /protein_id="ABZ74618.1"
FT                   /translation="MNIRFFIKASIIAGFLSLPLTVNATDLERRQSELKSIQVQINKQQ
FT                   SAVKNTSKQRERLVSLLKDDEKAIAQAARKVNTTKQALAKTDKKIAELDRKHVQLDKLK
FT                   KAQQKSLSNQLASAYLAGNHDYTKMLLNQQSPASIERLLAYYQYLNNARIDSINQLQTT
FT                   LKELDQIQADQQEQQNRLNQLVLEQQQQAKKLNQEQSQRQNTLTQLQRTLNNSGAKLEQ
FT                   LQIEEASLKRVVEQALLAMKNNPSYEGLSSRNKLKWPTKGHIKSAFGSRRSGQVKWKGV
FT                   IISADEGQNVSAIAGGKVIYADWLRGFGMVLVVDHGKGYMSLYGHAQALLKSAGDSVSK
FT                   GEPVALVGRSGGQTEPGLYFEVRHKGQAVDPARYCKR"
FT   gene            complement(51870..53414)
FT                   /locus_tag="Shal_0043"
FT   CDS_pept        complement(51870..53414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0043"
FT                   /product="phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent"
FT                   /note="KEGG: slo:Shew_3806 phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent; TIGRFAM:
FT                   phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent; PFAM: metalloenzyme
FT                   domain protein; BPG-independent PGAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74619"
FT                   /db_xref="GOA:B0TLE6"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TLE6"
FT                   /protein_id="ABZ74619.1"
FT                   /translation="MMTRKRPLALLILDGWGYRENTQKNAVFHANTPVLDQLTAKYPNS
FT                   LISGSGIDVGLPDGQMGNSEVGHINIGSGRIVYQELTRISKAIDDGEFDTNPTLIKAID
FT                   DAIKADAAVHIMGLLSPGGVHSHQDHIEAMCRLSVKRGAKKVYLHAFLDGRDTPPRSAK
FT                   PGLAHFEELFKTLGTGQVASLIGRYYAMDRDNRWDRVSQAYELITEGKGLHQATSAVEG
FT                   IEAAYTRDENDEFVGSTAIPDAQGNIIKLEDNDALIFMNFRADRARQITRSFINADFDG
FT                   FKRAVTPKINFVMLTEYAADIKAAIAYPSSDLVNTLGETLQNRDLTQLRISETEKYAHV
FT                   TFFFNGGKEEPFKGEDRILVQSPKVATYDLQPEMSSVELTDKLVEAIESTQYDVIICNY
FT                   PNGDMVGHTGNFDAAVKACEAVDSCIGRIVEALEKVGGECLITADHGNAEQMTDESTGQ
FT                   AHTAHTSELVPLIYVGRDAEIEKGGRLSDLAPTMLTLMGQEVPAEMTGRSIIQLKE"
FT   gene            53653..54087
FT                   /locus_tag="Shal_0044"
FT   CDS_pept        53653..54087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0044"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: slo:Shew_3805
FT                   rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74620"
FT                   /db_xref="GOA:B0TLE7"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B0TLE7"
FT                   /protein_id="ABZ74620.1"
FT                   /translation="MQEYMEFFKANPMLSVAWVGLFIGLIVITIKTSVSKVKNVDHQEA
FT                   TMMINKQDAKVVDVRGKEEFKKGHIVGAINLPLADIKNNQLKTLENSKASPIIMVCNAG
FT                   MTSSQAAQLMVKHGFENVTNLKGGMGEWQSNNLPVSKSKR"
FT   gene            54318..54803
FT                   /locus_tag="Shal_0045"
FT   CDS_pept        54318..54803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0045"
FT                   /product="protein-export protein SecB"
FT                   /note="TIGRFAM: protein-export protein SecB; PFAM: protein
FT                   export chaperone SecB; KEGG: sdn:Sden_3696 protein-export
FT                   protein SecB"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74621"
FT                   /db_xref="GOA:B0TLE8"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TLE8"
FT                   /protein_id="ABZ74621.1"
FT                   /translation="MAEVANNEQQGPQFNIQRVYTKDISFETPNSPAVFQKEWNPEVKL
FT                   DLDTRSNKLSDDVYEVVLSLTVTAKNGEETAFLCEVQQAGIFAIAGLTEQQLAHSLGAY
FT                   CPNVLFPYAREAIGSLVSRGTFPQLNLAPVNFDALFAQYVQQRQAAAADAPAEEANA"
FT   gene            54808..55827
FT                   /locus_tag="Shal_0046"
FT   CDS_pept        54808..55827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0046"
FT                   /product="Glycerol-3-phosphate dehydrogenase (NAD(P)(+))"
FT                   /EC_number="1.1.1.94"
FT                   /note="PFAM: NAD-dependent glycerol-3-phosphate
FT                   dehydrogenase domain protein; Ketopantoate reductase
FT                   ApbA/PanE domain protein; KEGG: slo:Shew_3803
FT                   glycerol-3-phosphate dehydrogenase (NAD(P)(+))"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74622"
FT                   /db_xref="GOA:B0TLE9"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TLE9"
FT                   /protein_id="ABZ74622.1"
FT                   /translation="MKNTADITVLGAGSYGTALAISLASNGHRTMLWGHEPEHIENLKN
FT                   DKSNEAFLPGIPLPDLLIPEADLATALAASNNVLVVVPSHVFGLVLSQAKPLLRKDSRI
FT                   VWATKGLEPETGRLIQDVAREVLGDEYPLAVLSGPTFAKELAAGMPTAISIAGTDPQFT
FT                   KDLVELLHSPKRLRVYANDDFIGLQLGGAVKNVIAIGAGLSDGIGFGANARTALITRGL
FT                   VELTRLGEAMGAQASTFMGMAGLGDLVLTCTDNQSRNRRFGLALGKGSDVEAAQEEIGQ
FT                   VVEGYRNTKEVYTLAKRLGVEMPITEQVYQVLYKGKSPVDAAKELLSREQKSETSSAE"
FT   gene            56080..57264
FT                   /locus_tag="Shal_0047"
FT   CDS_pept        56080..57264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0047"
FT                   /product="HI0933 family protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; HI0933 family protein; FAD
FT                   dependent oxidoreductase; FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; KEGG: slo:Shew_3802
FT                   HI0933 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74623"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B0TM30"
FT                   /protein_id="ABZ74623.1"
FT                   /translation="MKHHDVIIIGAGAAGLMCAATAGYRGRDVLVLDNAKQAGRKILIS
FT                   GGGRCNFTNQKVEPANFICSNHHFVKSALARYRSSDFIELVERHGIEYHERDHGQLFCN
FT                   DSAKEIVTMLLTECEWAGAQIKLRTEISEITKNSEGLFEVLTDKEHYSCQSLVIATGGL
FT                   SMPKLGASPYGYHIAEQFGLKVLSTHAGLVPFTWHSEQKQRFEPLSGIAVPSTITAKDG
FT                   TQFSEALLFTHRGLSGPTILQISNYWNPGEAISINLLPGEDVRAKIQQALEASPKQSLR
FT                   NALSQWLPKRLVEVLFDESLLNKALNQLVHAEREQLALDLESWTLVMNGTEGYRTAEVT
FT                   LGGIDTDELSSKTMEAKSVPGLFFAGEVMDVSGWLGGFNFQWAWSSGVAAGQAA"
FT   gene            57512..58129
FT                   /locus_tag="Shal_0048"
FT   CDS_pept        57512..58129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0048"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: slo:Shew_3799 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74624"
FT                   /db_xref="UniProtKB/TrEMBL:B0TM31"
FT                   /protein_id="ABZ74624.1"
FT                   /translation="MDVLLMKKLIAASILVSLSSAASADEQETLDMSDPTAVYSSLGIS
FT                   VDTREDLDVNGGFAWGVNQLLIETKGGGDSVSLTYARMTEGSGLYAETTFNKDLRSVNA
FT                   GYITTFSLAESMKLYPVIMGGYINDEVSDDVTPIMSTGFYFRYNFGSGFHLGVDPFYTI
FT                   GTDSFDSFVVDTFLGYQYKSHRFRVGIDEDKEVSLEYKIAFF"
FT   gene            58290..59240
FT                   /locus_tag="Shal_0049"
FT   CDS_pept        58290..59240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0049"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cps:CPS_1250 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74625"
FT                   /db_xref="UniProtKB/TrEMBL:B0TM32"
FT                   /protein_id="ABZ74625.1"
FT                   /translation="MVSVRILMMISLCLTLNACDSGAKHVALGSLERQRIALTATTNEV
FT                   VVALPVAQGSIVTKGTVLVQLDDTQQKSHVAKALADVAQATANYEKLLKGAREEEIAAA
FT                   RAAVAGTRARLQESEANYRRIASMAKDNLASKADLDRALASRDADAANLESAQENLLEL
FT                   VSGSREEDIRFALANLQASEAVLLGEQKKLDDLTIRATRDGILDNLPWNLGERVTQGSP
FT                   LAVVLAGKAPFARVYVPEPYRVKISIGDALLVHVDGIDNPIEGKVRWISNEPAFTPYYA
FT                   LNQEERSRLMYLAEVQLPDSSAALPSGVPAQVEMP"
FT   gene            59237..60160
FT                   /locus_tag="Shal_0050"
FT   CDS_pept        59237..60160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0050"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: cps:CPS_1249 ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74626"
FT                   /db_xref="GOA:B0TM33"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0TM33"
FT                   /protein_id="ABZ74626.1"
FT                   /translation="MSETVIKTTQLCRDFGSLKAIQNLDFEVEKGQIYGFLGPNGCGKT
FT                   TAIRMLTGLLLPTAGDIEILGLQLPRDAEKLRLKIGYMTQKFSLYDDLTVKENLKFIAK
FT                   IYGLSRREQTARIQELLNTYGLEQKADQLAGSMSGGQKQRLGLAAATMHKPELLFLDEP
FT                   TSAVDPENRRDFWEKLFDLCEQGTTILVSTHYMDEAERCHKLAILEAGVKRVDGSPEQL
FT                   MQNMGAQVVEVESTSLRRLKQELLALPEVISAAQLGSRLRVLVKTSCHDPIAFLSQKQS
FT                   LALDALTLVRPSLEDVFVTCTGKGRQ"
FT   gene            60157..61302
FT                   /locus_tag="Shal_0051"
FT   CDS_pept        60157..61302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0051"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: cps:CPS_1248 ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74627"
FT                   /db_xref="GOA:B0TM34"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:B0TM34"
FT                   /protein_id="ABZ74627.1"
FT                   /translation="MKTLYRLQAIVMKELTQLKRDRMTFGMVVMIPLIQLMLFGFAINT
FT                   NIRDIPVGVVDQSQTALSRVLIQTVRATQVVEFTEHFYDTESAHAAIARGEVRAVLVIP
FT                   NDVSQRLVRHKTVGLGTPPSSDEETSRPVAQWIVDGSDTMVAAAIKSLRAMPLTALLGM
FT                   PANRTTPTFEVALFYNPEQRTAVNIVPGLVGVILTMTMIMFTSAAIVRERERGNLEMLI
FT                   TTPIRPIELMLGKIIPYMFIGIVQVIIILGLGYSVFDVPINGSLLQLAGATLLFIMASL
FT                   TLGLVISTIAKSQLQSMQMTIFVLLPSILLSGFMFPYEGMPIEAQYIAEALPATHFMRL
FT                   IRGVVLRDVEIIDMTYDVTWLAAFTIIGLIVASMRFKKNLG"
FT   gene            61627..62097
FT                   /locus_tag="Shal_0052"
FT   CDS_pept        61627..62097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0052"
FT                   /product="NLP/P60 protein"
FT                   /note="PFAM: NLP/P60 protein; KEGG: sbm:Shew185_0058
FT                   NLP/P60 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74628"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B0TM35"
FT                   /protein_id="ABZ74628.1"
FT                   /translation="MRFLAVLFFAALLSACSSAPSQLNSADKTPSLSNTPETKNQLIQM
FT                   HREWKGVPYRLGGMGKGGIDCSGFVLLTLQSRFGVQLPRTTAQQKEMGKSVSKSQLRAG
FT                   DLVFFKTGWSTRHVGIYIGDSQFLHASTSQGVMISSLNNSYWKQKYWLSRRL"
FT   gene            complement(62177..63109)
FT                   /locus_tag="Shal_0053"
FT   CDS_pept        complement(62177..63109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0053"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vpa:VP1357 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74629"
FT                   /db_xref="UniProtKB/TrEMBL:B0TM36"
FT                   /protein_id="ABZ74629.1"
FT                   /translation="MNKHLVTVMLLSAITFNSWANTNSDTTDIERKQPAHWSNLPIWGD
FT                   KARELGYQLPIPVGFNIYYNKQSVAYDAKDNFNLGLRGSGWLNKLNANVVIPADDVIIT
FT                   GEDESIQLRADAWVLPFLNIYGLAGYTKGHKDILADLSNAEGLGNSGIDMVLPIPIEYT
FT                   AYNLGLGAVLAGQAEVIPGMHPFIFTGVAAFTNSWTTTTDSTIQTYIGSVRMGQRYDVG
FT                   GDKLAFLVGYNYQMINQKIGGSYDFNIPLLGRPGGIAIDYDVHLVSSESHNMSVSMVYD
FT                   FGPKDEWNVFIEYGFLNWDQLLLSVGRRF"
FT   gene            complement(63133..64458)
FT                   /locus_tag="Shal_0054"
FT   CDS_pept        complement(63133..64458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0054"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bth:BT_1162 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74630"
FT                   /db_xref="GOA:B0TM37"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:B0TM37"
FT                   /protein_id="ABZ74630.1"
FT                   /translation="MNSSQDLLRVCLALATILFSNIINAEQSLQTLPTKSSEQPFFSSQ
FT                   QQAEERSQAYDDAIDTLDNKEDDCSTEQACDELSTAITDLEYAKRNHIDKNGLAMFDIL
FT                   GGPAFTPENGLMMALGGLYSFKTEREQSELQRSSVSLFGIVNKGEGDVGYSLRSRQNLF
FT                   FDNDDIRYSGLFVLADQSENFWGVGYDAGKKQPASDDTLLNKTSLTYHANLDFKSDYGF
FT                   YFGPALRLNYFKPDQTNLPPTAIDDENFQQFKDKPLSIGLGFSFNYDSRDVTVNAWQGQ
FT                   YLNFEYINYNPSFGSDNQYQKILIDQRYYLTLSLGKVLAFYNAYQWSEGEVPYYDLPTL
FT                   GGQSSLRGLYQGRYRDKSAIEHTLEYRHTFLRGNGELSAHGATIWAGVGSIAGTDIQLY
FT                   EKLLYSYGFGYRYELQPRMNVRVDLGFSDDDSGFYLTFTEAF"
FT   gene            64809..65342
FT                   /locus_tag="Shal_0055"
FT   CDS_pept        64809..65342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0055"
FT                   /product="molybdenum cofactor synthesis domain"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain; PFAM:
FT                   molybdopterin binding domain; KEGG: shw:Sputw3181_4025
FT                   molybdenum cofactor synthesis domain"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74631"
FT                   /db_xref="GOA:B0TM38"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:B0TM38"
FT                   /protein_id="ABZ74631.1"
FT                   /translation="MSKARIGIVTVSDRASAGVYEDLSGKAIIDVLNEYLTSEWEPIYE
FT                   VIPDEQDVISATLIKMADEQNCSLIVTTGGTGPAKRDVTPEATEAVCDRMMPGFGELMR
FT                   AESLKFVPTAILSRQTAGLRGDSLIVNLPGKPKSIRECLDAVFPAIPYCIDLMDGPFLE
FT                   CDESVIKPFRPKAK"
FT   gene            65381..65491
FT                   /locus_tag="Shal_0056"
FT   CDS_pept        65381..65491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0056"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saz:Sama_0068 molybdenum cofactor biosynthesis
FT                   protein Mog"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74632"
FT                   /db_xref="UniProtKB/TrEMBL:B0TM39"
FT                   /protein_id="ABZ74632.1"
FT                   /translation="MRSQSFPAIPYCIDLMDGPFLECDESVIKPFRPKAK"
FT   gene            65530..65640
FT                   /locus_tag="Shal_0057"
FT   CDS_pept        65530..65640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0057"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saz:Sama_0068 molybdenum cofactor biosynthesis
FT                   protein Mog"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74633"
FT                   /db_xref="UniProtKB/TrEMBL:B0TM39"
FT                   /protein_id="ABZ74633.1"
FT                   /translation="MRSQSFPAIPYCIDLMDGPFLECDESVIKPFRPKAK"
FT   gene            65679..65885
FT                   /locus_tag="Shal_0058"
FT   CDS_pept        65679..65885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0058"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saz:Sama_0068 molybdenum cofactor biosynthesis
FT                   protein Mog"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74634"
FT                   /db_xref="UniProtKB/TrEMBL:B0TM41"
FT                   /protein_id="ABZ74634.1"
FT                   /translation="MRSQSFPAIPYCIDLMDGPFLECDESVINTNQYKDLVAQREFSGY
FT                   EARQRVKSIVVLRLSSLTQHQSR"
FT   gene            66300..67958
FT                   /locus_tag="Shal_0059"
FT   CDS_pept        66300..67958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0059"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: sde:Sde_0081 putative
FT                   methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74635"
FT                   /db_xref="GOA:B0TM42"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:B0TM42"
FT                   /protein_id="ABZ74635.1"
FT                   /translation="MDWLVSLSIKRKLMAVMLVFGFTGCAILVDVVFRTAEVEQSFNEY
FT                   DQAAVNSQKYLLSISRDMNYVSRLSRSIMLGDDFSKNFNLLETRIQDIYKHFDDLDTSI
FT                   DFIVMDADRQHIYQLTNNSKQATTAFLEDGRTRMLALKSVERTPEVLQKAWTEYSKGAS
FT                   PFANEARLTFKKLTEGEAQLRSRIQAEAISALASMRLQLLGLTLVSFAFAGIVLFFVSR
FT                   AILRSVDNMQQSITSIEADSDLTRRIQITSQDELGQLSQSFNLMLDKFQASLQGVAETS
FT                   TSLAESSQGMAAITADAANSVQTQRDELEMVATAMNEMTATVVEVAKNANDAADAAVQT
FT                   DGQSQAGLAVVNSTVEAIENLAVGIERASQVVHDLERDSHQIGSILDVIKGISEQTNLL
FT                   ALNAAIEAARAGEQGRGFAVVADEVRTLASRTQASTEEIQAMIEKLQGGAKLAASAMSD
FT                   SRQYVDDSVSHARSAGEALQSIVVAIATITDMNTQIATAAEEQSTVSEEINANIVNISH
FT                   AAEQTANGTNISSQESENLAHMAKRLSVLVQEFKI"
FT   gene            complement(68037..69173)
FT                   /locus_tag="Shal_0060"
FT   CDS_pept        complement(68037..69173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0060"
FT                   /product="ABC-2 type transporter"
FT                   /note="KEGG: slo:Shew_3782 ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74636"
FT                   /db_xref="GOA:B0TM43"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:B0TM43"
FT                   /protein_id="ABZ74636.1"
FT                   /translation="MSNKIISMIRKELIDAARDKRSVMAGLYYAMGAPLLMCGMFFLLI
FT                   GQLTSPEDLNIKIGNAQGAPDLVKFLSSRGISQGDGEDTKDIQLIISDDYAANMAKGLS
FT                   AEVTLIADASNEKLQISIRRLEKSLQEYSGEMGSLRLIARGIDPRVMQPIKLNVEDKAT
FT                   PDSKAGMILGLATMTMIYAVFISGMNLAIDTSAGERERNSLALLLSHPVSTWEIVIAKI
FT                   TAVTIFAMVGLILTLIVSKFAYAFVPWQELGFAVSVNTNFILMMIVVGAPVAVMAASLQ
FT                   LFVSFMAKSFKEAQSYITIVLMVPMMLAMAASYNIAPETIQWLPVSGQLQALIEFIKGR
FT                   ELPLTQLAVSSAFTLAIALGLAIGMQKSLKSEKIVFGL"
FT   gene            complement(69199..69933)
FT                   /locus_tag="Shal_0061"
FT   CDS_pept        complement(69199..69933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0061"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: slo:Shew_3781 ABC transporter-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74637"
FT                   /db_xref="GOA:B0TM44"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0TM44"
FT                   /protein_id="ABZ74637.1"
FT                   /translation="MIQVSNLSKRIGDVQALNDLSFSALDGQITGLLGPNGAGKTTCLR
FT                   TVFGLLKPDNGIAEIDGIDIAKSPVAAKQQLGLFPDPFGLYERLTPREYISYFAELNGL
FT                   SRKEAKIATSKVIDKLHLADIADRQCKGFSQGQRMKTALAQAIVHQPTNIILDEPTRGL
FT                   DVMSTRVLRDILRDLKNQGHCVLFSSHVMQEVAALCDQVIVMAEGRVVAVGSPDALCQQ
FT                   TGKDSLEDAFIQLIGTDEGIAA"
FT   gene            complement(69944..71527)
FT                   /locus_tag="Shal_0062"
FT   CDS_pept        complement(69944..71527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0062"
FT                   /product="TAP domain protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; TAP domain protein;
FT                   KEGG: slo:Shew_3780 TAP domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74638"
FT                   /db_xref="GOA:B0TM45"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B0TM45"
FT                   /protein_id="ABZ74638.1"
FT                   /translation="MLHGMYSQLRARVSPALWRKKPVAAAILLGAGLIIPSAQADTSAK
FT                   TPQSNSSNQHACYVDGLSEQMQCGSISVPENYAKPDGKQIEIHYVVMPAIKPSDKVEAL
FT                   LAIAGGPGQSAIENAQGFDRMLTKVRQTQDVILIDQRGTGQSNPLQCIGDGFDSALAVN
FT                   ESDFDTRVETQKCLDSLDADVTQYGSLSALKDFEAIRQHLGYQKLHLYGVSYGTRMAQL
FT                   YMRHYPEHLATVTLDGVVPMQQSVLAIGNAIARAFDLLIADCANNLLCHKQFPELKADL
FT                   EKVDAELTQGPKISQVPDPLTGEMTQLTLTRSKLKGALRMALYNPSTRSLMPHAIHQAA
FT                   KGNYQPITGLYAMGIDNAGIAMGMHASVVCSEDWQRLTPELRAKASESYFGKEMLKTFA
FT                   ESCAVWNMPAVDTDFSDPIASDIPTLLLSGELDPATPPSWGTLAMEKLTNAKHFIAPYA
FT                   THGVAYQSCGNDLIAELVEQGSVAELNAECLNEDIRRNFYLNASTVEAIPSDSTEQKDE
FT                   QIDEQTALIK"
FT   gene            72038..73834
FT                   /locus_tag="Shal_0063"
FT   CDS_pept        72038..73834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0063"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   slo:Shew_3776 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74639"
FT                   /db_xref="GOA:B0TM46"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B0TM46"
FT                   /protein_id="ABZ74639.1"
FT                   /translation="MSLEQYHVVRLIQQQSQALGDAIALEGFETAAPWHQVSWAQFDTI
FT                   TSKIARVLIQFGIESHDRAVILSQNCPQWTCADFGLLKAKAVVVPIYPTSTIEQATYIV
FT                   NDAEAKLVFVDDKDQYAMACDLVAQCDSLTRVVVFDKSVELQDQQNHFYLDDLLEREVD
FT                   LVAAAELEKRLADLSLDDLLTLIYTSGTTGDPKGVMLDYRNFASMVRQHDTLLPFTPGD
FT                   VSLAFLPLSHVFERGWSFYVLCRGGHNVYLSNPMAVKEAIVQVRPHTLCVVPRFLEKVY
FT                   SAVQDKVIKAPEMRQKMFTWAMSVGHKQSEVGQGRHKASLGLSLQWKLADKLVFSKLKQ
FT                   VLGGRLKFMPCGGAALDPNVSAFFQSIDVPVLCGYGMTETTATATCNTLSNRVPGSNGK
FT                   AIPEVEIKLGKDNEILVRGDTVMRGYFNRPQETADAFEDGWLKTGDAGRLDENGNLFIT
FT                   DRIKELMKTSNGKYIAPQRVEGKVGCCPFIEQVAIVADARNYVTALIVPAFESLEAWAK
FT                   EKGVHYETQLDLLRNIRVVELFEQRLKTLQSELAGFEKIKKFTLLPDAFSMEAGLITPT
FT                   MKLRRKVIYNKYAREIDKMYSR"
FT   gene            74073..74477
FT                   /locus_tag="Shal_0064"
FT   CDS_pept        74073..74477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0064"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   sfr:Sfri_3970 thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74640"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B0TM47"
FT                   /protein_id="ABZ74640.1"
FT                   /translation="MSETAFSLTLQPRFCETDALGHINNTVIPVWFEAAREPIFKIFNP
FT                   TQDLSKWNLIVAGFTIGFNAPTYFASDVTVKTWVSRIGNSSFELTQSCWQNGKKTAEAQ
FT                   TAMVHYDYVSEKSQPLSANIRAQLALLTGE"
FT   gene            complement(74528..74803)
FT                   /locus_tag="Shal_0065"
FT   CDS_pept        complement(74528..74803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0065"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO_0079 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74641"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR031165"
FT                   /db_xref="UniProtKB/TrEMBL:B0TM48"
FT                   /protein_id="ABZ74641.1"
FT                   /translation="MSEVIHLADESRFVINVDGAQAVLAYELYEDQTAADSPGRRCNFN
FT                   NTYVPPELRGRGLAEKLVRRGLKWAKAEGLEIEASCWYVQKFLGKK"
FT   gene            complement(74882..75310)
FT                   /locus_tag="Shal_0066"
FT   CDS_pept        complement(74882..75310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0066"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   sdn:Sden_0074 thioesterase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74642"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B0TM49"
FT                   /protein_id="ABZ74642.1"
FT                   /translation="MDNFLEQYPVNTKIAVAWGEMDALQHVNNVVYFRYFETAHIDFFN
FT                   QINLLDELQTTAVGPVISENQAKYKRPVTFPDTLTVGVSISDIKDDRFMMHYSVYSQSQ
FT                   QTVTTLGSSQVVMFNFKTGKKAKLTPELINALKTYQQA"
FT   gene            complement(75502..76179)
FT                   /locus_tag="Shal_0067"
FT   CDS_pept        complement(75502..76179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0067"
FT                   /product="2,3-diketo-5-methylthio-1-phosphopentane
FT                   phosphatase"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 1; 2,3-diketo-5-methylthio-1-phosphopentane
FT                   phosphatase; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: spc:Sputcn32_0069
FT                   2,3-diketo-5-methylthio-1-phosphopentane phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74643"
FT                   /db_xref="GOA:B0TM50"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023943"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TM50"
FT                   /protein_id="ABZ74643.1"
FT                   /translation="MGIRAIVVDTAGTTTDLNFIEEILFPYSAKALPAFLEENQHNVLV
FT                   ENCICDVQDIALEPDASLARVTEILLQWIKEDRKATPLKTIQGLIWKQGYANGEFKGHI
FT                   FPDFIEALDGYKQQGLRVYSFSSGSVEAQKLLFSHSDAGDLNDKFNGHFDTRTGNKRFK
FT                   QAYCNIVNTISLSPKQILFVSDVLEELKAASEAGLNVVQMVRDDSQRTGDFKTISSFAE
FT                   LSI"
FT   gene            complement(76436..77485)
FT                   /locus_tag="Shal_0068"
FT   CDS_pept        complement(76436..77485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0068"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="PFAM: Lytic transglycosylase catalytic; KEGG:
FT                   ilo:IL0198 membrane-bound lytic murein transglycosylase C"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74644"
FT                   /db_xref="GOA:B0TM51"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR024570"
FT                   /db_xref="UniProtKB/TrEMBL:B0TM51"
FT                   /protein_id="ABZ74644.1"
FT                   /translation="MSKYLFQLLIAIYCLIAITLANIASANSSELDLSDYDADVAALLL
FT                   EYQGQDSYSRPIMPSVLVFNESEQASTYVDFKRGLILVETRSKTQLKDAVVQVLLTQID
FT                   PKVIDAQTAQDFGLISKKKKPFFWGQVLDREGKEIEFQWRASRYADDLVAKSKRVNSRF
FT                   RVAIHMVKEHTQIAGNKYINYARSASRKHGISTDLIMAIMETESSFNPLARSRSNALGL
FT                   MQIKANTAGRDYFSLIQGYTHTPSSAYLYDPAKNIEVGTGYLKILSTRYLAGIKHPKKR
FT                   EYAVISSYNGGAGNLWKSLDPRGNRTKALARINKMTVSEFYWFLTHRHNRQETRNYLKK
FT                   VSSRQKKYL"
FT   gene            78106..79353
FT                   /locus_tag="Shal_0069"
FT   CDS_pept        78106..79353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0069"
FT                   /product="AAA ATPase"
FT                   /note="SMART: AAA ATPase; KEGG: vpa:VPA0800 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74645"
FT                   /db_xref="GOA:B0TM52"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0TM52"
FT                   /protein_id="ABZ74645.1"
FT                   /translation="MTGYIQNINTKIPFTDKVVNIELQGKSLILTGGNGCGKTNFLNHL
FT                   LEYLTERVINRKNADPLDLHRRINSLSQSMAQYGASHESYEGWKRALEIANDKLFELEN
FT                   PILSLSNLDNYVVNYQSDKALLTMFKAVREAKIAESTSALSTSNLADQVTNKRRGSSAG
FT                   SLFEQYLVSYKTVQAYAESPSIDNDPALASKVKSWFEFLQDNLRYLFEDETLKLRFDSK
FT                   LQTFFIQQEHKEEFRFQKLSSGFSSILAVYADLVTTIQLTEITPDEIEGVVFIDEIDAH
FT                   LHVSLQRKIFAFLTKSFPKIQFIVTTHSPFVVSSVSDAVIYDLSKLEQIDDLSMYSYES
FT                   ILDGLFGVSSSSDLLNAKVKELNEEATKLQLDIGKVESLISELRQSESKLDSESLYFLE
FT                   SAQLSVLKAKAKSTDV"
FT   gene            79346..80005
FT                   /locus_tag="Shal_0070"
FT   CDS_pept        79346..80005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0070"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vpa:VPA0799 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74646"
FT                   /db_xref="UniProtKB/TrEMBL:B0TM53"
FT                   /protein_id="ABZ74646.1"
FT                   /translation="MFNVKRGDEVPASLAARRSYKDEDVVKALERAFHKKCYLCETKEP
FT                   QDINVEHFVAHQNNDDLKYDWSNLYFSCGRCNNIKLQYFNNLLDCCAPNQDVFREIKLL
FT                   PPRTPGARKLVVERQSEDARSVETEQLLEKIYNSDHTVNKAVTGSYLRKKINTQFALFH
FT                   KWLNVYYAEDALEAEREDALERIQVLMSDQSQYSAFIKWCILDDEDLNELLGPLIN"
FT   gene            complement(80432..81658)
FT                   /locus_tag="Shal_0071"
FT   CDS_pept        complement(80432..81658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0071"
FT                   /product="imidazolonepropionase"
FT                   /EC_number="3.5.2.7"
FT                   /note="KEGG: slo:Shew_3759 imidazolonepropionase; TIGRFAM:
FT                   imidazolonepropionase; PFAM: amidohydrolase; Amidohydrolase
FT                   3"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74647"
FT                   /db_xref="GOA:B0TM54"
FT                   /db_xref="InterPro:IPR005920"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TM54"
FT                   /protein_id="ABZ74647.1"
FT                   /translation="MSWDQVWIDINIATMSPKISEPYGAITDAALAVQDGKIAWVGKRS
FT                   DLPEFDVFGTPIYKGKGGWITPGLIDAHTHLIFAGNRANEFELRLKGASYEEIARSGGG
FT                   IISTVNACREADEAELFELGRQRLNALAKEGVTTVEIKSGYGLDIETELKILRVARELG
FT                   KHHHVDVKTTFLGAHAIPPEYKNDSDAYVDLVINEMLPKVMAENLADAVDVFCENIAFN
FT                   LEQTERVLTAAIDAGLDIKLHAEQLSNMGGSAMAARLGAKSVDHIEYLDEAGVKALSES
FT                   GTCATLLPGAFYFLRETQHPPIDLLRKYQVPMVVASDYNPGSSPLCSSLLMLNMACTLL
FT                   RLTPEEALAGMTRNAAKALGIDDHVGVIEVGMTADFCIWNISTPAELAYTYGVASCVDV
FT                   VKNGNLVHQ"
FT   gene            81834..82538
FT                   /locus_tag="Shal_0072"
FT   CDS_pept        81834..82538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0072"
FT                   /product="transcriptional regulator, histidine utilization
FT                   repressor, GntR family"
FT                   /note="TIGRFAM: histidine utilization repressor; PFAM:
FT                   regulatory protein GntR HTH; UbiC transcription
FT                   regulator-associated domain protein; KEGG: slo:Shew_3758
FT                   transcriptional regulator, histidine utilization repressor,
FT                   GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74648"
FT                   /db_xref="GOA:B0TM55"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR010248"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0TM55"
FT                   /protein_id="ABZ74648.1"
FT                   /translation="MATPKFEEIKQYILAQIESGEWAEDSRVPSENQLAELFNCSRMTA
FT                   RRGLTELTESGVLERSQGLGTFVAGLKTQSSMMAIRNIADEIKDRGHGYSVQQVELTQT
FT                   HATGAIAIALGLEEGGNVYRSVLVHCEQGTPLQLEERFVNPKLVPDYLAQDFTKQTPHE
FT                   YLSMVAPLTEAKHTIEAKLADNAQLALLNIDASEPCLQITRRTWSRQGVVSFARLVHPG
FT                   SRFRLGGHLTFS"
FT   gene            82702..84366
FT                   /locus_tag="Shal_0073"
FT   CDS_pept        82702..84366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0073"
FT                   /product="urocanate hydratase"
FT                   /EC_number="4.2.1.49"
FT                   /note="KEGG: slo:Shew_3757 urocanate hydratase; TIGRFAM:
FT                   urocanate hydratase; PFAM: Urocanase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74649"
FT                   /db_xref="GOA:B0TM56"
FT                   /db_xref="InterPro:IPR023636"
FT                   /db_xref="InterPro:IPR023637"
FT                   /db_xref="InterPro:IPR035085"
FT                   /db_xref="InterPro:IPR035400"
FT                   /db_xref="InterPro:IPR035401"
FT                   /db_xref="InterPro:IPR036190"
FT                   /db_xref="InterPro:IPR038364"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TM56"
FT                   /protein_id="ABZ74649.1"
FT                   /translation="MDKRHDPSRRIIAPTGTKLSCKSWLTEAPMRMLMNNLHPDVAERP
FT                   EDLVVYGGIGRAARDWECYDKIVEVLQRLEDDETLMVQSGKPVGVFKTHSNAPRVIIAN
FT                   SNLVPHWANWEHFNELDKKGLAMYGQMTAGSWIYIGSQGIVQGTYETFVAMAKQHFNGV
FT                   SAGKWILTGGLGGMGGAQPLAGTMAGYSVLTCEVDETRIDFRLRTKYVDKKATSLDEAL
FT                   AMIEEANNSGKPVSVGLLANAADVFAELVERGITPDVVTDQTSAHDPLNGYLPQGWTLE
FT                   YAAEMRKKDEAAVVKAAKQSMAVQVKAMLALQAAGAATTDYGNNIRQMAFEEGVENAFD
FT                   FPGFVPAYVRPLFCEGIGPFRWVALSGDPEDIYKTDAKVKELIPDNPQLHNWLDMARER
FT                   IAFQGLPSRICWVGLKDRARLALAFNEMVKNGELSAPIVIGRDHLDSGSVASPNRETES
FT                   MLDGSDAVSDWPLMNALLNTASGATWVSLHHGGGVGMGFSQHSGVVIVADGTDDAAVRL
FT                   GRVLWNDPATGVMRHADAGYDIAKNCAKEQGLDLPML"
FT   gene            84387..85919
FT                   /locus_tag="Shal_0074"
FT   CDS_pept        84387..85919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0074"
FT                   /product="histidine ammonia-lyase"
FT                   /EC_number="4.3.1.3"
FT                   /note="KEGG: slo:Shew_3756 histidine ammonia-lyase;
FT                   TIGRFAM: histidine ammonia-lyase; PFAM:
FT                   phenylalanine/histidine ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74650"
FT                   /db_xref="GOA:B0TM57"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR005921"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR022313"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:B0TM57"
FT                   /protein_id="ABZ74650.1"
FT                   /translation="MSHLVLTPGTLTLAQIREISRGKVTLELAESAIADINTSAGLVQQ
FT                   VLDEGRTVYGINTGFGLLANTKIAAEDLQLLQRSIVLSHAAGTGKHMSDETVRLMMVLK
FT                   INSLSRGFSGIRLEVINFLIKLVNAGVYPCVPEKGSVGASGDLAPLSHMCLPLLGEGEM
FT                   SYQGQLISAAEGLEIAGLKPIELAAKEGLALLNGTQASTALALEGLFNAEDLFAASSVI
FT                   GAMSVEAAMGSRSPFDLRIHAARGQKGQIDSAAVFRHLLGDESEISLAHLNCEKVQDPY
FT                   SLRCQPQVLGACLTQIRHVAEVLGTEANGVTDNPLVFQDTGDIISGGNFHAEPVAMAAD
FT                   NLAIAIAELGSIAERRIALLIDSNLSKLPPFLVENGGVNSGFMIAQVTAAALASENKTY
FT                   AHPASVDSLPTSANQEDHVSMATFAARRLRDMSENTRGVLAVELLAAAQGLDFRAPLQP
FT                   ALAVARAKGELRELVAYYDKDRFFGPDIEAATGLLLTASFNAYLPADILPSL"
FT   gene            complement(85995..86402)
FT                   /locus_tag="Shal_0075"
FT   CDS_pept        complement(85995..86402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0075"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   cpf:CPF_1379 acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74651"
FT                   /db_xref="GOA:B0TM58"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B0TM58"
FT                   /protein_id="ABZ74651.1"
FT                   /translation="MDFQIELNGLIEETETIELYQANEWSSADKPDLLILALRNSHTLV
FT                   TARYEGKLVGIGNAISDGHLVVYYSHMLVHPSLHGKGIGRKMMAAMQSVYCGFHQQMLT
FT                   ADGDAVEFYKALGFERAGKTEPMWIYAGTEH"
FT   gene            86747..87673
FT                   /locus_tag="Shal_0076"
FT   CDS_pept        86747..87673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0076"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: sal:Sala_2416 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74652"
FT                   /db_xref="GOA:B0TM59"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037415"
FT                   /db_xref="UniProtKB/TrEMBL:B0TM59"
FT                   /protein_id="ABZ74652.1"
FT                   /translation="MLADSKIKIRQIEAFRCFMLSGTVTGAAELLYISQPAVSRLLSEL
FT                   EYRVGFPLFIRTHNKLEATPEAKLFYKDVNRVFVGMNSLTSSADAIARNNQGRLRIGVM
FT                   PICSNSFMPDVIAAFLSLHPNVSIELESASRIQLLEMVRSHRIDIAITTNVEADEDEFS
FT                   CRFLRRHRAVVLLHEGHPLAQKSSLSPIDLKHERFMTLAYGSPFRTRVEDAFLKQSVKR
FT                   NIILEAREQSTLFQLVRKGVGIAILDPFVLHSGADGIVSRPFEPVTEWEYHVVQAKGIQ
FT                   TPRMVNAFLDILFEYFESPSLNKEPDR"
FT   gene            complement(87756..88142)
FT                   /locus_tag="Shal_0077"
FT   CDS_pept        complement(87756..88142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0077"
FT                   /product="putative endoribonuclease L-PSP"
FT                   /note="TIGRFAM: putative endoribonuclease L-PSP; PFAM:
FT                   Endoribonuclease L-PSP; KEGG: vha:VIBHAR_03649 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74653"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:B0TM60"
FT                   /protein_id="ABZ74653.1"
FT                   /translation="MTKALNTESAPAAIGPYVQGVDLGSMIFTSGQLPIDPATGEMSAD
FT                   VAEQALQSLKNVQAIVESAGLTMANVFKMTVFVKDLNNFPIVNEVYQNFFDQLGASYPA
FT                   RSCVEVARLPKDAQIEIEAIAVRS"
FT   gene            complement(88218..89630)
FT                   /locus_tag="Shal_0078"
FT   CDS_pept        complement(88218..89630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0078"
FT                   /product="Na+/H+ antiporter NhaC"
FT                   /note="PFAM: Na+/H+ antiporter NhaC; KEGG: dde:Dde_2580
FT                   Na+/H+ antiporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74654"
FT                   /db_xref="GOA:B0TM61"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:B0TM61"
FT                   /protein_id="ABZ74654.1"
FT                   /translation="MSQSTKLEFHIGKIGGMVPLLTMVGLMLLLTFNGVGGPKAAWAPG
FT                   FIAIILGMFLVKSKRDYFQSILDGIADKTGVVVITAWIFAAVLGSLMKAGGLVDGILWF
FT                   GMSTGIQGSMFLIIVFMSTAIFAMGTGSSNGANLALAPILFPAGVYLGADPAFVALALL
FT                   SGAVFGDNIAPISDTTIVGCTTQGADFGATVRQRMPLSLTAGAIALVALVFFGQGDGLV
FT                   EAATQSGDSARPESLLMLLSVAAVVFFALKGRHLLEALSYGILVAAVVGLGIGAFAISD
FT                   LFTVPSQRGVSNGIIEDAIAGVTGAVVFVILILGVIKIFMNSGIMDDILKFITERVSNS
FT                   TRSTELLMFYSTSVSSLLVSSNAPSQLLVGPTLVKPLGEKNNITPERRANLMSASVCSI
FT                   FYMMPWCLAVMVWYSAIETSAISSGLAVPSASISFMAPYPWALLGVMMFSIITGWKRYG
FT                   KQAQPQAQVQPA"
FT   gene            complement(89748..90767)
FT                   /locus_tag="Shal_0079"
FT   CDS_pept        complement(89748..90767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0079"
FT                   /product="1-aminocyclopropane-1-carboxylate deaminase"
FT                   /EC_number="3.5.99.7"
FT                   /note="KEGG: bbr:BB4545 D-cysteine desulfhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74655"
FT                   /db_xref="GOA:B0TM62"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR027278"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:B0TM62"
FT                   /protein_id="ABZ74655.1"
FT                   /translation="MLTDKYPKAKLAHTPTPFEFMANMTKKFDGPKLWIKRDDATGLAM
FT                   GGNKARQLEFYVGKAQADGCNALLTTGAVQSNHVRMTVAAARKMGWHVEVQLEHRVDGR
FT                   LPEYENSGNPFLDKLMGAKIHVYPEGEDENGADQVMYDRADELVTEGYKPFVIPLGAVG
FT                   KTPWGALGYVDCVEELLLQAQATGMKIDAIVLPTGSANTHAGVLAGLIALNSDIPVYGF
FT                   CVRRDKVAQFERVLVKTRKVLQLLGVDENKATHDLVKCEDWVLGPGYGQLTTEVHEAIE
FT                   ILGHEEGILLDPTYTAKSMAGMIGMIRDGQFTKDQNVVFLHTGGTPALFGYPELIANK"
FT   gene            complement(90860..91600)
FT                   /locus_tag="Shal_0080"
FT   CDS_pept        complement(90860..91600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0080"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   btl:BALH_1459 membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74656"
FT                   /db_xref="GOA:B0TM63"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:B0TM63"
FT                   /protein_id="ABZ74656.1"
FT                   /translation="MELSLLLMTVFFAATLQAATGFGFGLIGVSILLVLLQSNSAVQIV
FT                   IILTLAMSLVHWIKIRKIAPMDLVKKIMLGCALGYPIGIIIFSNFDLTALKISVALLII
FT                   AITTQNIIEMIKSRKGHETIPANMGRGSCFGVGTMSGVMASAMAMPGPVVVAYLTRSVL
FT                   TKDQIRATVITCSTFSYIVALGLQASFVGIGADTFKTSMMLIPATFAGAFFGDYISKFI
FT                   NQELFKKITLFVLFGSGVNILLNI"
FT   gene            complement(91842..92510)
FT                   /locus_tag="Shal_0081"
FT   CDS_pept        complement(91842..92510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0081"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3754 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74657"
FT                   /db_xref="InterPro:IPR021501"
FT                   /db_xref="UniProtKB/TrEMBL:B0TM64"
FT                   /protein_id="ABZ74657.1"
FT                   /translation="MYKALRTYISIALLLFSIPAIAGEVARVTLENGATVKLNDDFNWE
FT                   YVILESQTKPDTAVPVTLPATVSTVAVAASTAPVETEALAKVEAVPTTLPANIETLTST
FT                   AIAQAELLKSTAKSGVKVSLLNSQWDDDGRLGLTFELSSTSPEHYVMIELEVSLFADSG
FT                   ALIDKETIKVWQAIFRMPDSYLRKGQTRESRTFWIEGIDKAQWTKELMSLKIGEMDSRM
FT                   "
FT   gene            complement(92692..93087)
FT                   /locus_tag="Shal_0082"
FT   CDS_pept        complement(92692..93087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0082"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vfi:VF1351 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74658"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B0TM65"
FT                   /protein_id="ABZ74658.1"
FT                   /translation="MTTLTSQSNKITLIKSGSFALNDLSQLLNIENLKSDMAEVSVTNN
FT                   SNALTIGHFTMAPGTEFEYFYDSVEYKVITKGKIVVRDTDNIKYVAEVGDVLLFSPDVT
FT                   VIFDAESDGEAIYTAHRLASADFAPKA"
FT   gene            complement(93176..94327)
FT                   /locus_tag="Shal_0083"
FT   CDS_pept        complement(93176..94327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0083"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase; KEGG:
FT                   son:SO_A0164 iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74659"
FT                   /db_xref="GOA:B0TM66"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:B0TM66"
FT                   /protein_id="ABZ74659.1"
FT                   /translation="MSSVFYMPPMTLMGQNAIQSLGSELTSKELTKALIVTDSVLVEIG
FT                   LVNRLTDELKAHNIDFAIYDGVKPNPTEKNIEDGLALLNQENCDFVISFGGGSSHDAAK
FT                   GVALVAANGGHIRDYSKGVHTSKKPQLPLVTINTTAGTASEMTVFAIITNEADETKYPV
FT                   VDKHFTPIIAVNDSELMVAMPKFLTAATGMDALTHAIEAYVSTAATPITDASAIKAIEL
FT                   ISQNLTTAVENGEDRKARDAMQYGEYLAGMAFSNASLGYVHSMAHQLGGVYDLVHGLCN
FT                   AILLPEVSRFNAVATPARFVDIAKAMGVDVSAMTQAQAIEAGIEAIEALSRQVGTAQRL
FT                   SDLGVTEEKLAFMAQNALNDACSLTNPRKASLEEIITIFRARL"
FT   gene            complement(94707..95243)
FT                   /locus_tag="Shal_0084"
FT   CDS_pept        complement(94707..95243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0084"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3753 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74660"
FT                   /db_xref="UniProtKB/TrEMBL:B0TM67"
FT                   /protein_id="ABZ74660.1"
FT                   /translation="MIRYLIASLITLTSLNAVANDFSLEPDTKPAPVMAVTVDYIPAAE
FT                   DMYGITFAPRHYDRDYADWGYYIGYAQSKKEDVYVEPPGEAYTQDSLWRFGISYTLTGD
FT                   LSLYGGATAYITEYSSTTNIVPYVVGAEPVWETEKGTTWGGEIGIRYVIGKHLILGAGY
FT                   NSATESAVFSIGYSM"
FT   gene            95438..96691
FT                   /locus_tag="Shal_0085"
FT   CDS_pept        95438..96691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0085"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   slo:Shew_3752 MscS mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74661"
FT                   /db_xref="GOA:B0TM68"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="InterPro:IPR030192"
FT                   /db_xref="UniProtKB/TrEMBL:B0TM68"
FT                   /protein_id="ABZ74661.1"
FT                   /translation="MDQELRAAIAQWLTNIGIDTQPSDGVSITIMLFACFVVAFIGYFF
FT                   VKRGVVTTMNLVILRSKAHWDDIFMRHQVLEKMAVLVPVIILNILLPLALYDHTVLSSL
FT                   TDRLLDVTIVVLFIRTIYSALDAANEIADYNLVSRRLPIKSFVQLAKLFMFFVAIIISI
FT                   SVLADQSPVYFLSGLGVATGLVMLVFRDTILGFVAGIQLAANRMVSPGDWIEMDNFGAN
FT                   GTVEEVSLTTVKVRNFDQTLTMLPAYSLTSGSFRNWRGMSESGGRRIKRAIQIDIQSVR
FT                   FLTEDDMRSLNKINHLKDYFSAKSAEIITYNAHVEDADMYVNSRHLTNIGTFRAYIQEY
FT                   LTQHDKIRKDMTLMVRQLAPTELGVPIELYIFTNDTRWEFYEGIQADIFDHLFAILPEF
FT                   DLRVFQGPTGADVRSLKH"
FT   gene            complement(96832..97458)
FT                   /locus_tag="Shal_0086"
FT   CDS_pept        complement(96832..97458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0086"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   slo:Shew_3751 lysine exporter protein (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74662"
FT                   /db_xref="GOA:B0TM69"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:B0TM69"
FT                   /protein_id="ABZ74662.1"
FT                   /translation="MSFDTWLLYLFAILLIAVSPGTMAVLSMGHGIHYGKSRSIATAFG
FT                   SVTSALILMMASAAGLGALLSATEYGFTVLKWCGAAYLLFLGIKLLLTKGDGKGLQLKT
FT                   TEGKGTPKQLFKQAFLVGISNPKDLLFFAALFPQFIDISAPQGPQLAILAATWAVVDFS
FT                   FVMIYASMANVLAPKLKASNKLHWFDRTSGGVFVALAAILVSREN"
FT   gene            complement(97559..98110)
FT                   /locus_tag="Shal_0087"
FT   CDS_pept        complement(97559..98110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0087"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; KEGG:
FT                   slo:Shew_3750 phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74663"
FT                   /db_xref="GOA:B0TM70"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:B0TM70"
FT                   /protein_id="ABZ74663.1"
FT                   /translation="MFQLFWKGLLKLIGWKISGELPKDKQFIAIVAPHTSNWDFIIGVI
FT                   ARGALGVQVNFLGKHQLFIPPWGWFFRAIGGTPVDRRKSNNLVDAVADLFKTNPHFRLA
FT                   LAPEGTRSPVSRWKTGFYHIANKAQVPIITVGLDFGSKTIVIAEGKVPTGDIRQEMNEI
FT                   IDFYRSIQGRHPKAIPDYTA"
FT   gene            98253..98675
FT                   /locus_tag="Shal_0088"
FT   CDS_pept        98253..98675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0088"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3749 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74664"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:B0TM71"
FT                   /protein_id="ABZ74664.1"
FT                   /translation="MFKKGLSVLLLCLAFNANAVPTDDIANILAEQEAAWNRGDLDAYM
FT                   LGYWNNDKMRFVSNGKFSYGWDKTLAAYKKHYPDKATLGTLTFTIKETKMLSNYAAIVV
FT                   GRWSLERAKDNPNGVFTLLVEKIDDRWVITHDHTSD"
FT   gene            complement(98905..99672)
FT                   /locus_tag="Shal_0089"
FT   CDS_pept        complement(98905..99672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0089"
FT                   /product="protein of unknown function DUF833"
FT                   /note="PFAM: protein of unknown function DUF833; KEGG:
FT                   slo:Shew_3748 protein of unknown function DUF833"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74665"
FT                   /db_xref="InterPro:IPR008551"
FT                   /db_xref="UniProtKB/TrEMBL:B0TM72"
FT                   /protein_id="ABZ74665.1"
FT                   /translation="MFMCILFVALQTHPQFPLIICANRDEFHHRPTEAAHFWPTSNKLV
FT                   AGKDLEAGGTWLGVNQQGKIAGLTNIRAPELNQNDMRSRGELVLKALEDDALNHDWLQI
FT                   HSRFYNPFNLLFGDEEQLQCFDSRKQKLTRLTSGFHSISNGALDDIWPKMARGTQAIEQ
FT                   HISNHPIPDVDALLTIMMDNTQAPDEELPQTGVSLEWERHLSSVYIRHEEYGTRSTSII
FT                   LKDKQGKIHFTEVRYDGKGRNLGRDEFVIEAAS"
FT   gene            complement(99753..101381)
FT                   /locus_tag="Shal_0090"
FT   CDS_pept        complement(99753..101381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0090"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3747 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74666"
FT                   /db_xref="GOA:B0TM73"
FT                   /db_xref="UniProtKB/TrEMBL:B0TM73"
FT                   /protein_id="ABZ74666.1"
FT                   /translation="MLYLLASCIALLLGPLFYRFFSTGNGLQKGLDGFIFVSLGGLVLI
FT                   HILPELLEHGGFLAIVFVIIGMWGPTLSERLFHRYSEVTHNLTLILGIGGLLLHTITDG
FT                   GAMILAQQQGNSILLALGIILHRLPVGVAIWWLLKPQVGSRWAMIVLAAMMLLTCVGYF
FT                   AGEQLLSQLSLENTVYLQAFVTGSILHVVLHQPHGSPDTDKQGKFEYQAGIGSLLGIVL
FT                   LVLLLMMDSGGHEHHHHSHSTEHLLDWMLTIAPVLLVAYAVATLRFHFGLTPHVQQLNR
FT                   LWLQRLLGPEAIIITGLLLGPTFALLQAISVLIIGWQLTRCNVEPTDPHDYLPDSAWRF
FT                   GFAHLVDRSAPWILLSLVLANLIGHPAVPLSSPLVQVIVLLLVFLPMRFCNLGAAVLSL
FT                   SLAYSGWTTTAVMLPLIAAPIFNLAQLKLMNWTQKASLFALLITLLGVIELLHPKWQAM
FT                   IHLPATLNNISLIIVAILFAASLLRLGPRKFLSRLMLLKPKTHHHAHGDGHGHQHSHEP
FT                   DHHNHGHEHSHESAHKHGHDHKHRH"
FT   gene            101599..102195
FT                   /locus_tag="Shal_0091"
FT   CDS_pept        101599..102195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0091"
FT                   /product="multiple antibiotic resistance (MarC)-related
FT                   protein"
FT                   /note="PFAM: multiple antibiotic resistance (MarC)-related
FT                   protein; KEGG: slo:Shew_3746 multiple antibiotic resistance
FT                   (MarC)-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74667"
FT                   /db_xref="GOA:B0TM74"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:B0TM74"
FT                   /protein_id="ABZ74667.1"
FT                   /translation="MDTFSAAVMLFLIMDPLGNLPIFASILRHIEPKKRRRVLIRELLF
FT                   ALVIMMLFLFAGEAILNFLNLRTESVSIAGGIILFLIAIRMIFPQPGGVVGLAAGEEPF
FT                   IVPMAIPLMAGPSVLAALILLAHTDNDRMFDWTIALVSAWGASAVILLFYKAFTKVLGE
FT                   KGLTAVERLMGMVLVMISVQMFLDGVANYISHTGL"
FT   gene            102372..104537
FT                   /locus_tag="Shal_0092"
FT   CDS_pept        102372..104537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0092"
FT                   /product="glycoside hydrolase family 37"
FT                   /note="PFAM: glycoside hydrolase family 37; KEGG:
FT                   slo:Shew_3745 glycoside hydrolase, family 37"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74668"
FT                   /db_xref="GOA:B0TM75"
FT                   /db_xref="InterPro:IPR001661"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:B0TM75"
FT                   /protein_id="ABZ74668.1"
FT                   /translation="MLTCLLLCVASLSSLDSADYQNLLPYQGTPTSMEQRDSNGNLTIG
FT                   SVYTDQGAWHGFHLPDNADYYGGFTGPLFIAQEYSLHLSDSLQRLQLINIDKDEFIALD
FT                   SASRIEIYSRPDALVQTFIWSGFQLNLTLSYSDNRTAVIRTELINLSPKEQTWQLVWHG
FT                   SPFNSHPSQPDYHLIKQAEVNANHISWQLNPIMETWRIQLADAEYELWFDRDMKIMLNE
FT                   QSGYRAFAEPVTLAAGQQHTFVSAQRYFHTQAERSAHLAPDWSKITGQLNDNRAKWQAR
FT                   LDRAITGGDKSARQLAVKSMMTLLHNWRSPAGALDHDAITPSITYKWFNGVWAWDSWKQ
FT                   AVALARFDPSLAKSNVLAMFDYQFTAQDSVRPQDAGNLPDAIFYNKDRQRGGEGGNWNE
FT                   RNGKPPLAAWAVWQIYEQDKDVSFLEAMYPKLLAYHEWWYRNRDNNDNGLAEYGANLHP
FT                   AHLAEDGSIDVEAVIEAAAWESGMDNAPRFDVDEALSVWQNRQAGQLVGYSVSQESVDL
FT                   NAYLYAEKRFLQQMAAVLGDDSAVVKWDVAATRLAKQIQMQMYDPESGFFYDIRYTATG
FT                   SELMVEQGKGVEGWLPLWAGAASEAQAKVIVERHLGAGQFGTLIPFPTVSADSPNFAAA
FT                   KYWRGPVWLDQALFGLQGVERYGYHQQAKALAKQLVSQGEGILGQSPIRENYNPLTGEG
FT                   LHCTNFSWSASVLLLLYQSWLVDGNDN"
FT   gene            104681..104983
FT                   /locus_tag="Shal_0093"
FT   CDS_pept        104681..104983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0093"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sdn:Sden_0093 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74669"
FT                   /db_xref="UniProtKB/TrEMBL:B0TM76"
FT                   /protein_id="ABZ74669.1"
FT                   /translation="MKVSLLVVIFLSIVFVSACNSRSQEIDQQSIITDSHSDLPRKHLL
FT                   CSSTPPILDTTKLKANLKERGLITEQMTEAEAEQIVVEYIRKRQKAFQDCKKGSQ"
FT   gene            104985..107789
FT                   /locus_tag="Shal_0094"
FT   CDS_pept        104985..107789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0094"
FT                   /product="peptidase M6 immune inhibitor A"
FT                   /note="PFAM: PKD domain containing protein; peptidase M6
FT                   immune inhibitor A; KEGG: slo:Shew_3744 peptidase M6,
FT                   immune inhibitor A"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74670"
FT                   /db_xref="GOA:B0TM77"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR008757"
FT                   /db_xref="InterPro:IPR012300"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR020008"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:B0TM77"
FT                   /protein_id="ABZ74670.1"
FT                   /translation="MNKLLKIKLLAAFFAAIISFSPIALAVPVTSGTTADANMINKERV
FT                   LYWLVKRGELSANATEAEKQQAIADFTKRAYGNKKIPLIQAQQQIKRLERAKQRAKSAN
FT                   YSSPLVKSFNNKTVKVLTVLIDFPDLRHDDNGLSSSDTQMFYNSYSPEHFKSLLFSKTG
FT                   YEGPQGQTLMTGYQYYQAESGGSFFFTGDVKGWYRATSNAAAYGGNDPDDDDNDIGVSE
FT                   LVKEAVTEAVAGMSAPELASYDIEDPYDLNNNGLTNEADGIIDHVMIFHSSIGEEAGGG
FT                   MLGSDAIWSHRSFVDGGSYTLPGTEIKLSGYTIQPIDAALGVCVHEFGHDLGLPDEYDT
FT                   TQLGKGAPVGFWSVMAGGSWAGSLAGSLPSGFSPYARSYLQTIYGGNWVTEQSVALDSI
FT                   SASGLDINLVEAINHDQVNQLSIAVPAVDIEFKEPYSGAFQYYSDQGDMINHAMSFDVD
FT                   LPAATPLSLTMLAHWSIELDYDYAQLMVDGIAIMGNHTKSSNSINNERNIITGQSSDLA
FT                   EAEGANAWVDLQFDLSPYAGRSVRISIRYVTDQAVGDYGIVLDDIAIKQSTETVLFDGA
FT                   EQETDIAYAGFARVGSKRPGKDRRYIVQLRSQQGVDKGLKSESYDPGIVLWFENQEYIN
FT                   NEVNSHPGYSLISVVDADQNLIGSNDSSVQVRDAAFSLFNQSSYFNDNHLSAVKLFDDG
FT                   NDFSAPLQKESGTILPELGLTMEVMTQSSNSSNAMVQFRYTSQTPPELQELNASISYSL
FT                   QGREASFSANASGGDGNYTYTWDFGTTDGTSREASPSYTYATDGNYLVSLTVTDGDGAS
FT                   VTNNTTLVVGSVIEVNFTQTTSNLMVSFANQSTGGSGELSYLWEFGDGNTSSAASPSYT
FT                   YGATGSYTVMLTVTDSMGQTAQKSALITVTAAVIERSGSSGGSLGWLSLVMLGLFSLYR
FT                   RQAS"
FT   gene            complement(107848..108411)
FT                   /locus_tag="Shal_0095"
FT   CDS_pept        complement(107848..108411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0095"
FT                   /product="Chorismate lyase"
FT                   /note="PFAM: Chorismate lyase; KEGG: sbl:Sbal_4229
FT                   chorismate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74671"
FT                   /db_xref="GOA:B0TM78"
FT                   /db_xref="InterPro:IPR007440"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/TrEMBL:B0TM78"
FT                   /protein_id="ABZ74671.1"
FT                   /translation="MTVTRLSFPYGESIQWFSPEQITNLPTPPFQEWLLSTCSLTQKLK
FT                   KHCTHFEVRVLGEDTLIPPAKEAFGCESMWIREVLLVLDGIPWIFARTLIPGQLLEKKQ
FT                   QEFLGLGVRPLGELLYSKDEFVPGRIEVAHFEACSKIAKLAGSLQQDVSQELWGRRRYF
FT                   QYETEQLVVSEVFLPAAQEAIAKL"
FT   gene            108565..108966
FT                   /locus_tag="Shal_0096"
FT   CDS_pept        108565..108966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0096"
FT                   /product="flagellar basal body-associated protein FliL"
FT                   /note="PFAM: flagellar basal body-associated protein FliL;
FT                   KEGG: sfr:Sfri_0049 flagellar basal body-associated protein
FT                   FliL"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74672"
FT                   /db_xref="GOA:B0TM79"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:B0TM79"
FT                   /protein_id="ABZ74672.1"
FT                   /translation="MNKIIAVLLVALCSSFGAVAADKKPLEEYAYYGFEPEIVTNYISN
FT                   RKKLGYVRLSVELMVKKPEQLVSLERHDPLLRAAIVEILGNQTEAKVKSLTGKEEIRRQ
FT                   CYEKVNQLLEQETGKPLVVNLLFTKYLYD"
FT   gene            109024..110166
FT                   /locus_tag="Shal_0097"
FT   CDS_pept        109024..110166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0097"
FT                   /product="protein of unknown function DUF890"
FT                   /note="PFAM: protein of unknown function DUF890; KEGG:
FT                   slo:Shew_3741 protein of unknown function DUF890"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74673"
FT                   /db_xref="GOA:B0TM80"
FT                   /db_xref="InterPro:IPR010286"
FT                   /db_xref="InterPro:IPR016909"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TM80"
FT                   /protein_id="ABZ74673.1"
FT                   /translation="MSHKTKPSTQERKAGKPSAPKRKVISKSPNSKLKTIVKGQKNTAV
FT                   KAQTSKPLHPRNVHNKGYDFPALIAAFAALKSFVKPNPYGNLSIDFADPQAVKMLNAAL
FT                   LKLHYDVEHWDIPAGFLCPPIPGRADYIHYVADLLAVKKSSKKRVPKGPRVKVLDIGTG
FT                   ANVIYPLLGIQSYGWSFVGSDVDPLSIANAQQVFASNPAIAARFNSRLQTNAKHVFHGV
FT                   IEPNERFDITLCNPPFHASLAEASEGTARKLKNLAANRAKSSEAKPLRSTKPVVTKTET
FT                   PLNFGGQKAELWCEGGELQFLQTMISESHEFASQCLWFTTLVSKKENLKPAKALLAKVK
FT                   AEEVKEMEMHQGNKITRVLAWTFLKPEQRELWAQYRDVEN"
FT   gene            complement(110298..111203)
FT                   /locus_tag="Shal_0098"
FT   CDS_pept        complement(110298..111203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0098"
FT                   /product="DNA binding domain, excisionase family"
FT                   /note="KEGG: slo:Shew_0052 DNA binding domain, excisionase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74674"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:B0TM81"
FT                   /protein_id="ABZ74674.1"
FT                   /translation="MTEPTDLIYMSAKQVSEYLDLNEKKVYSMANDRILPATKITGKWL
FT                   FPKILIDRWVMDSCHSGMLSDRMHITGSDDPLLSMLVARMMSQVGKSELISYSSTGSRL
FT                   GLDLLSRGYADVCTLHWGSVEERSVRHPALLQGYANHQQWVMVHGYTRKQGLMMRPDMH
FT                   HRCQELDKVSQQSWRWVARQAGAGSQQHLEQWLMKQGASFEELNSSIVAQSERELAGYI
FT                   ARNNADIGFGCQSVALESGLSFVPLVTESFDFVMPQGIYFRRQLQRLFNLLAEPQTQQL
FT                   AATLGGYDLTDCGKLLWNGQ"
FT   gene            complement(111251..112093)
FT                   /locus_tag="Shal_0099"
FT   CDS_pept        complement(111251..112093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0099"
FT                   /product="formate dehydrogenase subunit FdhD"
FT                   /note="PFAM: formate dehydrogenase subunit FdhD; KEGG:
FT                   slo:Shew_0053 formate dehydrogenase, subunit FdhD"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74675"
FT                   /db_xref="GOA:B0TM82"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:B0TM82"
FT                   /protein_id="ABZ74675.1"
FT                   /translation="MMGHMTAYKSNPTLIKTNTDVPLTIAVTAINENGEKVDKFIACER
FT                   PLTVYLNWQPIVTLMTLGARAEALSLGYLKNQGFISDINKLESVIVDWDVNSAAIITNE
FT                   KIENLDEKLSEKTVTTGCGQGTVYGDFMTGLDDIVLPTPQLKQSMIYSLLKNISAYNET
FT                   YKNAGAVHGCGLCKDDQIVGFVEDVGRHNAVDTLAGEMWLNQDSGNDKLFYTTGRLTSE
FT                   MVIKVAKMGIPVVLSRSGATQMGLELAQKLGITMIARAKGRHFLIYNGAENVEFDALS"
FT   gene            112377..112844
FT                   /locus_tag="Shal_0100"
FT   CDS_pept        112377..112844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0100"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_0054 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74676"
FT                   /db_xref="InterPro:IPR021736"
FT                   /db_xref="UniProtKB/TrEMBL:B0TM83"
FT                   /protein_id="ABZ74676.1"
FT                   /translation="MQHTESQWPMYVSLKKIEKQVGRWTSVQWEVDQMLPATHAAPEGA
FT                   YLILLELHKDERGSYRINIDMDNAMLYIVCDETEEGEWKPVAISADQNVAAGCLEADTP
FT                   VLNIPMPKAIACWIEAFITRHGEVEICAHRRKHVNRRKNEGPSTDHTADRA"
FT   gene            112841..113503
FT                   /locus_tag="Shal_0101"
FT   CDS_pept        112841..113503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0101"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sbl:Sbal_4132 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74677"
FT                   /db_xref="InterPro:IPR021735"
FT                   /db_xref="UniProtKB/TrEMBL:B0TM84"
FT                   /protein_id="ABZ74677.1"
FT                   /translation="MSGFLSRWNLRKQQVEAEGEAEVAAAEAAAQQLAEEQALTAQKQA
FT                   EAEQSTAQDSTQTIENAQVEADADRILTAEDLPDPEKIEVGGSFASFMGANVDPAAKSA
FT                   ALKALWKQPHYSEIDGLLEYALDYSNQPKLSAEVSAELAKKVFRYMVKDEDDEEGTQEG
FT                   TQEGVEAASDEMIAAENSDQNERLNDADSVSDILDGHQDNVTQNEPESSDASTSKVV"
FT   gene            113653..115332
FT                   /locus_tag="Shal_0102"
FT   CDS_pept        113653..115332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0102"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: slo:Shew_0056 4Fe-4S ferredoxin, iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74678"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B0TM85"
FT                   /protein_id="ABZ74678.1"
FT                   /translation="MSNSETQVGLKEIRQKVLAGTQVIQNLIPPTVSYTTEGNVLVIGP
FT                   EDLARLAADKLSSMGQCAILANEPITSQDEAHLEKVMTAAENVESYYNKLIEIKGFLGQ
FT                   FQVKVEHGDGSAELSTVAIRKAHFDLILDLSVSPCINLEMLPPGYFYVGQDQAKLDEAL
FT                   EQLPSLVGQFDKPRYVKVNSDICAHYRSGNEGCTRCLNFCPADAIASIEKKIEIDPYLC
FT                   HGAGSCTNACPTGAISYDLPTPQAMHTYLQKLVTSFRSQAQIAPVILFHDMGKGAELVT
FT                   DALAGEIIPIEMEEITVASMDHWMSALAWGARQVLILQTDATAPTLTQMLHGELSLAND
FT                   ILDEMGQPQRISLITEAHLTEVGAKALSELLITSASWPVIVPAEFVATTKRETIYNAID
FT                   HLNEQAASVDSCFSQSNIPYGQVSVNTENCTLCMSCVSTCPTMALTDGGDLPALHFVEQ
FT                   DCVQCGLCETACPEKVISLTPQVNLDKAARQTRQTLHEEAPFECITCGTPFATQSMVKR
FT                   MLDVVGTHSAFSANTDRLKMCGDCRVKDMFEDILQDPEKQLR"
FT   gene            115343..116017
FT                   /locus_tag="Shal_0103"
FT   CDS_pept        115343..116017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0103"
FT                   /product="cytoplasmic chaperone TorD family protein"
FT                   /note="PFAM: cytoplasmic chaperone TorD family protein;
FT                   KEGG: slo:Shew_0057 cytoplasmic chaperone TorD family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74679"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="UniProtKB/TrEMBL:B0TM86"
FT                   /protein_id="ABZ74679.1"
FT                   /translation="MTEFVREVSENDQLRADIYQLLAALLRRQPSHELLEFLSGLEIDA
FT                   DDDSDMTKAWVGLKLAAQQFSDEQLEDEYFNVFLGVGCGEILPYGSWFMTGSLMDKPLA
FT                   LLRNDLMQLGFEREEDVKEPEDHVAALCEVMGTLILEAPSYRQLAFYQRHMGSWIERFC
FT                   DNLAKAPSAAFYATVAQLAKAFFVIEANEFEQLSLDIPVNCPGSEAEASEKIEPSTNEL
FT                   AS"
FT   gene            116192..116389
FT                   /locus_tag="Shal_0104"
FT   CDS_pept        116192..116389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0104"
FT                   /product="Formate dehydrogenase region TAT target"
FT                   /note="TIGRFAM: Formate dehydrogenase region TAT target;
FT                   KEGG: shw:Sputw3181_3870 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74680"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR014177"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:B0TM87"
FT                   /protein_id="ABZ74680.1"
FT                   /translation="MKKQASDMGRRQLLKALAIGGAAGAVATASGQALAAQPDAAPIAK
FT                   KGSGYQESDHVRSYYDTLRS"
FT   gene            116409..119258
FT                   /locus_tag="Shal_0105"
FT   CDS_pept        116409..119258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0105"
FT                   /product="molybdopterin oxidoreductase"
FT                   /note="PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; molybdopterin oxidoreductase
FT                   Fe4S4 region; KEGG: slo:Shew_0059 molybdopterin
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74681"
FT                   /db_xref="GOA:B0TM88"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="UniProtKB/TrEMBL:B0TM88"
FT                   /protein_id="ABZ74681.1"
FT                   /translation="MRLNRKTDQAVTSDKAALGLNRRQFLKSASLATGGIAAASMLGAG
FT                   MMRKAEAKDIPHDVPTETKRTICSHCSVGCGVYAGVQNGVWTTQEPAFDHPFNAGGHCA
FT                   KGAALREHGHGEKRLKYPMKLEGGKWKRLSWDQAIEEVGQQALDIRKESGPDSVFFMGS
FT                   AKFSNEQAYMYRKFAAMWGTNNVDHSARICHSTTVAGVANTWGYGAQTNSFNDIRNAKA
FT                   MMFIGSNPCEAHPVAMQHILIGKERGAKIIVVDPRFTRTAAKSDEFVHIRPGTDIPFIY
FT                   GLLWHIFENGWEDQTFIDQRVYGMERIREEVKKYHPAEVANIVGATEEQMRRVAKLLAE
FT                   TKPGTIVWCMGGTQHHVGNANTRAYCILQLALGNMGVSGGGTNIFRGHDNVQGATDFGL
FT                   LFDTLPGYYGLKTGSWKHWCNVWDLDYEWVKGRFDQEPRLGQDPMTSTGIPCSRWHDGV
FT                   LEDKSKIAQKDNIHMAFFWGQSVNTETRGREVREALNKMKTVVVVDPFPTMAGVMHERT
FT                   DGVYLLPACTQFETYGSVSASNRSLQWRTKVIEPLFESKPDHVIMYKLAKKWGIDKEFF
FT                   KNIKINGEEPLIEDMTREFNRGMWTIGYTGQSPERLKMHQENWGTFDIKSLEAPGGPAK
FT                   GETYGLPWPCWGTPEFKHPGTQILYRTGREVMNGGGNFRARYGVEHDGVNILAEGSYSK
FT                   GSEIKDGYPEFTDKMLKQLGWWDDLTAEEKVAAEGKNWKTDISGGIQRVAIKHGCIPYG
FT                   NAKARCIVWNFPDDIPLHREPLYTPRRDLVAKYPTYEDRMVARLPTLYKTIQEKDFAKD
FT                   FPLIITTGRLVEYEGGGEETRSNPWLAELQQEMFIEINPADAADRGIRDGDNVFVHSPE
FT                   GAKITVKAMVIPRVVPGECFMPYHFAGVFEGESLAKNYPEGTVPYVIGEAANTVMTYGY
FT                   DVVTQMQETKASLCQVSKA"
FT   gene            119285..119872
FT                   /locus_tag="Shal_0106"
FT   CDS_pept        119285..119872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0106"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: shw:Sputw3181_3872 4Fe-4S ferredoxin,
FT                   iron-sulfur binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74682"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B0TM89"
FT                   /protein_id="ABZ74682.1"
FT                   /translation="MANMKFLCDTKRCIECNGCVTACKNANSSAIGWGIQRRRVVTLND
FT                   GEPGEASISVACMHCTDAPCMAVCPADCFYRTDEGIVLHNKETCIGCGYCLYACPFGAP
FT                   QFPQKNAFGSRGKMDKCTFCAGGPAPDFSEEERKLYGANRIAEGKLPLCAEFCSTKSLL
FT                   AGDALVISNIFRERSAARGAPEALWGYKPTTG"
FT   gene            119926..120933
FT                   /locus_tag="Shal_0107"
FT   CDS_pept        119926..120933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0107"
FT                   /product="formate dehydrogenase, gamma subunit"
FT                   /note="TIGRFAM: formate dehydrogenase, gamma subunit; KEGG:
FT                   slo:Shew_0061 formate dehydrogenase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74683"
FT                   /db_xref="GOA:B0TM90"
FT                   /db_xref="InterPro:IPR006471"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:B0TM90"
FT                   /protein_id="ABZ74683.1"
FT                   /translation="MFMKSLRSLFALLVIPLVLSMGLGLSASVMAADGQTNQQQVATND
FT                   VDLWRAVKSGESGYTTANNVEAGVLINVVGNEGKDIRNEYLIPVMGITVVAVFAAFLFF
FT                   YLVNGPSKLSKGFSGKMVLRWSKADLWIHWVLATSCLALIFTGLNIMLGKYILQPYIGE
FT                   GLWAGLIYGSKTIHDWVGPVFIVSWILCVVKWMPLQTFKMYDLKWFLVVGGYINFGPFK
FT                   GKHPDSGFANAGEKMWFWTLTIFGLFIAASGLMLVLPGLDLPREASMAALLIHAISAII
FT                   IIAFTIVHVWMATVLSEGGMECMVSGYCDENWAVQHHNLWYDELKDSNSIAYKD"
FT   gene            121639..121836
FT                   /locus_tag="Shal_0108"
FT   CDS_pept        121639..121836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0108"
FT                   /product="Formate dehydrogenase region TAT target"
FT                   /note="TIGRFAM: Formate dehydrogenase region TAT target;
FT                   KEGG: slo:Shew_0062 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74684"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR014177"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:B0TM91"
FT                   /protein_id="ABZ74684.1"
FT                   /translation="MNKQQPDLNRRSLLKALTIGGTASVAIAATGVSVAQASESKVSTT
FT                   NDNGYHETAHIRSYYNSLRG"
FT   gene            121855..124710
FT                   /locus_tag="Shal_0109"
FT   CDS_pept        121855..124710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0109"
FT                   /product="molybdopterin oxidoreductase"
FT                   /note="PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; molybdopterin oxidoreductase
FT                   Fe4S4 region; KEGG: slo:Shew_0063 molybdopterin
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74685"
FT                   /db_xref="GOA:B0TM92"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="UniProtKB/TrEMBL:B0TM92"
FT                   /protein_id="ABZ74685.1"
FT                   /translation="MKLTRKSNAAPTVEKKTLGISRRQFMKQAGITSGGIVAASLLGTG
FT                   MMRKAEAKDIPHDVPTEIKRTVCSACAVGCGLYAEVQNGVWTGQEPAFDHPFNAGGHCA
FT                   KGAALREHGHGEKRLKYPMKLVDGKWKKLSWEQAFNEVGDQMQTIRKESGPDSVYFMGS
FT                   AKFSNEGCYMYRKFAAMWGTNNVDHSARICHSTTVAGVANTWGYGAQTNSFNDIQNANA
FT                   IFFIGSNPAEAHPVAMQHILIAKEKNNAKIIVVDPRFSRTAAHADLHCGLRPGTDIPFI
FT                   YGMLWHIFENGWEDKTFIQQRVFEMDTIREEVKKFPPKEVANITGCSEEEVYQAAKLMA
FT                   ENRPGTVVWCMGGTQHHVGNANTRAYCILQLALGNMGVSGGGTNIFRGHDNVQGATDLG
FT                   LLFDTLPGYYGLKTGSWKHWCNVWDLDYDWVKARFDQNSYLGRIPMNTPGIPCSRWHDG
FT                   VLETPEKLAQKDRVRMAFFWGQSVNTETRQRDVRDALDQMDTVVVVDPFPTMAGVMHRR
FT                   KNGVYLLPAATQFETEGSVSNSGRSQQWREQVIQPLFESKTDLEIMYRLSQKLGFADEY
FT                   TKRIAKDANDVLVIEDVTREINRGMWTIGMSGQSPERLKLHTQNWGTFSNKTLEAVGGP
FT                   AKGETYGLPWPCWGTPEQKHPGTQILYNTNKHVLEGGGNFRARYGVEYKGQNLLAEGSY
FT                   SKGSEIQDGYPEFTADMLKQLGWWDDLTAAEKAVAEGKNWKTDISGGIQRVAMKHGCIP
FT                   FGNAKARCIVWTFPDQVPVHREPLYTPRRDLVSKYPTYDDMQVHRLPTLYKSIQEKDTA
FT                   AKYPLGLTSGRLVEYEGGGEESRSNPWLAELQQEMFVEINPADAADRSIRDGDTVWLEG
FT                   AEGGRIKIKAMVTPRVKPGVTWMPYHFAGEMHGESLAANYPEGTVPYVIGESANTALTY
FT                   GYDPVTQMQETKASLCQITKA"
FT   gene            124740..125309
FT                   /locus_tag="Shal_0110"
FT   CDS_pept        124740..125309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0110"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: slo:Shew_0064 4Fe-4S ferredoxin, iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74686"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B0TM93"
FT                   /protein_id="ABZ74686.1"
FT                   /translation="MATMKFLCDTKRCIECNGCVTACKNENDSALEWGIQRRRVVTIND
FT                   GVKGEASISVACMHCSDAPCMAVCPANCFYKTEDGIVLHDKDTCIGCGYCLYACPFGAP
FT                   QFPKSGAFGARGKMDKCTFCAGGPEENFSDAERQKYGANRIAEGKLPMCAELCATKSLL
FT                   AGDAEVISNIFRERVAYRGSNKNVWG"
FT   gene            125385..126365
FT                   /locus_tag="Shal_0111"
FT   CDS_pept        125385..126365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0111"
FT                   /product="formate dehydrogenase, gamma subunit"
FT                   /note="TIGRFAM: formate dehydrogenase, gamma subunit; KEGG:
FT                   sbm:Shew185_4112 formate dehydrogenase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74687"
FT                   /db_xref="GOA:B0TM94"
FT                   /db_xref="InterPro:IPR006471"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:B0TM94"
FT                   /protein_id="ABZ74687.1"
FT                   /translation="MNKWFKHIGVAIALLFSVSVFAHDAPKVGDTNEVNGQIWAQLKAG
FT                   EEGYTTSTSEFHGQAINTYDLRVLELRSDILAPAMMAALFGMIIIFVLFIKVNGISKLH
FT                   GGFSGKLVYRWSKFDVSIHWLGAIPCLLLILTGLTLLAGRFFFQPYIGEGLWAGLVNAA
FT                   KQIHDIMAIPFMIGWALMTVLWAKNQMPKMYDLKWMMVVGGYINFGPFKGKHPDAGFAN
FT                   AGEKLWFWAFAVFGLVVSASGMLLLFPNLFEPSRTLSLVALILHSVGAIIITAFSIVHI
FT                   FMATVMSEGGMECMVSGYCDETWASQHHNLWFDEIKENGTLKYKD"
FT   gene            127390..127587
FT                   /locus_tag="Shal_0112"
FT   CDS_pept        127390..127587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0112"
FT                   /product="Formate dehydrogenase region TAT target"
FT                   /note="TIGRFAM: Formate dehydrogenase region TAT target;
FT                   KEGG: slo:Shew_0062 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74688"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR014177"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:B0TM95"
FT                   /protein_id="ABZ74688.1"
FT                   /translation="MKKQQPDLNRRSLLKALTIGGTASVAIAATGISVAQASESKVSSN
FT                   NDNGYHETAHIRSYYNSLRG"
FT   gene            127606..130479
FT                   /locus_tag="Shal_0113"
FT   CDS_pept        127606..130479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0113"
FT                   /product="molybdopterin oxidoreductase"
FT                   /note="PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; molybdopterin oxidoreductase
FT                   Fe4S4 region; KEGG: saz:Sama_3609 formate dehydrogenase,
FT                   alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74689"
FT                   /db_xref="GOA:B0TM96"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="UniProtKB/TrEMBL:B0TM96"
FT                   /protein_id="ABZ74689.1"
FT                   /translation="MKLTRKSNAAPTVEKKTLGISRRQFMKQAGITSGGIAAASLLGTG
FT                   MMRKAEAKVQTVAHNAPTEIKRTVCSACAVGCGLYAEVQNGVWTGQEPAFDHPFNSGGH
FT                   CAKGASLRYHTHSYKRVKYPMKLEGGKWKKLSWEQAVSEIGDKMLEINQTSGPDSVYFM
FT                   GSAKFSNEGAYMYRKLAAMWGTNNVDHSARICHSTTVAGVANTWGYGAQTNSFNDIRNA
FT                   KNIFLIGANPAEAHPVAMQHILIAKERGATITVADPRFSRTMAHADIHLPLRPGTDIPL
FT                   VYGLMWHIFENGWEDKEFIRTRAYGMDKIREEAARWTPEEVEHVTGVSRDAVYAAAKQM
FT                   ATNRPGTVIWCMGGTQHHVGNANTRMYSILQLVLGNMGVSGGGTNIFRGHDNVQGATDM
FT                   GLLFDNLPGYYGVGEGAWQHWSRVWDLPFDSVKARFDQKSYLGRSPMITPGMPCSRWQD
FT                   GVLEAKDKLAQKDNLRLAFFWGQSINTETRQMEVRDALDKLETVVVVDPYPTMAGVMHR
FT                   RKDGVYLLPAATQFECEGSVNNSGRSAQWRQQVVEPMFDSKNDLEIMYRIAKHVGIADT
FT                   WTKHIKVNGNMPDPDDIMREYAKGMRSIGYTGWSPERIRAHTMNWGDFSSETLEAPGGV
FT                   NKGETYGLPWPCWGTPEQKHPGSQILYRTGMNVNQGGGNFRARFGVEHEGVSILAEDSA
FT                   SVDADIQDGYPQFDDKMLKQLGWWDELTAEEKALAENRTWSTDLGGGIVRVALAHNMVP
FT                   YGNAKARCRVWTFPDEVPVHREPIYTSRRDLIEKYPTHNDMQVHRLPTLFKTLQDKVIS
FT                   DDLDKKYPLIVTSGRLVEYEGGGEESRSCPWLAELQQEMFIEINPADAVDRGLRDGDDV
FT                   WVEGAEGGRIKIKAMVTPRVKPGVTWMPYHFAGVMHGEELQYPESGGISTKPYIVGESA
FT                   NTVMTYGYDPVTQMQETKASLCQIAKA"
FT   gene            130509..131078
FT                   /locus_tag="Shal_0114"
FT   CDS_pept        130509..131078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0114"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: saz:Sama_3608 formate dehydrogenase,
FT                   iron-sulfur subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74690"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B0TM97"
FT                   /protein_id="ABZ74690.1"
FT                   /translation="MATMKFLCDTKRCIECNGCVTACKNENDSALEWGIQRRRVVTIND
FT                   GEKGEASISVACMHCSDAPCMAVCPANCFYKTEDGIVLHDKDTCIGCGYCLYACPFGAP
FT                   QFPKQGAFGARGVMDKCTFCAGGPEENFSDAERQKYGANRIAEGKLPMCAELCATKSLL
FT                   AGDAEVVSAIFRERVAYRGSNKNVWG"
FT   gene            131154..132137
FT                   /locus_tag="Shal_0115"
FT   CDS_pept        131154..132137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0115"
FT                   /product="formate dehydrogenase, gamma subunit"
FT                   /note="TIGRFAM: formate dehydrogenase, gamma subunit; KEGG:
FT                   sbm:Shew185_4112 formate dehydrogenase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74691"
FT                   /db_xref="GOA:B0TM98"
FT                   /db_xref="InterPro:IPR006471"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:B0TM98"
FT                   /protein_id="ABZ74691.1"
FT                   /translation="MNKWFKHIGVAIALFFSVSIFANASDKVGDTIEVNNGQVWAQLKA
FT                   GEEGRTTSTSEFHGQAINMYDLRVLDLRSDILAPAMMAALFGMIIIFVLFIKVNGISKL
FT                   HGGYSGKLVYRWSKFDVSIHWLGAIPCLLLILTGLTLLAGRFFFQPYIGEGFWGALVNA
FT                   AKQIHDIMAIPFMIGWALMTVLWAKNQMPKMYDLKWMMVVGGYINFGPFKGKHPDAGFA
FT                   NAGEKLWFWAFAVFGLVVSASGMLLLFPNLFEPSRTLSLVALILHSVAAIIITAFSIVH
FT                   IFMATVMSEGGMECMVSGYCDETWASQHHNLWFDEIKENGTLKYKE"
FT   gene            132396..133724
FT                   /locus_tag="Shal_0116"
FT   CDS_pept        132396..133724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0116"
FT                   /product="Coproporphyrinogen dehydrogenase"
FT                   /EC_number="1.3.98.3"
FT                   /note="KEGG: slo:Shew_0073 radical SAM domain protein;
FT                   PFAM: Radical SAM domain protein; HemN domain protein;
FT                   SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74692"
FT                   /db_xref="GOA:B0TM99"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:B0TM99"
FT                   /protein_id="ABZ74692.1"
FT                   /translation="MSSIILPETAQPYNADITTPNWMISGMEKVMQFYVDRNLRLDTVS
FT                   AEMMPNPIEGKKYMLYAHIPFCHTLCSFCTFHRFLFKEDKARAYFISLRKEMDMVKALG
FT                   YDFESMYIGGGTTTVLEDELARTIEHAKKLFPSIKEVSCESDPQHLDSPGFKQLEGLVD
FT                   RMSIGVQSFNDDILTMTDRIEKFGSGQQTFDKIMAAKELFPIINVDLIFGFRGQTDEVI
FT                   QHDLDMASRLDPRQITTYPLMITHQTRKSVKGKLAAPHGDMARQYRQILNSLNGQYNQL
FT                   SAWAFGKANNEGFDEYVIDYDEYLGVGSGSFSFLNDTLYVNTFSLRNYQERIATGRMGV
FT                   DQQKNYGRKEVMQYRFLLGMFSGRLSRKYFRETFGVNLDTALFKEMASMKAIGAIKNDP
FT                   TDPDKLIVTDNGKMMGLLMMKEFYSGMDNVRAQLRKPLKACDM"
FT   gene            133910..134752
FT                   /locus_tag="Shal_0117"
FT   CDS_pept        133910..134752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0117"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: sbl:Sbal_0278 PfkB
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74693"
FT                   /db_xref="GOA:B0TMA0"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B0TMA0"
FT                   /protein_id="ABZ74693.1"
FT                   /translation="MANILLVANLNCDRIFLLNHPIKTGGRFHYKDGGQRLGGGGANTG
FT                   IGLVWAGHQVSLVTEVGRDDVGDWLLAEASTQGINCSLIQRRAGSTGEMLLMMTPDGER
FT                   TIIRPERPKFELPLPPNWQNVDVLYINSSSEGAASWAKTAMPYCWVVAQLAKDQRARPC
FT                   HVLIASLSDMQGRCEGDPWEFAKSISGNDLKYFVVTDGENGAMLYSAAESVLVAAVPSQ
FT                   VVDTTGAGDAYAAGLIHALVSQKEIVAAMQEAAIWSGFAVACNSSIPGKGLKHYLTAE"
FT   gene            134992..136449
FT                   /locus_tag="Shal_0118"
FT   CDS_pept        134992..136449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0118"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: she:Shewmr4_0268 diguanylate
FT                   cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74694"
FT                   /db_xref="GOA:B0TMA1"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:B0TMA1"
FT                   /protein_id="ABZ74694.1"
FT                   /translation="MGDKGWNDKKRFIWILSLLLLVAFVVTSGISYQVAHDSLTEQIKE
FT                   NNLPLTSDNIYSEIQQDLLKPIFISSLMAQDTFVRDWTINQEQNPEKLIRYLKEIQDKY
FT                   GTVTSFFVSEATRNYYHSSGVLKRIKDIDPEDAWYFRVRSLPEYEQYEVNIDPDTADQN
FT                   RTVIYVNYKVFDFEGNFIGVTGVGLAVESVKRLIELYQTRYNRSVYFTDRQGNITLHSQ
FT                   QYDGAATLQTSLGLEKLAIRILASPSTSFSYQKAGKTIFLNSRLVPEFKWHLIVEQDEA
FT                   RGEQKLLTTFWANIGLSLLVTIGVLIIANMTLGKYQRKLELMASTDKLTGAANRQAFEE
FT                   HFANSLTRSVLDSRPMSLLLMDIDHFKLVNDSYGHNIGDLVIQTVSHMLKSQLKEDDLL
FT                   CRWGGEEFLILLPNCSLSQSSELAERIRELVAGRLLRVNGCEINVTLSCGAAQHRASET
FT                   AEDLINRVDIALYQAKEQGRNRVVLSY"
FT   gene            136560..137258
FT                   /locus_tag="Shal_0119"
FT   CDS_pept        136560..137258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0119"
FT                   /product="MOSC domain containing protein"
FT                   /note="PFAM: MOSC domain containing protein; KEGG:
FT                   shw:Sputw3181_0239 MOSC domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74695"
FT                   /db_xref="GOA:B0TMA2"
FT                   /db_xref="InterPro:IPR005163"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:B0TMA2"
FT                   /protein_id="ABZ74695.1"
FT                   /translation="MESQILVEQISGLYLGEAIVELASVTSGINHKSRATELQVGTQAV
FT                   VGDTQADPKHHGGLDRVLHHFPREHYGQYRRWDMMASFKDAPAMGENISTVGLDETQVH
FT                   IGDIIKIGEVELQVTQPRSPCFKLNLQFGHNEFALAMQQSGRCGWFYRVIKPGTIYETD
FT                   SVVLLERLTDISVAEAMHIYFLPEFNAEQYQRLADCKGLAVAWVHSLQRRIENNAIEDW
FT                   QMRLYGPQAN"
FT   gene            137290..137637
FT                   /locus_tag="Shal_0120"
FT   CDS_pept        137290..137637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0120"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_0084 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74696"
FT                   /db_xref="GOA:B0TMA3"
FT                   /db_xref="InterPro:IPR019109"
FT                   /db_xref="UniProtKB/TrEMBL:B0TMA3"
FT                   /protein_id="ABZ74696.1"
FT                   /translation="MTQDEKNMGVLVHLASFSGYLIPFGSILGPLIVWLMKRDEYAFVE
FT                   SCGRNCLNFKISIIIYFIISGILMFVGIGFFLFGILAIFDVIVTIIAAIKASDGVSYKY
FT                   PLTINFIKPRV"
FT   gene            complement(137736..139385)
FT                   /locus_tag="Shal_0121"
FT   CDS_pept        complement(137736..139385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0121"
FT                   /product="Electron-transferring-flavoprotein dehydrogenase"
FT                   /EC_number="1.5.5.1"
FT                   /note="PFAM: monooxygenase FAD-binding; FAD dependent
FT                   oxidoreductase; electron transfer flavoprotein-ubiquinone
FT                   oxidoreductase; KEGG: slo:Shew_0086
FT                   electron-transferring-flavoprotein dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74697"
FT                   /db_xref="GOA:B0TMA4"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR040156"
FT                   /db_xref="UniProtKB/TrEMBL:B0TMA4"
FT                   /protein_id="ABZ74697.1"
FT                   /translation="MERESMEFDVVIVGAGPAGLATACRLMQISQDTGQELTVCVVEKG
FT                   SEVGAHILSGAVFEPKVLDELFDDWRDKNAPLLTAVTHDEIHMLSSATAARAMPNALLP
FT                   KTMHNEGNYIISVGNLCRWLAERAEELGVEVFPGFPASELLFNPDGSVKGIQIGDMGVG
FT                   EDGQPKDGYEPGMELHAKYTVFAEGCRGHLGKQLIEKYHLDNGKTAQHYGLGFKEIWTV
FT                   PSEQHELGKVVHTGGWPLTEGASGGGFMYHMEDNQVAVGLIIDLNYKNPHLSPFDEFQR
FT                   YKTHPVIAKTLAGGERISYGARAITKGGLNSLPKLTFPGGMIIGCDAGTLNFAKIKGTH
FT                   TAMKSGMLAAETLAQAMMAGVEPGKDLDCLQDRFDESWLKEELYTSRNFGPAMHKFGTY
FT                   LGGAFNFIDQNWFGGKLPITLRDEKPDYAQMAESSAYSKIDYPKPDGKLSFDKLSSVYL
FT                   SNTFHEEDQLCHLRLKDARIPIEVNLVKYDEPALRYCPAGVYEIVEEAGEKKFVINGQN
FT                   CIHCKTCDIKDPSQNITWVTPEGGGGPNYPNM"
FT   gene            139766..140746
FT                   /locus_tag="Shal_0122"
FT   CDS_pept        139766..140746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0122"
FT                   /product="molybdenum cofactor biosynthesis protein A"
FT                   /note="KEGG: slo:Shew_0087 molybdenum cofactor biosynthesis
FT                   protein A; TIGRFAM: molybdenum cofactor biosynthesis
FT                   protein A; PFAM: Radical SAM domain protein; molybdenum
FT                   cofactor synthesis domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74698"
FT                   /db_xref="GOA:B0TMA5"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013483"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B0TMA5"
FT                   /protein_id="ABZ74698.1"
FT                   /translation="MSQLQDNFGRRFHYLRMSVTDVCNFKCTYCLPDGYRPDGKPKFLD
FT                   LNEIEHLVSAFSQVGTQKIRITGGEPSLRKDFTDIIRIVNDNDKIKTIATTTNGYRLAK
FT                   HAQEWYDAGLRRINISVDSLDPKMFYQITGENKFDEVMRGVDAALEAGFERVKINAVLL
FT                   KGLNDKDLPRFLHWIKNTPIDLRFIELMETGLGHDYFKAHHLAGNDIKSQLEQAGWQFD
FT                   TPAADDGPAQNFSHQDYQGRIGLIMPYAKNFCASCNRLRVSANGKLHLCLFTENGVDLR
FT                   DLLQTSDQQAELVERLHGQLAQKKQTHFLHDGITGVTQHLASIGG"
FT   gene            140829..141353
FT                   /locus_tag="Shal_0123"
FT   CDS_pept        140829..141353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0123"
FT                   /product="molybdenum cofactor biosynthesis protein B"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain;
FT                   molybdenum cofactor biosynthesis protein B; PFAM:
FT                   molybdopterin binding domain; KEGG: slo:Shew_0088
FT                   molybdenum cofactor biosynthesis protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74699"
FT                   /db_xref="GOA:B0TMA6"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR012245"
FT                   /db_xref="InterPro:IPR013484"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:B0TMA6"
FT                   /protein_id="ABZ74699.1"
FT                   /translation="MGHCTQSQFSALNIAVLTLSDTRDFDSDTSGAFLESALLEAGHKL
FT                   AERQIIKDDKYQIRSVLSQWIASDDVQVIITTGGTGFTDRDNTPEAVKPLFDRDIEGFG
FT                   ELFRHITYTELGTSTVQSRALGGIANKTAIFCLPGSTGACKTGWNKLIKEQLDATHRPC
FT                   NFVMHVKKITE"
FT   gene            141427..141903
FT                   /locus_tag="Shal_0124"
FT   CDS_pept        141427..141903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0124"
FT                   /product="molybdenum cofactor biosynthesis protein C"
FT                   /note="TIGRFAM: molybdenum cofactor biosynthesis protein C;
FT                   PFAM: molybdopterin cofactor biosynthesis MoaC region;
FT                   KEGG: shw:Sputw3181_0244 molybdenum cofactor biosynthesis
FT                   protein C"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74700"
FT                   /db_xref="GOA:B0TMA7"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TMA7"
FT                   /protein_id="ABZ74700.1"
FT                   /translation="MTHAFTHINADGNAHMVDVTDKSVTEREARAEAYIEMASETLEMI
FT                   MSGSHHKGDVFATARIAGIQAAKKTSDLIPLCHPLMLTKVEVELEAQPEHNRVWIRSLC
FT                   KLSGKTGVEMEALTAASTAALTIYDMCKAVQKDMVISQVRLTEKRGGKSGHFKV"
FT   gene            141912..142163
FT                   /locus_tag="Shal_0125"
FT   CDS_pept        141912..142163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0125"
FT                   /product="molybdopterin converting factor, subunit 1"
FT                   /note="TIGRFAM: molybdopterin converting factor, subunit 1;
FT                   PFAM: thiamineS protein; KEGG: shn:Shewana3_0276
FT                   molybdopterin converting factor, subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74701"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:B0TMA8"
FT                   /protein_id="ABZ74701.1"
FT                   /translation="MINVLFFAQIRELLGTASVKIEAGEHTQTAEGLRATLAATDDKWA
FT                   KIMASDKLLVAVNQTISQWDTPIVDGDEVAFFPPVTGG"
FT   gene            142165..142617
FT                   /locus_tag="Shal_0126"
FT   CDS_pept        142165..142617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0126"
FT                   /product="molybdopterin biosynthesis MoaE protein"
FT                   /note="PFAM: molybdopterin biosynthesis MoaE protein; KEGG:
FT                   she:Shewmr4_0276 molybdopterin biosynthesis MoaE"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74702"
FT                   /db_xref="GOA:B0TMA9"
FT                   /db_xref="InterPro:IPR003448"
FT                   /db_xref="InterPro:IPR036563"
FT                   /db_xref="UniProtKB/TrEMBL:B0TMA9"
FT                   /protein_id="ABZ74702.1"
FT                   /translation="MIRVQTQDFNVPEEYHLISQDNSDGAVVTFVGKVRDFNDGSAVTD
FT                   LTLEHYPGMTEAVLNQIEVEARERWPLNKVTIIHRVGAMALGEQIVFIGVTSAHRKAAF
FT                   AACEFLIDFLKTKAPFWKLEAGDKGANWVEARDADEQAAKMWDKKA"
FT   gene            142648..143427
FT                   /locus_tag="Shal_0127"
FT   CDS_pept        142648..143427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0127"
FT                   /product="molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein"
FT                   /note="TIGRFAM: molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein; PFAM: extracellular
FT                   solute-binding protein family 1; KEGG: slo:Shew_0092
FT                   molybdenum ABC transporter, periplasmic molybdate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74703"
FT                   /db_xref="GOA:B0TMB0"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:B0TMB0"
FT                   /protein_id="ABZ74703.1"
FT                   /translation="MKFRVMVLALLLPFLAISNGASAAQDVPAIAAASSIKFALDDIAK
FT                   QFTQETGRKVRISYGSSGNFVAQIRHGAPFELFLSADERYIKQLTMAKQTLDDGVVYAV
FT                   GQLAIAAPKSSPLTLDPDLEGLKQLMAANQLKRFAIANPDHAPYGERAEEVLKKLGLWQ
FT                   PIQPYLVFGENVSQAAQFAVSGATQGGIVALSLAVAKPFEARANYVVIPQKYYTPLDQR
FT                   MVLTLKAGETAKLFYTYLQSEQAQGVFANYGFSRAMN"
FT   gene            143427..144107
FT                   /locus_tag="Shal_0128"
FT   CDS_pept        143427..144107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0128"
FT                   /product="molybdate ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: molybdate ABC transporter, inner membrane
FT                   subunit; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: slo:Shew_0093 molybdate ABC
FT                   transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74704"
FT                   /db_xref="GOA:B0TMB1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B0TMB1"
FT                   /protein_id="ABZ74704.1"
FT                   /translation="MDWEALLLSIKLSSVTVLILIPLAILAGRFLAYRHFPGKSWVEAL
FT                   VMVPLVLPPTVIGYYLLVGLGSESWLGRMLEQLLGHQLVFHFSGLVVASILVNIPFAIQ
FT                   PIQRAFEAVPEDVRDAAACCGMSRLKVLFKIELPMVWPGVLTAMVLCFSHVLGEFGVVL
FT                   MMGGNIAGETKTIAISIYDSVQAFDFASAGNMSLVLLLFAITVLALTTSLSRRVGGQYV
FT                   AKRR"
FT   gene            144088..145203
FT                   /locus_tag="Shal_0129"
FT   CDS_pept        144088..145203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0129"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: slo:Shew_0094 ABC transporter-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74705"
FT                   /db_xref="GOA:B0TMB2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0TMB2"
FT                   /protein_id="ABZ74705.1"
FT                   /translation="MSQSVADLYCRIKQTKHIKLDAEFSCKAGEVLAVVGPSGGGKSTL
FT                   LRMIAGLTLPEGGEIRYGDKHWFSKEQGIQLTPQQRHLGYVPQHFGLFPNLTALENVVA
FT                   ALDHIPKAEREARAKDWLERVNLHGLPDRLPAQLSGGQRQRVALARALAREPSVLLLDE
FT                   PFSAVDRETRERLYLELARLKEQLAIPVVMVTHDLNEAMLLADSMILISQGKMLQQGRP
FT                   REVLTRPRDEAVAKQMGLRNIFDAHVIAQEEERQITWLKFGEHLIASTYFDSLDVGTKV
FT                   RWVVPNQGVRFNSIKKGRLCRSFNKLDITIDSMLAMGETVRVLASVAGVQHKIHAEVPL
FT                   HLAQELELTVGTQTTVALKSELIHILEKSPF"
FT   gene            145325..145675
FT                   /locus_tag="Shal_0130"
FT   CDS_pept        145325..145675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0130"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   slo:Shew_0095 conserved hypothetical protein 156"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74706"
FT                   /db_xref="InterPro:IPR005220"
FT                   /db_xref="InterPro:IPR036700"
FT                   /db_xref="UniProtKB/TrEMBL:B0TMB3"
FT                   /protein_id="ABZ74706.1"
FT                   /translation="MSKKLTGLIILSAVLTLPAFAAYNGPGPATQVKTASDAAKAKDDT
FT                   PVELTGYLVQNLGDEKYLFRDDSGEVEVEIDNVLWRDIEVSDDSKVKLVGKVDDEWQGI
FT                   EIEIDSIRLVSE"
FT   gene            145720..146241
FT                   /locus_tag="Shal_0131"
FT   CDS_pept        145720..146241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0131"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_0250 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74707"
FT                   /db_xref="UniProtKB/TrEMBL:B0TMB4"
FT                   /protein_id="ABZ74707.1"
FT                   /translation="MARWLIGLLLVSGSSFAGQGLYSMMSTGNYPSPTEIMQKLELQHE
FT                   GVISEFEVDIENGELVYEFKIIDPQAKTITSYEYRAIDGSLKEREVGRLKKDDNDELAG
FT                   VVMLQQNGLSLSEMLILVGEETRGHIVKAEVDNDLEISYIELEILDIDGKRQLAFDIEN
FT                   KQLLPLLKWN"
FT   gene            146245..146922
FT                   /locus_tag="Shal_0132"
FT   CDS_pept        146245..146922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0132"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: slo:Shew_0097 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74708"
FT                   /db_xref="GOA:B0TMZ6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B0TMZ6"
FT                   /protein_id="ABZ74708.1"
FT                   /translation="MKILMVEDDATTIEYVVKGFVEQGHNIETATDGHQGLLLATSMKY
FT                   DLIILDRMLPQLDGLKLLAALRATGSQTPVLILSALSHVDERVKGLRAGGDDYMTKPFA
FT                   FSELLVRAEKLMQRGESLPTITDLNVGPLTIELLTRKVTLDGQEILLQPKEFQLLKYLM
FT                   EHVNQVISRTLLFEAVWDYHFDPRTNVIDVHIAKLRRKFEELGHGELIETVRGAGYRLR
FT                   QGH"
FT   gene            146891..148228
FT                   /locus_tag="Shal_0133"
FT   CDS_pept        146891..148228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0133"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: slo:Shew_0098 integral
FT                   membrane sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74709"
FT                   /db_xref="GOA:B0TMZ7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B0TMZ7"
FT                   /protein_id="ABZ74709.1"
FT                   /translation="MLDIGYAKGIKPYQSSAWRITIIFSALVTVIIGTLLLGMYRQLIN
FT                   EQEHQLDLHLDAERTRYQQMALTLDRRSFATQVRGADPKVALIVWRDTADLVGSLSMIP
FT                   KDMPMLPEKHEFPVFTGGPEKLHILTGGMVMTRYGPMLIATRVDQLGALIDKFTNAAIT
FT                   ALMLTLVLTLALGYLFSKAILRRLVQYNRLSKRIEQGQYSTRLPVSWRQDEFDMLARQF
FT                   NGVLDALEQNLAAVRGVTDNIAHDLRTPLSHLRIGLEQLPSKPKEELEEGCAILTEELD
FT                   HCLATFDAMLSLTRIEEGQQTLELQDVSLINISQDLFEMADAMAEFNGQSLKLTTGEEF
FT                   QVRGDKYLLFQALFNLVDNAVKYSGEGAEICISQNRNVISIQDNGPGIPEASREKVFER
FT                   LVRLDPSRHHKGTGLGLSMVKAILSRHNAKIALTDNQPGLKVIITF"
FT   gene            148280..148969
FT                   /locus_tag="Shal_0134"
FT   CDS_pept        148280..148969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0134"
FT                   /product="pseudouridine synthase Rlu family protein,
FT                   TIGR01621"
FT                   /note="TIGRFAM: pseudouridine synthase Rlu family protein,
FT                   TIGR01621; PFAM: pseudouridine synthase; KEGG:
FT                   slo:Shew_0099 pseudouridine synthase Rlu family protein,
FT                   TIGR01621"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74710"
FT                   /db_xref="GOA:B0TMZ8"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006508"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:B0TMZ8"
FT                   /protein_id="ABZ74710.1"
FT                   /translation="MYRVIADEHDFIVINKSTEVHFHSQDGSAGVVAQAEADLGIKLYA
FT                   VHRLDTLTSGLIILAKSSAAAAEFTRMFSAHLVQKYYLALAKGKPKKKQGWVIGDMAKS
FT                   RRSMHKLLRSTDNPAITQFFSHSIAEGERLYLLKPHSGKTHQLRVALASIGVPILGDTL
FT                   YGGEEADRGYLHAYSLHFDYQDKQYEYTVAPVTGDHFQDSAVCQQLNVWQQPHQLDWPK
FT                   LKKASAS"
FT   gene            149164..149643
FT                   /locus_tag="Shal_0135"
FT   CDS_pept        149164..149643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0135"
FT                   /product="pantetheine-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /note="KEGG: shn:Shewana3_4091 pantetheine-phosphate
FT                   adenylyltransferase; TIGRFAM: pantetheine-phosphate
FT                   adenylyltransferase; cytidyltransferase-related domain;
FT                   PFAM: cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74711"
FT                   /db_xref="GOA:B0TMZ9"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TMZ9"
FT                   /protein_id="ABZ74711.1"
FT                   /translation="MHKRAIYPGTFDPVTNGHADLIERAANLFEHVIIGIAANPSKQPR
FT                   FTLAERVELLKTVTAHLDNVEVVGFSGLLVDFAKEQNASVLVRGLRAVSDFEYEFQLAN
FT                   MNRRLSPDLESVFLTPAEENSFISSTLVKEVALHGGDVSQFVHAEVANALTKKAN"
FT   gene            149650..151149
FT                   /locus_tag="Shal_0136"
FT   CDS_pept        149650..151149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0136"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_3925 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74712"
FT                   /db_xref="InterPro:IPR026950"
FT                   /db_xref="InterPro:IPR038636"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN00"
FT                   /protein_id="ABZ74712.1"
FT                   /translation="MHKFIRFYIVRFLSVLALVFSGASIAAPWVDTSDIYLRADIQALA
FT                   DAGVITVPVNTYPLMWSGIGGDLAKVEPSTLSPGLVEAFARVNYYYRNAVDNRGNTSIK
FT                   LAAASDPARFQHFGSDYREQGELGASYEYLGERFAYKISASANYKPSDDEEFRFDDSYL
FT                   AMALGNWMFTFGAVEQWWGPGFDSALHKSNNARPMPSLMMSRNNAQAFETPWLSWLGPW
FT                   TFTAGISRFEEERYAPNALLWNFRGSIRPFRQLEIGLSWTTQFCGDGQECTWESAFKSI
FT                   TGQRDCRADNVDEVGCSNYGNQMAGYDIRFSDTWYNVPFGLYYERTCEDAKSSAPWDIV
FT                   DCGSMFGADTRFNLDGQQYKLFLEYTDTMVFCGEDENAFNCFYEHSTYQSGSRYYGRAL
FT                   GSTYDSDANVYVLGLIGQFANSKGFTSLLRYAQLNKDGKSPSHGWAPQPLKEDLLMLEL
FT                   SYRMPIWKGMMSVGGTVSQSEFEAQNNENNATVFSTYEYKF"
FT   gene            151495..152226
FT                   /locus_tag="Shal_0137"
FT   CDS_pept        151495..152226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0137"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   shm:Shewmr7_3977 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74713"
FT                   /db_xref="GOA:B0TN01"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN01"
FT                   /protein_id="ABZ74713.1"
FT                   /translation="MISVVIPAKDEQANIGPLVEEIHRALKDKTPFEVIVVDDGSNDDT
FT                   FGELLRTGERLGCSTKAIRHEKSTGQSTALHTGVQNASGDIIVTLDADGQNDPADIPAM
FT                   LDLIPTMTHSDFCIAGYRKNRKDTSWKRFQSRVANKIRDALLGDGVPDTGCGLKVFPKA
FT                   SFLKLPYFDHMHRYIPALIRRHGGEIKVSVVNHRDRMEGESKYTAWNRVWVGIVDIMGV
FT                   MWLNRRTRLPNVVKTETTRAE"
FT   gene            152229..152894
FT                   /locus_tag="Shal_0138"
FT   CDS_pept        152229..152894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0138"
FT                   /product="SNARE associated Golgi protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   shm:Shewmr7_3976 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74714"
FT                   /db_xref="GOA:B0TN02"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN02"
FT                   /protein_id="ABZ74714.1"
FT                   /translation="MKRLAKTLVVIAILVLLMFAAQQGLFEHLTDSNWVGNYVENNGNS
FT                   ALVVLFLMGAAFTSVGGPRQVIAFVLGFALGGVYGALLATLSALLGCVITFYFARLTFR
FT                   SSLKKRFKDKLFRFERLIIHRTFLKVLMIRLLPIGSNALTNLFAGTTHVSAWKFFAGSG
FT                   VGYLPQMLIFSFAGAGIGLSDHNNLIISIVLFIFSSLIGAYLYKTRLRKQVDEIVTDE"
FT   gene            152949..154676
FT                   /locus_tag="Shal_0139"
FT   CDS_pept        152949..154676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0139"
FT                   /product="glycosyl transferase family 39"
FT                   /note="PFAM: glycosyl transferase family 39; KEGG:
FT                   shw:Sputw3181_0066 glycosyl transferase, family 39"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74715"
FT                   /db_xref="GOA:B0TN03"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN03"
FT                   /protein_id="ABZ74715.1"
FT                   /translation="MVLKSLQQRFNSDDYYQVLSMLLLFAAVILLVGIGWRSPWPADEP
FT                   RFAEVAREMVDSGQWFFPQRGGEFYPDKPPVFMWAIALFYGLTGSLKVAFLLPNALAGF
FT                   LTLFLVYDLGSRLWSVRVGRNAALLLMLAPQFLIQSKNAQIDAMVMCWITLGCYGLLRH
FT                   FMTGPHWRWYFAGWAFMGLGVITKGVGFLPLLMLLPIIAYALIQKDLFKGRLKWWCLAG
FT                   PLAMLAVIACWLVPMVLIVQSQGTPELIQYQNNILFKQTGERYVNAWHHIKPWYYFLVS
FT                   VVPVMWFPLPLLFIAHWQRVVAKIKAEPIIAILLVWVVLVLVFFSISPGKRGVYILPAL
FT                   PMLALALSAIITGADTKRWFEWGLTGLLWLLGLVFTTAGVLALIHHPAIVKAMADYSAD
FT                   LTHMGYLLLTVGIIWFAVLLLLRRSQAMVRMGISLALTWIVMGTWGYSILEPMRTPQAL
FT                   MANAAKAIGPDGQLGLVKFKEQFILFSPVDITHFSYLAPLEQQERNAWQWMHEGDKRFI
FT                   LVGDHQKLNCFNFTGAKSMGVAHRDDWVLLSKDNLLPTCAEPDKRYQYFTPTPGRWMD"
FT   gene            complement(155936..156751)
FT                   /locus_tag="Shal_0140"
FT   CDS_pept        complement(155936..156751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0140"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /note="KEGG: son:SO_4726 formamidopyrimidine-DNA
FT                   glycosylase; TIGRFAM: formamidopyrimidine-DNA glycosylase;
FT                   PFAM: zinc finger Fpg domain protein;
FT                   Formamidopyrimidine-DNA glycosylase catalytic domain
FT                   protein; Formamidopyrimidine-DNA glycolase, H2TH DNA
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74716"
FT                   /db_xref="GOA:B0TN04"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TN04"
FT                   /protein_id="ABZ74716.1"
FT                   /translation="MPELPEVEVTRQGVSPYLIDNQVTDLIVRNPSLRWPVPEIAKQII
FT                   GQTIRNVRRRGKYLLIDTDAGTTIVHLGMSGSLRILPASTPVEKHDHIDLVLASGKALR
FT                   FNDPRRFGAWLWCELPEQAHPLLSKLGPEPLTDAFNAPYLLAALANKKKAIKLCLMDNH
FT                   IVVGVGNIYANEALFAAGIHPQAEAGKVDAERIEILVSEVKQILASAIKQGGTTLKDFT
FT                   NADGKPGYFAQKLHVYGRGGETCTQCGHLLSEIKLGQRATVFCSLCQKL"
FT   gene            complement(156848..157300)
FT                   /locus_tag="Shal_0141"
FT   CDS_pept        complement(156848..157300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0141"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_0068 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74717"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN05"
FT                   /protein_id="ABZ74717.1"
FT                   /translation="MALSRKKWNTIIILASILMISVLTVIDDNSKITPLQTQALFDKSA
FT                   PLSQLQYGELWLQKRQSGWQCSARVLNCLEWANAWDQVHITALTDKPETEGEPVELVIQ
FT                   VDDLVDAQLWILFSQQGLLKSPAGNWYQIPPSLRESLAPIVRAQAN"
FT   gene            158420..160450
FT                   /locus_tag="Shal_0142"
FT   CDS_pept        158420..160450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0142"
FT                   /product="Ig domain protein group 1 domain protein"
FT                   /note="PFAM: Ig domain protein group 1 domain protein;
FT                   KEGG: sdn:Sden_2330 Ig-like, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74718"
FT                   /db_xref="InterPro:IPR003344"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN06"
FT                   /protein_id="ABZ74718.1"
FT                   /translation="MVPFNKIFALVFLSFILTACGGDDGDGPVCPNNVPCELINDNAAP
FT                   TAAVIYEVSLTVTDAEGNEISSISSINPGKLVANVSGITESVIVTFGSTLGELPITTAV
FT                   TDDEGNASVVIYAGSELGAGTVTASLVSGEQDTAIIVIGATNLEIGSGDPLQPGVAEVS
FT                   TSSLSAGGTASVSVMIVDEQGQPFKEAIDVFFSSGCSLLSTPLAEMSSPVMLVNGVATS
FT                   TYLAKGCVGDDTINISANAGGINLFATGSISVLAAERGSIVFVSATPSNIGILGSGRGE
FT                   SSTVLFKVLDTNGNPVSNASVNFALNTEVGGLKIQPTQASTNGSGIVQTIVTSGTVATP
FT                   VRVTATIDSSNPLLSSQSSTLVVSTGIPDQNSFSLSAEILNAEGWSYDGEQVQVTARLA
FT                   DAFNNLAPDGTAVSFVTEGGAIGPSCFTESGECSVTWTSQNPRPLNGRATITATAIGEE
FT                   SFPDSNGNGRFDATEMTAFLAQDVAGRSNDMDEAFNDYNEDGIFNEDGLEELIDFNGDG
FT                   AFTVRDQLYNGVLCSDPVHSGCADGVSNSKSINVRGSLVLIMSGSTAYGSDITVLDSAN
FT                   DNGDGVLDLYGKETGQVSLIIKDINAQQMPAGTKVSISATAGTVVSKSSYIWPSTNASG
FT                   GLSFGILVKGEDTANSGALLIEVQTPNGVDTLVTTIPITIH"
FT   gene            161411..162193
FT                   /locus_tag="Shal_0143"
FT   CDS_pept        161411..162193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0143"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vvu:VV1_2522 prophage antirepressor"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74719"
FT                   /db_xref="InterPro:IPR003497"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN07"
FT                   /protein_id="ABZ74719.1"
FT                   /translation="MDNNLVNVCYEGTSGETDIRTLYIDNILHFSLNDVFILLNKENKG
FT                   MGERNPARYIPNLIKSQIHDLDDDEFKNLPHPKPTPGLEVETFVTQPGLNRVMGSDDSP
FT                   AGRKFQRWLYHDVVPSLTKHGVYPAPITPQGSALSQMAEIIAQNSRALADTILKQDKLE
FT                   QEVKAVSGDISEVKERIEKLESSNSQNEYRLTVRQWFDNQVLALSSAKELEIVTWCENL
FT                   SLRHNKPRLGCPSGERLAARFFEEVIIDAKSLVERARG"
FT   gene            complement(162347..163333)
FT                   /locus_tag="Shal_0144"
FT   CDS_pept        complement(162347..163333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0144"
FT                   /product="molybdenum cofactor biosynthesis protein A"
FT                   /note="KEGG: slo:Shew_3688 molybdenum cofactor biosynthesis
FT                   protein A; TIGRFAM: molybdenum cofactor biosynthesis
FT                   protein A; PFAM: Radical SAM domain protein; molybdenum
FT                   cofactor synthesis domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74720"
FT                   /db_xref="GOA:B0TN08"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013483"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN08"
FT                   /protein_id="ABZ74720.1"
FT                   /translation="MSLIVDTFGRTVEYLRLSVTDRCDFRCVYCMSEDPCFLGREHVLS
FT                   LEELAWVAQAFTELGVKKIRLTGGEPLVRTDCDQLVKLLGKLPGLEELSMTTNGSRLTR
FT                   FAQEMHDSGLNRLNISLDTLKPDLFTELTRNGKVDRVIAGIDAAIAAGFKKIKVNAVIL
FT                   RGQNDDEVLDLIEFCRERDLDIAFIEEMPLGVIDERKRSRHCSSKEIQEIIKQRYELIQ
FT                   SNRRTGGPARYYTMPGSDIHVGFISPHSNNFCHECNRVRVTVEGKLLLCLGNENSVDLK
FT                   AIVREFPGDIEKLKVAILEGIQHKPKEHHFDPNGETQILRFMNATGG"
FT   gene            complement(163354..165153)
FT                   /locus_tag="Shal_0145"
FT   CDS_pept        complement(163354..165153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0145"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein B"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain;
FT                   molybdopterin-guanine dinucleotide biosynthesis protein B;
FT                   PFAM: molybdopterin binding domain; molybdopterin-guanine
FT                   dinucleotide biosynthesis MobB region; MoeA domain protein
FT                   domain I and II; MoeA domain protein domain IV; KEGG:
FT                   slo:Shew_3687 molybdopterin-guanine dinucleotide
FT                   biosynthesis protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74721"
FT                   /db_xref="GOA:B0TN09"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR004435"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR012182"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN09"
FT                   /protein_id="ABZ74721.1"
FT                   /translation="MSIPFTNPLPIPVLGFCAYSGTGKTTLLKQLIPELNRRGVRLAVI
FT                   KHAHHNFDVDIPGKDSYEMRKAGAKQMLVASHVRWALMTEDAIDSDPELPHLLKQIEAD
FT                   KVDIVLVEGFKKLELPKIELHRAAHGKPFIHTHDDNIQAIACCDDTQLPSELRRLDINN
FT                   IAQIADYVSEYIAAWKPCPIDLPMAPTCGCELDNSSTLSVRQGIDRILSYVTPLTATES
FT                   VELDELESRILASDAISPINVPQHINSAMDGYAFKLNDEPNASYKMVGEVMAGYAYDGT
FT                   LQAGEAVRIMTGAPLPAGADTVQLRELANEQDGEVRFEGKMSLGQHIRQAGEDIAQGAT
FT                   ALAAHTRLHAAEQGLLASLGFGELPVFRRPKVAVFSTGDEVCQPGEPLKANCIFDSNRY
FT                   TIKSMAKKLGCEVIDLGIIQDSEAALAQALKDGAAQADIVISSGGVSVGDADYIKTVLE
FT                   QVGQINFWRINMRPGRPLAFGQIDDSLFFGLPGNPVAVMVSFLQFVQPAIRKLAGEQNW
FT                   APTMVPAITDKPLRSRTGRTEFTRGIYHLAANGKLHVTTSGAQGSGMLSSMVKGNCLIV
FT                   IGEKDEQLNPGDTVYIQPFADLL"
FT   gene            complement(165162..165764)
FT                   /locus_tag="Shal_0146"
FT   CDS_pept        complement(165162..165764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0146"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein A"
FT                   /note="TIGRFAM: molybdopterin-guanine dinucleotide
FT                   biosynthesis protein A; KEGG: slo:Shew_3686
FT                   molybdopterin-guanine dinucleotide biosynthesis protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74722"
FT                   /db_xref="GOA:B0TN10"
FT                   /db_xref="InterPro:IPR013482"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TN10"
FT                   /protein_id="ABZ74722.1"
FT                   /translation="MTAQVDAVILAGGMARRMGGNDKGLVELENRPMIEHAIERIQPQV
FT                   KEILINANRNQNRYSEFGFKVISDQDTGYLGPLAGMITAMSNTDAEYLLVIPCDCPLLP
FT                   TDLVARMLAKLTAEDAELAVASDGKREQPVVMLLKPSLRASMKAFLDAGERKIDFWYAK
FT                   HHYVVAEFSDQPNAFVNVNTPEQKQQLGEAIANEKNY"
FT   gene            complement(165815..166561)
FT                   /locus_tag="Shal_0147"
FT   CDS_pept        complement(165815..166561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0147"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: slo:Shew_3685 ABC transporter-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74723"
FT                   /db_xref="GOA:B0TN11"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN11"
FT                   /protein_id="ABZ74723.1"
FT                   /translation="MATINRKINARIIATNIEMRFENKHLFSATKLVFEQNRVIHLQGD
FT                   NGCGKTTLMKLLAGFIEPTAGTIQAQGFSAAPWWRSNSITGKAIYLHQHPYLFEGSVMY
FT                   NLTYPLRFLSTDREILKDRTEQAIDKAQLRHLLTQAASSLSGGEKQRLAIARAWIIQPK
FT                   LLMLDEPTSNMDKHSQHLVLQMIADLKQQGTGMLISSHQTCMLTKVCDHAWLVCDKTIT
FT                   SSNISANQDIAKAHIDVSTRLNVSIG"
FT   gene            complement(166567..167274)
FT                   /locus_tag="Shal_0148"
FT   CDS_pept        complement(166567..167274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0148"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: slo:Shew_3684
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74724"
FT                   /db_xref="GOA:B0TN12"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN12"
FT                   /protein_id="ABZ74724.1"
FT                   /translation="MNEGWLALIQQALSLLFSLDPEVWSIISVSFSVSFAALAITLLPS
FT                   MVLGFLLAFARFPGRWLVTNLVQTLQSIPTVVIGLLVYLLLTRMGPLGDLKWLFTQKGM
FT                   ILGQMLICAPVLVAMSQAAFTSVDRRAWETSRTLGAPALSAIWAVCRELKVPLLLAIVA
FT                   AFSRILTEIGCSMMVGGNIAGVTRNIPTAIALETSKGDFAQAIALGLVLLVLALILNFA
FT                   LGTLRGKAEPRSH"
FT   gene            complement(167271..168083)
FT                   /locus_tag="Shal_0149"
FT   CDS_pept        complement(167271..168083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0149"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: slo:Shew_3683 extracellular solute-binding protein,
FT                   family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74725"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN13"
FT                   /protein_id="ABZ74725.1"
FT                   /translation="MLNLKRVIGLAVTAALVVGMPAQANEVIKLATTTSTENSGLLKNL
FT                   LPTFEKETGYKVQVIATGTGKALKLARQGDVDVVMTHAPGAEAKFVEEGYGHLPRGIME
FT                   NDFVVLGPKNDPAQIRSSKTAEEAFAKIEKSGVPFISRGDNSGTNMKELLIWKNANITP
FT                   DFKGYTAVGQGMGKTLLMASELEAYTLSDRGTFVAYSGKIDLAVDFDGGAALANPYQII
FT                   LISETKYPTLNHKGAKALSDWLIGAEAQGMINNYKVQGEQLFKATYSE"
FT   gene            168374..169744
FT                   /locus_tag="Shal_0150"
FT   CDS_pept        168374..169744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0150"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: response regulator receiver; sigma-54 factor
FT                   interaction domain-containing protein; helix-turn-helix
FT                   Fis-type; ATPase associated with various cellular
FT                   activities AAA_5; SMART: AAA ATPase; KEGG: slo:Shew_3682
FT                   two component, sigma54 specific, transcriptional regulator,
FT                   fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74726"
FT                   /db_xref="GOA:B0TN14"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN14"
FT                   /protein_id="ABZ74726.1"
FT                   /translation="MNNMKPLPSAVSVLIVDDEPGMRSFLKKALAKKFALVETASSVED
FT                   AEQLRSRCHFDLLIVDIRLPGRSGIEWHEALNDQERRSDIIFMTGYADMDVAIKALRAG
FT                   ASDFIMKPFHLEQMMKAVDRCIERRLLKRENLMLRREVSFNQSSTIIGQSDAMTEVKHV
FT                   IERVAPTNAVVLIEGESGTGKELVARQLHILSGRQGPFVPVNCGAIAPELLESELFGHS
FT                   AGAFTGAKGNREGLFSFASGGTIFLDEIGEMPLKMQTALLRVLEQRTIRPVGSEKEINI
FT                   DVRVLAATNRKLSEEVEAGNFRRDLYYRLNVLDIVIPPLRERPEDIVELTHHFTCQLAA
FT                   ELGVKEVVWSHEDLLKLQQHEWPGNIRELRNMIERCILLGKPPAEYWKAQPKAETLGES
FT                   GYPLQWALKDVERDHVTRVVDVHGGNKSAAARDLGVSRKTLDRKYKEWFGGEADKEE"
FT   gene            169773..171911
FT                   /locus_tag="Shal_0151"
FT   CDS_pept        169773..171911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0151"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: slo:Shew_3681 integral
FT                   membrane sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74727"
FT                   /db_xref="GOA:B0TN15"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN15"
FT                   /protein_id="ABZ74727.1"
FT                   /translation="MSFFSNMFGVSWQQMQAKVRYRILILTLLPILLTLVSLVFITIYW
FT                   NISYTGKQLFMKVKADLTVANSTLITVQDNQEKQLELVMESWPFQNDFRQIGNHPTLQR
FT                   NNLQQVLDKAKKDLNLDFLRLVSVSEAAADPDLRQMLPHIEGLAPFSGLMVLEPSRLSR
FT                   IDPELAERAEVTVIKTLRAHEPNKHEEKRGLLSRSLLPVADINGNVAWYLDGGIMLNRD
FT                   TRIVDHIRDLVYDKGTLPERSIGTVTIFLDNIRISTNVPLHFFPQGDDKQGRALGSLVS
FT                   SEVREKVLNQGLLWVDRAFVFNDWFISAYSPLKDINGKRIGMIYTGFSESPFIHNYLLN
FT                   IIELGTILMLVLLVSGWLVYRGAYSLLQPIERIHHVVKAVQSGRNLRIGSLGLDSDNEL
FT                   SNLAEQFDRMLDLLQRRNSQIQAAAEQLEVKVEERTRSLQEKTEELQANVALLNETRQQ
FT                   LVINEKLTALGELTAGIAHEINNPTAVILGNMELLKYELGDRAVDVEEEIELVIQQVGR
FT                   ISTIIRSLLQYSRPGEFNAPLEMHQITPIIEEMLVLVRHSIQKQEVVLNQELNASYPIQ
FT                   VNRPQLLQVLINLVVNAAHAMNGKGRIWIRTYDWVQHGEPIGVKIEVEDEGKGIPEEEL
FT                   NRIFDPFFTTRKDGTGLGLSLSYGIIKRIGGTIEVSSTVGKGSLFTIGLYHKAIEDQSN
FT                   APYEGLLFSGKHNDMSKQ"
FT   gene            complement(172529..172987)
FT                   /locus_tag="Shal_0152"
FT   CDS_pept        complement(172529..172987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0152"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   shn:Shewana3_4074 acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74728"
FT                   /db_xref="GOA:B0TN16"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN16"
FT                   /protein_id="ABZ74728.1"
FT                   /translation="MYTIEIEAVTEFTPEVFELIQTSYSSIPEFEQGYASQEIATRLLA
FT                   GPALLLIARVEGEIAGFKLGYQTEDQVFYSWLGGVAPDFRGLGLAKSLLEYQERWATEQ
FT                   GYQRIDVKTRNCFPSMLNMLISSQYQITAMISDTQNHSQNKLHLQKQF"
FT   gene            complement(173116..173775)
FT                   /locus_tag="Shal_0153"
FT   CDS_pept        complement(173116..173775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0153"
FT                   /product="conserved hypothetical integral membrane protein"
FT                   /note="TIGRFAM: conserved hypothetical integral membrane
FT                   protein; PFAM: protein of unknown function DUF165; KEGG:
FT                   sbm:Shew185_4313 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74729"
FT                   /db_xref="GOA:B0TN17"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN17"
FT                   /protein_id="ABZ74729.1"
FT                   /translation="MLMLTPAQIRRALLLLAGFHIVIICASNYLVQLPFQIFGFHTTWG
FT                   AFSFPFVYLATDLTVRIFGQQAARKIIFLAMLPALIISYLMGVVFHQGSFQGAEALLEF
FT                   NSFVFRIAFASFAAYLIGQLMDIFVFAKLRETKSWWVAPSASTIVGNLIDTIVFFGLAF
FT                   YASTDEFMAAHWPEIATVDYGFKLIVSLGLFLPAYGLLLKFLQDKILQDEARKTAT"
FT   gene            complement(174080..179365)
FT                   /locus_tag="Shal_0154"
FT   CDS_pept        complement(174080..179365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0154"
FT                   /product="GLUG domain protein"
FT                   /note="PFAM: GLUG domain protein; KEGG: hch:HCH_03195 RTX
FT                   toxins and related Ca2+-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74730"
FT                   /db_xref="GOA:B0TN18"
FT                   /db_xref="InterPro:IPR011493"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN18"
FT                   /protein_id="ABZ74730.1"
FT                   /translation="MIRITAVALLIGMSCLALKANAQVLPQVPMAPDGSPYIDGGGGLI
FT                   SNLAELRWLSETPSAWDESWLQTQDIDASETKNWNLGDHDLLPDTPDEPMGFSPIGDNS
FT                   IAYNGSFNGGGFKIHGLYINRPQSDNIGFFGKLTAGSLEYINLERLYVAGDYYVGGLAG
FT                   NVMQSSIVDCHTSGEVKSVGRLDSDVYPDEKPGSYLGGLIGYASHPTIEHCSSTALVTM
FT                   TLDNPSVTQPTGGLIGTLSGGEVIASRSEGDVHGYSSTGGFIGSTFGTPLITNSFARGN
FT                   VICDSNCGGLIGDADGGRIEDSVATGDVASTSAYVGGLVGGLYNASIVRSSASGQVLTT
FT                   SWGVGGLVGRCNSDPDKPLSSVSDSYASGKVSGNTSGALIGVTWDGCRVSNSYATGFNS
FT                   ELFGRAEGIEPIIENSFFDCSGSETGCSQPYAKTTQELHNLQTFIDAGWNMGSYNQAGT
FT                   WLLNHKAYPILSHGKAVLFTTLPEDIQLQGSEDLLYELTLQVEDIPANQHVAFEVIDAP
FT                   AWLSLQPQGITASLSGTADDSGVGDNIVVIAAVSQGVRNDFPLQLVNISNINDLPVASS
FT                   AQLEIVEDTLLSIDLSTLVKDDDFIHGDEQHSFSVITPLPDGHGNIELAGNNASYMPAA
FT                   NFFGATKFKYQVTDIAGATASGWVNVNVAPVNDAPVASAGQIIVNEDATASLNLMTLVQ
FT                   DVDDNELLFSVSGGLYGQLSLNGTMVSYTPNKNYFGADSFSYTVDDKHSGIRLIAGAQV
FT                   SVAVLPVNDAPTAQSASYHIEEDRTLQVNLASLVNDIDGDLLSYSISTPPAADTASIAL
FT                   AGAMAVLTPTADFNGQVSFIYAVTDNAGGQAQAAINVEVIPVNDSPSANSGSLTVLEDH
FT                   SGTINLAALVQDKDNDPLSFSISPASHGSVSLSGSVVSYQPYENYSGTDTFKFSVTDGF
FT                   QTISNQVHMTIEAVNDAPTISGIPKPSVDLGSHYQFAPKVNDIEGDRLSFSINNKPAWA
FT                   SFNNRTGELVGTPSAEDDLGLHERIRIRVSDGIDVTFLADFTIEVTGEPEANFAIADSF
FT                   TLPADQDERYVLNVLDNDRVAEGETLTLAAAQTSNGQVSIDGRNLIVALNQPLTRVTLS
FT                   YFVDNSLNQQDSANVVLTLEREEDEGLPVINLPEPIWFDATGALSEIELPIPDAFDAEG
FT                   ESLTPIRSDDKIYFPPGRHTVVWQATDSKGNKVAVEQQVNIRPQVTLPRDASVHLLGYE
FT                   SYSVKFMLNGEAPQYPVMVDYILTDELSGMTTEESLLIEAGTEGVLDLMLTDNVGEHSV
FT                   VAYRVALADSTNQGENNTFALSIQSEPQPPLVSSVLTQNGEKRSIIAIPKQEGSGQGVQ
FT                   VNLLVQNAKDGEQFNFEWHSDDIALTIEDDLTSSIAKFVPQIGMDEGVRKVSVDVTRLG
FT                   EHDVTKHHSRHDLYLDIRSELPALSAVADTDGDGIPDKLEGMTDSDQDGIPDYQDAIMV
FT                   PNLMPAIVNNQSSHLIEVEAGLSLKKGMTVPDNHNGGLLLDPELDNIVIDTETSVVGGI
FT                   FDFIVQGLKIPGDTIAIVLPQMNPIPANASYRKYQVTQNGEAKWVEFDLSAGAIYSARG
FT                   KSGICPAPHAESWSSGLTRGDWCVKLVIIDGGANDADGIANGTVVDPGGVAVLLSGNTL
FT                   PILKDDSFTLYDDEIEVNLDVLANDLDAEDPLSIISATTSHGVITHDGQALQLTLPTSL
FT                   PEEITIEYSVIELRENGVTQVANARVNFIERPISNDSGSLTWIWLYCLVSLLGYRRWHG
FT                   RLNKQ"
FT   gene            complement(180017..181375)
FT                   /locus_tag="Shal_0155"
FT   CDS_pept        complement(180017..181375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0155"
FT                   /product="isochorismate synthase"
FT                   /note="TIGRFAM: isochorismate synthase; PFAM: Chorismate
FT                   binding-like; KEGG: slo:Shew_3677 isochorismate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74731"
FT                   /db_xref="GOA:B0TN19"
FT                   /db_xref="InterPro:IPR004561"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR034681"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN19"
FT                   /protein_id="ABZ74731.1"
FT                   /translation="MTIPLLPQAVKSLTDKIKSFTLQPNSDPIVQLSVVVSPIPVIAWL
FT                   AAQSTYPRVYWKGRDTEEEVAAIGSCKDFFFGDEVDDIELSVEYQKQRALTNNQEIRYY
FT                   GGVAFDRRNESWPDFGKAHFVLPRIELRRSGNDYKLLVNLNFTEQEFTQEIDDALQSLQ
FT                   ALDAPKPLAPPNKVALMGRSDRPDRYRWDELVNRVTHPKFIEDTPKVVLSRLTQLEINE
FT                   QVDPWMLLACWQGRNPNSFQFGFQFSPDSTFISCTPERLYRRRQRELFTEALAGTTIRG
FT                   LNQEEDKALAQELLDDTKNSHENQLVRQHIVDVLNPLSNYVGAEETPTVFKLSHIQHLH
FT                   RSIRAELKPGVNDFQLIQALHPTPAVGGLPKESAMNFIRQQEGYVRGWYAGACGYFNKY
FT                   ESEFAVAIRSALIEPGRINLFAGAGIVAGSEADKEWTELENKLTTILSILTEL"
FT   gene            181815..183764
FT                   /locus_tag="Shal_0156"
FT   CDS_pept        181815..183764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0156"
FT                   /product="TonB-dependent receptor plug"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: she:Shewmr4_3867 TonB-dependent
FT                   receptor, plug"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74732"
FT                   /db_xref="GOA:B0TN20"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN20"
FT                   /protein_id="ABZ74732.1"
FT                   /translation="MKKQQKVLRVSTLALAMGLAYQVQADDLERDPIFNVSEVIVVHGE
FT                   RASVTEAATTNWSIDAEEIKASGAQSLDQVLENVPGIYVRVGGDSTPRVDIRGLKTRHI
FT                   TFLINGVPASSTEDGQFDPSVIPTNQIARVDVSVGPSSVLYGPGGSAGVINIITKQGDN
FT                   ASAFSGRLEAAQDNTFNGDLSAAGSGDNWQGIMSVTHQETDGTPMPDDFEDTRNQIGDV
FT                   RFNSDRKLTNYYAQGSYFINDSTKLMANYTQRDGEWGKSPTVDRKKAPSRIEDFNEQSM
FT                   QLGAAHEINEQYVVRGFVYYNQTDMVENFYNHRMNNLNSIVKSTSKVSGTNLQFISEFD
FT                   YGAVLTTSVIVEKQDWFSHTNKLRSDKGTGSGGGTGGGQGGSGDIDESLIVYTGAAEYQ
FT                   YQDDGKYGYSLGVAVHNYDLDVNSETDFSVQASAFYQATDSSRIHTGLARKVRYPSISD
FT                   LYAANSGNVNLKAEVANQFELGLQQSLPFDTQLDISSYITDANDYIAKDDNNQEQNIGD
FT                   FRFMGVDLQMTNQYFDSLGVTFAYSYIDTEDRATNERLQYRPTHNLRLQASYDFSFGLT
FT                   TRLNAERIIDQVNGKGVQLDNYTLVDLSLSQNIWHDNLELYVRATNLFDELYYQSDFMP
FT                   QAGRQVFIGINWQV"
FT   gene            183782..185233
FT                   /locus_tag="Shal_0157"
FT   CDS_pept        183782..185233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0157"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: son:SO_4712 ABC transporter, ATP-binding protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74733"
FT                   /db_xref="GOA:B0TN21"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN21"
FT                   /protein_id="ABZ74733.1"
FT                   /translation="MKLIALEGIHFGYGSHQSEILDDLNLVVNRGECHCINGPTGSGKS
FT                   SLLHLMAGELSRPYEGEVYRAPSLLVGLVMQDPNVQILRQSVGAEIAFGLENLGIAAEL
FT                   MVEKVQQSLRRVGLYISLDTPVEVLSLGQKYRLMIAAQLVFKPSLLLLDEPWAQLDDSG
FT                   VKELYAVLKTLLDDGVAVVMVEHNPGAFLDLVDYLWLLKDGLLKDGLLKDGQLEEGRLD
FT                   AGQNDPSNVAVNNVAASNEQVFDKEDVVSLKSRFSFDNSECLIKIQPHHFRFIEQECLF
FT                   DCQQSLSLYSGEVVALVGDNGVGKSSLLKTLAGIQANIPTFPISVLGKRPRLGIYGAEL
FT                   GLLMQRPNRQLFEQTVQAELQFSLKRFKLPLSRAEQVLQALELTHLAESSPHKLSYGQQ
FT                   HIIALASLVCLQPKVLLLDDPFAGLDKQHVEKVVLLLQQLSMQGCGILLTSHRAIPSLD
FT                   VDRYWLIESGKLMDGAGHIEQLNVG"
FT   gene            185223..185915
FT                   /locus_tag="Shal_0158"
FT   CDS_pept        185223..185915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0158"
FT                   /product="cobalt transport protein"
FT                   /note="PFAM: cobalt transport protein; KEGG: sbl:Sbal_0091
FT                   cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74734"
FT                   /db_xref="GOA:B0TN22"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN22"
FT                   /protein_id="ABZ74734.1"
FT                   /translation="MWANRHIRRGVNKRSDTIHSSFSLSATQYCAVALVLSLVLSSCAF
FT                   FLPNSGLVWLVLVDILLVIHGLYLKNKITALLKLGAAQLALTLPLYYLLHGEAQLLEGV
FT                   IVVLRVFLAMLPGWWLSSTQSPERLGEVLSWGLPAKWAFVIAASIGLLPYMLQETKEIY
FT                   AIQCLRGANITPKALRNPKNWPELIYCVVLPVLIQLLKLSKQMAKAAKLRHFGKVSQPT
FT                   HWPSTRDD"
FT   gene            185915..186460
FT                   /locus_tag="Shal_0159"
FT   CDS_pept        185915..186460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0159"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3673 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74735"
FT                   /db_xref="GOA:B0TN23"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN23"
FT                   /protein_id="ABZ74735.1"
FT                   /translation="MKSPFDLQDALFIGFCATLLVVLKSMLRLKLGLSGHSMFLMTFFY
FT                   LICYGAVGRVGCITACGLLAGLIAMMLSVGKGGPMILLKFGLPAMAMDLALLFMAGMFS
FT                   LRWRSIILALVGCLAWAGKGWIGNLLVGMSGQVALAKFGLSFIQGGAFAIAAALLVPPV
FT                   LKRLHAHDLLHRGQIEDK"
FT   gene            186509..187270
FT                   /locus_tag="Shal_0160"
FT   CDS_pept        186509..187270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0160"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3672 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74736"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN24"
FT                   /protein_id="ABZ74736.1"
FT                   /translation="MKAWLICIDDTDDIGTKGTGEIAEEIAAKLAPPPLTADDKIPVTR
FT                   LVTRHQLFVHPDIPYTSHNSAMCFQIETELSFDEIKAICIAHLKQESAAASDPGLAILD
FT                   LASSYDIEQLIAFGQQSKVEVKTKDQAYTLAEVLGIDLSEHGGTGQGIIGALAGLGLRL
FT                   SGQDGRVKGQLKLGQTSDGSGEVQMSVAEVLAATGLQAVISVDGEKLAGDQVLTLKGKI
FT                   KAVLTQYQFALLVCGDSGRWLNATKQELKPY"
FT   gene            187298..187513
FT                   /locus_tag="Shal_0161"
FT   CDS_pept        187298..187513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0161"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_3955 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74737"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN25"
FT                   /protein_id="ABZ74737.1"
FT                   /translation="MQQWFIQVDGLWQFKFGIEDHLLAREAAAHCEVFLSDDEDEHTDN
FT                   VLRSCYNCMYRRWQPLSFQCHKCRAE"
FT   gene            187755..188939
FT                   /locus_tag="Shal_0162"
FT   CDS_pept        187755..188939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0162"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; SMART: metal-dependent phosphohydrolase HD region;
FT                   KEGG: son:SO_4711 HD domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74738"
FT                   /db_xref="GOA:B0TN26"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR021812"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN26"
FT                   /protein_id="ABZ74738.1"
FT                   /translation="MGDSIESSSLIKIPVSKLKVGMFVEAIDKNKSLVNIANAGQIRSA
FT                   EAILRLHKSNVTHVWVNGERSLPELGLGRVASAPKPFIRKVTVERATTQMQAKELIVEA
FT                   KDLIQKVLSDTFEGKAVEVEPFEALADSMIESVLLDADALKCVSAMRSKDVYLLEHSIN
FT                   VAFLLVTFGRYLNFDADMLRQIAIGGILHDIGKIKIDSKILNKPGKLTAEEFEHVKLHQ
FT                   TYAIEIMGQTKGLSQISKDISLMHHEKLDGCGYPLGLKGEQIPIHGRMSCIVDIFDALT
FT                   ATRCYKEAMSPASAFKILLGMTPTHLDQGLVYEFIRCIGVYPVGSLVQLSDGRIGIVWE
FT                   AKGRDVLHPKVKCFYSVKHKCYTQVEVVDLLRSPLNIEKGISPSSLEIDPTPFY"
FT   gene            189172..189837
FT                   /locus_tag="Shal_0163"
FT   CDS_pept        189172..189837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0163"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /note="PFAM: ThiJ/PfpI domain protein; KEGG: slo:Shew_3669
FT                   ThiJ/PfpI domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74739"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN27"
FT                   /protein_id="ABZ74739.1"
FT                   /translation="MLAAGVTAPLTQAKPTVTFSPFQAGKYRILALVFDDYETLDLHGP
FT                   VEMLGHMPNAEIKLVATKEIVKSYQGPRMVADCLTNQTYDCDLLLIPGGLGTRTLVSDI
FT                   ALRQWLVEQVTRSQNVFTVCTGTALLAMTSVLNGRKATTNKMAFEWVTSLNDNPQWQPK
FT                   ARWVFDGKFLTSSGVSAGTDAALFWVKHLHGEQEARRIEALTEYSWNQDASNDPYAVV"
FT   gene            complement(190425..191363)
FT                   /locus_tag="Shal_0164"
FT   CDS_pept        complement(190425..191363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0164"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   sbm:Shew185_4296 conserved hypothetical protein 698"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74740"
FT                   /db_xref="GOA:B0TN28"
FT                   /db_xref="InterPro:IPR018383"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN28"
FT                   /protein_id="ABZ74740.1"
FT                   /translation="MTNESPNKIHLAVFILVGLLCLMPMVSSPVALILGFTLASIGWAP
FT                   SQVHLGTLTKKLLAYSIVGLGFGIQLDAAVSISLENLPLILGSIIFTLILGFALTRLLK
FT                   MDHKTGHLIASGTAICGGSAIAAVSPAIRANSEQTAIALATIFILNSVALFLFPAIGHA
FT                   LSMSQHDFGVWSAIAIHDTSSVVGAASAYGNEALTTATTIKLARALWIIPIALISAMLF
FT                   KGDKKKIAIPYFIGFYCLAIVMVHWLPAGEVIYSAIFEGSKRLLVVCLFLIGAGITIQR
FT                   MKATGPKPLILGVLLWIAIGSSSLAYILLLN"
FT   gene            complement(191823..193001)
FT                   /locus_tag="Shal_0165"
FT   CDS_pept        complement(191823..193001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0165"
FT                   /product="diaminopropionate ammonia-lyase"
FT                   /note="TIGRFAM: diaminopropionate ammonia-lyase; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   KEGG: pin:Ping_2030 diaminopropionate ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74741"
FT                   /db_xref="GOA:B0TN29"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR010081"
FT                   /db_xref="InterPro:IPR019871"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN29"
FT                   /protein_id="ABZ74741.1"
FT                   /translation="MLKLTQNDFFNGETSELFTAQVAEQTRQFHQQIEAYQPTPLISLE
FT                   QLAARLGVKAILVKDESYRFGLNAFKVLGGSYALGKQLAEHLNVDISEIDMKTVAAKLS
FT                   EPLVFATATAGNHGTGVAWAAREMGQKAVVYMPKGSSQASVTRIKGLGAECIVTDCNYD
FT                   DTVRIANQTAEENGWMLVQDTAWEGYDKIPTWISQGYMTMAVEAQEQVEAMGLKPTHLM
FT                   LQAGVGAMAGGLLGYFADKVGANNFKTIIAEPAKADCIYNSGIKGEMVAVTGELNSIMA
FT                   GLACGEPNPVTWPILKQCSSFFASVEDQVTATGMRILGNPLAGDTKVVSGESGALTLGL
FT                   LYMLASREEYSEYRTQLGLDQDAVIMLFSTEGDTNPDRYRQIVWEGMLSTAQ"
FT   gene            complement(193088..193471)
FT                   /locus_tag="Shal_0166"
FT   CDS_pept        complement(193088..193471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0166"
FT                   /product="putative endoribonuclease L-PSP"
FT                   /note="TIGRFAM: putative endoribonuclease L-PSP; PFAM:
FT                   Endoribonuclease L-PSP; KEGG: vha:VIBHAR_02784 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74742"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN30"
FT                   /protein_id="ABZ74742.1"
FT                   /translation="MKTVIHTENAPAAIGPYSQALAFDKLVFTSGQLPLDPATMAFVEG
FT                   GIKEQAYQSLKNLKAVLEQAGAGTDTVLKTTCFLANMEDFVAFNEVYTEVFGTEAAPAR
FT                   SCVQAARLPKDALVEVEAIAFTK"
FT   gene            complement(193492..194172)
FT                   /locus_tag="Shal_0167"
FT   CDS_pept        complement(193492..194172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0167"
FT                   /product="YheO domain protein"
FT                   /note="PFAM: YheO domain protein; KEGG: sfr:Sfri_0689 YheO
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74743"
FT                   /db_xref="InterPro:IPR013559"
FT                   /db_xref="InterPro:IPR039445"
FT                   /db_xref="InterPro:IPR039446"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN31"
FT                   /protein_id="ABZ74743.1"
FT                   /translation="MIKAAEQAYKTEFTARDRQLLQGHFHLAESMADLIGPHCEVVIHS
FT                   LESFEQSVVKIVNGHHTGRKVGSPITDLGLKMLRLYEQTGEITPKSYFSNNKGGEMLKS
FT                   STCILMGENGKPIGMFCVNMNLSHPFPEIIKTLMPDTTQHHSFDMTENFSASAGDVVEQ
FT                   ALNHAVIEVDADDSVNLKGRNKAITKVLFDNGIFELKEATNIVANHLSITKHAVYKYIR
FT                   EFKS"
FT   gene            194513..195679
FT                   /locus_tag="Shal_0168"
FT   CDS_pept        194513..195679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0168"
FT                   /product="peptidase M24"
FT                   /note="PFAM: creatinase; peptidase M24; KEGG: pin:Ping_2026
FT                   peptidase M24"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74744"
FT                   /db_xref="GOA:B0TN32"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN32"
FT                   /protein_id="ABZ74744.1"
FT                   /translation="MKSILQRGFTTAEFEMRATKAQQKMRELEVDAILLTTEPNVRYFS
FT                   GFHTQFWHSPTRPWFLILPAEGKPIAVIPEIGASGMAGTWVEDIHTWASPRPDDDGISI
FT                   VASVLNSLPSRFGRVGATLGIESHLRMPVANYLQLTTLINKEFVDVSLAIHELRQVKSV
FT                   AEIDKVREICRITNVGFDKIPGYAKAGMTEREICKQFGIDMLMEGADECPYIIAGSGQD
FT                   GYDSIIMGPTDRVIEDGDVLIIDTGAVRDGYFSDFDRNWAFGHASEQTKAAYRATYEAT
FT                   TMGFEAARPGNTTSDIYNAMWKVLEANGALGNDVGRLGHGLGIELTERPSNTATDNTLL
FT                   VPGMIMTLEPGMVYAPGKSMVHEENIVITENGAEWLSKRAEPELLIIK"
FT   gene            195745..196524
FT                   /locus_tag="Shal_0169"
FT   CDS_pept        195745..196524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0169"
FT                   /product="Asp/Glu racemase"
FT                   /note="PFAM: Asp/Glu racemase; KEGG: pin:Ping_2031 Asp/Glu
FT                   racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74745"
FT                   /db_xref="InterPro:IPR026286"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN33"
FT                   /protein_id="ABZ74745.1"
FT                   /translation="MMSFEAFTSFEKPLEHKQAPRINRVHIGLVQLSTDHSLEMDWAKL
FT                   LGTQAGVFSSRVFYSSEMTPEALDQIASGIVEASDLIATGLPMDVMAFGCTSASIIIGE
FT                   EKVASLLTQNRGDIPATNPWTAAKASFKHLNAKKIAVFSPYPTSVNYPLYQQLTDADFD
FT                   VVTLGSLGIERDTDITLVAKESMFAALELMLKDSDAELVFMSCTNLRVLDYIEEIEAKF
FT                   GIPVVCSNSAMFWHAMHLTGNVAQCPGYGKLLNAKTA"
FT   gene            196564..197550
FT                   /locus_tag="Shal_0170"
FT   CDS_pept        196564..197550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0170"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: rci:RCIX1169 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74746"
FT                   /db_xref="GOA:B0TN34"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN34"
FT                   /protein_id="ABZ74746.1"
FT                   /translation="MSNTQKGWLAAIFVGLLWGIPWIVGTPILEVMDPQVLVWLRYTVA
FT                   FVTLGFIFNIGLASGKMKKKTDFKLNWANRNDIFWAACCGIIGQGAFSFLSFLSLDYIT
FT                   ASENGVIQGLIPILILSVGFLRHGERFTVMQIMCALGAFLGVAILVMDPQSETKGFNIG
FT                   HLICLGSAASFATMAYARAKLADKYGSVATMFHQFVFASLGFGLYLLVVGADFSSALNV
FT                   FSSPLRILCIVILGVCISGMSYLVYIYGMERVGVDGTGMALNLMPLSSFILAVFALGEQ
FT                   VTPMRLVAIAVVITSMIAFMKLGNKNKAKAEEVEAELAVAPKPCRSQ"
FT   gene            197633..198787
FT                   /locus_tag="Shal_0171"
FT   CDS_pept        197633..198787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0171"
FT                   /product="amidohydrolase"
FT                   /EC_number="3.5.1.32"
FT                   /note="KEGG: pin:Ping_2027 amidohydrolase; TIGRFAM:
FT                   amidohydrolase; PFAM: peptidase M20"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74747"
FT                   /db_xref="GOA:B0TN35"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN35"
FT                   /protein_id="ABZ74747.1"
FT                   /translation="MNIEQKVIEWRHHIHQHPEFGTQEHETAAFVASKLEEFGIEVHTG
FT                   IGGTGVVGILKCGDSEHSIGLRADMDALHIHEENTFDYASVNEGAMHACGHDGHTAMLL
FT                   AAAHELAQTKNFDGTVYFIFQPDEERGTGAKAMIADGLFTRWKIDAVYAMHNLPGIEAG
FT                   HFVTRPHSIMASESSFEIEVLATGGHAAMPHMGTDPIVVGAQIVTAIQTIVSRNLSAID
FT                   ETAVISVTEFATNGTVNVIPTKVTITGDTRSFTDGALHKIEKALERVVAGQCMSAGVDY
FT                   TYKFNNSFLSTINTPAEAAYAVRAAQTVVGEDKVNGSCQPFTISEDFSFMLREAPGCYI
FT                   LVGNGAGCGCGSVALHKPTYDFNDNILVPGLRYWQTLVEQCLAK"
FT   gene            complement(199692..200906)
FT                   /locus_tag="Shal_0172"
FT   CDS_pept        complement(199692..200906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0172"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_0952 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74748"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN36"
FT                   /protein_id="ABZ74748.1"
FT                   /translation="MLPLKILAYLSATFALLGHLSETGPMHIQMLPSILVSSLLLLSSI
FT                   TLPAFAANDLSGVWQGTLGKSKIRVCFNEYGTGSYYYQRYLTPIRLEQVDNHWQEDKQT
FT                   GFWQFESISEQQLTGLWFNKERSKTERFNKEWSKNDPSKTASSKSLAITLERQISPDGI
FT                   NDCSSDAFNQPLETAPKLRRGKWQQFADTDSQQENANQASSHQISYSQLTYGTEIGLEL
FT                   KAEQAGITAINQWLKQKLTSKTQLEETFETRRRMLAQIGLPIADETGAEIEFVNQHWLS
FT                   VRFYRWAAGYGARGINRTFTSFNLSDGKPFNPWQWFKQDVALDEMRHQLPAALREKLFA
FT                   DMEVFEDCDNSDGSGYFYLTLSPKGIALWETPNGSGCENEFTLSPKEAMLFANEYGKSQ
FT                   LTLME"
FT   gene            201090..202364
FT                   /locus_tag="Shal_0173"
FT   CDS_pept        201090..202364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0173"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   hch:HCH_03999 nitrate/nitrite transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74749"
FT                   /db_xref="GOA:B0TN37"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN37"
FT                   /protein_id="ABZ74749.1"
FT                   /translation="MSHQERKSYLALTLATLAFAACFSVWTLYSILGIELQRQLNLSST
FT                   EFGLLLAAPIFTGAIFRIPIGFLAEKVSCRSLFFWQMLSVVPPLFYLPYVETFSGYITL
FT                   GFLIGISGVSFTIGIRYVTDWFETKHQGFALGVFGAGNAGAAITLVLVPLVVEFYGWKT
FT                   IGTVYGFGMIFMAILFRLFAPEVNAFYKNKQQTKSFEFYWEPLKQLQVWRFGLYYYFVF
FT                   GSFLALLLWLPQYYVSAYGLSLTQSLALTLLFVTSSSIVRAVGGWFADTFGARTVNWSA
FT                   FWICMVCLFFLSYPPTTMTVHGVEKDVTVAFEVNVWLFTLLIVIIGLAQGFGRASIYKT
FT                   IYDYYPHHMGSVGGVVAAVGALGGCTLPILFGLSVDVIGVYSACFMLLYGVLALCMVVM
FT                   YFAIRAEREQKLLKEAIANNFLEKD"
FT   gene            complement(202530..203171)
FT                   /locus_tag="Shal_0174"
FT   CDS_pept        complement(202530..203171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0174"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; response regulator
FT                   receiver; Bacterio-opsin activator HTH domain protein;
FT                   Sigma-70 region 4 type 2; KEGG: pau:PA14_13730 putative
FT                   nitrate/nitrite response regulator; NarL"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74750"
FT                   /db_xref="GOA:B0TN38"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN38"
FT                   /protein_id="ABZ74750.1"
FT                   /translation="MPIAKILLVDDHPALRQGLAQLMSLEESLDVVAQASSGEEAISLA
FT                   VQYEPDIILLDLNMRGLSGIDTLISLKNAQVKSKVIIFTVSDNESDVVQAIKFNTDGYL
FT                   LKDSEPEELIEKIHLALQGEFVISSPLTQILAQSLRSGGKKVSQLEELTQRELQIVKLI
FT                   ASGKSNKEIANKLGITDSTVKVHVKNLLKKLTLKSRVEVVLWAVENKISP"
FT   gene            complement(203201..204961)
FT                   /locus_tag="Shal_0175"
FT   CDS_pept        complement(203201..204961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0175"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase dimerisation and phosphoacceptor region; KEGG:
FT                   psa:PST_0892 two-component sensor NarX"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74751"
FT                   /db_xref="GOA:B0TN39"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR016380"
FT                   /db_xref="InterPro:IPR029095"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR042295"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN39"
FT                   /protein_id="ABZ74751.1"
FT                   /translation="MAEPDNVKHLPLVQSEDNDNVSSSLVATAGLYMATIISLALMSMI
FT                   FSILVTEKLAGGAELINNTGSLRMQVIRISRAQFLETGSANHLIGEEKKAFETKLFKLK
FT                   QTTLGTSFNTPEIEKQYQQIVSQWQQLNSAPKAALPEDYDQFTSKLDNLVHLIQLESEK
FT                   KLTLLRLIQSIAVLLILVISTIALIKINQLLAAPLKNLVHVAEEAGKGNFSAPIEFEAD
FT                   NELGLLAKTIKRMSSQLAYTYQDYEQIVAEKTRELTRSNESLEVLYKGARLLSNQEYDR
FT                   VKSVIIQDMQALIGIGTIKIRLIHKHIDNLVVFQAGESGHPSNYKHSYQFSLEKHNKVF
FT                   GDIIWEVPEGQSVEDWQKQLIQAMADIVATAIELGHQKNAENRLLISEERAIIARELHD
FT                   SLAQSLSFLKVQMSLLTRKMEKKLPEEQIEETIVEIKSGLNKAYLQLRELLTTFRLKLD
FT                   DPSIESALQGTIAEFTQKCQHPIRFSYDLPQHCLSANQEIHLLQIIREGLSNIHRHAKA
FT                   SEAGVRLSPKGELIKLDIWDNGAGLPGTLQTQGHFGLGIMRERVSSLKGQMYLKDHLPS
FT                   GTMISITFEN"
FT   gene            205341..206945
FT                   /locus_tag="Shal_0176"
FT   CDS_pept        205341..206945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0176"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   hch:HCH_04020 nitrate/nitrite transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74752"
FT                   /db_xref="GOA:B0TN40"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN40"
FT                   /protein_id="ABZ74752.1"
FT                   /translation="MSDIDKWNVEDPKFWDGEGKKIANRNLWISIPSLLCGFAVWLYWG
FT                   IITIQMLNLGFPYATSELFTLMAIAGLTGATLRIPSSFFIRLCGGRNTIVFTTALLMIP
FT                   AIGTGIALQDKNTPLWVFQGLALLSGLGGGNFASSMSNISFFFPKKQQGLALGLNAGLG
FT                   NFGVTTMQILVPLVMTFGIFGGEPMELVNTSGTLIGKIPAGSDAWIQNAGYVWLLFLIP
FT                   LAVVGWFGMNNIKASHVTPGLPSPVGSFGIISGMLAIGFLTSILGLWLMLPEKVGGSGI
FT                   ELSKWIVLPIVIALTVFLLKLIPGQVKENLTHQYKIFGNTHTWVMSVIYTMTFGSFIGF
FT                   SAGFGLSIKVIFGYQHVMVDGVMTHDIINPNGPSALMYAWMGPFIGALIRPVGGWIADK
FT                   FGGAKVTQICAIVMVASALGVAYFMKAAYSSETPQEFFVPFLVLFLVLFAATGIGNGST
FT                   FRTISMVFDKEQAGPVLGWTSAVAAYGAFIIPKVLGEQIKLTTPENALYGFAVFYGLCI
FT                   LVNWWFYLRPGAEYKNP"
FT   gene            207064..210828
FT                   /locus_tag="Shal_0177"
FT   CDS_pept        207064..210828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0177"
FT                   /product="nitrate reductase, alpha subunit"
FT                   /note="TIGRFAM: nitrate reductase, alpha subunit; PFAM:
FT                   molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; molybdopterin oxidoreductase
FT                   Fe4S4 region; KEGG: psa:PST_0896 respiratory nitrate
FT                   reductase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74753"
FT                   /db_xref="GOA:B0TN41"
FT                   /db_xref="InterPro:IPR006468"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="InterPro:IPR028189"
FT                   /db_xref="InterPro:IPR037943"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN41"
FT                   /protein_id="ABZ74753.1"
FT                   /translation="MSNFLDRLQFFKKKTGEFSDGHGDTTNESREWENSYRQRWQHDKV
FT                   VRSTHGVNCTGSCSWKIYVKNGLVTWETQQTDYPRTRPDLPNHEPRGCPRGASYSWYLY
FT                   SANRLKYPKVRKPLLKLWRQARLNQDPVDAWASIVEDKAKADSYKSKRGMGGFVRSSWD
FT                   EVNEIIAAANVYTTKTFGPDRVIGFSPIPAMSMVSYAAGARYLSLIGGVCLSFYDWYCD
FT                   LPPSSPMTWGEQTDVPESADWYNSNYIIAWGSNVPQTRTPDAHFFTEVRYKGAKTVSIT
FT                   PDYAEVSKLTDEWLNPKQGTDAALGMAFGHVILREFHLDNPSEYFTNYVRQYTDFPMLV
FT                   VLEKHDDASLKSTRFLRASDLADNLGQDNNPEWKTIAIDENSDEFVSPTGSIGYRWGEK
FT                   GKWNIREREGGEGKETKLQLSLIGGDISPVSFPHFAGDDANKHWVSCDQEVVQVRNVPS
FT                   KKITTADGEELIVATVYDLMMANYGLDRGLGGENVASSYDQDIPGTPAWQEKITGVSRA
FT                   KVIKVAREFADTANKTHGKSMIIVGAAMNHWYHMDMNYRGLINMVMMCGCVGQSGGGWS
FT                   HYVGQEKLRPQTGWQPLAFGLDWSRPPRQMNSTSFFYNHSSQWRHEKVSVHEVLSPLAD
FT                   KSQFPEHMLDYNIKAERLGWLPSAPQLNRNPLQLTKDAEAAGMSPKDYAVQQLKSGELK
FT                   FACEAPDAPENFPRNMFIWRSNLLGSSGKGHEYMLKYLLGTKNGLMNDDLGKSGGFKPE
FT                   EVEWVDQGATGKLDLVTTLDFRMSSTCMYSDILLPTACWYEKDDLNTSDMHPFIHPLST
FT                   AVDPAWEARSDFEIYKGIAKAFSEVCVGHLDKETDFVTVPMLHDTPGELAQPFDVKDWK
FT                   KGECDLIPGMTAPNMVVVERDYPSTYKKFTSFGPALDKLGNGGKGINWNTDDEIMLLGD
FT                   LNHRNTDEGVSEGRPIIETAIDAAETILTLAPETNGAVAVKAWAALSEFTGIDHTHLAK
FT                   PKQEEKIRFRDVQAQPRKIISSPTWSGLEDEHVSYTAGYTNVHEQIPWRTITGRQQFYQ
FT                   DHKWMQAFGEQFVSYRPPINTRTIDVVKGTKQNGNKEIVLNWITPHQKWGIHSTYSDNL
FT                   LMLTLSRGGPIIWMSEVDAKDAGIEDNDWVEVFNANGAIACRAVVSQRVMQGMTMMYHA
FT                   QERIVNVPGSEMTGTRGGHHNSVTRIVMKPTHMIGGYAQQSWGFNYYGTVGCNRDEMVV
FT                   IRKMDKVDWLEGSNTDDLPRPLPTNPDEA"
FT   gene            210840..212378
FT                   /locus_tag="Shal_0178"
FT   CDS_pept        210840..212378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0178"
FT                   /product="nitrate reductase, beta subunit"
FT                   /note="TIGRFAM: nitrate reductase, beta subunit; KEGG:
FT                   pap:PSPA7_1235 nitrate reductase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74754"
FT                   /db_xref="GOA:B0TN42"
FT                   /db_xref="InterPro:IPR006547"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR029263"
FT                   /db_xref="InterPro:IPR038262"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN42"
FT                   /protein_id="ABZ74754.1"
FT                   /translation="MKIRSQIGMVLNLDKCIGCHTCSITCKNVWTSREGVEYAWFNNVE
FT                   TKPGIGYPKEWENQDKWNGGWERKSNGDIQPRIGGKYRILANIFANPDMPEIDDYYEPF
FT                   DYDYQHLHTAPIVEHQPTARPRSVISGKRMEKIEWGPNWEEILGTEFEKRSKDKNFDNM
FT                   QKDMYGEFENTFMMYLPRLCEHCLNPACVASCPSGAIYKREEDGIVLIDQEKCRGWRMC
FT                   ISGCPYKKIYYNWKSGKSEKCIFCYPRIEAGMPTVCSETCVGRIRYLGVLLYDADKIKE
FT                   VASTASEQDLYEKQLEVFLDPFDPAVIEQARKDGVADSVIQAAQKSPVYKMAMDWKLAL
FT                   PLHPEYRTLPMVWYIPSLSPIQNAAESGTLGKAGVIPDVRSLRIPVKYLANLLTAGDEA
FT                   PVITALERMLAMRAYKRAENVEGVEDLEVLQQVGLTKKQADEMYRYLAIANYEDRYVIP
FT                   SGHREMNVPEAYGEKSGCGFTFGNGCSDGHNGVNMFGGKKITRRNIIKTVSVED"
FT   gene            212383..213117
FT                   /locus_tag="Shal_0179"
FT   CDS_pept        212383..213117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0179"
FT                   /product="nitrate reductase molybdenum cofactor assembly
FT                   chaperone"
FT                   /note="TIGRFAM: nitrate reductase molybdenum cofactor
FT                   assembly chaperone; PFAM: Nitrate reductase delta subunit;
FT                   KEGG: maq:Maqu_3084 nitrate reductase molybdenum cofactor
FT                   assembly chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74755"
FT                   /db_xref="GOA:B0TN43"
FT                   /db_xref="InterPro:IPR003765"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="InterPro:IPR042290"
FT                   /db_xref="InterPro:IPR042291"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN43"
FT                   /protein_id="ABZ74755.1"
FT                   /translation="MLILKVVSRLLDYPTEALFGAADEMIAIVEQSGELSVESRAALVE
FT                   FIRQLTARDLYDAQESYDLLFDRGRALSLLLFEHVHGESRDRGQAMVDLMNVYKTNGFE
FT                   VDSSQLPDYIPLYLEYLSEQSPEYIEEWLGDICHILTMLSERLIDRECYYSVLLDSLIE
FT                   VSGVEVDRVEIADNVSKEERDDTVEAIDKEWEDKEIRFDDPMVGQCPSAGVHQSQNSLD
FT                   PNTVNQVPIKWHDADAAQVAGL"
FT   gene            213128..213805
FT                   /locus_tag="Shal_0180"
FT   CDS_pept        213128..213805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0180"
FT                   /product="respiratory nitrate reductase, gamma subunit"
FT                   /EC_number="1.7.99.4"
FT                   /note="KEGG: psa:PST_0899 respiratory nitrate reductase
FT                   gamma chain; TIGRFAM: respiratory nitrate reductase, gamma
FT                   subunit; PFAM: Nitrate reductase gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74756"
FT                   /db_xref="GOA:B0TN44"
FT                   /db_xref="InterPro:IPR003816"
FT                   /db_xref="InterPro:IPR023234"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN44"
FT                   /protein_id="ABZ74756.1"
FT                   /translation="MSNLNFLLFGIYPFIAITVFVVGCWIRYDREPYSWKADSSQIFDQ
FT                   KGFRLASYLFHIGVIFILGGHFVGLLTPESIYHHFISTPDKQLLAMVSGGFFGILCFIG
FT                   TVMLIRRRLNNDRVKANTKRSDLVVLFLLLLQVSLGLLTIIASAQHLDGSVMVLLANWA
FT                   QSIVTLQGVQATESIESVNIIYKLHILVGLTLIMIFPFTRLVHVISVPVKYFTRSYQIV
FT                   RQR"
FT   gene            213950..214765
FT                   /locus_tag="Shal_0181"
FT   CDS_pept        213950..214765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0181"
FT                   /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
FT                   /note="PFAM: PpiC-type peptidyl-prolyl cis-trans isomerase;
FT                   KEGG: psa:PST_0900 probable peptidyl-prolyl cis-trans
FT                   isomerase, PpiC-type"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74757"
FT                   /db_xref="GOA:B0TN45"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN45"
FT                   /protein_id="ABZ74757.1"
FT                   /translation="MGSCGQHASATPSEQKLPIISVNGVTIKEEVLANELQYHSNSDFD
FT                   VVVQQAGQTLVIRQLLIEQAKQNGVDVTADNEEQGIGQLLADKVVYQEPSEEDCLRYFQ
FT                   NNREKFVTAPLLEVDHILLPASAEDEEAKEVARQNAENILVQLSQDISCFAELAKKYSA
FT                   CPSKETGGSLGQISSGQTVPEFEQQLMQHGEGLVEQPLASRYGFHVVNIARKVDGKQLD
FT                   YNMVADKVKGYLVHRASRLAIQAYIHGLVEVAEIEGIEVGFAPELNIHL"
FT   gene            complement(214812..215309)
FT                   /locus_tag="Shal_0182"
FT   CDS_pept        complement(214812..215309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0182"
FT                   /product="HPP family protein"
FT                   /note="PFAM: HPP family protein; KEGG: tcx:Tcr_1929 HPP"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74758"
FT                   /db_xref="GOA:B0TN46"
FT                   /db_xref="InterPro:IPR007065"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN46"
FT                   /protein_id="ABZ74758.1"
FT                   /translation="MKKMSNTEVIASIIGAFFATLCASFFSNSILEANDMPMVLASTGA
FT                   SAMLIFAIPHSPVSQPWPLIGGHLIAAFIGITCYFLIPNAVVASSVAIGLAMLAMHFTD
FT                   SMHPPGGATAVTAVIGGNTVHELGYYFIIVPVFFNAIILLSIAMAVGSFREKNPYVING
FT                   RG"
FT   gene            complement(215586..215996)
FT                   /locus_tag="Shal_0183"
FT   CDS_pept        complement(215586..215996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0183"
FT                   /product="ribonucleotide reductase, alpha subunit"
FT                   /note="KEGG: psa:PST_3997 ribonucleotide reductase, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74759"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN47"
FT                   /protein_id="ABZ74759.1"
FT                   /translation="MSKNTMIANFDELLKMTKNQSNPQRLLLLFANAESVNPKKSKKHQ
FT                   KGTISPVMCVDKLPEEIASFSDLVEEADNINKTWNFIFIASLSGEEGQAPSSNDAEQFL
FT                   NKMANDVETGNGVGRYVVFDRKESPIEIESNI"
FT   gene            complement(216010..217821)
FT                   /locus_tag="Shal_0184"
FT   CDS_pept        complement(216010..217821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0184"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="PFAM: Protein phosphatase 2C-like; SMART: protein
FT                   phosphatase 2C domain protein; serine/threonine protein
FT                   kinase; KEGG: hch:HCH_04002 serine/threonine protein
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74760"
FT                   /db_xref="GOA:B0TN48"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN48"
FT                   /protein_id="ABZ74760.1"
FT                   /translation="MSISDKQTATSGCGCLVNSISGLAMTHKKKSNKLTIDLASHSTRG
FT                   LKEINEDAVGFFSPSEERLLEGKGIALVVADGVSSAEAGKDASETAVKRFIEDYYPTPD
FT                   TWSVKHAGQKLLSSINITLFKRSHEFASEEKGYLTTFTGLVIKSQTCHYFHVGDSRAYL
FT                   FRDGSLSQLTRDHIASIASGKSFLSRALGMDNCLQIDYSSLNLIKGDQLLLTSDGIHDF
FT                   VDEENLVNTLSDSTSPQQKIDKLVYLALENGSDDNVSGVIGEVTSLPNESLNDYNSKLT
FT                   MLPFPPPLDTGVKLDGYKVIKELFASSRSQIYLVKDTDTGELMAMKTPSINFEDDAGYI
FT                   DRFIQEEWIGKRINSPYVVKVIEQKRKRTCLYYLMEYVDGISLDKWMQQNRFPKPKTAI
FT                   SIVEEIAKGLNEFHKMETIHQDLKPANIIIDSVLNIKIVDFGSVFVAGVAEIFIPLEHE
FT                   GVLGTASYSDPKYLLGKNTGIQGDLYALATITYELFCGELPYGKKIEECQTAFEYDRLR
FT                   YIPANSLNPMIPVWFDRTLQRGVMFDLEHRYQRIADFLKDLKNPNSNYLRDDPQIRKNK
FT                   SQILFWQLLSGFWILMLLLVIAMFKHN"
FT   gene            complement(217811..219286)
FT                   /locus_tag="Shal_0185"
FT   CDS_pept        complement(217811..219286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0185"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   hch:HCH_04000 nitrate/nitrite transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74761"
FT                   /db_xref="GOA:B0TN49"
FT                   /db_xref="InterPro:IPR004737"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN49"
FT                   /protein_id="ABZ74761.1"
FT                   /translation="MQNNGRMNLLNLADPKIKMLHITWFAFFLSFVVWFSHAPLMVFIK
FT                   EAFDLTSDQVKALLILNVALTIPARIIIGILVDKFGPRIIYSSLLILSSGICLTFATAT
FT                   SFEQLAFFRFLLGFVGAGFVIGIRLVGEWFPAKQVGIAEGIYGGWGNFGSAAAAMTLPT
FT                   IAYAFGGDDGWRYALGLTGVAAGLYGIFFYIMARNTPKGSTYFKPKKSGGLEVTSWKDF
FT                   FFYLGMNVPMYIALAVLAWKLSPAGVNLYATETMYMMWVGLTALFFIQLNSIWRVNKEN
FT                   LTHGVPDIDKYEFKQVAILNVAYFVTFGSELAVVSMLPLFFLDTFEGLDPVKAGLLASG
FT                   FAFMNLVARPTGGWLSDKFGRRQSLMIFIGGLTLGYAMLSQIDGTWFIPFAVMATMVCS
FT                   FFVQAGEGAVFAIVPLVKRRMTGQIAGMTGAYGNVGAVIYLTVLSFVDYSTFFMVIAAS
FT                   SAVMFLAVLFLSEPKGHMAEVNEDGTVELIDVD"
FT   gene            complement(219584..220477)
FT                   /locus_tag="Shal_0186"
FT   CDS_pept        complement(219584..220477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0186"
FT                   /product="RarD protein, DMT superfamily transporter"
FT                   /note="TIGRFAM: RarD protein, DMT superfamily transporter;
FT                   PFAM: protein of unknown function DUF6 transmembrane; KEGG:
FT                   ppr:PBPRB1503 hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74762"
FT                   /db_xref="GOA:B0TN50"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004626"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN50"
FT                   /protein_id="ABZ74762.1"
FT                   /translation="MLFSGNSIAVCAFLAWGLLPLYFQFIPSANVLELLSIRILFSIPC
FT                   IYLLLKAKSLPMAKIWAAMRNRRVLLICFLAGIFNLTSLYSFTWAVTNGQVLAASLGYF
FT                   MNPIFSIALGVLFLKDKLSTLQSVAVALSIAGIGLQVLYYGELPWLSIIMGGTFALYGL
FT                   MKKFVDLDALSIMMIELILMLPFALCLIMSDLWHQTSVLYSDDNSKILLYLLSAPVTLI
FT                   PLVLFSLAVEKISLIMIGFIQYIEPSIQFLLAVMIFGEVLLPVKVASFSLIWLGLLLCI
FT                   ADIVFKKRMSPTTSRL"
FT   gene            complement(220549..220716)
FT                   /locus_tag="Shal_0187"
FT   CDS_pept        complement(220549..220716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0187"
FT                   /product="amidohydrolase"
FT                   /note="KEGG: pin:Ping_2027 amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74763"
FT                   /db_xref="GOA:B0TN51"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN51"
FT                   /protein_id="ABZ74763.1"
FT                   /translation="MQREVASCYILVVNGTKGEKGSVALHLPHYDFNDELLMVSVKFWV
FT                   ELVRDQLPSE"
FT   gene            221091..222191
FT                   /locus_tag="Shal_0188"
FT   CDS_pept        221091..222191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0188"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; KEGG:
FT                   vha:VIBHAR_05496 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74764"
FT                   /db_xref="GOA:B0TN52"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN52"
FT                   /protein_id="ABZ74764.1"
FT                   /translation="MSTLFSPARIGKMTLKNRFVRSATWENMATEDGHMTDKLYSVYEE
FT                   LAKGEVGLIVTGYANIVAEEKPNAGMMGMYNDSFIAEYQKLTELVHKYDSKIVMQLAYG
FT                   GTKTTYNVGERVIFAPSAVAERGTQTLGKPMTKTEIDYIASAFALASRRAQESGFDGVE
FT                   IHAAHTYLINQFLSPYYNQREDEYGGSLENRMRFLLDIYTEIRKRVGESYPILVKLTAS
FT                   EFFDGGLTFDETRLICKKLESVGVDAIIISGNIHGNACTVVGESFDGHAIQQEGYFREY
FT                   GAVISQEVNLPIITVGGLADFCAIEEIAATTNIQFFALSRPLLAEPQLIKRWSDGRRAE
FT                   VDCERCSKCRTKRGNFCVVYKKRNAA"
FT   gene            222693..224645
FT                   /locus_tag="Shal_0189"
FT   CDS_pept        222693..224645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0189"
FT                   /product="choline/carnitine/betaine transporter"
FT                   /note="TIGRFAM: choline/carnitine/betaine transporter;
FT                   PFAM: BCCT transporter; KEGG: vfi:VF1121 BCCT family
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74765"
FT                   /db_xref="GOA:B0TN53"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN53"
FT                   /protein_id="ABZ74765.1"
FT                   /translation="MKKHFELIDKPTFFGALLLLCAVVIPLLLFPAEGAEWIAVAKTFM
FT                   TDKLGFAYLGLGLAAFFFMIYIVFSDIGQIKLGDPDEKPEFALASWAAMLFCGGIGASI
FT                   LYWGTIEWAYYYQNPPFQLEAGSEEAVRWAATYGLFHWGPIAWCIYMIPAIPIAYFFYV
FT                   RKQPVLKVSAALMPVIGEANSFGKLGKVIDILFIFGLLGGAATTLGLAAPLINEGISYL
FT                   FGIPATTGSQILVLMVCTAIFAYSSYMGMDKGIKILSNINFWGALGLLLFVLVCGPTIF
FT                   MLETGLDSIGRMLSNFFVMATWAEPFGGMGTFEDTHFPQDWTIFYWAWWLVFAPSMGLF
FT                   VARISRGRTIKQMVSGAVFFGSLGCSMYFIILGNYGLSLQLSGQLDVVSILNAEGATRA
FT                   IFAILETLPFSTLIIALFTLLCVIFTATTFDSISYILASVVQTNVTEDPMRWNRLFWAF
FT                   TLSFMPSALMFMGGLATLQTAAIVGGLPLLIIAVMLMISGVKAAMLDLSHQDNYVDPVI
FT                   NISDLPDVDPWSKEGQALARFEALRDKAINAADLEREANDAIWMLKKQLRREALARGES
FT                   SVELGDAPDEIIEQLRQLTDDSMKAKEAKLAASELAQEARVAFDALMRDKEQEEALLAQ
FT                   EEVKLAIQARLNTPN"
FT   gene            complement(224775..226130)
FT                   /locus_tag="Shal_0190"
FT   CDS_pept        complement(224775..226130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0190"
FT                   /product="glutathione-disulfide reductase"
FT                   /note="TIGRFAM: glutathione-disulfide reductase; PFAM:
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; pyridine nucleotide-disulphide
FT                   oxidoreductase dimerisation region; KEGG: slo:Shew_3660
FT                   glutathione-disulfide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74766"
FT                   /db_xref="GOA:B0TN54"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006322"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN54"
FT                   /protein_id="ABZ74766.1"
FT                   /translation="MAQHFDYICLGAGSGGIASANRAAMRGAKVLLIEAKELGGTCVNV
FT                   GCVPKKVMWYGAQVAEAMHLYAKDYGFDVTVNKFDWSTLVASREAYIDRIHGSYDRGLE
FT                   SNGVTLVRGYGRFVDSSTIEVNGEHYSADNILIATGGAATIPNIPGAEHGIDSDGFFAL
FT                   AEQPKRVAVIGAGYIAVEVAGVLQALGSDTHLFVRKHAPLRNFDPMLSEALMESMATDG
FT                   PTLHTHSVPESVTKNSDGSLTLKIENGESYDIDCLIWAIGRQPSTANIGLENTKVKLDE
FT                   KGYVITDEQQNTTDTGIYCVGDIMAGGVELTPVAVKAGRLLSERLFNGMTDAKMDYSCI
FT                   PTVVFSHPAIGTMGLTEPEAKAEYGEDNVTVYTSGFTSMYTAVTAHRQACKMKLICAGD
FT                   NQKVVGIHGIGYGMDEILQGFGVAMKMGATKADFDAVVAIHPTGSEEFVTMR"
FT   gene            complement(226461..226937)
FT                   /locus_tag="Shal_0191"
FT   CDS_pept        complement(226461..226937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0191"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sbl:Sbal_0122 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74767"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN55"
FT                   /protein_id="ABZ74767.1"
FT                   /translation="MLLLLRLVIGMFVIFYSQSCFSSDPDTSSLVLGSVLNDKGQPIEI
FT                   PSKPQSDFNYSPPTIEESKRSSTQARVAKKSPPKKDKSRKQQLASRNSVANDPGCRWLN
FT                   GRMNSLERHLSAGVNSRNRHYQTELNIRQDEWQCMKCGAEGPKQSDHASCQYRR"
FT   gene            complement(227145..227927)
FT                   /locus_tag="Shal_0192"
FT   CDS_pept        complement(227145..227927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0192"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3658 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74768"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN56"
FT                   /protein_id="ABZ74768.1"
FT                   /translation="MNKTSLYTALVTLLISPLAFADDAVSIDDSHTIKVIEQLPSDDSG
FT                   QVQGLIDLGWDSKYISEGRNNLEKGGIYWATAAVQKDNFNIYATVGRGDSQHYTEWNFG
FT                   IEYGFDLSENLSGSIGYQRLEFYGDERAYDNELFSSLEYTAVDWLVPSVSYTYSTEAAG
FT                   YFVEVSLHSNWELADGLSVSPYVTQGFDFQYVTEDHDGPNHFQFGVEAEYLLPNNFVVS
FT                   GHISHTIAQEDIKLEARNDGITGSLDETFAGLHLSWNF"
FT   gene            228203..230242
FT                   /locus_tag="Shal_0193"
FT   CDS_pept        228203..230242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0193"
FT                   /product="Oligopeptidase A"
FT                   /EC_number="3.4.24.70"
FT                   /note="PFAM: peptidase M3A and M3B thimet/oligopeptidase F;
FT                   KEGG: slo:Shew_3657 oligopeptidase A"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74769"
FT                   /db_xref="GOA:B0TN57"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN57"
FT                   /protein_id="ABZ74769.1"
FT                   /translation="MSNPLLSSAKLPPFSSIKPEHIQPAVEQGIADCRQKIEEVLKHQG
FT                   EFTWDNLVAPLEETDDLLGKIWSPISHMNSVVSNEEWRKAHDACLPLLSEYGTFVGQHQ
FT                   GLYQAYKSLAESAEFAHYSQAQKKLIENSLRDFELSGIGLSDSDKLRYGELVKRMSELT
FT                   SNFSNQLLDATQAWTKLITDEADLKGLPESATAAAKAMAESKELDGWLFTLDIPSYLPV
FT                   MMYSENRELREECYRAFITRASDQGPNAGEFDNGPLMDEILVLRHELANLLGFDSFSHK
FT                   SLATKMAESPAQVLDFLTELAARSKSQGETELAELKEFAEKECGVTELEPWDLSFYAEK
FT                   LKHHRYEISQELLRPYFPEDKVLSGLFYTVSRLFGLKVEEQKEFDSYHKDVRFFHITDS
FT                   NNEHRGSFYLDLYAREGKRGGAWMDDCRARRMTENGLQDPVAYLTCNFNAPVAGKPALF
FT                   THDEVTTLFHEFGHGIHHMLTKIDVGGVSGISGVPWDAVELPSQFMENWCYEEEALAEI
FT                   SGHYETGEPLPKAMLDKMLAAKNFQSGMMMLRQLEFSLFDFKMHLEFDPAKGAEIQQKL
FT                   DEVRQEVAVIEAAEFNRFQHSFAHIFAGGYAAGYYSYKWAEVLSADAFSLFEEQGIFNA
FT                   ETGQRFLENILEMGGSEEPMELFKRFRGREPQTDALLRHSGING"
FT   gene            230394..230966
FT                   /locus_tag="Shal_0194"
FT   CDS_pept        230394..230966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0194"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_3934 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74770"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN58"
FT                   /protein_id="ABZ74770.1"
FT                   /translation="MNLYFRLIWLFLWRKRHCNKIDFLGTSRLAYRALPTDCDINFHLT
FT                   NSRYPAFMDLARTYMMAEMGFLKRFLTLGWMPIVNAAEFTYIRDIKPFAKFEIETKLVG
FT                   WDEKYFYIEQRFVSERGLHCIAHVRGVFVCKRKQVAITTMLEEVGFNEPAPQLPPEVIK
FT                   WKSFLQLKKECNLPSPTGEPIEFRAAS"
FT   gene            complement(230963..231610)
FT                   /locus_tag="Shal_0195"
FT   CDS_pept        complement(230963..231610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0195"
FT                   /product="Glutathione S-transferase domain"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   shw:Sputw3181_3976 glutathione S-transferase, N-terminal
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74771"
FT                   /db_xref="GOA:B0TN59"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN59"
FT                   /protein_id="ABZ74771.1"
FT                   /translation="MDLYYHPLARQSQKTLIALYEKQASFNPHIIDLGDAFSRRSFQQL
FT                   NAASKLPLLHVRAGESFNDASIIIEYIDNYISSGTQLIPIDKTQALYVRLYDRLSDNQL
FT                   DREIDAWLQAVRSSNNQLYTKRLERAMLTSLEHFDRRLANNHWVCGESFSLADCAFIPC
FT                   LKTLESRLQLLDYEHIGRYWIQAKLRGSVNQVIEEIELTLATTGQNEQVVHT"
FT   gene            231805..232494
FT                   /locus_tag="Shal_0196"
FT   CDS_pept        231805..232494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0196"
FT                   /product="conserved hypothetical 3-methyladenine DNA
FT                   glycosylase"
FT                   /note="KEGG: shn:Shewana3_4048 conserved hypothetical
FT                   3-methyladenine DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74772"
FT                   /db_xref="GOA:B0TN60"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN60"
FT                   /protein_id="ABZ74772.1"
FT                   /translation="MSKIESFAAIYARASQRKGGDQSLGSLLPTGLRSEEIEQFSDAVL
FT                   LSEISKKVFQSGFVWRIVEANWPEYEKAFFGFEPFKVLMLSPEQLQDRASDPKLIRHLK
FT                   KTMAIYDNAHMVNDLAGEHGSFAKFIADWPSEDITGLWAELKRKGARLGGNTGPYFLRS
FT                   MGKDTFLLTADVQGYLKSHGLVDYGFSSKAGLKQVQSVFNHWQQESGRSLADISRVLAC
FT                   SVGDNRV"
FT   gene            232852..234003
FT                   /locus_tag="Shal_0197"
FT   CDS_pept        232852..234003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0197"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   slo:Shew_0031 efflux transporter, RND family, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74773"
FT                   /db_xref="GOA:B0TN61"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN61"
FT                   /protein_id="ABZ74773.1"
FT                   /translation="MRQIVKIASVLSVALWISGCEQKPEQGPQQRGPMEVGVITIAAKP
FT                   QSIMVELPGRSKSYLEAEVRPQVSGIIMERGFVEGRDVEKGQSLYQIEPSTYEAALVSA
FT                   KADLKSAQAGLVSAKAKALRFEKLVKLNSISEQDYDEADAAYKEALARVTVAEANINTA
FT                   QINLEYTKVTAPISGRIGKSDVTAGALVTANQSQTLATIQQLDPMNIDIAQSSTQMLRL
FT                   KSQLKRGQIEAAANANVELILEDGTPYHHTGVLQFAEVTVNENTGSVIIRAEFPNPDGV
FT                   LMPGMYVRAVLNTGTDPEAILVPQKAITRNTKGQAVAMVIEDGKVAARIVTTAEVIDNQ
FT                   WRITSGLKVGEQLIVEGLQKIRPGAPVKAGPLAADKKPETQQK"
FT   gene            234013..237171
FT                   /locus_tag="Shal_0198"
FT   CDS_pept        234013..237171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0198"
FT                   /product="transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family"
FT                   /note="TIGRFAM: transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family; PFAM: acriflavin resistance protein; KEGG:
FT                   slo:Shew_0032 transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74774"
FT                   /db_xref="GOA:B0TN62"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN62"
FT                   /protein_id="ABZ74774.1"
FT                   /translation="MARFFIDRPIFAWVIAIIVMLAGVLSIVGLPVSQYPSIAPPSVVI
FT                   SAVYPGASAKTMEDSVTQVIEQRMTGLDNLRYISSTSDSFGNAQITLTFNAEADPDIAQ
FT                   VQVQNKLQLAMPLLPQEVQAQGVNVTKSSAGFLMVAAFVSEDGSLDKNDIADYVGSNIQ
FT                   DPLSRVPGVGTIELFGAQYAMRIWLDPLKLTQFNLTSQDVISSIREQNAQVSAGQLGGA
FT                   PSLPGQELNATVSAQSRLQTAEQFQKIIIKADTSGAKVFLEDVARVELGAESYAVESFY
FT                   NGKPAAGIGIQLATGANALATAEGVRAKIAELKPFFPEGMEVVYPYDTTPFVEKSIEGV
FT                   VYTLLEAVVLVFLIMYLFLQNFRATLIPTIAVPVVLLGTFAILAVAGFSINTLTMFAMV
FT                   LAIGLLVDDAIVVVENVERVMQEEGLSPIEATKKSMDQITGALVGIGLTLSAVFVPMAF
FT                   MSGSTGVIYRQFSITIVSAMALSVMVAIILTPALCATMLKPIAKGESHAKTGFFGWFNR
FT                   KFDALTSRYEANVAAMIKRTGRTMMVYLAITVAVGWIFMRMPTAFLPDEDQGILFTQAI
FT                   LPVNSTQQETKQVLEQVSDYFLNDESANVKSVFSVSGYSFAGMGQNMGLAFVGLKDWSE
FT                   RSNPGQDVQSVANRAMAKFSQMKEAFVFAFVPPAVIELGTANGFDFYLQDKNGQGHEKL
FT                   VEARNMLLGMAAQNPNLVGVRPNGQEDAPLYQVHIDHGKLRALGIDIESVNSVLGTAWG
FT                   GNYVNDFIDRGRIKKVYVQGEAEYRMQPEDLDSWYVRNSKGEMVPFSAFASGTWGYGSP
FT                   RLERFNGLPAMNIQGGTAPGYSTGAAMDDIEAMVKKLPPGFGIEWNGLSYEERLSGNQA
FT                   PMLYALSIVVVFLVLAALYESWSVPFAVVLVVPLGIIGALIAMNGRGLPNDVFFQVGLL
FT                   TTVGLATKNAILIVEFAKEYYEKGAGLVEATLHAVRVRLRPILMTSLAFGLGVVPLAIS
FT                   SGVGSGSQNAIGTAVLGGMMSSTFMGIFFIPIFFVIVERMFSKRERDAARAVKAEAKAA
FT                   KANK"
FT   gene            complement(237548..238105)
FT                   /locus_tag="Shal_0199"
FT   CDS_pept        complement(237548..238105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0199"
FT                   /product="phosphodiesterase, MJ0936 family"
FT                   /note="TIGRFAM: phosphodiesterase, MJ0936 family; PFAM:
FT                   metallophosphoesterase; KEGG: ypi:YpsIP31758_1434
FT                   phosphodiesterase, MJ0936 family"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74775"
FT                   /db_xref="GOA:B0TN63"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041802"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN63"
FT                   /protein_id="ABZ74775.1"
FT                   /translation="MKLFIASDLHGSLSATKAMLTRFEQSGARYLILLGDLLNHGPRNA
FT                   IPEGYDPVALSETLNAYADKIIAVRGNCDSEVDQMLLQFPITETYAQILMPQMRLFLTH
FT                   GHVYSPDKLPPLQAGDGLLYGHTHIAVAEYRDDILLFNPGSTTIPRNDSRASYGLITDT
FT                   ECQIRALDNDELLLSCPIRHRL"
FT   gene            238336..239733
FT                   /locus_tag="Shal_0200"
FT   CDS_pept        238336..239733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0200"
FT                   /product="permease"
FT                   /note="PFAM: permease; KEGG: mbb:BCG_2984 putative integral
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74776"
FT                   /db_xref="GOA:B0TN64"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN64"
FT                   /protein_id="ABZ74776.1"
FT                   /translation="MIQSLFELIWHVLSTLSGMVWQIYWPLAFGLMLSSVLRNILPLDV
FT                   VVKHLGKTNGRSLVLTTLLGMVSSSCSYAAASMSKTLLIKHATLANSMAFLVASTNLIL
FT                   EMFIVLVSLLGWQFLWGEISGGLLLVVIVGFIFRFYPKAQSRALRDKLQSEEKGASTEM
FT                   KCGAAMPGMAKATTNPAPSSNSHKNDVEMKCGADMAGMAKAPSDPAPNSNSHKNDAEMK
FT                   CGADMAGMAKAPSDPAPNSNSHKSDAEMKCGAGKCGADMSGSDSAQNKTTESHYMDKVR
FT                   RSAGYFYMDLGMIGKDIIIGVVISSVLIALVPADWWRELFISSQVNLPAWLHSLLDVLV
FT                   GIFVAVIAYVCSVGNLLLAAALWHGGISFGGVIGFILADVLTIPMLGVYAKYYGAKPAR
FT                   WIGALLFLSILATGIIIDLIYMNVDWSASKETIRTLHQSGFGWNFTTVMNVIFIPLSIW
FT                   YYRLGKS"
FT   gene            complement(240034..241653)
FT                   /locus_tag="Shal_0201"
FT   CDS_pept        complement(240034..241653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0201"
FT                   /product="AbgT putative transporter"
FT                   /note="PFAM: AbgT putative transporter; KEGG: slo:Shew_3654
FT                   AbgT putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74777"
FT                   /db_xref="GOA:B0TN65"
FT                   /db_xref="InterPro:IPR004697"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN65"
FT                   /protein_id="ABZ74777.1"
FT                   /translation="MSSNNGDSLPMSSDASSDPNNQPSGWFVRFLNVVERLGNLLPHPI
FT                   TLFVIFCAAVIVISGIAGYFELSVVDPRPEGASGRSSDGMIHVVSLMNAEGLRMIVSNL
FT                   VTNFTGFTPLGTVLVALLGVGIADRSGLLSAAMRSLVMGTSKRLVTLTIVFAGIVSNTA
FT                   AELGYVVLIPMAAMIFHSLGRHPLAGLAAAFAGVSGGYSANLLLGTVDPLLSGITEAAA
FT                   QMIDPDYTVGPEANWYFMFVSTFLITFLGAFVTEKIVEPKLGKYDPSEAASDLGEQKMD
FT                   GVSAIEKQGLKAAGLAVLVMSVLLALTVVPEGAPLRNPETGLVSGSPFLKGIVAFIFIC
FT                   FAIPGLVYGRIVGTMKRDVDVINAMSHSMSSMGMYIVLVFFASQFVAFFTWTNLGSVLA
FT                   VAGADALNAIGLTGPLVFVVFIAMCGFINLMLGSASAQWAVTAPVFVPMLMLVGYAPET
FT                   IQAAYRIGDSVTNLITPMMSYFGLILAVASQYKKNLGIGTLIATMLPYTIVFFIGWTSF
FT                   FFIWVFGFGLPVGPGSATYYTP"
FT   gene            complement(242229..243848)
FT                   /locus_tag="Shal_0202"
FT   CDS_pept        complement(242229..243848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0202"
FT                   /product="AbgT putative transporter"
FT                   /note="PFAM: AbgT putative transporter; short chain fatty
FT                   acid transporter; KEGG: slo:Shew_3654 AbgT putative
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74778"
FT                   /db_xref="GOA:B0TN66"
FT                   /db_xref="InterPro:IPR004697"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN66"
FT                   /protein_id="ABZ74778.1"
FT                   /translation="MSSNDGDSLPLSSQAPLEPSNKPNGWFVRFLNGVERLGNLLPHPI
FT                   TLFALFCAAVVVISGIAGYFELTVVDPRPEGASGRSSDGLIHVVSLMNAEGLRMIVSNL
FT                   VTNFTGFTPLGTVLVALLGVGIADRSGLLSAAMRLLVMGASKRLVTLTLVFAGIVSNTA
FT                   SELGYVVLIPMAAMIFHSLGRHPLAGLAAAFAGVSGGYSANLLLGTVDPLLSGITEAAA
FT                   QMIDPDYLVGPEVNWYFMFVSTFLITFLGALVTEKIVEPKLGKYDVSEAATDLSQQKMD
FT                   SVSALEKKGLKIAGLTILVMSAVLALTIIPEGAPLRNQETGLVAGSPFLKGIVAFIFIC
FT                   FAIPGLVYGRIVGTMKRDIDVINAMSSSMSSMGMYIVLVFFASQFVAFFKWTNLGAVLA
FT                   VSGADALNAVGLTGPLVFVLFIMMCGFINLMLGSASAQWAVTAPIFVPMLMLVGYAPET
FT                   IQAAYRIGDSVTNLITPMMSYFGLILAVASQYKKNLGIGTLVATMLPYSIVFFIGWTCF
FT                   FFLWVFVIGLPVGPGAATYYTP"
FT   gene            244721..245290
FT                   /locus_tag="Shal_0203"
FT   CDS_pept        244721..245290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0203"
FT                   /product="LemA family protein"
FT                   /note="PFAM: LemA family protein; KEGG: slo:Shew_3652 LemA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74779"
FT                   /db_xref="GOA:B0TN67"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN67"
FT                   /protein_id="ABZ74779.1"
FT                   /translation="MEGILLGSGLVVIIAYLWYVSLIKKRNTGREALSGIDVQLKKRSN
FT                   LVPNILKIAQKYMDHEKSLLTEITELRTLATKGYDSVDPAAVKTHLEVSEKLNQKMSQL
FT                   MVSVESYPELKSDNTMLQAMQTYNEVEAQLSAARRFYNAAVSELNTAVEIFPGSIIASI
FT                   ANVKVMPFYEADEASKAPVNATDYLR"
FT   gene            245375..246397
FT                   /locus_tag="Shal_0204"
FT   CDS_pept        245375..246397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0204"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3651 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74780"
FT                   /db_xref="GOA:B0TN68"
FT                   /db_xref="InterPro:IPR021484"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN68"
FT                   /protein_id="ABZ74780.1"
FT                   /translation="MNIFSFLFGAPIKPIRNSNNLTAAPNELAEFKLYYQQYLEPLTSK
FT                   FESARVASLKSCRQRLYLCSAIYLGIVALAFMFTPYLNISDPMIIYLIGLVVLALPFAW
FT                   WVFNPIKHYKADVKQRIYPLIFKYFGHDFIFCREHKMSLATLKASKLLPYYDAANFDDY
FT                   VQGTYKSIEIAINELHLTKQVKREKNTNTVTVFKGVMIELSNHKDFRGHTVVVKSRGGL
FT                   VNFLSDSFKGLERVKLEDPIFEKQFDVFSTDQIEARYLLTVTFMERLQELSASFGNKIQ
FT                   CAFYRNKLLIMLGSKDNRFEMTSIFKAATFEYEFSQINKEMKQLFAIVDVLQLERTTGL
FT                   "
FT   gene            246394..247107
FT                   /locus_tag="Shal_0205"
FT   CDS_pept        246394..247107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0205"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="PFAM: Lytic transglycosylase catalytic; KEGG:
FT                   shw:Sputw3181_3969 lytic transglycosylase, catalytic"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74781"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN69"
FT                   /protein_id="ABZ74781.1"
FT                   /translation="MMKQGVLIGLLLTSVAAIAETDKPHFVAKPSSKSVLGKTVSNNDK
FT                   HNTSPSTGVTLQQGEKVYHYLSADGGLVFSDHAPQQGHYQVLLFDCYACKPQSNINWNT
FT                   IPLFTAQYQQQIAMAARAYRLEPALIRAVIHAESAFKSTAVSKTGAQGLMQLMPATAGE
FT                   LGVSDAFHPEQNILAGSRYLALLLKRFDGDIALACAAYNAGASRVEQYNGVPPYPETQA
FT                   YVERVQILLKRYRRT"
FT   gene            complement(247116..248498)
FT                   /locus_tag="Shal_0206"
FT   CDS_pept        complement(247116..248498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0206"
FT                   /product="multi antimicrobial extrusion protein MatE"
FT                   /note="PFAM: multi antimicrobial extrusion protein MatE;
FT                   KEGG: ppr:PBPRB1940 putative Na+-driven multidrug efflux
FT                   pump"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74782"
FT                   /db_xref="GOA:B0TN70"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN70"
FT                   /protein_id="ABZ74782.1"
FT                   /translation="MLAQSIENNSNDSISRTFWRYTLPAIAAMLVNGLYQIVDGIFIGH
FT                   YIGYEGLAAINMAWPVIYFMVGFGIMIGMGSGSLLSIQRGKGDTSAAPTILTTSLLSML
FT                   ALAVASSAILSILSTFFLEAQGGAGTTLVMAQDYISVFSWGTAITIIASALPLLIRNDE
FT                   SPNIATGLMVLGAFINIALDYLLIGVFEFGLLGAAIATITAQLTVCILGLVYFCSRISN
FT                   ISWPSKFRYFNASFAKQIVLLGSSSLFMYLYTSFVFALHNRLFIEYGTPLTVGAFAIVG
FT                   YLMVLYYLVSEGIAEGLQPPVSYYYGAEQHANINKMLKLSIKVTLIAGTSWILLLNAIP
FT                   ETMVKLFNSSDSELIATAVDGIRMHLFAMPLDGFIVLSSVYFMATNQGVKALVIACGNM
FT                   LIQLPFLMILPKFFGVDGVWMAMPISNIALCLIVVPLVWLDVKARARKFGPTTTEAVIA
FT                   TA"
FT   gene            248605..249483
FT                   /locus_tag="Shal_0207"
FT   CDS_pept        248605..249483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0207"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: vfi:VFA0935 transcriptional
FT                   regulators, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74783"
FT                   /db_xref="GOA:B0TN71"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN71"
FT                   /protein_id="ABZ74783.1"
FT                   /translation="MNWTLDELSAFVNSVKLGSFSAAARKMGKAQSRISTAISNLEAGL
FT                   GFELFDRSAKLPVLTPLGEEMFIEAQSVLAQCQRLNARAMTVTSGEEVVLTVAMDEAVP
FT                   VNAFEALFQRISSKFPLLKLTIINGSQEDIAIWVDEGLADIGIMFHATLLLPDSLEFMS
FT                   IGQFKQSLVVAPSHPLAAVSAPTLEQLMQYRQLAICDRAGHSNTKPLSANYWYIDSYYY
FT                   IVALVLQGVGWALVPEHVAKSEWYIDDLASLSTEYITEPLLVEMGVVNRRDKQIGPVMH
FT                   WLFDELHSVLS"
FT   gene            249677..249934
FT                   /locus_tag="Shal_0208"
FT   CDS_pept        249677..249934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0208"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sbm:Shew185_4004 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74784"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN72"
FT                   /protein_id="ABZ74784.1"
FT                   /translation="MKRISVILLALLALNSMACSSTTVANAGCDFVSGAHRNEQQREQR
FT                   EQIGQSSVASTQDNKDVEVGILNAILGVFSRQLNDDTECL"
FT   gene            complement(250283..251125)
FT                   /locus_tag="Shal_0209"
FT   CDS_pept        complement(250283..251125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0209"
FT                   /product="protein of unknown function DUF519"
FT                   /note="PFAM: protein of unknown function DUF519; KEGG:
FT                   shm:Shewmr7_3922 protein of unknown function DUF519"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74785"
FT                   /db_xref="GOA:B0TN73"
FT                   /db_xref="InterPro:IPR007473"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN73"
FT                   /protein_id="ABZ74785.1"
FT                   /translation="MLSYRHGYHAGNYADVLKHAILLQVLKLMHKKDKPMAYIDTHAGA
FT                   GGYALTDEFSKKTGEYLDGVARLWQRTDLPESLEQYIEDVKHFNQGKEELEFYPGSPAF
FT                   VDMNMREKDRMVLHELHGTDFLTLEEQFTGDRHVRVIKGDGLKGLIAAVPPLERRGVIL
FT                   IDPSYEIKTDYQDVAKAIIKAHKRFSTGVFMLWYPVVDRDQTEGMLKLLAESGIKNQLR
FT                   IEQAIKPDSNEFGMTAAGLWIINPPWQLDTTAKEMLDYLERRIGHNGGKTVVKQEVPE"
FT   gene            complement(251182..252417)
FT                   /locus_tag="Shal_0210"
FT   CDS_pept        complement(251182..252417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0210"
FT                   /product="transcriptional regulator, CadC"
FT                   /note="PFAM: transcriptional regulator domain protein;
FT                   KEGG: sbm:Shew185_3867 transcriptional regulator, CadC"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74786"
FT                   /db_xref="GOA:B0TN74"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN74"
FT                   /protein_id="ABZ74786.1"
FT                   /translation="MQLTPKLSLNVAQQHLFDAEDSSRIELSYAETAVLQLMLKHQATL
FT                   ITREALLEAGWHDRVVSPSSLQQCISVLRKKLANYPEIELKTIPRHGYILHLSTTEKPK
FT                   KITAKNKAAGLFSIAVFACLLLMAYGYATHNQPPYSETQIDSQLSQVKGEMTLFSPRQN
FT                   ETISASKANKRLSNQIGNELDWRAPFKTFSSFGLLTDKMDNFAICPDYQDKICSGKQLI
FT                   NISSEKDHGSKLALSNFLTTKIRMEQKTYNKLDLPELRKHQGELKEQIYHGDLYFSIDD
FT                   HRLVRSDIRISLVDLAPDSGIFYFAACITDEDCYTTPIRYEIRGQFKRTTQKWQQRKVE
FT                   RFDIEVSKTTLSSPDALSDTAQIIYLALRKQHLTQAGVSFYRVYQDDGTAVWQLPMVNQ
FT                   NMMWMQRQTLKL"
FT   gene            complement(252981..255275)
FT                   /locus_tag="Shal_0211"
FT   CDS_pept        complement(252981..255275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0211"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_2576 decaheme cytochrome c MtrF"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74787"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN75"
FT                   /protein_id="ABZ74787.1"
FT                   /translation="MMNANKFKTRLCYATLVAACSMSMVACSGDDGKDGEDGQPGGNVT
FT                   TSAEVLTVTIDKTTITDNTLSIDFSAENELAIPVIKIAAIKINAAQLLPQIEGERSQWQ
FT                   KLASETCSPEKGCDGNLVDNMDGSYSYTLHAPLVAGDIAHNGDFTQRVLFKVLETDNLP
FT                   ATEVITDYNLDGSEISDNRSIIDGSSCLSCHDDIASIKHGGDNIENCASCHTSNYMSDA
FT                   SKVWPVLAHTVHIGITPQALGNCTTCHAKEVSETELQATNWNLVPTRETCSSCHDMTTN
FT                   PVYDHSTQPDNGSCLTCHSPENTYDVHMSKSEKAVEEDQRNIVNISLEDAKLVEQNGEH
FT                   FAEISFALLDRQGQRIAVANNNPADADWIKNLQLYVNWGTSVDFTTSRGYSIFVKSNKK
FT                   DITQDGSDGITPAGERARTPLHKSEGNVFTYLMGPVVTQDQFSGDLLGDAGFITNRMIY
FT                   CFDSAQNLVSCDQAGHTKNAEVNKRWFFDKDGLTEAPEAKRPLIVSNKTCGSCHGYDEF
FT                   NDNSELACRNCHSRKTEINKELADTTCFSGHDHDELGEHVRPFEERAMVAKGKPGFLSS
FT                   TADIVDPCLACHNPNTPPTQAIREMHTKASDWDFVEQLTVSHPDHKVWMHSLHTNQRAT
FT                   QDRENGVRNIEFPADKANCYRCHEGDTFGVERLTAVGRPLALDLDYNPDSRVHPATDIT
FT                   IDAYTSPVSATCYACHAKHEDADGKMVINKAVRAHMEQNGGRFGVTANELQVESCGVCH
FT                   SLDNLKKVHNL"
FT   gene            255560..256321
FT                   /locus_tag="Shal_0212"
FT   CDS_pept        255560..256321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0212"
FT                   /product="protein of unknown function DUF548"
FT                   /note="PFAM: protein of unknown function DUF548; KEGG:
FT                   sfr:Sfri_3857 protein of unknown function DUF548"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74788"
FT                   /db_xref="GOA:B0TN76"
FT                   /db_xref="InterPro:IPR007536"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TN76"
FT                   /protein_id="ABZ74788.1"
FT                   /translation="MTSIFFNRHYPTLESACERWGLEFDANAEFELVFENDILTLIKRD
FT                   EPKLKGIFVDFVTGAVAHRRKFGGGRGQSIAKAVGLKQGVTPTVVDGTAGLGRDAFVLA
FT                   SLGCKVIMVERHPIVAALLEDGLRRGYEDTEIGDWMRERMSLFHGSSIDSLADAPQASN
FT                   TEVDVVYLDPMYPHREKSALVKKEMRVFQSLVGADLDADGLLAPAMALASKRVVVKRPD
FT                   YADDLDGVKPSMVIATKKNRFDVYVKAAMTA"
FT   gene            complement(256439..257857)
FT                   /locus_tag="Shal_0213"
FT   CDS_pept        complement(256439..257857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0213"
FT                   /product="magnesium transporter"
FT                   /note="TIGRFAM: magnesium transporter; PFAM: CBS domain
FT                   containing protein; MgtE integral membrane region; MgtE
FT                   intracellular region; KEGG: sfr:Sfri_2763 MgtE
FT                   intracellular region"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74789"
FT                   /db_xref="GOA:B0TN77"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN77"
FT                   /protein_id="ABZ74789.1"
FT                   /translation="MSLPKDEHPIDNRQQPSEAEYEAPELAMVEVSQSVEQLTNAEGEQ
FT                   QAELFNDMLEEAEPGTVALLLESLPLDERYERWSQVDANERIGVLDLMRADPRNGILKE
FT                   MPEVELDSLFSQISPEDLIEWSDTLPEAMTDRALSQMGERQREHYDRYDQYSENEIGRY
FT                   AEHQFLALNLTSTVSQAQRFFRRIKLDCNDHVFLLDDDDKYIGSVRRHDVFRAAPESTL
FT                   ASLLWEDSRSILADSSLIEAAEAIEHSNELEIAVVDVSGIMIGRMTLRTATALVREHYE
FT                   SQLMATAGMDEDDDLFAPITVGARRRAVWLGINLLTAFLASATIGLFENVLEKVVALAV
FT                   LMPIVASMGGIAGSQSLTLMIRGMAMGQISSGNVVSLLKNELGIGILNGVLWAIVIGLI
FT                   AGWWFGDPIIGTVIGAAILINMTVAAIAGVMVPMILQKMNQDAALSGSVILTTVTDVVG
FT                   FFCFLGLASVLYLY"
FT   gene            complement(258177..259316)
FT                   /locus_tag="Shal_0214"
FT   CDS_pept        complement(258177..259316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0214"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_2682 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74790"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN78"
FT                   /protein_id="ABZ74790.1"
FT                   /translation="MIMKTRKTFYLSLIASAVALSSFHTIAAEQEEDGINIHGGVRINY
FT                   AYKDYSDNSKDKAGDVTFDMLSLRFDAKHGNWGLKSDYRFTANTNYIKFGYGYYDFNPD
FT                   WQLQFGVNKVPFGNIGYISNSYWFGLPYYLGFEDDHDIGVKAVYEHNGWQTDMAFYKGA
FT                   EYGPTENKRYAADLYSGTINGTEYHNEETNQVNLRQSYTMEYQGGSTTFGASVEAGQIF
FT                   NSETGHNGDRYAFAAHLDSTFNGWNLQLQAIQYEFNAADSADDNKIAVSVVGWQYEVAS
FT                   KGQVYSANIAKTVPTDWGNVKFYNDFGLMTPDVDDDSYDNSMQNVLGAAISAGPTYTQI
FT                   DFIMGKNMTFSTANNDHIGLPEVGDDWDKRVNVSVAYYF"
FT   gene            complement(259529..260887)
FT                   /locus_tag="Shal_0215"
FT   CDS_pept        complement(259529..260887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0215"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: slo:Shew_2681 general
FT                   substrate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74791"
FT                   /db_xref="GOA:B0TN79"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN79"
FT                   /protein_id="ABZ74791.1"
FT                   /translation="MKPRTNFDDMEFTPLHRKIMLWGSGGPFLDGYVLVIIGLALQQLT
FT                   PALELDAQWIGLVGAATLAGLFIGTALFGYVADIFGRKLMFMIDIIAIAVLSFATMFIS
FT                   SPIELVILRFLIGIVIGADYPIATSMVAEFSPTKKRAFTMGFIAAMWYVGATAANMVGY
FT                   LLYDVEDGWRWMFGSALIPCFIILFGRFHLPESPRWLLKKGRVKECKETMEKFFGPDVE
FT                   ISFESAEPTKYGKLFEPVYLKRILFIGIIWTCQVIPMFAIYTFGPQIIELLGFSDGKDA
FT                   ALGNIVISLFFMAGCIPAMYWLNSIGRRPLLIGSFGIMTASLALLGIVPDPSIWLIICA
FT                   FATYAFFSGGPGILQWLYPNELFPTDIRASAIGAVMSFSRIGTIVSTYALPIFMTTYGI
FT                   SAALLVGAGISLLGLIVSVFMAPETKDLSLETTSSVEFKCKGTAAAPNTYKAI"
FT   gene            complement(261162..261449)
FT                   /locus_tag="Shal_0216"
FT   CDS_pept        complement(261162..261449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0216"
FT                   /product="putative ferredoxin"
FT                   /note="KEGG: slo:Shew_2680 putative ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74792"
FT                   /db_xref="GOA:B0TN80"
FT                   /db_xref="InterPro:IPR012206"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN80"
FT                   /protein_id="ABZ74792.1"
FT                   /translation="MSEIVNVDVKLGVNKFHVDEGHPHVILKDNPDMNEYRKLVNACPA
FT                   GLYKLEDDSSIRFDSAGCLECGTCKFLCGETILEKWEYPRGTFGIEYRYG"
FT   gene            complement(261446..262735)
FT                   /locus_tag="Shal_0217"
FT   CDS_pept        complement(261446..262735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0217"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: monooxygenase FAD-binding; fumarate
FT                   reductase/succinate dehydrogenase flavoprotein domain
FT                   protein; HI0933 family protein; FAD dependent
FT                   oxidoreductase; FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; KEGG: slo:Shew_2679
FT                   FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74793"
FT                   /db_xref="GOA:B0TN81"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR039651"
FT                   /db_xref="UniProtKB/TrEMBL:B0TN81"
FT                   /protein_id="ABZ74793.1"
FT                   /translation="MSEESFDAIIVGAGLAGCVAAYVLAKEGADVLVIERGNFAGSKNM
FT                   TGGRLYAHSLEKIIPGFAKEAPIERKVTKEKVTFLTDDTGVTLDYHNGREQNSTQESYT
FT                   LLRGDFDQWLMGKAEEVGAQFITGIRVEEILTQDGKVIGVKADGDELTAKSVILAEGVN
FT                   PILGEQLGMVKRVKGDVMAVGAKELIELPQEVIQDRFNVSKDEGCAWLFAGSPANGLMG
FT                   GGFIYTNKNSVSLGIVCGLHDIGSSSKTVPQMLEDFKNHAMIKPLIEGGKLLEYSGHVV
FT                   PEAGINMVPKLVDDGVLIAGDAAGFCLNLGYTVRGMDLAIASGEAAAKAVLAAREKNDF
FT                   SAEGLSSYQTLLEDSFIMKDLKLYKDLPAFMETPRIFNQYPKMVADIMQSMFTVDGTPS
FT                   QPIRKTLMKHCKEVGYMNLIKDGIKGVTSI"
FT   gene            complement(262827..263768)
FT                   /locus_tag="Shal_0218"
FT   CDS_pept        complement(262827..263768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0218"
FT                   /product="Electron transfer flavoprotein alpha subunit"
FT                   /note="PFAM: Electron transfer flavoprotein
FT                   alpha/beta-subunit; Electron transfer flavoprotein alpha
FT                   subunit; KEGG: slo:Shew_2678 electron transfer
FT                   flavoprotein, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74794"
FT                   /db_xref="GOA:B0TNP1"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR023461"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNP1"
FT                   /protein_id="ABZ74794.1"
FT                   /translation="MSKLSNIWVFSDIASRLPEMIAAGVALGEKVSTFVIGTEADINAA
FT                   FSYGATHVYYLGDKDSQKITEDYSHTMAQTISAAAENTLMLLAPTKRGKALASKLGVQL
FT                   QAGVVNDVIEISIEDGIRAKHMAYGGLAIAEEKINSPVAIITLSSGAYEVQAADTARTG
FT                   EAVSVAFVEPASTIKCVERRAKQGESVNLGKAKRVVGVGNGIGSQENLQVAAELSALMG
FT                   AELGCSRPIAETEKWMERERYIGVSGVMLKPEIYFALGISGQIQHMVGALGSQTIFAVN
FT                   KDKNAPIFQYVDYGIVGDVNKIMPALISALKA"
FT   gene            complement(263782..264555)
FT                   /locus_tag="Shal_0219"
FT   CDS_pept        complement(263782..264555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0219"
FT                   /product="Electron transfer flavoprotein
FT                   alpha/beta-subunit"
FT                   /note="PFAM: Electron transfer flavoprotein
FT                   alpha/beta-subunit; KEGG: slo:Shew_2677 electron transfer
FT                   flavoprotein beta-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74795"
FT                   /db_xref="GOA:B0TNP2"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNP2"
FT                   /protein_id="ABZ74795.1"
FT                   /translation="MKIITCYKLVPEEQDITVAADGSLDTNKAAPKINPFDLCAVEAGV
FT                   QLKSLIEGCSITAMSVGGKALENPKARKDILSRGPDDLTVVIDEKFEQLLPHQTARVLM
FT                   AAAQKSGFDLIICGDGSGDLYAQQVGLQLGELLGVANINAVSKIISAEPGKLTVERALD
FT                   NEVEVLEITLPAVISVSADINEPSIPSMKTILAAAKKPVTSLSATELELTEFPALVELV
FT                   SVIAPEQKARQKIVIEGDDEQQIAQFAEHLRNALN"
FT   gene            265540..267129
FT                   /locus_tag="Shal_0220"
FT   CDS_pept        265540..267129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0220"
FT                   /product="choline/carnitine/betaine transporter"
FT                   /note="TIGRFAM: choline/carnitine/betaine transporter;
FT                   PFAM: BCCT transporter; KEGG: slo:Shew_2676
FT                   choline/carnitine/betaine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74796"
FT                   /db_xref="GOA:B0TNP3"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNP3"
FT                   /protein_id="ABZ74796.1"
FT                   /translation="MNDKTMDVNATEVKKKKVTIDPTIFFPSLLAVILLSYLTVRDLDA
FT                   ANLAISEVFHYLTHSWGWLFEWYMIFMGAGWAWLTWGPYSNNRLGQEKPEFSTASWIFL
FT                   MFASCTSAAVLFWGSLEVYYYVTYPPFDIEPLSIQAKELGLAYSLFHWGPLPWMGYGFF
FT                   TVALGYFLFVKKMDVVRPSGTLEPILGKHHKGFIGTFIDNVYVVALILAMGTSLGLATP
FT                   LVTECIQWLFGIPRTPAVDTIVISSWIVFNAICVAFGLTKGIKIASDLRSYLSIIMLVW
FT                   VFLIGATSFTVNYFTDSVGIMLELLPRMLFNTASVSEGSFPQDWTVFYWAWWVVYGIQM
FT                   CIFLAKISRGRTVRELCLTMVAGLTASTWFLWTILGSNTMNLMNENLINMPQLIEQYGA
FT                   ARAIIETWAALPFSTITMWGFFILCFLATVTLVNACSYTLAMSTCKGADADNEPPIWVR
FT                   VGWSVLVGVIGIVLLSLGGLKPLQTAIIAGGAPLIIVNVMIIFSFLKDARKNNWKPVGE
FT                   EAKPHLGSTAKI"
FT   gene            267141..268277
FT                   /locus_tag="Shal_0221"
FT   CDS_pept        267141..268277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0221"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: slo:Shew_2675
FT                   acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74797"
FT                   /db_xref="GOA:B0TNP4"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNP4"
FT                   /protein_id="ABZ74797.1"
FT                   /translation="MDFKLTDEQELFVAGIRDLMAKENWESYFAECDENSQYPERFVKE
FT                   LAEMGIDSLLLPEEHGGFNEGMVTLAVIWEELGRLGAPTYVLYQLPGITTMLRHGSPEQ
FT                   IDKIMTLRGTGKQMWNSAITEPSAGSDVGSLLTTYKRRDGKVYLTGSKCFITSAAGAPY
FT                   IVVMAKDADSEKPIFTEWFVDMSKPGIKLSKLPKLGLRMDSCCELQFDEFELEESDMFG
FT                   IEGNGFMRVKEEFDSERFLVALTNYGAAYCAFEDAAKYANQRVQFGEAIGRYQLIQEKF
FT                   AHMAIKLNSMKNMVYEAAWKCDNGTMTSGDSAMCKFYCANAGFEVIDSAMQVLGGYAIA
FT                   GEHRISRMWRDIRVDRVSGGSDEMQILTLGREVLKRYR"
FT   gene            268532..269767
FT                   /locus_tag="Shal_0222"
FT   CDS_pept        268532..269767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0222"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: slo:Shew_2674 L-carnitine dehydratase/bile
FT                   acid-inducible protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74798"
FT                   /db_xref="GOA:B0TNP5"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNP5"
FT                   /protein_id="ABZ74798.1"
FT                   /translation="MGIMSNKLSTPTFGPLAGLRVVFSGIEIAGPFAAQMLAEWGAEVI
FT                   WIENVAYADTIRVQPNYPELSRRNLHALSLNIFKDEGRDAFLKLMETTDIFIEASKGPA
FT                   FARRGITDEVLWEQNKKLVIAHLSGFGQYGTDEYTNLPAYNTIAQAFSGYLIQNGDVDQ
FT                   PMPAFPYTADYFSGMTATTSALAALYRVRETGVGESIDIAMYEVMLRMGQYFMMDHFNG
FT                   GEVCPRMTKGKDPYYAGCGLYKCEDGYIVMELVGGNQIKEMFKDMNIMHLYGGEEVPEG
FT                   TQLIHRIECPFGYQVEDALDGYLAQKSIEEVLARFAELNVACAKVLTIPELDSNPQYIA
FT                   RESITEWQNIDGKTYRGPNVMPKFKNNPGQIWRGMPKHGMDTAAILEDIGYSQEQIQSL
FT                   SEKGLAKVSECK"
FT   gene            269778..271331
FT                   /locus_tag="Shal_0223"
FT   CDS_pept        269778..271331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0223"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   slo:Shew_2673 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74799"
FT                   /db_xref="GOA:B0TNP6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNP6"
FT                   /protein_id="ABZ74799.1"
FT                   /translation="MDIVGSKTLRCMWEERARKFSNNTALVYEDAAGDVQEYTYSHLNA
FT                   EINRAANLFLSLGINKGDKVAVQLYNSPQFIFCWFGLAKIGAVIVPINNQYLFAECQYI
FT                   INKCAVKAVVIEEEFLPIYTRMKQETGNSINNILVTRTANPEISDSMNFDTLLSQQIVE
FT                   LVQRVTISSDDVAEILFTSGTTSRPKGVEITHCNLQFAGYFTAWQTCLRSDDIYLTMMP
FT                   SFHIDFQCNAAMAAFTVGAKLVMLEKYSARKFWKQICDYRATITHSMPMIVRTLMLQPA
FT                   TPFERDHCLRDMLFFLHISDQEKLDFETRFNVQLFNSYGMTETLVGLIGDSPAEERHWP
FT                   SIGRPGLGYEAKIADENGQELAPNVIGDLWVKGVPGRTIMKGYYQDTKATEEVLSAEGW
FT                   LYTGDKAYVDDNGLFYFVDRKTNMIKRSGENISSSEIEKVLMSHPYIQDAAVIGVPDLI
FT                   RDEAVKAFVIFNEGVSLSVEQILQYCAENMAKFKVPSFVEIKKSFPRTCTCKVQKKLLM
FT                   "
FT   gene            271394..272179
FT                   /locus_tag="Shal_0224"
FT   CDS_pept        271394..272179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0224"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   slo:Shew_2672 enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74800"
FT                   /db_xref="GOA:B0TNP7"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR022852"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNP7"
FT                   /protein_id="ABZ74800.1"
FT                   /translation="MSESLHVTRNGAILEITLDRPKANAIDAKTSFEMGEVFLAFREDP
FT                   ELRVAIITGAGERFFSAGWDLKAAAEGEAPDADFGPGGFAGLTEIFDLDKPVIAAVNGY
FT                   AFGGGFELALAADMIICSENASFALPEAKLGIVPDSGGMLRLPKLLPPAIVNELMMTGR
FT                   GMGAEEALRWGVVNRVVESDKLMDSARELAQQIAQGAPLAIAAIKEIYRETSELSVEEG
FT                   YRHIRAGGLKNYPSVLRSEDALEGPLAFSEKRDPVWKGR"
FT   gene            272273..273124
FT                   /locus_tag="Shal_0225"
FT   CDS_pept        272273..273124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0225"
FT                   /product="3-alpha,7-alpha,
FT                   12-alpha-trihydroxy-5-beta-cholest-24-enoyl-CoAhydratase"
FT                   /EC_number="4.2.1.107"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   drm:Dred_0577 MaoC domain protein dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74801"
FT                   /db_xref="GOA:B0TNP8"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNP8"
FT                   /protein_id="ABZ74801.1"
FT                   /translation="MALKLEMQGQTYGPFVNEYTARDVMLFALGCGAGSDGKTDLDYVY
FT                   EKQLKVLPIFAATQIVDAEVTKTIDYGFNWGGSLHWGFDLHIHQPLPTNPGKLSTKVLL
FT                   KGLFDRGEGRGCLAQHIGETFDETGTKLFTNESWDCALYDGGFGGPKAPADIVEIPERA
FT                   PDFEIEQDIPLNQALIYRLSGDDHPQHVDWEYAQEFGHPKPNLHGVSTAGVACRHIIQA
FT                   MFPGEPERLTRFKTRLTKSLYPGARVKTQIWKWDDNCVHFRVMDANDPDTFYLNFGLVE
FT                   WK"
FT   gene            273204..273872
FT                   /locus_tag="Shal_0226"
FT   CDS_pept        273204..273872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0226"
FT                   /product="transferase hexapeptide repeat containing
FT                   protein"
FT                   /note="PFAM: transferase hexapeptide repeat containing
FT                   protein; KEGG: stm:STM0069 stimulates carnitine racemase
FT                   activity of CaiD and CaiB activity"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74802"
FT                   /db_xref="GOA:B0TNP9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNP9"
FT                   /protein_id="ABZ74802.1"
FT                   /translation="MFEAQQLSSESCDLLRVKQFMPCYEFEGLIPVVDPSAYVHPTAVL
FT                   IGDVIVEAGVYIGPNASLRGDYGRLILQRGSNLQDGCIMHGYCDMDTVVEPDGHIGHGA
FT                   ILHGCVIKRNALVGMNAVVMDGAVIGEDSIVAAMSFVKAGFQGLPQQLLMGQPAKVMRQ
FT                   VSEQDLHWKGLNTLEYQVLAQRSAKTMQPVTPLTQQEVNRPRLKGVTEVQPKAQQTQAG
FT                   "
FT   gene            274046..274984
FT                   /locus_tag="Shal_0227"
FT   CDS_pept        274046..274984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0227"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: slo:Shew_2671 alpha/beta hydrolase fold-3 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74803"
FT                   /db_xref="GOA:B0TNQ0"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNQ0"
FT                   /protein_id="ABZ74803.1"
FT                   /translation="MPLDPKVALYLQQVRDSGAQAYEDMTPAESRRLDMNELTKTKADR
FT                   VLEPVAAIEHSFIPGPTADLPIRIYRPKGDTSELQPAIIFIHGSGWVVSNIETNDHFSR
FT                   ALANRTGSVVIAINYQKAPEHKFPIPMDDCYASTLWIFEHATLLGLDSNRIGILGDSAG
FT                   GNLAAAVTLRLRDEQGPKLAYQVLVYPAVQYGWQTPSAIAHAEGYLLQQASMKYYWGHY
FT                   LRSEADAQNPYCSPLNALSHKDLPPTLIYTAEFDPLCDDGYLYARELQGSGVTVKYRCF
FT                   DGVIHGFIKMLGVFDQADEFLDELKQDLLEI"
FT   gene            275174..276064
FT                   /locus_tag="Shal_0228"
FT   CDS_pept        275174..276064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0228"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: slo:Shew_2670 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74804"
FT                   /db_xref="GOA:B0TNQ1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNQ1"
FT                   /protein_id="ABZ74804.1"
FT                   /translation="MNNNIPLRALQVFESCARLESCSLAANELCITQSAVSQQIKLLED
FT                   YFLEKLFHRNAGKITLTESGLELRQRLAPVFYDLNSVCASLVPDMSNEVRVHSYNSLAA
FT                   RWLVPKMAKLRKEHPEFNINVGMFQDDVEMSDMIADIFIITRECQDGYTITPLVEEKLV
FT                   AFCSPEYLQKHPEISLSTFHEQTLLYSKHKDYGVDWEGWFRDNKVAVGPLQRKIIFNHN
FT                   MLAVQAAIFGQGIVLGLEQTLQVELDSGNLVKLDLPHCYTGWTYSIAYKSSRKRDARIT
FT                   KIVDWIIKEYAGSVS"
FT   gene            complement(276244..276879)
FT                   /locus_tag="Shal_0229"
FT   CDS_pept        complement(276244..276879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0229"
FT                   /product="Disulphide bond formation protein DsbB"
FT                   /note="PFAM: Disulphide bond formation protein DsbB; KEGG:
FT                   son:SO_3870 disulfide bond formation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74805"
FT                   /db_xref="GOA:B0TNQ2"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNQ2"
FT                   /protein_id="ABZ74805.1"
FT                   /translation="MSLQQRLKEFWGQFKATPADSLTHMQDHRPIWLVMVGGALFLILS
FT                   AIFYFQLFLAMDPCELCVYIRFSQCCIVLAGLIILIDPRNHILKFLGLLLAWYAVIQGW
FT                   MWSVELMKIHDAAHMVVDETMDFFAAAGDAAGSACSTDPRFPLNLPLDEWLPFEFAPTG
FT                   GCGEDDWTLLGMNMAHYCIIAYTVFMVCLAPLTFGWVRSLKKLLPLKK"
FT   gene            complement(276889..277500)
FT                   /locus_tag="Shal_0230"
FT   CDS_pept        complement(276889..277500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0230"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: son:SO_3871
FT                   thiol:disulfide interchange protein, DsbA family"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74806"
FT                   /db_xref="GOA:B0TNQ3"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNQ3"
FT                   /protein_id="ABZ74806.1"
FT                   /translation="MKKTLSAIAATLFLSFGAHAATEGVEYQVLPEVAQFNAPNQVVKI
FT                   YSINCPFCYKYEKAGIPNDKLMPAGSTLDQYHITSKPPFGVEKSTALAIAKEIKGEKTF
FT                   KQLKDKYYDQYHVKKVKFKDADSTIAFTLDTLGMSRAEFDTHAQDPKVKQLMTKWDKGV
FT                   EVAKIQGVPAITVNGKYLINTKSIRSMDMLKELIAELSAK"
FT   gene            complement(277569..279329)
FT                   /locus_tag="Shal_0231"
FT   CDS_pept        complement(277569..279329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0231"
FT                   /product="Arylsulfotransferase"
FT                   /note="PFAM: Arylsulfotransferase; KEGG: spt:SPA3941
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74807"
FT                   /db_xref="GOA:B0TNQ4"
FT                   /db_xref="InterPro:IPR010262"
FT                   /db_xref="InterPro:IPR035391"
FT                   /db_xref="InterPro:IPR038477"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNQ4"
FT                   /protein_id="ABZ74807.1"
FT                   /translation="MKLNKIMSAILTASVLTCSAISLSVNAAGNLPGTSSSAVAQGQLG
FT                   FVYVDPYDFSPLVAVIDLGGKTITNATVSVKGKDRKGIDIDYPVSTTQLNTHNGIPVFG
FT                   LYPDHLNEVEVSYKLDGKKIKETYKIRTNDIPHQHIDGQDRTQYEYEPIKVAKGFEDRF
FT                   YLVDGQVITPDLRDKWDWKPTQNIIDTNGDVRWHLSADVIYDRPGGSMSFKQTRDGKLI
FT                   FGQGLMFNQHNGFLSPYYAKYDFIGKPIFKRDLPRGYIGFSHEVTEMPNGNLLLRVGKK
FT                   DYITPTGIKVDSIRDHVIEVNNNGEVVKVWDFNKILDPLRDDVLSSLDMGAVCLNVDVA
FT                   SAGKTMSAEELANEPYGDVAGVDTGRNWLHINSIGYDAEDDSIIISSRHQSAVIKIGRD
FT                   DEVKWILGTPIGWEGDLADKVLIPVDKKGKKLKCDAKDCEGDFDWTWTQHTAWPVPERG
FT                   TVTVFDNGDGRSLEQPALPTMKYSRGVEYKVDMDNMTVQQTWEYGKDRGYEWYSPITSI
FT                   TEFQPDHNTMFMASASAGLLESDKAPEHWITEVDPKTNEVKVEIKVKTLTKHEPGYRST
FT                   VVHPEAMFNQ"
FT   gene            complement(279344..280090)
FT                   /locus_tag="Shal_0232"
FT   CDS_pept        complement(279344..280090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0232"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vfi:VF0719 putative sugar hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74808"
FT                   /db_xref="GOA:B0TNQ5"
FT                   /db_xref="InterPro:IPR036777"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNQ5"
FT                   /protein_id="ABZ74808.1"
FT                   /translation="MNKKLQSGIAALALSISFSSNAAMLAVETGLMDWRSSASDYFGES
FT                   KNNNPYIKMIGAHGTALGDIYGHVTLENFDNTDIYGTEINLVGQINIGETDFNLYGQVF
FT                   DKSMPVWGETNTLLGFSWDKNYDNTYVQLAFAAHIVNATYKAFDSNFDEQGFNGGYAYL
FT                   NISHDLSLFDQDFKFVWWQEFYFGRNEQYLELAGDMEDFGFNGQLRANWIINNNWSVGV
FT                   SYRYAENNLGKKGYHDAFFYSVQYKF"
FT   gene            280255..280920
FT                   /locus_tag="Shal_0233"
FT   CDS_pept        280255..280920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0233"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: slo:Shew_0277
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74809"
FT                   /db_xref="GOA:B0TNQ6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNQ6"
FT                   /protein_id="ABZ74809.1"
FT                   /translation="MESKTLEHILNVSEQLIYKDGVIGFKFCTVAKEAGISTTSLYKFF
FT                   GNKEDILVALASKSFMNTKNKKWWLNLEGDALIKVIAYYILQLDVAHDFPFYSSMSTLT
FT                   SNQLICGRSAHPHISALNKNAYGFWQTPIALLQQARGQGSCQLCDQAITRLCALISMII
FT                   RGQEVVSCAEVGRACSAEANLTTQWIIEFCFKQVGFEYHLINHCIQQADILITEHGLR"
FT   gene            complement(281119..281754)
FT                   /locus_tag="Shal_0234"
FT   CDS_pept        complement(281119..281754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0234"
FT                   /product="Disulphide bond formation protein DsbB"
FT                   /note="PFAM: Disulphide bond formation protein DsbB; KEGG:
FT                   son:SO_3870 disulfide bond formation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74810"
FT                   /db_xref="GOA:B0TNQ7"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNQ7"
FT                   /protein_id="ABZ74810.1"
FT                   /translation="MSLQQRLKEFWRQFKATPADSLTHMQDHRPIWLVMVGGALFLILS
FT                   AIFYFQLFLAMDPCELCVYIRFSQCCIVLAGLIILIDPRNHILKFLGLLLAWYAVIQGW
FT                   MWSVELMKIHDAAHMVVDETMDFFAAAGDAAGSACSTDPRFPLNLPLDEWLPFEFAPTG
FT                   GCGEDDWTLLGMNMAHYCIIAYTVFMVCLAPLTFGWVRSLKKLLPLKK"
FT   gene            complement(281764..282375)
FT                   /locus_tag="Shal_0235"
FT   CDS_pept        complement(281764..282375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0235"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: son:SO_3871
FT                   thiol:disulfide interchange protein, DsbA family"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74811"
FT                   /db_xref="GOA:B0TNQ8"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNQ8"
FT                   /protein_id="ABZ74811.1"
FT                   /translation="MKKTLTAIAATLFLSFGAHAATEGVEYQVLPEVAQFNAPNQVVKI
FT                   YSINCPFCYKYEKAGIPNDKLMPAGSTLDQYHITSKPPFGVEKSTALAIAKEIKGEKTF
FT                   KQLKDKYYDQYHVKKVKFKDADSTIAFTLDTLGMSRAEFDTHAQNPKVKQLMTKWDKGV
FT                   EVAKIQGVPAITVNGKYLINTKSIRSMDMLKELIAELSAK"
FT   gene            283096..284886
FT                   /locus_tag="Shal_0236"
FT   CDS_pept        283096..284886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0236"
FT                   /product="Arylsulfotransferase"
FT                   /note="PFAM: Arylsulfotransferase; KEGG: son:SO_3872
FT                   arylsulfate sulfotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74812"
FT                   /db_xref="GOA:B0TNQ9"
FT                   /db_xref="InterPro:IPR010262"
FT                   /db_xref="InterPro:IPR035391"
FT                   /db_xref="InterPro:IPR038477"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNQ9"
FT                   /protein_id="ABZ74812.1"
FT                   /translation="MKRNILTAAIVAALFQSVVSFESNAAGFKPAPAAGQLGAVLVNPY
FT                   GNSPLTAVLDLGSKRPTDVTVTVHGKGNKGVDISYPVGQQTINTHDGIPLFGLYADHSN
FT                   QVTVKYNLDGKKVKEDYKVLTGPITNEYMDNRNITVMQEVQVKKVAKGFENRLYMVNSH
FT                   TYNQQGSDLHWSGQKSKDAGIFESSPAMGSLPFDNAPMTYVVDTNGDIRWWLDQDAVYD
FT                   GVGIDVNKRGYLMGLHDNGEGRITFVQGQQYGTFDLLGNFEQRRLPRGYVDASHEHNIM
FT                   PNGHSLVRAAKANYKNPQGDIVHTVRDHILQIDQQGNLVDVWNLNEIMDPYRDALLEAL
FT                   DMGAVCLNVDIDQMGQTAEMEIDAPYGDIPGIAPGRNWAHINSIEYDPKDDSIILSFRH
FT                   QGVAKVTRDKEVKWILAPYEGWNKELSKKLLKPVDKNGKPIKCTDKGVCDGDFDFTYTQ
FT                   HTAWLNNTTGNLTVLDNGDGRAHEQPALPTMKYTRFVEYKIDDENMTVQQTWEYGKDRG
FT                   YDWYSPITSNVEYMEDKNTMFGFGGSIHLYTPGERTIGKINEIGYDDMKVKVEIDVLSD
FT                   KANSPHYRAIIVNPTSQFGL"
FT   gene            284936..285694
FT                   /locus_tag="Shal_0237"
FT   CDS_pept        284936..285694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0237"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO_3873 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74813"
FT                   /db_xref="GOA:B0TNR0"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR018013"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNR0"
FT                   /protein_id="ABZ74813.1"
FT                   /translation="MKLSRSVLAVLVGIGGISSASAEVLFQQNNVIVGYEYLLDAEDKN
FT                   PNLYDQAHLILGHTTIADWGSATGWLRFENPLDSSENQQGKDAGATTKAWLKLDYNLGD
FT                   SPFNLWVQSFTCANKPVVEQNFYLGGSYDVAIGKLKGTVGVGMQYAYGSFSPTGKSFNG
FT                   ASGTAATIMLGYPLTPHWFAKAYYEAQFNRSDEHREVFGFDSYGHQAIVGVDYRFNSQF
FT                   FVSTLYKHRQSWGGALNGGGELLFEAGYNF"
FT   gene            285880..286851
FT                   /locus_tag="Shal_0238"
FT   CDS_pept        285880..286851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0238"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: son:SO_3874 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74814"
FT                   /db_xref="GOA:B0TNR1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNR1"
FT                   /protein_id="ABZ74814.1"
FT                   /translation="MNTNESVKDLSVAHLQLIVCLIKHGNACVASDELGMSQSTISYHL
FT                   RRVRSIFSDEMFVRTGKGLKPTERCLQVGHFAQDLINRVEEELIHGNDFEATHIERELS
FT                   LIADDTACGWFGELFVDLHKALPKVNLCARPWYLNAMKDLDNGAVHFGLHIMQSGIKGI
FT                   YDLEVAPCYRLCVVRDGHPLVSQGEVTLEDLAMYPVILNDLAGWNNNGHSVMETVLKNH
FT                   GLKANLVGRLGYVNSIFSALQGCNAITYTSAVSLPKDLSGLSLLKAPAALDAVECNYRL
FT                   YISKTRYGSQETNYLIEFLYNSFKRFATRQYERPEVAPIIRS"
FT   gene            complement(286906..288165)
FT                   /locus_tag="Shal_0239"
FT   CDS_pept        complement(286906..288165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0239"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: slo:Shew_3638 integral
FT                   membrane sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74815"
FT                   /db_xref="GOA:B0TNR2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNR2"
FT                   /protein_id="ABZ74815.1"
FT                   /translation="MLIGCLLLTNQLVSYISVAVYFIKPSYQQINQLIARQVKLLFVGG
FT                   IDIGREHLTMVDALNAKVRDDTMQFYNLKQARQAGIDRATYYSFLSSQMSEYLGGEAEV
FT                   RIAQGEEFEIWIRPPQAPSIWIRVPLTGLNEKNLSPLTLYLMVIGALSVAGGWWFARQQ
FT                   NRPLRRLQKAAIAVSRGDYPDPLPLSGSTEIVEVTNTFNQMSHSMKQLEQDRALLMAGI
FT                   SHDLRTPLTRIRLASEMMVEEDQYLKDGIVNDIEDMDAIINQFISYIRQDQEGTRELEQ
FT                   INDLIQDVIQAESNREGSIDSELVECPRIPMQGIAVKRVLSNLVENAYRYGNGWVRINS
FT                   QFNGQYVGFSVEDNGPGIDEEQIPKLFQPFTQGDTARGSVGSGLGLAIIKRIVDRHQGK
FT                   VILTNRSEGGLHAQVWLPIE"
FT   gene            complement(288261..288986)
FT                   /locus_tag="Shal_0240"
FT   CDS_pept        complement(288261..288986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0240"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: slo:Shew_3637 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74816"
FT                   /db_xref="GOA:B0TNR3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNR3"
FT                   /protein_id="ABZ74816.1"
FT                   /translation="MGQETSKILVVDDDMRLRALLERYLMEQGYQVRSAANAEQMDRLL
FT                   ERENFHLLVLDLMLPGEDGLSICRRLRQMGNPIPIVMLTAKGDEVDRIIGLELGADDYL
FT                   PKPFNPRELLARIKAVMRRQTPEVPGAPTLQEEEITFGEYSLNLATREMYHGEESISLT
FT                   SGEFAVLKVLVSHPREPLSRDKLMNLARGRDYSALERSIDVQVSRLRRLIEKDAANPRY
FT                   IQTVWGLGYVFVPDGQSRK"
FT   gene            289338..289817
FT                   /locus_tag="Shal_0241"
FT   CDS_pept        289338..289817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0241"
FT                   /product="transcription elongation factor GreB"
FT                   /note="TIGRFAM: transcription elongation factor GreB; PFAM:
FT                   transcription elongation factor GreA/GreB domain protein;
FT                   KEGG: stm:STM3503 transcription elongation factor and
FT                   transcript cleavage"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74817"
FT                   /db_xref="GOA:B0TNR4"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006358"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNR4"
FT                   /protein_id="ABZ74817.1"
FT                   /translation="MRTAIVTREGFEKLQKELNYLWREHRPEITKIVSWAASLGDRSEN
FT                   ADYTFNKKKLREIDRRVRYLRKTLENVQVVDYSPAQEGKVFFGAWVEIENDDGNKLQFK
FT                   IVGYDEIFGRKDYISIDSPMARGLLKKEVDDEAVIKTPTGEQVWYINRISYQGFE"
FT   gene            289982..292339
FT                   /locus_tag="Shal_0242"
FT   CDS_pept        289982..292339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0242"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="PFAM: RNA binding S1 domain protein; SMART:
FT                   Resolvase RNase H domain protein fold; KEGG: slo:Shew_3634
FT                   RNA binding S1 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74818"
FT                   /db_xref="GOA:B0TNR5"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNR5"
FT                   /protein_id="ABZ74818.1"
FT                   /translation="MQNIAQLIAEELNVRQQQVIDTISLLDDGATVPFIARYRKEATGG
FT                   LDDVQLRTLFSRLGYLRDLNDRRNVILSSIEAQSKLTPELKAAIIAADSKTRLEDLYLP
FT                   YKPKRRTKGLIAIEAGIEPLADYLLANRQVDCEAAASEYINAAAGFADAKAVLDGARFI
FT                   LMERFAEDAELLQKIRTQVEQNAVLESTMVKGKEKEGAKFRDYFEHSEKLTKVPSHRAL
FT                   AMLRGRNEGMLSLNINADPHQEPKQASYCEVIIIEHFKLGLTDTGVDAWLKTVVAATWK
FT                   VKIALQMETEFLGRMRDSAEQEAIKVFARNLGDLLMAAPAGAKATLGLDPGLRSGVKVA
FT                   IVNDTGKLVAHTTIFPHAPQNQWDKSVRTLSNLVKMHKVELIAIGNGTASRETDKLAAD
FT                   LISQVKADLPTLTKIMVSEAGASVYSASELASEEFPDIDVSIRGAVSIARRLQDPLAEL
FT                   VKIEPKAIGVGQYQHDVSQSQLSSSLEAVVEDCVNGVGVDVNMASAALLAQVAGLNKTL
FT                   ARNIVTHRDEQGRFNNRKALLKVARLGPKAYEQAAGFLRINDGDNPLDSSSVHPEAYSL
FT                   VESIAADKAVSVAELVGNSELIKLLEAKDFITNEFGLPTVTDILAELDKPGRDPRGEFK
FT                   TATFKEGVEEIKDLQLDMILEGVVTNVTNFGAFVDVGVHQDGLVHISSMTDKFIDDPHK
FT                   VVKAGDIVKVKVMEVDAERRRIALSMRLDDKAGDAHKSAPRPTYNKASPNKGAANKGTN
FT                   QQRGQQKSHKPKQQANAAMGNAFADAFAKLKK"
FT   gene            complement(292389..292883)
FT                   /locus_tag="Shal_0243"
FT   CDS_pept        complement(292389..292883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0243"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: saz:Sama_3506 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74819"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNR6"
FT                   /protein_id="ABZ74819.1"
FT                   /translation="MLVVTNYPNVPIATSNAATDSARTDSQQRPPIIPPQQATKGHEER
FT                   AFNPQHERTADHAQNQAKLRESVQQKQQGQSQQQEQSGQEKQKQAANLNLKQLLSQRAP
FT                   LKRSDIKLPGQQPPPTDTSPTNQAMPNETLQFYQAFGVRIEAFYHQRTEPDTQPNLLET
FT                   A"
FT   gene            complement(292982..293752)
FT                   /locus_tag="Shal_0244"
FT   CDS_pept        complement(292982..293752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0244"
FT                   /product="bioH protein"
FT                   /EC_number="3.1.1.1"
FT                   /note="KEGG: sbm:Shew185_4199 BioH protein; TIGRFAM: bioH
FT                   protein; PFAM: alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74820"
FT                   /db_xref="GOA:B0TNR7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR010076"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNR7"
FT                   /protein_id="ABZ74820.1"
FT                   /translation="MSQIKLHVESIGQGPDVVMLHGWGVNSAVFTPLHSELNNYRFHYV
FT                   DLPGFGHSQAVMGNIEHWLEAIMEQVPEKAIWTGWSLGGLVATLAAIKQPQRVSALCTI
FT                   ASSPCFMAREDWPGIPAEVLGQFASQLTQDLDKTVERFLAIQAMGSQTAKADIKQLREL
FT                   VLARPSAQQPALAQGLDMLENVDLRSQLSQIDQPWLRVWGRLDGLVPRRVIKAMPQVSA
FT                   SEDMLLTKASHAPFISHQAEFLDGYKLWLDKISN"
FT   gene            293804..294568
FT                   /locus_tag="Shal_0245"
FT   CDS_pept        293804..294568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0245"
FT                   /product="competence protein ComF"
FT                   /note="KEGG: shw:Sputw3181_0113 competence protein ComF"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74821"
FT                   /db_xref="GOA:B0TNR8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNR8"
FT                   /protein_id="ABZ74821.1"
FT                   /translation="MLSLVNRGILKRISPIKIMFLNRWLAAILPNRCLMCHQHIEAEHH
FT                   GICTVCLHACRYQTEICLGCGSKILLQMPFCGRCMLSPRLKVIAPCSYHQGMGHWVGQI
FT                   KYQAQFAVIDVLVDALVQRILYLEFLGFIELPQVLVAVPLHRKRLQQRGFNQAWLIAHA
FT                   LSKRLDIPLVDNLLLRTIDTQPQAGLSGKLRRKNLNNAFELSAEFNWQRVALIDDVVTT
FT                   GTTVDEIARLLQRKHTQVQVWCLARAEAPGLS"
FT   gene            complement(294599..297139)
FT                   /locus_tag="Shal_0246"
FT   CDS_pept        complement(294599..297139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0246"
FT                   /product="peptidase M14 carboxypeptidase A"
FT                   /note="PFAM: peptidase M14 carboxypeptidase A; KEGG:
FT                   slo:Shew_0105 peptidase M14, carboxypeptidase A"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74822"
FT                   /db_xref="GOA:B0TNR9"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNR9"
FT                   /protein_id="ABZ74822.1"
FT                   /translation="MLRIGLIFLCAFLILPSFLAEAKKTRLTDNPLYGVTTTSPEAFLG
FT                   YPLGERLLRHDQINTYLKEIAQQNPRVSIENTGQSHEARQQLTAVITSPENQAKLDEIL
FT                   AERQQIKYLGKQGGPLIIWLAYSIHGDEISGAHSAIKLSHMLATSEEKWVVNLLDKAVV
FT                   LITPSQNPDGLDRFSTWANGYAGKVTVSDPNHKEHKQGWPTGRSNHYLADLNRDWLFLR
FT                   HPESQGRVALFHRWQPHYVGDFHEMGHNFTYFFQPGVPERTHPLTPAGNQKLTAKLAAY
FT                   HQAELDAKKQNYFSRQLFDDFFYGKGSTYPDINGAIGVLFEQASARGQQQDSVNGVLSL
FT                   QEAIENQYATSISSLKGAIALKSELEHYQAEFFKNKHQKAMKKKPHQAGLLLSANNDQG
FT                   RINALTKLLDQHLIAYYYLTKPLTQGGVEFEVDNSLFIPHNQAQSSLLKAMFDDRTEFV
FT                   DPTFYDISTWNLQHAFDLTLRRNIKLELSVLSQTAPEFQPDSWGDNTVALLIDWRQSQA
FT                   ASLLQQLLEQGVMVKFAAKPFSIAVAAKESDFAAGTLQIPLKQDNLSADEISQKVGKLA
FT                   QEFKVNIVAVDTSAATQGIDLGSPDFKVIKPIRPLIISGKGTSIAEVGQLWYYLDNTLG
FT                   VATTLVDINNLALVKLSDYSHVLMADGNYFTLNERFARKLGQFASNGGVVIAQKGALDW
FT                   LSKSNLLKTNLRSDRFYKQLFDADGLTFDKKSKFKAEQEIGGAILELKLDTSHPINFGL
FT                   NDDRLPVLKNQVLGFSQTTNDFTVAAKYASDPLLSGYLAQEYQSSFSNSPAIIIESHNK
FT                   GAVVAMADNLLFRNIWLGSQKVYANALYFIPALH"
FT   gene            297350..297928
FT                   /locus_tag="Shal_0247"
FT   CDS_pept        297350..297928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0247"
FT                   /product="HesB/YadR/YfhF-family protein"
FT                   /note="PFAM: HesB/YadR/YfhF-family protein; nitrogen-fixing
FT                   NifU domain protein; KEGG: shw:Sputw3181_0119
FT                   HesB/YadR/YfhF-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74823"
FT                   /db_xref="GOA:B0TNS0"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR017726"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TNS0"
FT                   /protein_id="ABZ74823.1"
FT                   /translation="MITISETAQAHFVKLLSDQPEGTHIRVFVISPGTAQAECGVSYCP
FT                   PDAVEADDTEFEFNGFNAMVDEKSAPFLEEATIDFVTDQLGSQLTLKAPNAKMRKVSDD
FT                   ASLSERIEYVIQSEINPQLASHGGNIMLVEITEEGIAVLQFGGGCNGCSMVDVTLKDGI
FT                   EKQLLEMFPSELTGVKDVTEHQHGEHSYQ"
FT   gene            complement(298019..299350)
FT                   /locus_tag="Shal_0248"
FT   CDS_pept        complement(298019..299350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0248"
FT                   /product="MATE efflux family protein"
FT                   /note="TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE; KEGG: sbl:Sbal_0144
FT                   MATE efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74824"
FT                   /db_xref="GOA:B0TNS1"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNS1"
FT                   /protein_id="ABZ74824.1"
FT                   /translation="MIALLLNPQKNRQLFALALPMILSNITVPLLGLVDTAVVGHLSNA
FT                   YYLGGVAVGSTIITLILWLLGFLRMATTGLVAQAYGANDTEQQFKLLVQAASLALLFGI
FT                   AAIALQLPILNLAMAMSDASVEVERYCREYFQVRIWSTPFALMNLVMLGWLLGRQQPKA
FT                   AMWQLIIANLVNIVLDIVFVLVLGWGVKGAAFASVIADISGFLVALTMVRGQLNKLGNF
FT                   KLFNVAKQLTLQSYGKLMGLNTDIFVRSLCLQLSFAFMTFYGAGLGDNTVAANAVLLNL
FT                   LLLISYALDGIAYYAEAEVGRAYGQKNSRLMQESVTLAWAWSAIAALGFTLFFALAGSH
FT                   IIAMLTSITEVREVAEQYIIWVIFLPLLAFGSYLFDGVYIGAAQGKVMRNSMILSTFGV
FT                   FFPVWYLLEPQGNFALWAAMSCFMLARSASLSLHYWFKLRLVLN"
FT   gene            299369..300415
FT                   /locus_tag="Shal_0249"
FT   CDS_pept        299369..300415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0249"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG:
FT                   sbl:Sbal_0145 polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74825"
FT                   /db_xref="GOA:B0TNS2"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNS2"
FT                   /protein_id="ABZ74825.1"
FT                   /translation="MVKNVLLALLALTGFSAHAAVILQYHHVSDSTPAVTSVTPAQFKE
FT                   QMQYLAENNFNVVPLSTVVESIKAKKALPAKTIAITFDDGYRSIANTAHPILKQYKFPY
FT                   TLFVSVEPILKEYGEMMSWQQLITLSNEGAEIANHSWGHEHLIRKNADETDEQWLARIE
FT                   ENILRTEAEIVKATGQNLKMLAYPYGEYNQQIEDMLDKHGFVAFGQQSGAAGPYSPLTA
FT                   LPRFPVAGVYADLNSLKVKLHSLNMPVISQTNSDPQLPQGQWRPEIKVTLDMSDINASQ
FT                   LMCFIQGQGAKKPNWISDNQFSIQAELDLPAGRSRYNCTAPSKSKGSYYWFSQPWIRPK
FT                   SNGQWIAE"
FT   gene            complement(300630..301259)
FT                   /locus_tag="Shal_0250"
FT   CDS_pept        complement(300630..301259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0250"
FT                   /product="electron transport protein SCO1/SenC"
FT                   /note="PFAM: electron transport protein SCO1/SenC; KEGG:
FT                   slo:Shew_0116 electron transport protein SCO1/SenC"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74826"
FT                   /db_xref="GOA:B0TNS3"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNS3"
FT                   /protein_id="ABZ74826.1"
FT                   /translation="MRLTWIITAILMVAAGVYASIGLNSPKPLALQTSFEYPSPQPLAP
FT                   FSLIDQHGNTFTNADLNGKWSLFFIGYTSCPDVCPTTMGKLTSAYPSLAQGEDLQVIFL
FT                   SVDPQRDSTSTLESYIRFFNPEFVAVTGEHKQLLPVTRSLGFVYAMVGEGEDYQVDHSA
FT                   SFALVSPKGEKVAIIKPKSKTPGQLPQIKNRDLIHDVNAIIDKYSG"
FT   gene            complement(301349..302254)
FT                   /locus_tag="Shal_0251"
FT   CDS_pept        complement(301349..302254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0251"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /note="TIGRFAM: protoheme IX farnesyltransferase; PFAM:
FT                   UbiA prenyltransferase; KEGG: slo:Shew_0117 protoheme IX
FT                   farnesyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74827"
FT                   /db_xref="GOA:B0TNS4"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TNS4"
FT                   /protein_id="ABZ74827.1"
FT                   /translation="MPKPIALSRNPSTPLFQWRAYYEMTKPKVVALMLLTVLVGMCLAV
FT                   PGVVPIVPLIAGMAGIGMMAGSAAAFNHLIDRRIDGLMARTYNRPLPKGRVSIAKALTF
FT                   SCSLGILGFVVLYVLVNPLTAWLTFASLIGYAVVYTAYLKRATPQNIVVGGLAGAMPPL
FT                   LGWTAVTGEFHGNALLLVIIIFAWTPPHFWALAIHRRVEYAKVDIPMLPVTHGVEFTKT
FT                   CIFLYTILLAIACLLPVLVGMCGPVYLVSSTLLSVTFIYKAWQLKFHEEPGMAMKLFKF
FT                   SIYHLMLLFIALLVDHYLWL"
FT   gene            complement(302268..303251)
FT                   /locus_tag="Shal_0252"
FT   CDS_pept        complement(302268..303251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0252"
FT                   /product="cytochrome oxidase assembly"
FT                   /note="PFAM: cytochrome oxidase assembly; KEGG:
FT                   sdn:Sden_3523 cytochrome oxidase assembly"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74828"
FT                   /db_xref="GOA:B0TNS5"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNS5"
FT                   /protein_id="ABZ74828.1"
FT                   /translation="MQIKPLLKITLVFTLCVILMGAYTRLSDAGLGCPDWPGCYGMLKV
FT                   PSQAHELNQVQQAFPEHTVEADKAWLEMIHRYIAGTLGLLVLLILAISLKTNDAPKKLP
FT                   MFIAALIIFQAALGMWTVTMKLMPIIVMAHLLGGFALFSLLLLLYLRSKPLRIPGGDLP
FT                   ARKLAGFAAISIGVLLLQIILGGWTSSNYAALACTTLPFCEGNWVDNLSFAKAFSPFQG
FT                   EHASFEYGVLDYSARMTIHVAHRVGAIITTAMLLYLAFKLIHTAKSTTIRNAAWLLAVL
FT                   VVVQVILGISNIVLHLPLGIAVSHNGGAALLLLTLVFINYALWRKA"
FT   gene            complement(303265..303810)
FT                   /locus_tag="Shal_0253"
FT   CDS_pept        complement(303265..303810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0253"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_0119 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74829"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNS6"
FT                   /protein_id="ABZ74829.1"
FT                   /translation="MNSPQKNGKKTLLLLLLAFALPVIAAKLVLSFNLYQGGVTNKGQL
FT                   LDTDISYQSLAMVNPQPHEWQLLYQLPNHCDAVCKDRLYILQQSHVALGRNQDRVHTII
FT                   MINEHSDTAALDSSDFVTAIPSKALSQLLAQQELVIVDPLGSLVMSYPIAADHQSQIMQ
FT                   GKALVADLRKLLKLSRIG"
FT   gene            complement(303938..304867)
FT                   /locus_tag="Shal_0254"
FT   CDS_pept        complement(303938..304867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0254"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_0129 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74830"
FT                   /db_xref="GOA:B0TNS7"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNS7"
FT                   /protein_id="ABZ74830.1"
FT                   /translation="MTPVPNATNSNSTTNTEKSTRRPKYWLISTLFSPFTMINRARAKL
FT                   NSMNSSSSTKTNLKINKADMALPRVKMNLAWLFVVLSTVVVFSILVKLGFWQLERAQYK
FT                   AHWQQQLTNRQAASVLSYRQLLNFPKDEPLTGFKLKAAVTPISTDIFLLDNQVYKGKVG
FT                   YLALQAVQVNESEPWLLVELGFIAASMDRAKLPSVTAITAPAMLEGRVYQKQLNPMSSE
FT                   LMPEAGWPKRIQNLNIPQLSEQLNMPLASAVLQPSNLANSYSHPWQPIPLSSQKHHGYA
FT                   VQWFSMAGVFALLMGYLLFRTLKQQHNK"
FT   gene            complement(304932..305813)
FT                   /locus_tag="Shal_0255"
FT   CDS_pept        complement(304932..305813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0255"
FT                   /product="cytochrome c oxidase subunit III"
FT                   /note="PFAM: cytochrome c oxidase subunit III; KEGG:
FT                   slo:Shew_0122 cytochrome c oxidase, subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74831"
FT                   /db_xref="GOA:B0TNS8"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNS8"
FT                   /protein_id="ABZ74831.1"
FT                   /translation="MTTEHKHDNYYVPEQSAWPIIGAVGLFLIAFGAGSYVSELNSQGG
FT                   FGGYILLAGIAVIIFMIFGWFRTVIAESMAGLYSKQMDRSFRQGMSWFIFSEVMFFAAF
FT                   FGALFYARIIAIPWLGGASNNAMTHEVLWPMFEAAWPLLTTPDGSLTQAMDWTGLPLYN
FT                   TLILLTSSITLHFAHLGLEKNKRSALTVWLAITILLGVAFLYLQVEEYLHAYQEMGLTL
FT                   NSGIYGNTFFLLTGFHGMHVTLGTVFLIVLFFRVLKGHFTPDKHFAFQAGSWYWHFVDV
FT                   VWLCLFIFVYVL"
FT   gene            complement(305925..306509)
FT                   /locus_tag="Shal_0256"
FT   CDS_pept        complement(305925..306509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0256"
FT                   /product="cytochrome c oxidase assembly protein CtaG/Cox11"
FT                   /note="PFAM: cytochrome c oxidase assembly protein
FT                   CtaG/Cox11; KEGG: slo:Shew_0123 cytochrome c oxidase
FT                   assembly protein CtaG/Cox11"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74832"
FT                   /db_xref="GOA:B0TNS9"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNS9"
FT                   /protein_id="ABZ74832.1"
FT                   /translation="MAEIKRYSNRKLIAALIIGAVGMFGFGFALVPLYDVLCDTLGING
FT                   KTQSTASVYQPVVVDKSRSITVEFVSQVQSDMPWTFTPQVNTMQVHPGELIRTHFVATN
FT                   LSATHIVGQAIPSVSPGLGAAYFNKTECFCFNQQVLQANAAANLPLIFFVDPQLPDSIS
FT                   TLTLSYTLYNITDKGYVVSAASNAVEQGAAQ"
FT   gene            complement(306512..308116)
FT                   /locus_tag="Shal_0257"
FT   CDS_pept        complement(306512..308116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0257"
FT                   /product="Cytochrome c oxidase subunit I type"
FT                   /EC_number="1.9.3.1"
FT                   /note="KEGG: shn:Shewana3_3992 cytochrome c oxidase,
FT                   subunit I; TIGRFAM: Cytochrome c oxidase subunit I type;
FT                   PFAM: cytochrome c oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74833"
FT                   /db_xref="GOA:B0TNT0"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033944"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNT0"
FT                   /protein_id="ABZ74833.1"
FT                   /translation="MSTITQDSPAAHDDHHDDHHHGAPKGIMRWLLTTNHKDIGTLYLL
FT                   FSLIMFFVGGAMAMVIRAELFQPGLQLVEPNFFNQMTTVHGLVMVFGAVMPAFTGLANW
FT                   LIPMMIGAPDMALPRMNNWSFWILPFAFTILLSSLFMEGGGPNFGWTFYAPLSTTYSPD
FT                   STALFVFAVHIMGISSIMGAINVIVTIVNLRAPGMTWMKLPLFVWTWLITAFLLIAVMP
FT                   VLAGTVTMVLTDKYFGTSFFDAAGGGDPVMFQHIFWFFGHPEVYIMILPSFGIISAIVP
FT                   AFSRKRLFGYSSMVYATASIAILSFLVWAHHMFTTGMPVFAELFFMYCTMLIAVPTGVK
FT                   VFNWVATMWRGSITFETPMLFAVAFIILFTIGGFSGLMLAIAPADFQYHDTYFVVAHFH
FT                   YVLVTGAIFSIMAAAYYWLPKWTGHMYSETLGRWHFWCSVISVNILFFPMHFLGLAGMP
FT                   RRIPDYAIQFADVNQIVSIGGFAFGLSQLIFLAVVIKCIRGGEKAPAKPWEGAEGLEWT
FT                   LPSPAPYHSFTTPPEVK"
FT   gene            complement(308126..309712)
FT                   /locus_tag="Shal_0258"
FT   CDS_pept        complement(308126..309712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0258"
FT                   /product="Cytochrome c oxidase subunit II"
FT                   /EC_number="1.9.3.1"
FT                   /note="KEGG: slo:Shew_0125 cytochrome c oxidase, subunit
FT                   II; TIGRFAM: Cytochrome c oxidase subunit II; PFAM:
FT                   cytochrome c oxidase subunit II; cytochrome c class I;
FT                   cytochrome C oxidase subunit II transmembrane region"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74834"
FT                   /db_xref="GOA:B0TNT1"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR034210"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNT1"
FT                   /protein_id="ABZ74834.1"
FT                   /translation="MKQLLYCVLALLFSPVLFASEMPLNMTEGVTEISGRIYSLHMVIL
FT                   YICCAIGIVVFGIMIYAMINHRKSKGAVAANFHESTKVEILWTVVPFIILIVMAIPATK
FT                   TLIAMEDPSNADLTIKITGSQWKWHYSYFDQDIEFFSLLSTPREQIIGDETKGENYLLE
FT                   VDKPLVLPINRKVRFLMTSEDVIHSWWVPAFAVKKDANPGFINEAWTRIDKPGTYRGQC
FT                   AELCGKDHGFMPIVVEAVSEEDFDAWLITQQQQAQNAEAAAKAALSQTLTMDELMTKGE
FT                   QIYLARCAACHQPNGAGLPGVFPSLIGSPIIKGPAQLHIDIVLNGKPGTAMQAFLNQLT
FT                   ATEIAAVVTYERNAWGNNSGDTVQASDVSSDTTTPATSVDSSPATPTTLPATLPATRPE
FT                   VKQAIASETQADDQVAKELATAPLGDLAMNELITMGEKVYMANCAACHQAAGTGLPPAF
FT                   PSLVGSPIVKGPIAAHLDIVINGKPGTAMQSFSAVLTPQQLAAVVTYERNAWGNDSGDA
FT                   VQASDVDGHAK"
FT   gene            complement(310190..310726)
FT                   /locus_tag="Shal_0259"
FT   CDS_pept        complement(310190..310726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0259"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO_4604 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74835"
FT                   /db_xref="GOA:B0TNT2"
FT                   /db_xref="InterPro:IPR004596"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNT2"
FT                   /protein_id="ABZ74835.1"
FT                   /translation="MNKLMGTSPRHPGLWQDMPSTSMVSSAGNEITTMVTQTQGRDELN
FT                   QISAQLSQLSQQGRWIVLISPPNIGYKQMLAAAGVRMDRILLVHAKDEVETLWAMEKAL
FT                   MSGTSSAVITWTNSLDARDSRRLQIVAKSARAAGIIIENSIESANKNTSSHLPICTMNM
FT                   QDKTFAQAALFGAVH"
FT   gene            complement(310723..311343)
FT                   /locus_tag="Shal_0260"
FT   CDS_pept        complement(310723..311343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0260"
FT                   /product="transcriptional repressor, LexA family"
FT                   /EC_number="3.4.21.88"
FT                   /note="KEGG: slo:Shew_0127 SOS-response transcriptional
FT                   repressor, LexA; TIGRFAM: LexA repressor; PFAM: LexA
FT                   DNA-binding domain protein; peptidase S24 and S26 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74836"
FT                   /db_xref="GOA:B0TNT3"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR006199"
FT                   /db_xref="InterPro:IPR006200"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TNT3"
FT                   /protein_id="ABZ74836.1"
FT                   /translation="MRPLTPRQAEILELIKRNIADTGMPPTRAEIARRLGFKSANAAEE
FT                   HLKALAKKGCIEIMPGTSRGIKLTQENTEDADLGLPLIGQVAAGEPILAQEHVEQHYKV
FT                   DPAMFKPSADFLLRVRGDSMKNIGILEGDLLAVHKIQQARNGQIVVARVEDDVTVKRFE
FT                   KKGNKVFLHAENEEYSPIEVDLANQSLSIEGLAVGVIRNGDWQ"
FT   gene            complement(311970..313604)
FT                   /locus_tag="Shal_0261"
FT   CDS_pept        complement(311970..313604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0261"
FT                   /product="FGGY-family pentulose kinase"
FT                   /note="TIGRFAM: FGGY-family pentulose kinase; PFAM:
FT                   carbohydrate kinase FGGY; KEGG: ppr:PBPRB0722 putative
FT                   carbohydrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74837"
FT                   /db_xref="GOA:B0TNT4"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006003"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNT4"
FT                   /protein_id="ABZ74837.1"
FT                   /translation="MSSYFIGVDVGSGSARAGVFDSQGRKAGEAKRDISIFKPKAHFVE
FT                   QSSDDIWQCVCLAVRDAMSQANIDSVQVKGIGFDATCSMVVLDKHGLPLTVSPTGRSEQ
FT                   NIVMWMDHRAIAQAERINASKHPVLAFVGNHISPEMQTPKLLWLKENMPSTWAKAGYFF
FT                   DLPDFLTWKATNENSRSLCSTVCKWTYLGHESKWDKDYFNTIGLGELLQDDARIIGSDI
FT                   RPMGEAIGNGLTAQAAAELGLLTGTKVATSIIDAHAGGIGILGAAGMSGEAADFNKRLA
FT                   LIGGTSTCHMAVSKTARFIDGIWGAYYSAMIPGLWLNEGGQSATGVLIDHIINAHPYNA
FT                   QAVEQAKAAGITIYQLLNDRLLNLAGSKEDIAFLTRDRHVLPYFNGNRSPRANPHLTGT
FT                   MTGLSMGVTLDDMALQYLATVQAIALGTRHIIEEMNKSGYAIDTIMACGGGTKNPVFIQ
FT                   EHANATGCAMLLSEESEAVLLGSAMLGAVAGGGFDSIPDAMNAMSRIGKTVTPTADKSK
FT                   RFYDAKYQVFQQMYEDDCRYKAMMAAV"
FT   gene            complement(313613..314572)
FT                   /locus_tag="Shal_0262"
FT   CDS_pept        complement(313613..314572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0262"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   ppr:PBPRB0721 putative ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74838"
FT                   /db_xref="GOA:B0TNT5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNT5"
FT                   /protein_id="ABZ74838.1"
FT                   /translation="MDALMNTLKLPTDRNIRYLLMILAAIMALMAFSLGGTFFSLTNLQ
FT                   SMSSQLPLLGIFALAMAVCMLTGGINLSIIATTNACSLVMASIITLAPDSSLMLMAALA
FT                   AGLVTAVIVGLANGFLIAYIGVSPILATLGMMTFINGLNVLVSGGSVISGFPDALLLLG
FT                   NGDILGVPMPLIFFALFAIGLWVILEHTPLGRAIYLIGSNEKASRFSGINTQKSLVYVY
FT                   IISSILCWLAAIIMMAKFNSAKAGYGESYLLVAILASVLGGINPDGGFGRIIGIFLALL
FT                   VLQALESGLNLLGVSSYLTMALWGGILIVFIALQKYKS"
FT   gene            complement(314572..315570)
FT                   /locus_tag="Shal_0263"
FT   CDS_pept        complement(314572..315570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0263"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   ppr:PBPRB0720 putative permease of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74839"
FT                   /db_xref="GOA:B0TNT6"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNT6"
FT                   /protein_id="ABZ74839.1"
FT                   /translation="MLSLHKDSFYSLFKQHEFYLSLLIALLILGLSVATEDFMTLGNIF
FT                   DMTVSSAILGIMACGLFVVLIAGGIDISFPAIAAIGQYLMATFVLANGGNFAIAFAIAA
FT                   LTGIALGMVNAVLVYKLKAPAIIITIAMLNVYFGLLIYFSNGEWLYGFPDWFMDGVEVL
FT                   RFTASDGYDYGLNLPMMTLLAVIALTSILMNKTRIGRQIYAMGGNSDAASRIGINGFGL
FT                   NLFVYGYMGAMAGIAAVVQTQITQSVAPNSLMGFELTVLAAVVLGGTSMSGGKGTLLGV
FT                   ILGVVLLAVLKNGLTLLGVPSYWHTVVTGLIILISISMTALNEKQQAKQVA"
FT   gene            complement(315563..317074)
FT                   /locus_tag="Shal_0264"
FT   CDS_pept        complement(315563..317074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0264"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ppr:PBPRB0719 putative ATP-binding protein of
FT                   ABCtransporter"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74840"
FT                   /db_xref="GOA:B0TNT7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNT7"
FT                   /protein_id="ABZ74840.1"
FT                   /translation="MSKQAFITLKGVSKHFGSVKALSDINLSFNRGEVHCLAGKNGCGK
FT                   STLFKVISGVHAPEAGSEITIDGKHYSRLTPQQSIEHGVQVIYQDLSLFPNLSVAENIA
FT                   IQDHIHWYKGLVSRARIRTIAQKAMDSVGVSLPLDTRVEQLSIAQRQLVAICRAMAADA
FT                   KLVIMDEPTASLTRTEVNQLIKVVADLKSRNITVVFVSHKLDEVMEISDRITVIRDGCT
FT                   VGTYNAADVDSDELAFLMTGQRFEFTPIGNFEPKADDSDIRLSTCKLTKAGQFYDIDLT
FT                   VRSGEIVSITGLLGAGRSELCMALFGMTVPDNGVIKLAGESVRFKSNRDAIAQGIGYVT
FT                   EDRMTTGLVMNQSISDNTIATVLPKLSRQGLAKGLLDHSKAKALVSKLISSLSIKVSDP
FT                   QLPVSSLSGGNAQRIAIAKWVAAEPQVLILDAPTVGVDIANKESIYQIAKDLAAKGIAI
FT                   IMVSDEIPEVFYNSHRVIVMKEGRFTHEFSPSSCTQQQIMEAVNA"
FT   gene            complement(317216..318190)
FT                   /locus_tag="Shal_0265"
FT   CDS_pept        complement(317216..318190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0265"
FT                   /product="putative periplasmic binding protein"
FT                   /note="KEGG: ppr:PBPRB0718 putative periplasmic binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74841"
FT                   /db_xref="GOA:B0TNT8"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR030159"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNT8"
FT                   /protein_id="ABZ74841.1"
FT                   /translation="MKKVFFKVAAVSLALLSASVYAKDYEIVNVVKVSGIPWFNQMDKG
FT                   VEQAAADLGVNARQVGPATPDPAQQVKMIEDLIAKGVDAITVVPNDVTVLEPVFKKARD
FT                   KGIIVLTHESPENHNADWNIEMLDNLAYAKATMDEMAKLMDSKGGYVVFVGSLTVPLHN
FT                   NWANLAIDYQKNTYPDMYEVTSRMPVAESVDASYGATNDLMKAHPDMKGIISYGSLGLI
FT                   GAGEAIKKKRAKNKIDTVGIIMPSQAAQYLMRGEIDKGFLWNPADAGYAMVAVAKMMLD
FT                   GKSVEAGVEFDNLGKAEINTQTRVIKFNKILEVDKSNARSLGF"
FT   gene            318924..319838
FT                   /locus_tag="Shal_0266"
FT   CDS_pept        318924..319838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0266"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vfi:VF1104 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74842"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="InterPro:IPR033399"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNT9"
FT                   /protein_id="ABZ74842.1"
FT                   /translation="MARLASNYPALNRLRSVPLELVNAVMLSAALTATVLASDKINPAT
FT                   SATQQSIQFSNPQSTPLSSLLSNQPSNQLANHESAQEMIQKAMDNWRGLTSSSLLTMVI
FT                   HRPDWERSMTVQGWTQGDKQSLVRVTDPKVDAGNAFLIDDKQMWSYSPKINRVIKVPSS
FT                   MMSQSWMGSDFSNKDVSRTTELLDDYSHRLIATEELDGHRVYTIESIPHESAPVVWGKQ
FT                   VTVLRDDWVMLRQEFWDQDNQLVKAMECDDIEPVGKRSVAMRCRMSQVEKVEEWTEIRN
FT                   QNVHFDIILPSYMFTLSNLRNPR"
FT   gene            319838..321076
FT                   /locus_tag="Shal_0267"
FT   CDS_pept        319838..321076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0267"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   slo:Shew_2660 protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74843"
FT                   /db_xref="GOA:B0TNU0"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNU0"
FT                   /protein_id="ABZ74843.1"
FT                   /translation="MNGQILLAWRSLWQHKRRTWLTLGAMIFCNSLLVFMITLQAGTYP
FT                   MMIENTLRIFSSQLQINQQGYLDEPELRLRILDSSDLVARLELQFPELIVIPRSRGFLL
FT                   AASEQRSVGMLVNGVAPDKERLASSIPQQIIIGRYLEAGDNNLVVLGERLAKNLQVTVG
FT                   DELTVMGSTMEGGFAAGVLSIVGIFNSGINELDRTTSQVSLATFQRLFEMPNQVSLLSI
FT                   NAPSMSQVSFYQQQLQSLLQLSSAEAKLTIHDWQQLNPGIKQGIEADLSSAVIMYAVLV
FT                   LLVILGVMNTQLMAVLERTKEFGIMLAIGTKPSRLFTQVLIETLMMGIIGMLLGALFGG
FT                   VVAGYFSLVGIALPGMGDIGAQFGIGDRIYPLLSPLSVLIGPVVVCVGSVLISIYPAFK
FT                   TLGLEPISAMQSK"
FT   gene            321189..322313
FT                   /locus_tag="Shal_0268"
FT   CDS_pept        321189..322313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0268"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   slo:Shew_2659 protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74844"
FT                   /db_xref="GOA:B0TNU1"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNU1"
FT                   /protein_id="ABZ74844.1"
FT                   /translation="MIVVSAFLRGMVDGMNQTSLNNLPGEIQLHQRDFLNDQNVMNHIP
FT                   EPAGALLQQLHQSWITQWASRVRSPVMIGSERVTLGSQLIAIAPQQEPFTVNELELVAG
FT                   RMLKDGEDNGIIIGQKMATRLKTALNKRVVITLQDVDNEIAESGVRVVGIYHKPTEQEE
FT                   LATIYTGKGFIQKLLNMPGMVTEIAVFTDTNQPLEQVVSSLESAVDDSYDVATWRQLNG
FT                   YLAAISDLMNSYIIIFIVIVFCVLGFGLANTLLMSIFERQQEIGLILALGLQSKAVILM
FT                   IVIEAVLLLISGLIFGDTLALLTTNALSAGVDLSSIADGLAMAGMDTTLYPVVYSQDVI
FT                   AANIIVMVLGVITSLWPAIKAARSNPIESINTAA"
FT   gene            322347..323030
FT                   /locus_tag="Shal_0269"
FT   CDS_pept        322347..323030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0269"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: cps:CPS_5040 ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74845"
FT                   /db_xref="GOA:B0TNU2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNU2"
FT                   /protein_id="ABZ74845.1"
FT                   /translation="MSNIVCKQLVKTFLQGDQTIYGLDHVSLTIKQGEMTVLSGPSGSG
FT                   KTTLLNAIGGLDEPDSGIVYVGDVEITGLTKSQRADVRLQRIGFVFQSYNLIPVLTVQE
FT                   NIEFVMQLQGVSASERKKRSQEILGEVGLTGLETRRPAQLSGGQQQRVAVARAIASKPV
FT                   LILADEPTANLDSKTSAQLLELFTQLNRQHGITFLIATHDAQVFDYCRRHIYMVDGKIV
FT                   TDSTS"
FT   gene            323040..324341
FT                   /locus_tag="Shal_0270"
FT   CDS_pept        323040..324341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0270"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cps:CPS_5039 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74846"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNU3"
FT                   /protein_id="ABZ74846.1"
FT                   /translation="MGKGCCSKLIDRFLLRRKSNCLAYLVGLCSLPLSLAAAELQHHGH
FT                   LKYEYDGYAFSDSSVYQARYGQHQVNQTAQLRYHLGSRWQSGWLVEVDYQLLAGYGEHR
FT                   FQATPLMNGYLGLSSVIDDELRLFNLTNTLSEHRDFVMLQRLDRAIVGYQTDNNVVKFG
FT                   RQAITWGNGQFFNPMDFVNPFDPASLDKEYKTGDDMVYGQHLLQDGSDLQAAYVIRRDG
FT                   DSDITADVATLALKYHGFIDYIYEYDLLLAEHYDNTVAGVSSIISVGGAIWATDLVATW
FT                   GETNYLSLVSNWGYSWVGFERNMSGTLEYFYNGLGISDGDYSPESLLQHPELVAKIERG
FT                   ELYNLARHYLTGSLYIEMTPLWSVSQNLFYNASDNSALYQVLSQNSLSDELRLTTALTV
FT                   PIGANGTEYGGLKFSDGQYFSFELLLYAQLAWYF"
FT   gene            324601..327024
FT                   /locus_tag="Shal_0271"
FT   CDS_pept        324601..327024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0271"
FT                   /product="Glycerol-3-phosphate O-acyltransferase"
FT                   /EC_number="2.3.1.15"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; KEGG:
FT                   slo:Shew_3530 glycerol-3-phosphate O-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74847"
FT                   /db_xref="GOA:B0TNU4"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR022284"
FT                   /db_xref="InterPro:IPR028354"
FT                   /db_xref="InterPro:IPR041728"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TNU4"
FT                   /protein_id="ABZ74847.1"
FT                   /translation="MSKQDSLWFKSLRWLQRKLVHTVVVPHDPFDDLNLDPSKPLVYVM
FT                   KTESVSDIAALSEMTEKLGLPSPYEELEVNGIRAPRVVCLEGSKPLFGQREGGEQYIDY
FT                   FKRLLSVHKQNLELDIQLVPVSLYWGRTPGKEDDTMRAAVLERQNPTWLRKCLMILFLG
FT                   RHNFVQFSNAVSLRYMADEHGTDKRIAQKLARVARAHFERQRKVMTGPQLPKRQALFHA
FT                   LLKSDSITKAIKEEAASKKISESEARAKAMEYLDEVAADYSDSLVRIAERFLTWLWNKL
FT                   YKGINIKGAEQVRQLHHDGHEIVYVPCHRSHMDYLLLSYILYYQGMVPPHIAAGINLNF
FT                   WPAGPAFRRGGAFFIRRSFGGNKLYTAVFREYLDQLFTKGYSVEYFTEGGRSRTGRLLA
FT                   PKTGMLAMTLNSVLRGVERPVTLVPVYLGYDHVMEVATYHKELSGKKKKKESVWQIFGA
FT                   IRKLGNFGQGYVNFGEPITLHNFLNEQVPSWRDDIAKDPDQKPTWLTPVVNTLANQVMT
FT                   NINDAAAVSSVTLTSMVLLASEQNALERSQLEKQLDLYLTLLKERPYTDYTSVPDGTGH
FT                   DLVSQGLELKKLQIESDPLGDIISIDQSIAITMTYYRNNIIHLMVLPSLIAACLLRKEN
FT                   CGRNDVISIVNDFYPLLEAELFMGIEDPSQYANQILDILVAQGLVVECDHFEVVDSSIN
FT                   QLLLLSGTISETMQRYAILFNLLEVKPNMERSELEKDSHRLAQRLGALHGITAPEFYDK
FT                   KLYATLSVKLKELGYLTDNQGCSDIKRIKERANLLLRSSVKQTIVDSVHAEHIA"
FT   gene            327024..328280
FT                   /locus_tag="Shal_0272"
FT   CDS_pept        327024..328280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0272"
FT                   /product="aromatic amino acid transporter"
FT                   /note="TIGRFAM: aromatic amino acid transporter; PFAM:
FT                   aromatic amino acid permease; KEGG: slo:Shew_3531 aromatic
FT                   amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74848"
FT                   /db_xref="GOA:B0TNU5"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR013059"
FT                   /db_xref="InterPro:IPR018227"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNU5"
FT                   /protein_id="ABZ74848.1"
FT                   /translation="MANHMNAAGHETSGKSLLGGAMIIAGTAVGAGMFSLPVVGAGMWF
FT                   GYSLLMMAGVWFCMLVSGLLLLETNLHFKPGDSFDTLTRTTLGNFWRIVNGLSIAFVLY
FT                   ILAYAYISGGGSIVNYNLASAGIELPQGIAGLIFALGLAFIVFISTKAVDRITTIMLGG
FT                   MLITFFLAVGNLLLDVESVKLFSPDGENKYLPYMLAALPFGLVSFGYHGNVPSLVKYYG
FT                   KDHRTIIKAIVIGTGIALVIYICWLVATMGNISRTDFIGIIEQGGNMGVLVNALSGVMT
FT                   SDWLTTMLTLFANLAVASSFLGVTLGLFDYLADLFGFDESRSGRFKTAAVTFLPPTVLG
FT                   LLFPDGFLVAIGFAALAATIWAAIVPAMMAYKVRVMYPDSASYKVPGGNAVIVIVILFG
FT                   VITAACHLLAMAGMLPLYG"
FT   gene            complement(328314..329381)
FT                   /locus_tag="Shal_0273"
FT   CDS_pept        complement(328314..329381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0273"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="SMART: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: ppr:PBPRB1682 hypothetical AraC-type
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74849"
FT                   /db_xref="GOA:B0TNU6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNU6"
FT                   /protein_id="ABZ74849.1"
FT                   /translation="MIQLSHYRLRIFTMLLNTAFIRSCYISPVLEGVEAHYGVTPADLG
FT                   IPALLLQDRMTLIPFTEVSKWFEQIELLTGEADFMVKIQQHLTLQGLEVPGNWFLRAPD
FT                   LAISFRRINHGVCCFQSGACYYAQQSGKILKWCYSNPFVKDKARAHDSLRVAFTLFNAI
FT                   KNYVGDSYSPRKVRLSGPPIQQQETEQLFGCPVSWNAPQTEIWLGIDQLLMSTDDYCYM
FT                   PEPVTASIPLSQLEKYLNMPQPTDTPKVLYEMVNYSRYYGLPNVDTVAALFNISRQQLQ
FT                   RRLQKLGFTFTYLSGYILCNQAIRYMLEGMDIAEIASRLGYANTHSFSRSFARFRRQTP
FT                   TQYLSQLKLENKKPL"
FT   gene            329480..329827
FT                   /locus_tag="Shal_0274"
FT   CDS_pept        329480..329827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0274"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ppr:PBPRB1681 putative permease of the major
FT                   facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74850"
FT                   /db_xref="GOA:B0TNU7"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNU7"
FT                   /protein_id="ABZ74850.1"
FT                   /translation="MSLFSMPFVDSGVDTALHSVAAVVMVLTVAAAAFGFWKIHDMPIN
FT                   KAHKEQHHQIGLITALTWIGFIWHWVWVIAVIVAFVDGEKALRRIRDVWRENEPATEQT
FT                   DVTVKEEQTNA"
FT   gene            329820..331043
FT                   /locus_tag="Shal_0275"
FT   CDS_pept        329820..331043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0275"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   ppr:PBPRB1680 putative multidrug resistance efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74851"
FT                   /db_xref="GOA:B0TNU8"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNU8"
FT                   /protein_id="ABZ74851.1"
FT                   /translation="MLEGLAVWALFIYLLRLVGMPWNTYSKAFAYLGGTGWLMFVWVGL
FT                   LNYTPMDLSGGSLVQSPHIQLRPANSQIRGAVDNIYVQPNQKVEAGQLVYDLDAEPYQI
FT                   ALNKALVAKESANVGLSLAAEDVKLALKQHEVAIADVSITKNQLNAATKDLAWKQKNLA
FT                   RYIEQNRVVPDTITKSQLDEQQTAVDLAMAQVQTYSTQIEKAQMAEHTALLNIEKSHLA
FT                   VQSRQSDLDSEHENVAQAQWNLDNTKIYAPADGYVTNFIMREGQYIGVAPRMQMYTNEK
FT                   YVLMRVNHQAIRNVKVGQLAEFASAVYPGKVFSAEVEGIVEATGEAQGRLVALDDNVRQ
FT                   TTGQNINNKHHFVRLKLTETGDYDIPVGSVGLAWISGTKPIEFLAFLDVIRGIVIRMKS
FT                   QIYYFYSI"
FT   gene            complement(331128..332306)
FT                   /locus_tag="Shal_0276"
FT   CDS_pept        complement(331128..332306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0276"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: sdn:Sden_0245 GGDEF domain"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74852"
FT                   /db_xref="GOA:B0TNU9"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNU9"
FT                   /protein_id="ABZ74852.1"
FT                   /translation="MPVLERSLRYLFAPIVLTFIGIAALQQLTATWQEWLPSFHELPYY
FT                   LLALSTLLALQFNCGRISYLSLLLLLYYYLRQVAPLAALDQDQVFLAGTLIITFFAISK
FT                   DRSPFSIHFFKVLLGISLCFALAFVWKASASGLASFNITQLPSMLNLVASLYIPVGISC
FT                   IVISIYTVLHASGTNSTIALTQFIWLFHHYLPKEMPLAILLSMLATAYLFSMLFALYDL
FT                   AYKDELTGLSSRRALNTMALSLNNHYSLAMIDIDHFKKFNDTYGHDVGDQVLRLVAKKL
FT                   SKVKGGGQVFRYGGEEFTIVFENKNIERVLPHLEELRHKISHYDIVLREQGRKSRSKLD
FT                   RNSKHKANQALNITISIGVAEQHGETTFEKTLKRADEALYKAKNNGRNCVFA"
FT   gene            332472..333254
FT                   /locus_tag="Shal_0277"
FT   CDS_pept        332472..333254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0277"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: sdn:Sden_3512
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74853"
FT                   /db_xref="GOA:B0TNV0"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNV0"
FT                   /protein_id="ABZ74853.1"
FT                   /translation="MNVDQYFQGQPCWVELACLDINSCKSFYSALFGWEIIDMPVPQGT
FT                   YSMLAIDGDDIGAMYQLPEEMVANGDTTQWTVYFAVENLDSTLVDVAGAGGTLIIGPHD
FT                   VGEAGRMAIIQDPEGARFALWQAKNHIGAKRAAEPNTLCWVELACRDPELAKKFYPHVL
FT                   SWGSRATNMQGMDYTEWQVGAQDVGGMLVMTEEWGDMPAHWMLYFTVESCDDKAVQVEQ
FT                   LGGTVCVPPTDIPNVGRFAVINDPDGGLFSVIELRMGN"
FT   gene            complement(333328..336465)
FT                   /locus_tag="Shal_0278"
FT   CDS_pept        complement(333328..336465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0278"
FT                   /product="heavy metal efflux pump, CzcA family"
FT                   /note="TIGRFAM: heavy metal efflux pump, CzcA family; PFAM:
FT                   acriflavin resistance protein; KEGG: sfr:Sfri_0266 heavy
FT                   metal efflux pump, CzcA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74854"
FT                   /db_xref="GOA:B0TNV1"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNV1"
FT                   /protein_id="ABZ74854.1"
FT                   /translation="MLERIISASIKQRAMVLVLTAVIALIGYQAMRITPLDALPDLSDV
FT                   QVIVKTSYPGQAPQLVEDQITYPLSTAMLAVPGAKTVRGFSMFGDSYVYIIFEDGTDIY
FT                   WARSRVLEYLSQTQGQLPDNVTPTLGPDASGVGWVFQYALVDRKGQHDLAQLRSLQDWF
FT                   LKLELQSVAGVSEVATIGGMEQSYQIIVDPHKLALYQIDLMTVKNALDNSNSSTGGSVI
FT                   EMAEAEYMITSSGYRQTLADFEEIPLGIVSESGTPVLMKDVAQLRTGPAARRGIAELNG
FT                   EGEVVGGIVVMRYGENALATINNVKDKLKEVENGLPDGVELVITYDRSELILNSVDNLT
FT                   HKVLEEMLVVGVICLIFLLHARSTLVAIISLPISILISFIVMNIIGVNANIMSLGGIAI
FT                   AIGAVVDAAIVMVENTHKHLEHYREQHDGATPTGEAHWELVRKASVEVGPALFFSLLII
FT                   TLSFVPVFALEAQEGRLFHPLAYTKTFAMAASAILAITLIPVLMGYFVRGKIPDERKNP
FT                   ISRFLIAIYEPTLRLVLRFPKTTILLAMLTLASAVYPMTNIGSEFMPELEEGDLLYMPT
FT                   TLPSVSAGKAAEILQQTDRLIKTIPEVKRVFGKVGRAMTATDPAPLTMLETTIMLNPRD
FT                   TWREGMTLEGIIAELQKTVKVPGMTNAWVQPIKTRIDMLSTGVRTPVGIKISGADIEEL
FT                   QRIGTEIEAVVSKLPGTTSAFAQRTSGGRYIDIEPNLKNAARYGMTLKDIQDVVQMAIG
FT                   GMQVGKSIQGQERYPINIRYPRELRDSIEKLEDLPVLTKTGKYLPLGNLASITISDGAP
FT                   MLASENGRLISWVFVDLKDISIGEYITTARAALDEQIALPPRYSYSFAGQYEYMQRVEA
FT                   KMQLVVPLMLAVIFMLLMMTFSSFIQASVIMLSLPFSLVGSAWLLYFLNFDFSVAVSVG
FT                   MIALAGVAAEFGVVMQVYLNNSIRDRKLAGLYNKRSDLSEALIHGAVMRIRPKAMTVAT
FT                   IFFGLLPIMWGSGTGNEVMQKIAAPMVGGMVTAPLLSLFVIPAIYLLIYGRSLNRE"
FT   gene            complement(336478..338160)
FT                   /locus_tag="Shal_0279"
FT   CDS_pept        complement(336478..338160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0279"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; KEGG: sfr:Sfri_0267 efflux transporter, RND
FT                   family, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74855"
FT                   /db_xref="GOA:B0TNV2"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNV2"
FT                   /protein_id="ABZ74855.1"
FT                   /translation="MSFFISKKMRQTTVCALSLVMASTPLMGFSQTTETTNSKQAQAHQ
FT                   HESSQHESEYYCPMHPEVTSHEPGRCPECKMFLVKDEANSSTSEAAAIVENYYCPMHPE
FT                   VTSHEPGRCPECKMFLVKEEEEETLPDEHVGHNHADKQHKNSQQQTNKTAADKILSKPK
FT                   PTLIPAAQSNGDGNIKYVCPMHPHVVSDVPGTCPICGMDLEKVTIGGVGEEVVVGVSGG
FT                   MQQALGMRSEEVTQGTLWKLVKTIGTVEYNENAIGHSHTRVNGWIETLKVHNVGQRVKK
FT                   GQLLYELYSPELINAQDDYMQAMDYLKQDKDRGQALLRKARLRLELLGVSSDTIKQLER
FT                   TGKTIYRVPFYAEQDGFISKLTVRHGMYVQPGDTLFEIVDLSSVWVIADVFENEQSWLE
FT                   QGRPVEVTSAAQGLFDIESSIDYIYPELDPVSRAMRVRIKLDNPDKLLKPGTLVDVKLF
FT                   GGPKQEVLSIPTEALILTGRENRVVVQRDDNRFASVPVKVGMIAQGKAEIIEGLQVGDK
FT                   VIVSGQFLLDSEASIQGSLQRLSGSNSGSNSNSSAASDPHANH"
FT   gene            complement(338185..338799)
FT                   /locus_tag="Shal_0280"
FT   CDS_pept        complement(338185..338799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0280"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3536 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74856"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNV3"
FT                   /protein_id="ABZ74856.1"
FT                   /translation="MKTLISLALSALLFLSWTGTATANEHHNGAHKSQHAVQSQDYACP
FT                   MHPEVTGVKGDSCPKCGMDLEAAKTATKGHAKNCDSCPNKESCPNKANKHHQHMSKHTH
FT                   ACPMNPAITGKAGESCPKCGMDLEPIAKTDNAKNCDSCPNKESCPNKANKHHKHMSKHT
FT                   HACPMNPAITGQAGDSCPKCGMDLEPIATGDKATKSDHMHH"
FT   gene            complement(338945..339361)
FT                   /locus_tag="Shal_0281"
FT   CDS_pept        complement(338945..339361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0281"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3537 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74857"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNV4"
FT                   /protein_id="ABZ74857.1"
FT                   /translation="MLSIIRRHTLLAFTLLALLSQLVLSNGSLMVPSALADEMTMMSMQ
FT                   DGTGCHQVQMAEDTHCCDSDEQMQMLPGDSKHCCNGNGSCQSDCNHCLVISVTGTLFSV
FT                   SPWSGFNASEIAMATPMPHFHSISLPQDLRPPIA"
FT   gene            complement(339479..339898)
FT                   /locus_tag="Shal_0282"
FT   CDS_pept        complement(339479..339898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0282"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_0591 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74858"
FT                   /db_xref="InterPro:IPR018635"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNV5"
FT                   /protein_id="ABZ74858.1"
FT                   /translation="MKKFISVIALSLFSFTSSAASVSFPESIEVLAVNGLSKVNSQYLQ
FT                   LDEGQNLIELQYRDLFESNAEDSNWVRSEPLYLYIDLETAANYKAFTPSILSEEDAYQF
FT                   IDNPTIKLNDGMGSEKQVSLMTHGQLMTKLLLSKQ"
FT   gene            complement(340186..340620)
FT                   /locus_tag="Shal_0283"
FT   CDS_pept        complement(340186..340620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0283"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3539 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74859"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNV6"
FT                   /protein_id="ABZ74859.1"
FT                   /translation="MRKQIAYLAFFIVLVGQFILSPAMAMPKYLHASSHTYQHIESQSS
FT                   LVSTPPLITESNTLSDIADSQMNCASKVLNLTLVNIDCDALCEMLGASDCVSSCVSAPG
FT                   IVEQEQLPLTAQSSIASLQTIFWSLQTAELSSVNPPPISL"
FT   gene            341012..341575
FT                   /locus_tag="Shal_0284"
FT   CDS_pept        341012..341575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0284"
FT                   /product="NapC/NirT cytochrome c domain protein"
FT                   /note="PFAM: NapC/NirT cytochrome c domain protein; KEGG:
FT                   slo:Shew_3540 NapC/NirT cytochrome c domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74860"
FT                   /db_xref="GOA:B0TNV7"
FT                   /db_xref="InterPro:IPR005126"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR024717"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="InterPro:IPR038266"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNV7"
FT                   /protein_id="ABZ74860.1"
FT                   /translation="MNWRALFKPSAKYSILALLVVGIVVGVVGYFATQQTLHATSTDEF
FT                   CMSCHSNHSLKDEVLASPHGGNSFGVTVQCQDCHLPHNPVKYLIKKIVVSKDLYGYLTI
FT                   DGFNTQEWLDANRKEQADLALKYFKGNDSANCRHCHTRIYENQPESMKKMAKRMHANNF
FT                   KKAEDKRKTCVDCHKGVAHVYPKG"
FT   gene            complement(342009..342293)
FT                   /locus_tag="Shal_0285"
FT   CDS_pept        complement(342009..342293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0285"
FT                   /product="protein of unknown function DUF1145"
FT                   /note="PFAM: protein of unknown function DUF1145; KEGG:
FT                   spc:Sputcn32_0287 protein of unknown function DUF1145"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74861"
FT                   /db_xref="GOA:B0TNV8"
FT                   /db_xref="InterPro:IPR009525"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNV8"
FT                   /protein_id="ABZ74861.1"
FT                   /translation="MKAMLVLGKIVTAFAWLMMLYNLVSPFAGNIAVILNILFAMTIFM
FT                   HCFQTLIFHTMFKPLLPLKKSDYLQVFLFGVFSLLQYRKQVMDKQVQNG"
FT   gene            complement(342294..342914)
FT                   /locus_tag="Shal_0286"
FT   CDS_pept        complement(342294..342914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0286"
FT                   /product="putative methyltransferase"
FT                   /note="TIGRFAM: putative methyltransferase; PFAM: conserved
FT                   hypothetical protein; KEGG: shm:Shewmr7_3848 putative
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74862"
FT                   /db_xref="GOA:B0TNV9"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNV9"
FT                   /protein_id="ABZ74862.1"
FT                   /translation="MVKKRPSSGQVRIISGQWRSRKLPIHDLEGLRPTTDRVRETLFNW
FT                   VANDIRGARVLDCFAGSGALSLESLSRYASYAKIFELQVQAAKQLVANLATLKCDNADV
FT                   IKGDSLALLANKPSEGFDLVFIDPPFRKSLAEKSISLIDQHQWLNDDALIYVETESEIA
FT                   MLTVPGSWSLLKEKKAGQVIYRLYQYSAESALDETTCDTEETN"
FT   gene            343140..344933
FT                   /locus_tag="Shal_0287"
FT   CDS_pept        343140..344933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0287"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /note="KEGG: sbm:Shew185_4164 signal recognition
FT                   particle-docking protein FtsY; TIGRFAM: signal recognition
FT                   particle-docking protein FtsY; PFAM: GTP-binding signal
FT                   recognition particle SRP54 G- domain; GTP-binding signal
FT                   recognition particle SRP54 helical bundle; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74863"
FT                   /db_xref="GOA:B0TNW0"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNW0"
FT                   /protein_id="ABZ74863.1"
FT                   /translation="MAKKGFFSWFRKDKSNEEAQAVEAAKLEAEKLELEEAEKLELERA
FT                   EAERLAAEQAETERLAEEARLAVEQAEAERIESERVEAERHAAEQAEAQRVAEETAAEQ
FT                   ARLAAELAAQAETQRIEAERLESEREAAEQAEGQRIEAARLESERVIAEQAEAQRVATE
FT                   QASQAEAARIEAERIEAARIESERVVAEQAESARIAAEQAEAQRIEATRIEAARIEAER
FT                   IEAARIEAARIEAARIEAERIEAERIEAERIEAERIEAEAADQAAQLEAAEEQQPEPQA
FT                   KPVKEGLFARLKRGLKRTSESIGSGFIGLFSGKKIDDDLFEELEEQLLIADVGVETTTR
FT                   LIKNLTEQASRKQLKDGEALYELLREEMQKTLEPVSVPLVPENADGPFVILMVGVNGVG
FT                   KTTTIGKLAKQYQAQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVL
FT                   FDALQAARARKVDVLIADTAGRLQNKAHLMDELKKVVRVMKKQDETAPHEVMLTLDAST
FT                   GQNAISQAQLFQEAVGVTGITISKLDGTAKGGVIFAIADKFGIPIRHIGVGEQIDDLRT
FT                   FDAKDFIEALFSQTKDDKDAK"
FT   gene            345005..345706
FT                   /locus_tag="Shal_0288"
FT   CDS_pept        345005..345706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0288"
FT                   /product="cell division ATP-binding protein FtsE"
FT                   /note="KEGG: slo:Shew_3605 cell division ATP-binding
FT                   protein FtsE; TIGRFAM: cell division ATP-binding protein
FT                   FtsE; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74864"
FT                   /db_xref="GOA:B0TNW1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNW1"
FT                   /protein_id="ABZ74864.1"
FT                   /translation="MIRFEQVSKVYPGGQKALSDVSFHLKRGEMAFLTGHSGAGKSTLL
FT                   KLITVIERANGGRVSINGHDIAKVTRSQVPYLRRDIGMIFQNHHLLMNKSVFDNVALPL
FT                   IIEGFSIGEIRKRVAGALDMVGLYGKERHNPVMLSGGEQQRVGIARAIVNKPPLLLADE
FT                   PTGNLDPKLSMDILRLFETFNDAGTTVLIATHDLGLIARMKYRTLTLKQGRVLGAEELN
FT                   AHDHFGRAEDK"
FT   gene            345706..346671
FT                   /locus_tag="Shal_0289"
FT   CDS_pept        345706..346671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0289"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   slo:Shew_3604 protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74865"
FT                   /db_xref="GOA:B0TNW2"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNW2"
FT                   /protein_id="ABZ74865.1"
FT                   /translation="MSQQPQLNRSKLPFSGRIVMFFIRHIQHAMASLGELWRNPISSIM
FT                   TMAVLGVSLSLPAALQVLVKNAETITESWNSAAEISLFIDEGRSETVIQSLITRLKVYP
FT                   EVSDVNYIDRDQALEEFQRLSGFGEALSYLDSNPLPAVVMVTPSLKYSSPAGARELLRK
FT                   LEQEPEVSFGRLDIEWLERLQAVVKLLERTVLAIAALLVLAVVLVIGNTIRLAIMNRRS
FT                   EIEVMKLVGATEAFIQRPFLYTGIWYGVIGGILAWVIINLLVWYLDSALVELLGLYGST
FT                   LHLESLTFGELGQLVLLASFLGWLGSYLSVRQHLRAIEPS"
FT   gene            346897..347754
FT                   /locus_tag="Shal_0290"
FT   CDS_pept        346897..347754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0290"
FT                   /product="RNA polymerase, sigma 32 subunit, RpoH"
FT                   /note="TIGRFAM: RNA polymerase sigma factor RpoH; RNA
FT                   polymerase sigma-70; PFAM: sigma-70 region 2 domain
FT                   protein; sigma-70 region 4 domain protein; KEGG:
FT                   slo:Shew_3603 RNA polymerase, sigma 32 subunit, RpoH"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74866"
FT                   /db_xref="GOA:B0TNW3"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNW3"
FT                   /protein_id="ABZ74866.1"
FT                   /translation="MTVQTQTMALMVPQSSGSLESYVHSAHNIPMLEADTEYELAKRLQ
FT                   ETGDLQAAKQLIMSHLRFVVHVAKGYSGYGLPQADLIQEGNIGLMKAVKRFDPDVGVRL
FT                   VSFAVHWIKAEIHEYVLKNWRIVKVATTKAQRKLFFNLRKAKKRLGWFSDSEVGMVADS
FT                   LGVSKADVTEMESRMAAQDPAFDLASDNDDEHDYAPMHYLEDHSSDLASQVESDNWEQN
FT                   NQARLLSAIKTLDERSQHILKARWLDEDKTTLQDLASTYQVSAERIRQLEKNAMSKLKG
FT                   CMEV"
FT   gene            complement(348691..349050)
FT                   /locus_tag="Shal_0291"
FT   CDS_pept        complement(348691..349050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0291"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppr:PBPRA1981 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74867"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNW4"
FT                   /protein_id="ABZ74867.1"
FT                   /translation="MSLADTVQRGWEAVAAGDFDKLVADYVEEMVFIMPGQTDILEGRT
FT                   AFRSALDSLGDLLPLGFEITDLRQIEGDNEVVSIVAWKSEKVSGSQFSVLFKFVDGKIY
FT                   EERWFVDTEQWKAAL"
FT   gene            349416..351221
FT                   /locus_tag="Shal_0292"
FT   CDS_pept        349416..351221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0292"
FT                   /product="Proprotein convertase P"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; Proprotein convertase P; KEGG: vha:VIBHAR_05576
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74868"
FT                   /db_xref="GOA:B0TNW5"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR002884"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034182"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNW5"
FT                   /protein_id="ABZ74868.1"
FT                   /translation="MKGNNMTLKLSKCSLALLPLMLSTVSYAGESDPLYKHQWHLKNTG
FT                   QAAFSENGGKAGNDLKTKQAHKKGALGQGVQISVVDTGLQIDHIDLADNVVPGSMDLIT
FT                   GSDYPEDTHGHGTAVGGIIAAVGFNGEGVRGIAPKAGINGFNFLFEQSMNSWLLSHGYG
FT                   EGTENTELFNQSYGSQALFIPQFDLENDPQLAIENAVMEDVASNSNNGRGAAFVSSAGN
FT                   SYNYYGYAGYYFLPADYFDVEASNHGLPMQNSNMTNSKATHWSTTVSAINANGERSSYS
FT                   TVGANVFMAATGGEYGSETPAMVTTDLMGCDSGFNDSTGLGKNGLHGGTADDPNCNYTS
FT                   VMNGTSSAAPSMVGAIAAVMSANPQLTTRDAKHVLALTAKKTDPNNKGVTLTFTDINGN
FT                   LVEYPAIDGWQKNDAGFDYHLFYGLGRPNVSKAVQLVRHESEDDLEDIKLPPQLVSQWH
FT                   AKAVNVEVPDVDPNGGTASLEIDLDDFVIEGVEVLVTIDHPRVTDLAIELISPEGTRSV
FT                   LMTPRNGMYGQAFGGDAYVNKLLSSTHFYGEEAEGDWTLKVVDTGGEGDGEFIWYPVEN
FT                   VTQANNVSPGIIQNWSVRFIGHEED"
FT   gene            351225..351701
FT                   /locus_tag="Shal_0293"
FT   CDS_pept        351225..351701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0293"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vha:VIBHAR_05575 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74869"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNW6"
FT                   /protein_id="ABZ74869.1"
FT                   /translation="MKKTIMLMAIFAISSQAFASVTKELPIVVTQDYSTIGTVYLQGEK
FT                   FQKVVKDEAKGGPAMMQRAFGPVELFAGDMIKGGQVSKVATLNGKFFLSLKNEADIEAI
FT                   AKSHGLGVEFTKGKLAILKAPQDMELSALLDILSNDARVSMVNLEQITNEMAPE"
FT   gene            complement(352696..354228)
FT                   /locus_tag="Shal_0294"
FT   CDS_pept        complement(352696..354228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0294"
FT                   /product="O-succinylbenzoate-CoA ligase"
FT                   /note="TIGRFAM: O-succinylbenzoate-CoA ligase; PFAM:
FT                   AMP-dependent synthetase and ligase; KEGG:
FT                   shn:Shewana3_3968 O-succinylbenzoate-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74870"
FT                   /db_xref="GOA:B0TNW7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR010192"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNW7"
FT                   /protein_id="ABZ74870.1"
FT                   /translation="MDLCMQTKTLSPIHRVALRSSTSVAYRLMGQSVSYGALSQSAIAL
FT                   AEQLSAMGLKRGDRLACIAHNCPQLLQLYWACVDSGIIFCPISPRFTANQVVELMQSHN
FT                   YHHYWLEASQQSDSSLIDTLNRQPQLKAISLVFNPSLQAQQTSEKAQLTSEKAQLTVEP
FT                   APVLEPHIAVNAILTSGSSGTPKAAAHSLANHIASAAGSSELIKLAAEDSWLLSLPLFH
FT                   IGGLAILNRCALAGACVVFEDKSLSLAEQLTRDRVTHLSLVSAQLQQLLNINGDSENNA
FT                   KSDCLSQVKAMLLGGGAISADLLTELAKRNIKAYTSYGMTEMGSQITTGIACTDGSSGK
FT                   LLSGRELKIIESEIWVKGDCLFLGYLTAEGFNQPIDKDGWFYTKDLGHFDDNGNLCIDG
FT                   RADNMFISGGENIQPEEIEAALKLHPLISDAIVFPIIDAKFGNLPAAILKLVSGTSNDQ
FT                   EQLPSEAELTAFLASKIARFKRPRRYYPWPEVSSAGIKVIRKQVIAAVNLAK"
FT   gene            complement(354351..355412)
FT                   /locus_tag="Shal_0295"
FT   CDS_pept        complement(354351..355412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0295"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: sbm:Shew185_4159 O-succinylbenzoate-CoA
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74871"
FT                   /db_xref="GOA:B0TNW8"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNW8"
FT                   /protein_id="ABZ74871.1"
FT                   /translation="MTATLQQAKPLTLARLGLYQFAIDLDKPLPVGKQRIEQRRGLVLV
FT                   AQTQERQEWVEISPLCGVDNQGETISGFSQETLEGVSQQLLNLLPELQQQPIDCLLTLA
FT                   EQSKLPSLAYGLSLMHAKLMGKLDGHTLTARTVPLIYRQADESLSLVANRVSALPETIL
FT                   SVKVKVAQDSLKDELQLIHHILAIRPKLKLRLDANRGFSLEQAIEFAACVPLDSIEYIE
FT                   EPCQNPQDNRAFYQAIKMPWALDESLNSPDYQFSMQSGLSALIIKPTLLGSLEKLQQLI
FT                   DTAAEHGVRTVLSSSLEASLGIEAISRLAQIFTPDETPGIDTLGAFSQDLLVSSGKEYC
FT                   LKLEELTPLLELS"
FT   gene            complement(355431..356282)
FT                   /locus_tag="Shal_0296"
FT   CDS_pept        complement(355431..356282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0296"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   she:Shewmr4_3768 alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74872"
FT                   /db_xref="GOA:B0TNW9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022485"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNW9"
FT                   /protein_id="ABZ74872.1"
FT                   /translation="MLSYRCRGQIGSPAVVLLHGFLGSKEDWNEIIEQLADDFFCISID
FT                   LPGHGGHCSHNSHGDTTQASGNNQLDFTSQSLELPTPGFNRCAELIHTTLEQLNISQYH
FT                   LVGYSLGGRIALHLARLYPQALLSLCLESCHPGLQNQADRVARKANDLAWASKLETLSI
FT                   RDFLSLWYQQAVFSDLTEAERAKLIDKRADNRPLQLLNCYLATSLAEQQDLWDTPSCLP
FT                   VDCHFIAGHQDHKFMALAKRWQQQQPLSLHCIEASGHNVHLAAPEAFAEQLKTIFASNS
FT                   NF"
FT   gene            complement(356282..357991)
FT                   /locus_tag="Shal_0297"
FT   CDS_pept        complement(356282..357991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0297"
FT                   /product="2-succinyl-6-hydroxy-2,
FT                   4-cyclohexadiene-1-carboxylic acid synthase/2-oxoglutarate
FT                   decarboxylase"
FT                   /note="KEGG: slo:Shew_3599
FT                   2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic acid
FT                   synthase/2-oxoglutarate decarboxylase; TIGRFAM:
FT                   2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic acid
FT                   synthase/2-oxoglutarate decarboxylase; PFAM: thiamine
FT                   pyrophosphate protein TPP binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74873"
FT                   /db_xref="GOA:B0TNX0"
FT                   /db_xref="InterPro:IPR004433"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR032264"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TNX0"
FT                   /protein_id="ABZ74873.1"
FT                   /translation="MQTEHTAELNLLWGTLILEELARLGVKHVCMAPGSRSTPLTLAAA
FT                   KQSKLSQHIHFDERGLGFMALGLAKASQAPVAIITTSGTAVANLYPAIIEAWLTHVPLI
FT                   VLSGDRPPELIDCGANQAIIQPAIFAQYAKQLNLPTPDLNIAPQALLSLLDDAVCNQSQ
FT                   PVHINCMYREPLYPNEPSVDFSRYLAPIAKWQQQTKPYSQFATMNSGQMPTSDALARFV
FT                   HGKGVIVAATLAPEQQSEELIVLAQKLGWPIVTDAQSQLRQHGGAIGNIDQLLQQPKSK
FT                   ALLAQAEKVLVFGGRILSKRLISYLNDQDWKDYWQVLPQQQRLDPSNKPKQVWIAPAHQ
FT                   FAALAWPRSSQANWALNLVQFNDELETLYQQQIDHAEFGEAQAIRAIAKRQTNEQQLFI
FT                   GNSLPIRLYDMFAPITTSSANVFTNRGASGIDGLLATACGVAIAGAKPTTLIIGDISAL
FT                   HDLNSLAIARTVTSPFVIVILNNDGGNIFNLLPVPNEQLRSDYYRLSHGLEFGFGAAMF
FT                   GLAYNQVDSLSDFIESYEYAMTYSGPSVIEVTVAQNQASEQIAQISSWVKQS"
FT   gene            358237..359208
FT                   /locus_tag="Shal_0298"
FT   CDS_pept        358237..359208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0298"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; KEGG: saz:Sama_2899
FT                   transcriptional regulator-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74874"
FT                   /db_xref="GOA:B0TNX1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNX1"
FT                   /protein_id="ABZ74874.1"
FT                   /translation="MRKELSKLDYFTLKVFIGLVEFKNGSVVAQKLDTTQPKVSRALSN
FT                   MREVIHDELFVRRQYGVEPNIMADKLYPIAKSIVQAYEQMADVTAQLPEKNQLIIAAQE
FT                   HLAGFLVDSISEVCQRQGLEISVSIQAWSDNVQELLAQGKIDYAITVNSTQSESVRNFK
FT                   IGDVKNYFLAARKAHPFFDKEVSLSRLLENKLVFINYAKVGLIEHWFERYTKDHSLDIK
FT                   MSFKTTSLAMALNHVAKTDDICWTASIFSYLYFNSRSDIDYIDVTDFYEKVLFPNGDFA
FT                   SYSYYLQYHQSHDNDFSTALSKLLQQSLALAQEQYEQQSMAN"
FT   gene            complement(359276..360241)
FT                   /locus_tag="Shal_0299"
FT   CDS_pept        complement(359276..360241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0299"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: shn:Shewana3_3964 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74875"
FT                   /db_xref="GOA:B0TNX2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNX2"
FT                   /protein_id="ABZ74875.1"
FT                   /translation="MRDISFSDLDLLSINILVNLYEHKSATFVSHKLNVPAPKISRCLK
FT                   HAREVFGNELFIRKKHGLVPNEFAAKVYPIAKEIIECSKNLQKLNGIHELSPTHHFEIV
FT                   APDLISYPFPKVLLNAIKNAGKEVSFNIAPWTKSSINDIINGEVDLGLCCSKMLDSIKD
FT                   TDDSLNAIPLKKLNKVFLVCHHEHPILKEEITLESIAGYPFINSNMGQSELEQSPFQEF
FT                   CQSQQIKLITEMNLTGLTGLFEYLRSSQGIALLPYSSIFTMINNTPDLHACRLSDVESE
FT                   RLYMHVKEPYLYLVYSDSNKDPNLRWLSSEVKELVELLLH"
FT   gene            360798..361289
FT                   /locus_tag="Shal_0300"
FT   CDS_pept        360798..361289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0300"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3155 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74876"
FT                   /db_xref="GOA:B0TNX3"
FT                   /db_xref="InterPro:IPR024402"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNX3"
FT                   /protein_id="ABZ74876.1"
FT                   /translation="MSASVMLSYAFMYFVLFLVVPFVLATFAMTCIKFFKSTEFVASNI
FT                   KLKPNSLGDQSVSFINKLNDLVVGKYNVLYGTTLDSLCDVDKNEKEQDAHSYLQGCHLD
FT                   YVLVDSESSAVKLVITDPQHNSEENNRFIDDTLAKMGVKVLHLAKNDCDANLIKSSLVA
FT                   "
FT   gene            361373..361843
FT                   /locus_tag="Shal_0301"
FT   CDS_pept        361373..361843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0301"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: saz:Sama_2902 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74877"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR023155"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNX4"
FT                   /protein_id="ABZ74877.1"
FT                   /translation="MSSLFKYLASVLISILLVVAASTAPIKAIAAEFEINKNKQCIMCH
FT                   KRNGIMHGVHANDALDIRCQDCHGEKEGHPRKASNLIGFSNKPTSDANAQTQSCLKCHD
FT                   HSVLAERDWSHDAHSNKVNCASCHLLHPNTDPVLGVSAKERSELCSSCHVAK"
FT   gene            361857..362540
FT                   /locus_tag="Shal_0302"
FT   CDS_pept        361857..362540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0302"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: she:Shewmr4_3763 twin-arginine translocation
FT                   pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74878"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNX5"
FT                   /protein_id="ABZ74878.1"
FT                   /translation="MSNSRRLFLKGACAAAVGASGFTIAMARSTTSGDVEPACNYALVH
FT                   DETKCIGCDACSIACREVNQVPEGVSRLEIEREGPFGEYPNQHFRFTRKSCQHCDDTPC
FT                   VKVCPTGAAYKDPKTGIVSVDEWKCVGCQYCIAACPYQIRFINPVTKAADKCDFCKETR
FT                   LKEGQLPACVTACPTKALTFGDITDPQSQVVQVLKSTPSYRSKTDLGTRPKVFRIASQS
FT                   GEIKL"
FT   gene            362537..363478
FT                   /locus_tag="Shal_0303"
FT   CDS_pept        362537..363478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0303"
FT                   /product="Polysulphide reductase NrfD"
FT                   /note="PFAM: Polysulphide reductase NrfD; KEGG:
FT                   shw:Sputw3181_3893 polysulphide reductase, NrfD"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74879"
FT                   /db_xref="GOA:B0TNX6"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="InterPro:IPR017566"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNX6"
FT                   /protein_id="ABZ74879.1"
FT                   /translation="MSPFHFDSLIWHWPIAIYLFLAGVSAGAICFAVLLKHFKLGRDAY
FT                   KSGFVQAACLIAPLAVFAGLGILVIDLTKPFDFWKILLFYNPTSVMSVGVAVLMVYQVA
FT                   LFAWLACVFKEPALSWCSGRWPVVEKLFNAIAKHEATITGFLVMLALSLGAYTGFLLSA
FT                   LTTYPMLNNPVLPLLFLVSGLSSGAAGTLLGGVLLKGNPDGKEVHFIHNIEIPMILVEI
FT                   VLIFTFFAGLILTGGQSQVAAFTAIGEGFWGWIFWAGIVVVGLSMPLAFNLFMKASSKR
FT                   KFSYVAITASCSLIGVLLLRNFILYTGQMTVA"
FT   gene            363500..363790
FT                   /locus_tag="Shal_0304"
FT   CDS_pept        363500..363790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0304"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_2184 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74880"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR012286"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNX7"
FT                   /protein_id="ABZ74880.1"
FT                   /translation="MLKVLGLTVLLSFSGAAMATSVADSHTEMAGCESCHQDGAPSADM
FT                   AYENETCVSCHGSLKDLDGEMHQQHDGIITCSDCHVVHGEASANDSCASCH"
FT   gene            complement(364043..364504)
FT                   /locus_tag="Shal_0305"
FT   CDS_pept        complement(364043..364504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0305"
FT                   /product="protein of unknown function DUF1332"
FT                   /note="PFAM: protein of unknown function DUF1332; KEGG:
FT                   shw:Sputw3181_3890 protein of unknown function DUF1332"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74881"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:B0TNX8"
FT                   /protein_id="ABZ74881.1"
FT                   /translation="MIAKLKQFFANPHTQLSDEERAEHLKLAAASLLLEVVMADETMSE
FT                   QEAKLLPSLLTTTLNLASDDVHGLVHDAKTSQQNSISLYEFTQAVNDNFDIDQKQQLIL
FT                   AMWRLAYADGHLCQYEDQIIRRTAELLYLRHSELIQMRNIAMEQQANPS"
FT   gene            complement(364606..365124)
FT                   /locus_tag="Shal_0306"
FT   CDS_pept        complement(364606..365124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0306"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3594 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74882"
FT                   /db_xref="InterPro:IPR021302"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPL1"
FT                   /protein_id="ABZ74882.1"
FT                   /translation="MKLITATLFTMTALLSMPTNAGILDQLAQATEPAKVQTQQAQSND
FT                   LVGAVMSQLGLSQTQAEGGLGSILSLAQSTLGSSDFSSISDSIPGIDGLLSAAPELDSD
FT                   SGMSGLLSKAGDLGQSLQGGAMVYDAFEKLGISKELAAPMVDIVKSYLDTNGSAGTSNL
FT                   LMKGLNSIL"
FT   gene            365308..366054
FT                   /locus_tag="Shal_0307"
FT   CDS_pept        365308..366054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0307"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3593 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74883"
FT                   /db_xref="GOA:B0TPL2"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPL2"
FT                   /protein_id="ABZ74883.1"
FT                   /translation="MPLSAILTQAFNFFRNNISQLAFLFVPILFVQVGIQLWLSLEISA
FT                   ADLENPQFGTSHMVAMMVLLLVFSFLIAALTLFLEIRSQGHSPSNAMILKTALNFVPAL
FT                   LLAGVFSGLAVLAPVFILMAVNPTLGIIGLVGSIYLFARLAFVNFMVVVERLTPMEAIK
FT                   RSFSFSGPIALKTIVVLLLYIPLSLLGGLLVQITQLGGMPVQLIGEVIVAFFGLFVNVA
FT                   LFRLYMVSRPTPETPGNIVQDDESSK"
FT   gene            366178..367602
FT                   /locus_tag="Shal_0308"
FT   CDS_pept        366178..367602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0308"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="PFAM: Sel1 domain protein repeat-containing protein;
FT                   KEGG: slo:Shew_3592 Sel1 domain protein repeat-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74884"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR025285"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPL3"
FT                   /protein_id="ABZ74884.1"
FT                   /translation="MLNDIEFVNLFSAELGADYRKAKSYVKDVPTQALLHVRSFSHKLT
FT                   SLLAEPKKVQFESPNLYDRIEQLNQRRLIDVKTTRALHKLRGDGNRGAHPEKYHLTPEQ
FT                   LQQLSERSIKHLLSLVESLFVTVTKQDKPDYYFEEFDSLAGRDLCYRAVMERDPESQYL
FT                   VGMSLKTRALMQREQELALQDSGDDAVEDRSTASLKQASYWFEQASTKNLNALYEHGVA
FT                   LIHGYSGETNVIAGELAIAKAADAGIANAMALLGYFYLVGSEQFSVELNQAEKFLSQAA
FT                   KLEQSEAMANLGVLYYQQDNLPAAYKYINRAAQAGFPQAQYHLALMLARGEGCKQDAIK
FT                   SAYWMAEAAEQGQNDAMLSCAQTMLHDDNALGQDLSQAESYLREVIKYGHSVPAMIELS
FT                   IALADGILGHIDVVSAAALLKMARERANQTELDVILPLWESLALQVDTVLEMTESPQER
FT                   LSLNKAAELLSEPQIS"
FT   gene            367748..369025
FT                   /locus_tag="Shal_0309"
FT   CDS_pept        367748..369025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0309"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3591 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74885"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPL4"
FT                   /protein_id="ABZ74885.1"
FT                   /translation="MPHFDTEQVEQGCAKFLPFEAQQQALNQFAERYIKLVLAVGQHDC
FT                   YYVDAYYGPEEWQKETYWQPLADLQSQYLQGSELIEAMAVRLSEPELVERHQFLQTQWL
FT                   SIGAYLALLQGKEYSFNEEAVALYDCHLTPYSLLEHQQVLADIEALLPGEGSLTNRYNQ
FT                   FKSQFIVPKDKAAEVFTASVDIARKLTSMHMHLPENESFEIEYVNDKVWTAYNWYKGDS
FT                   HSLIQLNQDQPLGIERYLELASHEGYPGHHVFNVLQEQKLVKAKQWLEYAIYPLYSPIS
FT                   YLSEGSANYALSLIMSDDEVVDFERDVLMPLAGLEGDLALFHQILKLVKKLGYYENYVS
FT                   QCLTDKLVDAEMAQKMLIDGALYPQSRAKQRVQFFERNRSYVINYSVGEDAVAAWVEAK
FT                   AETTVEKWTRFESILSRPLNASDMLV"
FT   gene            complement(369050..369382)
FT                   /locus_tag="Shal_0310"
FT   CDS_pept        complement(369050..369382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0310"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3590 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74886"
FT                   /db_xref="GOA:B0TPL5"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPL5"
FT                   /protein_id="ABZ74886.1"
FT                   /translation="MIYSQFQHNPMQNRFSGTRGWLAFVIGLAFMTLALVALPFLLLFG
FT                   AITFVALSLFGRVFLKRQLARFQKQQATQEFHCQGEEFQEAIYKEVPTSAPRQGRTFEH
FT                   NPNEPV"
FT   gene            complement(369540..370508)
FT                   /locus_tag="Shal_0311"
FT   CDS_pept        complement(369540..370508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0311"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: slo:Shew_3589 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74887"
FT                   /db_xref="GOA:B0TPL6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037402"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPL6"
FT                   /protein_id="ABZ74887.1"
FT                   /translation="MKLENLARIDLNLLVILQVLLEEQSVTRAANRLHVSQSALSKSLN
FT                   RLRETLGDPLFLRTAHGLKPTAHAVQLGKILPQSLLSLYQLTLPPSFTPGNSTRQFSFA
FT                   MVESAYETLIPYFIGTLLNRAPNLKLDSFVWSENSIQAIQQGQIDFGIAGRDLHPQSAF
FT                   QVNRLPEGIAHQTLFTDHQVCLVRQKHPMLSTIAAGHWDLSVYLEMSHVQVRCEGNDWW
FT                   ALDYHLAELGHHRRLSTIVPDFYGAASVCAHSDLIFTLPASFAQHAKKLYPLVELPLPI
FT                   EFIPQAYVLLWHERNADEPGHRWVKEIICESVAKALSSNKS"
FT   gene            370609..371811
FT                   /locus_tag="Shal_0312"
FT   CDS_pept        370609..371811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0312"
FT                   /product="drug resistance transporter, Bcr/CflA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, Bcr/CflA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   shn:Shewana3_3948 drug resistance transporter, Bcr/CflA
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74888"
FT                   /db_xref="GOA:B0TPL7"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPL7"
FT                   /protein_id="ABZ74888.1"
FT                   /translation="MRRSLLPILLPMVILSPLAIDIYLPSMPVMAAEFSVSASEIQSTL
FT                   VLFLFAMGTGQLLIGPLADRYGRRPVAIGGIIFYMISSVLAAIAVEFHWLQIARVMQGL
FT                   AACSTSIVVFSAVRDCFSPKEGARYYSYLNGMICIIPALAPTLGGMLALQFGWRSNFIF
FT                   MALYGLVILALVSLRLPETRPQNTVSDGPLYRWARYKPVITEPHFLFYAISCMAGMAAI
FT                   LCYVSYAPVWLIGHLGVSELTFSGLFGLNAVVNIIACFTAPLVIKKLGNRPTVILALVL
FT                   MLVSAVTQVVVQLVGPQTGLMAAYSYMLPMMLLCIGFALLLGPATSMALSAFGERAGTA
FT                   TAMLGFIQMSGASLLTALVQQTSLPAPYAVALLMGTGTIALLAMMAMPKFDHWHQEQHA
FT                   Y"
FT   gene            371981..372574
FT                   /locus_tag="Shal_0313"
FT   CDS_pept        371981..372574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0313"
FT                   /product="DTW domain containing protein"
FT                   /note="PFAM: DTW domain containing protein; KEGG:
FT                   sbm:Shew185_4137 DTW domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74889"
FT                   /db_xref="InterPro:IPR005636"
FT                   /db_xref="InterPro:IPR039262"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPL8"
FT                   /protein_id="ABZ74889.1"
FT                   /translation="MSRPTCPNCHYPQNACLCASIETMQVKSELIILQDPSEVGHAKNS
FT                   VRLLELVIAETRVVVGETADDFAALRQQLAASEKPVYLVYPSENSISANETKVEEEVIL
FT                   LLLDGTWRKAYKLLQLNPWLQDYPALHLDLDSASNYTIRKASRSDSLSTLEAAAMMLKA
FT                   IDEEQDVAPLTNALSAMVEQRLASMPADVRARYR"
FT   gene            complement(372829..374976)
FT                   /locus_tag="Shal_0314"
FT   CDS_pept        complement(372829..374976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0314"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="KEGG: sbl:Sbal_0199 diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC and GAF sensor(s);
FT                   TIGRFAM: PAS sensor protein; diguanylate cyclase; PFAM:
FT                   GGDEF domain containing protein; EAL domain protein; PAS
FT                   fold domain protein; SMART: PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74890"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPL9"
FT                   /protein_id="ABZ74890.1"
FT                   /translation="MSVLIWSKLYPRVSSSDPALSEQLSLWQHESESTALAIMQGHHFL
FT                   AASPAALSYFESLEQNFIHATPFDFSPRLQSSGRNSVEYGLQMIKKAAKGEVVSFNWLH
FT                   MSQQGKELPTVVTLHPAQLDDSRVILVSFRPIDRRKRSRMSISNGFEKLPKELMSITLE
FT                   DSAEAVYITNEDNLILAVNKAMCRICGYSAEHLLGKTPQNLKLELQLEDQAHDTPLKGR
FT                   GSWQGEVWKCRSDGSTFPAWQSCRRIYADNTVFFVNLFSDISEKKTLEAKLTQQAMYDK
FT                   LTGLPNRFHLIQILSKAINNIKRSPEMIGALMFLDLNGFKNVNDSFGHSTGDKVLQLVA
FT                   ARLEACCIENAEIARLGGDEFTLVLPECHNRQEIETFSELILSLFEAPFEINGQKFYLG
FT                   TSIGISLFPQQSDDPNQLLSMADTAMYSAKRSPNHVRFYNATIREAAEKKLHTLNDLRH
FT                   AQGLGQFSLAYQSIVDLESNDIVAVEALLRWTQSHGEIIEAQDFIPLLEEAGLMVNVGQ
FT                   WALEQACTQMLKWHQEFDSSLKISVNISRSQLEHPDFIPMLKGLLTRTQLPANALIIEI
FT                   TERTFIRRPKLMTKVLVQLKEMNVAIAIDDFGAELSSLARLSSLPIDSLKIDAGFAQRV
FT                   DNKQGQKLCKAIMQLAQTLEIDFVVEGVETQAQRDLLLSLGKGMGQGYFFDRPVIAESF
FT                   TLELLSPIYATPQTRYRVLGR"
FT   gene            375346..375738
FT                   /locus_tag="Shal_0315"
FT   CDS_pept        375346..375738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0315"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3584 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74891"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPM0"
FT                   /protein_id="ABZ74891.1"
FT                   /translation="MAIQKIILTSQSLAIIVIMFVSLNVEAVEAEPTINSGHSLSEQAE
FT                   KTKYRVEQEQLQKARDAAKSREERETKVLERQESGDWEGEQKEKAQKQFKQRGTLQEKY
FT                   LREAREAASSERKIPKPFNSELLRNK"
FT   gene            375754..376389
FT                   /locus_tag="Shal_0316"
FT   CDS_pept        375754..376389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0316"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: slo:Shew_3583 methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74892"
FT                   /db_xref="GOA:B0TPM1"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPM1"
FT                   /protein_id="ABZ74892.1"
FT                   /translation="MSICPLCQQPDLQAFHQDKFREYQRCDNCLLVSVPESFLLNTADE
FT                   KAVYDQHQNNPDDLGYRKFLSRALDPVLERVTQDAEGLDFGCGPGPTISVMAAEKGIKV
FT                   DNYDLYYCNDPQKLQKQYDFVTITEVIEHVADAKSLLATLDSLLKPSGLLVIMTKRAGD
FT                   LEAFSRWHYKGDPTHIRFYSTATFEWIAKHYGWTLEVLGNDVVLFTKS"
FT   gene            376477..377448
FT                   /locus_tag="Shal_0317"
FT   CDS_pept        376477..377448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0317"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bfs:BF1302 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74893"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPM2"
FT                   /protein_id="ABZ74893.1"
FT                   /translation="MRITRWTFIYSLWLCLSVTLSSVALAATSDSIAFLNRVDAAKVLT
FT                   QEDDFVRGISQFDMASRMKREDSPTKSEYLAFVAEQTLDWTPQERAAVTQAFNQLQPKL
FT                   SALKVGLPTPIEFIKTTGLEEGGAAYTRGQAIILQQKQLASEPRLPSLIAHELLHVFSR
FT                   FNPEVKQQLYQAIGYYPVGEISFPTSFAKQKITNPDAPINDFAIKVSHDDKWVWVVPIL
FT                   YSADKQYSLEKGGEFFDYLEFKFVIVGHDEQANILSYDPDNAQIVKVSEFKGFFKQIGR
FT                   NTNYIIHPEEIIAENFSLLMTGETELKSPKLLHKIEKVFLAQ"
FT   gene            complement(377522..378190)
FT                   /locus_tag="Shal_0318"
FT   CDS_pept        complement(377522..378190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0318"
FT                   /product="type IV pilus assembly PilZ"
FT                   /note="PFAM: type IV pilus assembly PilZ; KEGG:
FT                   slo:Shew_3582 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74894"
FT                   /db_xref="GOA:B0TPM3"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="InterPro:IPR009926"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPM3"
FT                   /protein_id="ABZ74894.1"
FT                   /translation="MSSEKDFNTLDNLTCNTEVHLQLLTPTKTIRLRSRLIGVDPGRAV
FT                   ILAHGNDKSWRGTSAFITDRQSVIIRVVSSDEQDASILAFRSNIHQVISVLGRWIVINY
FT                   PKELQTLSLRQHSRIPINIKASLTAIESTEALSTGYLKDISIKGGAFVSEASGNFNVDS
FT                   QYRLKMDLDGEEESIAITIKNQQELDPSSRLAQYGFTLDADIEESEKVVQKAILHYLNQ
FT                   "
FT   gene            378480..379811
FT                   /locus_tag="Shal_0319"
FT   CDS_pept        378480..379811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0319"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   slo:Shew_3581 peptidase M16 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74895"
FT                   /db_xref="GOA:B0TPM4"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPM4"
FT                   /protein_id="ABZ74895.1"
FT                   /translation="MKRYTKALLLSIGMLLAAPMVQATQAKDVQSFTLDNGMKIMVLED
FT                   SSIPNANMYLFWKVGSRNEVPGITGISHFFEHMMFNGSKKYGPKMFDRTMEAAGGANNA
FT                   YTTENLTVYTDWFPANALETIFDLEADRIESLDINEQMVESERGVVASERLTGLENSNW
FT                   RVLQEELKGAAFRAHPYSWSVIGHESDIAAWTLEDLTQYHKTYYAPNNAVVVIAGDVKL
FT                   AEVKKLADKYFAPIPAQTPPREVKTVEPLQKGERRVFVQKPSVSTPNVMLGYHIPATSN
FT                   ADYYALDLLSSILATGNSSRMYQGLVDKQVAIEVDTYMPMSFDPNLFYVMGVANPGVTA
FT                   PELEDAMISEINRVARDGVTAEELEKVKNIKLMGFYRAMETINGKANTIGTYELFFGSY
FT                   DKLFNAPEAYNKVTPEDIQRVAQTYLKRANRTVAVLAATEEADQ"
FT   gene            379808..381274
FT                   /locus_tag="Shal_0320"
FT   CDS_pept        379808..381274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0320"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   she:Shewmr4_3741 peptidase M16 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74896"
FT                   /db_xref="GOA:B0TPM5"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPM5"
FT                   /protein_id="ABZ74896.1"
FT                   /translation="MKKCNSTLIASTTLLQSKRLLTAMAVAGTLALSGCAATAESNKTV
FT                   DTGSFSVPAYQQVTLSNGLTVYMMPQREVPLITLDAIVRAGAVNDTTAGVAEMTAAGLM
FT                   LGAGGKSKLEIEQEVDFLGASLSSGAGKEGSYISSDFMAKDADKILPLIKDMLVSPDFD
FT                   GKEFDKLRQREIAGLSQSKESPRAVISRYFDKLVFSDHPYGNATSGNSDSLAELTIPQL
FT                   RAFHKSYYQPSNTAISVVGDFEPAQMQAKLETLFASWQDSEPVTRIDLSKGLPKLDEAD
FT                   VLLVDKGDAIETTFLIGGMGISRDNPDFVGLTVVNTILGGRFTSWLNDELRVNAGLTYG
FT                   ARSGFVPYSASGTFKISTFTKTATTKETIDLALKTYARLWEQGLDQATLDSAKAYVKGQ
FT                   FPPKYETSGQLAGLMSDMYLYGFDDAFINEFQAKVDGLTLEESKRLIDTYFPKENLQFV
FT                   IIGNAAKIAPIAKEYGKVKQVDITEVGFGG"
FT   gene            complement(381411..381872)
FT                   /locus_tag="Shal_0321"
FT   CDS_pept        complement(381411..381872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0321"
FT                   /product="RNA methyltransferase, TrmH family, group 2"
FT                   /note="TIGRFAM: RNA methyltransferase, TrmH family, group
FT                   2; PFAM: tRNA/rRNA methyltransferase (SpoU); KEGG:
FT                   sbm:Shew185_4126 RNA methyltransferase, TrmH family, group
FT                   2"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74897"
FT                   /db_xref="GOA:B0TPM6"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPM6"
FT                   /protein_id="ABZ74897.1"
FT                   /translation="MFHIALYEPEIAPNTGNIIRLIANNGCKLHLIEPLGFDLEDKKLR
FT                   RAGLDYADLANVTHHKNFEAFLEAMDGKRIMACTTKGSRPHSELTFKQDDVLLFGPESR
FT                   GLPADIIDSIPTEQRLRIPMMSTSRSLNLSNAVAIISYEAWRQLDYAGM"
FT   gene            382088..383020
FT                   /locus_tag="Shal_0322"
FT   CDS_pept        382088..383020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0322"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: sbm:Shew185_2285 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74898"
FT                   /db_xref="GOA:B0TPM7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037402"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPM7"
FT                   /protein_id="ABZ74898.1"
FT                   /translation="MDLAKLSRISMKHLITLHVMLDTLSVTASAERLCLSPSSVSKTLS
FT                   QLRLSLDDELFYRHGNKLVATPLARRLGPSVHQIINDMNQLMTKEAFNPADYEGRFSLA
FT                   MRESTFELLAVKFMAHVLTLAPNIRLDIFAKDSVGFEGLVKGSLDFILLPHDRSQPPIS
FT                   LHELVWETLINDEMVCLMKPAHPLATQAQISIEDYLSFSHIGISDADLNTPFFEMQLAQ
FT                   RARNRAVPISVADFGSAALLCYHSDLLFTCSRRWAETALQAQGLVTKALPLDYGEVAYS
FT                   LVWHKQSMNDPALRWLYQQLVEFTQMEFQ"
FT   gene            383624..384397
FT                   /locus_tag="Shal_0323"
FT   CDS_pept        383624..384397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0323"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74899"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPM8"
FT                   /protein_id="ABZ74899.1"
FT                   /translation="MDEIVELGLSLVDKYQHAGIFRKSCRIPNNIFGSADYLALVAYPS
FT                   IRSDEKRSNFKDAMLSALLKESCKTRGIRKADKTMLAQRLGLSKDMIWRDIDRAITGGT
FT                   KKDGGGTKKLIDRFHSYHVFRAYDSALSDDANLTFEQVLGEISTAYESQQSKVSDSETR
FT                   IENLKRTFRQSRPVLHLTWGLVESFKLKGWATDTGQLCYGVKPAIHDPSWLPEALDLAK
FT                   IVLGLQLVEYESAKLNGKRLRSHKFDPQEIIYIHF"
FT   gene            384811..385155
FT                   /locus_tag="Shal_0324"
FT   CDS_pept        384811..385155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0324"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: esa:ESA_02741 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74900"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPM9"
FT                   /protein_id="ABZ74900.1"
FT                   /translation="MSNDDDLMRMRLGALDSIDALNKDIYDDSDWKMGVLWFSALAPTS
FT                   RTGHAERHGVVYTTEEARLFYSKNDNPKNCLCSLSPTLVNVKTGEVLQTELVEKMLFAK
FT                   KTFMKSVLIE"
FT   gene            386672..386920
FT                   /locus_tag="Shal_0325"
FT   CDS_pept        386672..386920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0325"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vha:VIBHAR_p08260 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74901"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPN0"
FT                   /protein_id="ABZ74901.1"
FT                   /translation="MAKNSKRTTKQLASTAAKFLSDANSSKIKKHLSGSVLAQSRTTKQ
FT                   TGKKMESELSAILKSSKYDKDTKMLAASLLSQSNSSR"
FT   gene            complement(387341..388234)
FT                   /locus_tag="Shal_0326"
FT   CDS_pept        complement(387341..388234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0326"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; Radical SAM domain protein; KEGG: sfr:Sfri_1984
FT                   radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74902"
FT                   /db_xref="GOA:B0TPN1"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012839"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023912"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPN1"
FT                   /protein_id="ABZ74902.1"
FT                   /translation="MVRVATVNQIIPFSCVDGPGSRLVIFLQGCNFNCKNCHNPHTIDM
FT                   CDSCGDCVATCPVGALSLSLSEVTEAVITKPRVLWDSDKCTQCDTCLSTCPKQSSPKTR
FT                   QYSVPQMLELIRSQVHFINGITVSGGEATLQLPFIIELFQAIKASPDLKHLSCMIDSNG
FT                   YLSESGWEQVMPYLDGAMIDLKSWQQHTHHYITGRDNHRVFISLKLLAAEGKLYEIRLL
FT                   YIPRVSDFDNEINAVAGYLSQLPASVRVKLNAFQHHGVTGEARQWGTCSEQQMQQLAAQ
FT                   LSQRGVRNLVLPNVYL"
FT   gene            complement(388291..389814)
FT                   /locus_tag="Shal_0327"
FT   CDS_pept        complement(388291..389814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0327"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sbm:Shew185_2283 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74903"
FT                   /db_xref="InterPro:IPR016905"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPN2"
FT                   /protein_id="ABZ74903.1"
FT                   /translation="MTLQHRITQITRDPNLSPKQKSNFLALEAEASLPYMALSDAVTEA
FT                   KESGIICDMFEGNAPFKPRYVLPDYAKFLQNGSEYLELSPVQDLDEALNALTIIYHHVP
FT                   SVTNIPVYLGQLDDILLPFCQGLDPETIYRKLKLFWIMLDRTLPDAFMHVNIGPTDNIV
FT                   CRTILRVDAELKQIAPNLTFMYDPQITPDELLQIAASNICECSKPHIANYPLHANSFDE
FT                   KGFGIVSCYNSLPLAGGANTLVRINLKEVALKASSVDDFFNQVLPHYCQLTYELIEARA
FT                   KFLHEESNFFNSFLVKEGLIEESRFAPMFGIYGMAEAVNILLGTPSNHYGHNAAANELG
FT                   HKISKALDAIVKSTPVKYGYHGLALLHSQGGMNVDKDVTPGVRIPYGTEPNPIVHIQAL
FT                   AEHHQYYTSGISDILTIDETVKANPLAMMQLCKGALSLGFREFSANVASNDLIRVTGYM
FT                   IKLSDIASFKQAGSRTNTTWLGAEAAVNTKILERQPRVIAHEQSPTHAK"
FT   gene            complement(390068..391588)
FT                   /locus_tag="Shal_0328"
FT   CDS_pept        complement(390068..391588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0328"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: shm:Shewmr7_3772
FT                   aldehyde dehydrogenase (NAD(+))"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74904"
FT                   /db_xref="GOA:B0TPN3"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPN3"
FT                   /protein_id="ABZ74904.1"
FT                   /translation="MIYSKPGTADALINFKPQYQNFIGGEWVKPVNDLYFDNTSPVDGQ
FT                   VFCQVPRSGSVDIELALDAAHEAKDSWGKTSVTERANILLRIADRIEQNIEPLAIAETW
FT                   DNGKAVRETLVADLPLVVDHFRYFAGCIRAQEGSAADIDANTVSYHFPEPLGVVGQIIP
FT                   WNFPLLMAAWKIAPALAAGNCIVLKPAEQTPASILVLLELIEDLLPKGVLNVVNGFGTE
FT                   AGQALATSSRINKLAFTGSTQVGQHILKCAAESLIPSTVELGGKSPNIYFADVMDHEDE
FT                   YLDKAVEGMLLAFFNQGEVCTCPSRALIHESIYDKFIAKVIQRAKTIKQSNPLDTDTQV
FT                   GAQASQEQFDKILSYLDIGKDEGAEVLIGGNICKLEGEQSQGFYITPTILKGTNDMRIF
FT                   QEEIFGPVISVTTFKDEAEALAIANDTEYGLGAGVWTRDMNTAQRMGRGIQAGRVWINC
FT                   YHAYPAHAAFGGYKKSGIGRETHKMMLDHYQNTKNLLISYDANPLGFF"
FT   gene            391885..392865
FT                   /locus_tag="Shal_0329"
FT   CDS_pept        391885..392865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0329"
FT                   /product="Quinone oxidoreductase putative YhdH/YhfP"
FT                   /note="TIGRFAM: Quinone oxidoreductase putative YhdH/YhfP;
FT                   PFAM: Alcohol dehydrogenase zinc-binding domain protein;
FT                   Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   sbl:Sbal_0250 alcohol dehydrogenase, zinc-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74905"
FT                   /db_xref="GOA:B0TPN4"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014188"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPN4"
FT                   /protein_id="ABZ74905.1"
FT                   /translation="MFNALVLTQEEKLTHANVCQISETDLPEGEVLVDVACSSLNYKDG
FT                   LAVTGVGRIIRNFPMVPGIDFAGTVLESSDERYKVGDKVILTGWGVGENHWGGLAERAR
FT                   VKADWLVPMPTNCDAAKAMQIGTAGLTAMLCVQALQQAGIKPEDGDVLVTGASGGVGSV
FT                   AVTLLAQLGYRVVASSGRALQNGALLTKLGASEVIDRSELEVDSRPLEKQRWAGVVDTV
FT                   GNKVLATALAQMNYGGAAAICGLAGGFALPTTVMPFILRGVNLLGIDSVACPFEKRQAA
FT                   WEQVLNLLPASYFEDACETIALEQVPEFAQRIIKGQVTGRVLVQL"
FT   gene            complement(393275..394207)
FT                   /locus_tag="Shal_0330"
FT   CDS_pept        complement(393275..394207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0330"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: vfi:VF0021 transcriptional
FT                   regulators, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74906"
FT                   /db_xref="GOA:B0TPN5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037402"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPN5"
FT                   /protein_id="ABZ74906.1"
FT                   /translation="MELEEIYRQDLSLLIALQILVEERSVTQAAKRLHLSQSATSRILA
FT                   RLREMLDDPLFSRVGQQLVPTSFALECYQQLRQPTGQLIELLTPKAFVPEECQQQFSIA
FT                   VTDYAMQALVPFILPHIYQKAPQIRLEIVPVQQKELQAQLSVKGADMAICRAIGQTGNL
FT                   QHSFLGKVGVSCLLSPNHPLADSDISLEDYLHYPHATIAISDGVKALLDDAISQYPPRT
FT                   ELLRTPHLDTALALQSINPLIITLPEGMAAIAAERHCLRVKPLPFKLQSLDYNLFWHSR
FT                   CEQDKAQKWLRNEIIEATQSLLTQTPQNL"
FT   gene            394704..396224
FT                   /locus_tag="Shal_0331"
FT   CDS_pept        394704..396224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0331"
FT                   /product="flavocytochrome c"
FT                   /note="TIGRFAM: flavocytochrome c; PFAM: fumarate
FT                   reductase/succinate dehydrogenase flavoprotein domain
FT                   protein; FAD dependent oxidoreductase; KEGG:
FT                   spc:Sputcn32_3536 flavocytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74907"
FT                   /db_xref="GOA:B0TPN6"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR010960"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPN6"
FT                   /protein_id="ABZ74907.1"
FT                   /translation="MSNNNLLGRRNFIKGMGAAAGVAMAAPALAISEKADGVKWDQQVE
FT                   VLIIGSGFAGLAAAIEATRKGAKDVHIYEKMSYFGGNSAINGGLFAAPDTPMQKTEGVK
FT                   DSVDTMVADQLAAGRGIADEALLRHVAEHAVEALQMTLDAGSEYHPYLQQLGGHSVART
FT                   YQTTVSCGAGITQPLLQECRKLGVHTHNRAKFEGFLVGDKGEVVGVKMRQNYHFGEDQP
FT                   GEVINIRAKRGVIMATGGFAQNVNLRMAQDPTLTAEVGCTNAPGATGEGMYEMFRLGAI
FT                   PVHLAHIQSGPWASPDEGGFGYVSNYSIYNFPHSVAIDRLTGKRFMNEIADRKTRADAE
FT                   LNCRDAQGNALPPILITSYKDSKKHPNTKKVIKYNVGWKFDSVEALAKHFDVPLAPLKA
FT                   QIAEYNEYVKAQNDPQFGKNMTEAKDKYIEAPFTVVRLWPKVHYCQGGVQINTNAEVKD
FT                   SFTGQAIPGLYAAGEVCGGIHGVSRLGSCSIPECMVMGMTAARSMMKA"
FT   gene            396253..396606
FT                   /locus_tag="Shal_0332"
FT   CDS_pept        396253..396606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0332"
FT                   /product="tetraheme cytochrome c"
FT                   /note="KEGG: spc:Sputcn32_3535 tetraheme cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74908"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR012286"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPN7"
FT                   /protein_id="ABZ74908.1"
FT                   /translation="MINLKAVLALTFGCFLSLSAQAVEIRDHHKEVIGKDCKTCHDNGI
FT                   KQFPSDQACLQCHDVDDLAEQTARSEEDKWQNPHDNLHYGKELPCQECHSEHDTKKPLC
FT                   SNCHTFKYDKHKE"
FT   gene            396869..398113
FT                   /locus_tag="Shal_0333"
FT   CDS_pept        396869..398113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0333"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: spc:Sputcn32_3534 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74909"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPN8"
FT                   /protein_id="ABZ74909.1"
FT                   /translation="MKYTMLLGSLLLSNGLVAAELPDFLDKKDINDAQFQCLGESPNYN
FT                   AQDQKYIDILWDETLTYLRAYAEALTNDQNSGCLNSDMAMVDSTEGGQHMCVMDRRDMK
FT                   LMVKNIYQVINNADEAKKCFGAREDVSWIYNPGGELTENSPVAQHFKRTTFEEFFDNKV
FT                   TDKQVKKHGENFTNNFYKMVTGDEVKMPAVFPYDISANSLPNLWAAAGWFPMYAEEGKR
FT                   NDKNFDNIRGGYAYAEIFGHWGLLRIDEINGEKVGAEVGMTVQSVDTLYPFHNHAISEM
FT                   YYNMRVPACTNQFKTIAVREDSPLVKTVKEDDTMRRVQFDEGQHNSQTMWLSGSAEQDS
FT                   LIYFHQNTIHAFDVDGSCETKPEERAIVSVWARSNANDKRNDYGTTLLCESAANPGTPA
FT                   KRGEVIQCDLTKVKW"
FT   gene            398330..399439
FT                   /locus_tag="Shal_0334"
FT   CDS_pept        398330..399439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0334"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sbm:Shew185_2536 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74910"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPN9"
FT                   /protein_id="ABZ74910.1"
FT                   /translation="MKKSIINLAVASILLPVFAAPAVADDLNIGGSVRANYSYSDYSES
FT                   SKDKGGDFDFNLVSITFADKWNDIGVKAEYRFYDGYDHLKYGYAFWDVNEDLTINGGAI
FT                   SKPFGNKGYASHNWWYSLNYYMGFEDDYGVGVSAQYENGISLSEFAFIKNAIYGGTDHR
FT                   DFAGTVAKGTVGDTSYNNEETNTLAGRQSFTLTNGELTTIVGASVEYGQLYNSEYGENG
FT                   DTFNYALHLDMNYAGWGLQAQYLAYDFDQYDDGKIDPDKIGMGMLGGFYEVASKGNIYT
FT                   ANLSKNIATSWGSLTVYNDFSMVQPDVEEFDDSILNTTGVSIAYGPLFIYVDHYMAKNV
FT                   LWLGGNSLGLVQTDDDWDHRFNINFAYYF"
FT   gene            complement(399578..400465)
FT                   /locus_tag="Shal_0335"
FT   CDS_pept        complement(399578..400465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0335"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: shm:Shewmr7_2226 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74911"
FT                   /db_xref="GOA:B0TPP0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPP0"
FT                   /protein_id="ABZ74911.1"
FT                   /translation="MLKIELLESFIAVVECGNLSKAAEKLCRTQSTISLQIKKLEESVG
FT                   KPLLLRDNKGVTMTDAGKTLLNYAYKMLQLSSQAIDELKDCQNREVIRLGVPTDYINRY
FT                   LGSFLLEFIREFTCIELVIDTDVSGNLYKRLHNGEFDVIVATHWQTPAAGHGELLFERR
FT                   FHWVAAKGGSAHKRETVPMALYPENCPIRAQVFANHQISMRPMSVLLSTPSPTAMCMAV
FT                   ENDLVIAPIAEFRINDKMQIIDPIEHNIPPLPSFNESLYINPETQTAATNQLINLIKAN
FT                   VQGLGEVNKAQMLG"
FT   gene            400587..401234
FT                   /locus_tag="Shal_0336"
FT   CDS_pept        400587..401234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0336"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG: sbl:Sbal_0259
FT                   putative transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74912"
FT                   /db_xref="GOA:B0TPP1"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPP1"
FT                   /protein_id="ABZ74912.1"
FT                   /translation="MSNWQQRESYLTDIAERCLRGHKSFDLRRSHLVEASQISKGTIYN
FT                   HFPTEADLVVAVATAHYRKRLERAAIDDDLYQDYLTRFLMHHCWGLRDDLLYDRFIISR
FT                   VMPNSELLAQVTDDNRETFEQVYGEYVRWNNDLIKAIGVVEGFNRAELVANYLRGALIN
FT                   CDDAGKQYTDASLYYQFSYALAQLMGHSDKRIPKQADYAHWLARLEPAANAA"
FT   gene            complement(401249..402619)
FT                   /locus_tag="Shal_0337"
FT   CDS_pept        complement(401249..402619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0337"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: sbl:Sbal_0260 integral
FT                   membrane sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74913"
FT                   /db_xref="GOA:B0TPP2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPP2"
FT                   /protein_id="ABZ74913.1"
FT                   /translation="MQLRKNPNNIFVKLLLGFWLCSSLIITLVGLLPLLQQNHDQSELP
FT                   PQLKHLLETVSQKIINNPQVLNNDKMKRWDRFKEFNGRPIRIYLVDENANVLNTHKPSR
FT                   TLRRFMLIADEAGKPIKQQFRNELMFGPYSFHVEGKEYSLYGRIPEHHSRPWFFFFSDN
FT                   KILTLSIAILLSGLLCGLFAWHLGKPLRSLKRSADALAGGDLSSRVDMATALRNDEIGQ
FT                   LAQAFNSMADSVEDMVNSQQRLISDISHELRTPLTRLKLSLALSRKKGQETAETERIEY
FT                   EADQLEQMIAELLELSRVKLNANETKRNLELSETLSQVLDDADFEAQQQQKQLHIDIDE
FT                   SIVAPLYPRPLCRAVENLLRNAIRYANSQVSIQAIATASNIQIEIIDDGPGIADETDLE
FT                   AIFEPFYRPQSARDRESGGWGLGLAIARAAIQAHQGKITAENNQHSGLKITINLPIQ"
FT   gene            complement(402620..403303)
FT                   /locus_tag="Shal_0338"
FT   CDS_pept        complement(402620..403303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0338"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: slo:Shew_3570 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74914"
FT                   /db_xref="GOA:B0TPP3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPP3"
FT                   /protein_id="ABZ74914.1"
FT                   /translation="MSRILLIDDDLGLSELLAQLLELEGFELTLAHDGQSGLDLAIEQQ
FT                   FDLILLDVMLPKLNGFEVLRALRSKKQTPVLMLTARGDEIDRVVGLEIGADDYLPKPFN
FT                   DRELVARIRAIIRRTHSQANETPLSTRQYGDINLDPARQEVHCQDQLIILTGTEFSLLF
FT                   ELVKSAGELASKEVLSEKVLGKKLMPFDRSLDMHLSNLRKKMPERDDGRPRVKTIRGKG
FT                   YIWLP"
FT   gene            403532..404014
FT                   /locus_tag="Shal_0339"
FT   CDS_pept        403532..404014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0339"
FT                   /product="protein of unknown function Spy-related"
FT                   /note="PFAM: protein of unknown function Spy-related; KEGG:
FT                   slo:Shew_3569 protein of unknown function, Spy-related"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74915"
FT                   /db_xref="GOA:B0TPP4"
FT                   /db_xref="InterPro:IPR012899"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPP4"
FT                   /protein_id="ABZ74915.1"
FT                   /translation="MMKKNNLKAGLLAIVASTVLLTAGVSAANDYHGSRDGKQGHHQMK
FT                   GGCGSHHDLRKMFHGLDLSDEQKTEMKALFSAHRDEMKQNRPSKEARAAQKQQMLGFIT
FT                   SPNFNEAEVKQALVAKQEARQQKAVGIIKLQNQAYQLLTPEQQEKFKQRFAKHHKR"
FT   gene            404164..405033
FT                   /locus_tag="Shal_0340"
FT   CDS_pept        404164..405033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0340"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG:
FT                   shm:Shewmr7_3767 cation diffusion facilitator family
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74916"
FT                   /db_xref="GOA:B0TPP5"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPP5"
FT                   /protein_id="ABZ74916.1"
FT                   /translation="MTDTSQYDFWVKLASRAAVATALTLITIKFAAWMYSGSASMLASL
FT                   TDSFADTLASIVNFIAIRYAIVPADQDHRYGHGKAEPLAALAQSAFILGSAFLLLLHGG
FT                   ERLINPVEVQHATLGVVVSIIAIVLTLALVMLQKRALAATSSTVIEADALHYKSDLFLN
FT                   AAVLLALVLAQYGWLWADGLFALLIALFIGQQAVGLAYRSVQSLLDRELDDETRGKITE
FT                   IAKRDPQVKGIHDLRTRESGKTMFIQFHLELDGDLSLLQAHKIAVETSERVRQEFVDSE
FT                   VIIHQDPV"
FT   gene            complement(405148..406557)
FT                   /locus_tag="Shal_0341"
FT   CDS_pept        complement(405148..406557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0341"
FT                   /product="nitrogen metabolism transcriptional regulator,
FT                   NtrC, Fis Family"
FT                   /note="KEGG: shm:Shewmr7_3764 nitrogen metabolism
FT                   transcriptional regulator, NtrC, fis family; TIGRFAM:
FT                   nitrogen regulation protein NR(I); PFAM: response regulator
FT                   receiver; sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; ATPase associated with
FT                   various cellular activities AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74917"
FT                   /db_xref="GOA:B0TPP6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010114"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPP6"
FT                   /protein_id="ABZ74917.1"
FT                   /translation="MTEQVWILDDDSSIRWVLEKALQSAKFSCASFAAAESLWQALEMT
FT                   QPQVIVSDIRMPGTDGLTLLERLQNHYPHIPVIIMTAHSDLDSAVSAYQAGAFEYLPKP
FT                   FDIDEAISLVDRALTHAKEQSSSITVEEPLVATPEIIGEAPAMQEVFRAIGRLSRSSIS
FT                   VLINGQSGTGKELVASALHKHSPRKGKPFIAINMAAIPKDLIESELFGHEKGAFTGAGS
FT                   VRQGRFEQANGGTLFLDEIGDMPLDVQTRLLRVLADGQFYRVGGHSPVQVDVRIIAATH
FT                   QDLEQLVYQGGFREDLFHRLNVIRVHLPPLSQRREDIPQLARHFLMIAAKEIAVEPKVL
FT                   TKEAATKLSQLPWPGNVRQLENTCRWLTVMASGQEILPLDLPPELLQEPKLNNAQTSDS
FT                   DDWQGALKLFIDQRLSDGDSDLLTEVQPAFERILLQTALKHTNGHKQEAAKRLGWGRNT
FT                   LTRKLKELEMD"
FT   gene            complement(406575..407615)
FT                   /locus_tag="Shal_0342"
FT   CDS_pept        complement(406575..407615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0342"
FT                   /product="signal transduction histidine kinase, nitrogen
FT                   specific, NtrB"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: sbl:Sbal_0267
FT                   signal transduction histidine kinase, nitrogen specific,
FT                   NtrB"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74918"
FT                   /db_xref="GOA:B0TPP7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPP7"
FT                   /protein_id="ABZ74918.1"
FT                   /translation="MDTSLLLNHLVTAVLVINEELELLYVNAAAEQLLGVGSNRLSEHP
FT                   LPEHYQLLGVDPQVLKLAIFEGQGLSINTVPLVTLDAQHHTVDVTLTPLEQEKYLALIE
FT                   LRQVDQQRRIHQQLTQDAQQQAAQYLVRNLAHEIKNPLGGLRGAAQLLSRELKEPELHE
FT                   FTDLIIEQADRLRNLVDRLLGPQRPTQHSLYNIHEVIQKVVQLVNVTLPSNIELTQDYD
FT                   PSIPDIEMDPDQLQQAILNIVQNAIQALEPKGGNIRLKTRTQHQITIGTKRHKLVLMLS
FT                   IIDDGPGIQPELMDTLFYPMVTGREQGSGLGLSIAHNFARLHGGRIDCDSTVGHTEFTI
FT                   TLPINS"
FT   gene            complement(407765..408313)
FT                   /locus_tag="Shal_0343"
FT   CDS_pept        complement(407765..408313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0343"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3559 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74919"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPP8"
FT                   /protein_id="ABZ74919.1"
FT                   /translation="MRVGLALLLLLVATLAHATVYKWVDEEGKVHFSDEPVKNAEVVEL
FT                   KENTQNNIKLPEVTVIPSYLKAPEAAQPSYKMSIASPSEQESIRSNDGNITIITNITPK
FT                   IADAHQFALYMDGNQIGNKQTIGIFKLSNIDRGEHRFVVKVLDQNGKRIASTPVRTIFL
FT                   HRTSINAPTRIKPQPRVNE"
FT   gene            408544..409194
FT                   /locus_tag="Shal_0344"
FT   CDS_pept        408544..409194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0344"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppr:PBPRA1243 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74920"
FT                   /db_xref="InterPro:IPR009739"
FT                   /db_xref="InterPro:IPR018660"
FT                   /db_xref="InterPro:IPR036328"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPP9"
FT                   /protein_id="ABZ74920.1"
FT                   /translation="MQKTILLGCLVLLAACSSTVATQIKPTQADSELVVPVSDMHVAPT
FT                   FDCAKAQGQVETLICHDAELAQLDRLMEQIYKAAVVNIPASEQPKATQRGWIKGRNDCW
FT                   KAQDVRECTLQNYKGRIIELQIQGGLLEVPPAVVFDCGHHPQITAVFYTQLDPVTAVFT
FT                   FSSEKMGEQQLQATNVRSGSGAKYQGRNFEFWEHQGEASVQFFDDSYRCKLHK"
FT   gene            complement(409381..410058)
FT                   /locus_tag="Shal_0345"
FT   CDS_pept        complement(409381..410058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0345"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /note="PFAM: ThiJ/PfpI domain protein; KEGG:
FT                   sbm:Shew185_0262 ThiJ/PfpI domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74921"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPQ0"
FT                   /protein_id="ABZ74921.1"
FT                   /translation="MKILMVLTSHDKLGDTGLKTGFWLEEFASPFYRFKDSGFTITLAS
FT                   PAGGQPPLDPSSEQPGFQTAATDRFNQDEQAKQQLATTKVLAEINQADYDAVFYPGGHG
FT                   PLWDLTNDAHSIALIEAFYQAKKPVGLVCHAPGALKNVKAADGSPLVAGKQVTGFTNGE
FT                   EAAVQLTEIVPFLVEDMMLANGALYNKGDDWASHLAVDGNLITGQNPASSEAVADEIIK
FT                   QLK"
FT   gene            complement(410170..411327)
FT                   /locus_tag="Shal_0346"
FT   CDS_pept        complement(410170..411327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0346"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase; KEGG:
FT                   shw:Sputw3181_0227 iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74922"
FT                   /db_xref="GOA:B0TPQ1"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPQ1"
FT                   /protein_id="ABZ74922.1"
FT                   /translation="MYSFDYYNPTHICFGEGKIAELDNLVPQDAKVLVLFGGNSARSTG
FT                   TLDEVKAALKQREVVEFGGIEANPTYETLMQAVDVVKQQNIDFLLAVGGGSVIDGTKFV
FT                   AAAALFEAEPWDILLSWGEKVTQAMPFGTVLTLPATGSEMNSASVVTRKEYQSKLSFMS
FT                   NHVFPKFSVLDPSKTFTLPERQVANGVVDAFIHITEQYLNYPVNAPVQDRFAEGLLQTL
FT                   IELGPKALSQPKDFDVRANLMWVATMALSGVIGKGVPHDWATHMISHEITVLYGIDHAR
FT                   TIAMILPGMLDVRRDAKQEKLLQYADRVWGINQGSNDEIIDAAISKTREFFETMGIKTR
FT                   LSDYDLDSSSIDEIINKLEGHGMTALGENQDVDLAMSRKILERNL"
FT   gene            complement(411474..411926)
FT                   /locus_tag="Shal_0347"
FT   CDS_pept        complement(411474..411926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0347"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; KEGG:
FT                   slo:Shew_3558 transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74923"
FT                   /db_xref="GOA:B0TPQ2"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPQ2"
FT                   /protein_id="ABZ74923.1"
FT                   /translation="MDVKDRNILAILQRQGRIAISELAAKLNMSDTPCLRRVRKLEQSG
FT                   IIRGYAAQIDPKDVGFNVVVYAFVRLKENSDQHAILFEDSMENLEQVMECSVVTGAHDY
FT                   LLKIVASDLLSYESFVKKSLGSLNCIAGIESTVVLKQNFSRSTLPL"
FT   gene            complement(412290..412595)
FT                   /locus_tag="Shal_0348"
FT   CDS_pept        complement(412290..412595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0348"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74924"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPQ3"
FT                   /protein_id="ABZ74924.1"
FT                   /translation="MRKKATRVALLSAGLLLSTTSLAAMSPITECNDCSSQAAQETAKA
FT                   QQSDSVYVVDFVNRTAQKFVTDDKGTTLLAKLSVGELNHLNQEFNHRKVYLRAVTP"
FT   gene            412844..413854
FT                   /locus_tag="Shal_0349"
FT   CDS_pept        412844..413854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0349"
FT                   /product="glycosyl hydrolase, BNR repeat-containing
FT                   protein"
FT                   /note="KEGG: sus:Acid_2127 glycosyl hydrolase, BNR
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74925"
FT                   /db_xref="GOA:B0TPQ4"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPQ4"
FT                   /protein_id="ABZ74925.1"
FT                   /translation="MKIFMLLISFCCFGVSAMEWNIQSLAPGSSFRGSAVLEGVAWVTG
FT                   TDNRVYISKDSGNSWLDVSVKDQPLTDFRDIEVFDANTAIVMGAGQGGLSKLYITQNQG
FT                   LSWQLLFDNPDELGFFNSIAFWDRNNGLLLGDPVGGCYVILRTADGGKTWQRIAKGELP
FT                   EMLDKEVAFAASGNTLIVGKRGRAWFTTGGYSSSAYSSADSGQHWRRRPISLYDDTQTA
FT                   GGYALAFNHLGDLFVVGGDYQQRDKYDANMVYRRGYVWHKAPGTTPGLRTAMVCYEETC
FT                   IATGKLSSDISRDHGYSWQPLLINGQAQGFFTLAIDGNTLVAGGHGGRVAVYTFE"
FT   gene            complement(413922..414236)
FT                   /locus_tag="Shal_0350"
FT   CDS_pept        complement(413922..414236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0350"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   pat:Patl_1386 transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74926"
FT                   /db_xref="GOA:B0TPQ5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPQ5"
FT                   /protein_id="ABZ74926.1"
FT                   /translation="MEINAITVKELRQSKGWTQQHLADACAISLRTVQRVEKEGSASNE
FT                   TLLGLCAVFEVEQKQLQVIPKPTHAQMQKVSLYSQWLLFALATLIGGCVGALIMYLILG
FT                   "
FT   gene            complement(414278..414706)
FT                   /locus_tag="Shal_0351"
FT   CDS_pept        complement(414278..414706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0351"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74927"
FT                   /db_xref="GOA:B0TPQ6"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPQ6"
FT                   /protein_id="ABZ74927.1"
FT                   /translation="MEQSITRHKMDTTMDTVTIANGYWYYFNDEEVRITAHGSGFTGKE
FT                   TIYVNDELITEKRNLGMKSAHEFCYLGNDYQVTFEVSSLLTATVVCTLYKNGKYMATET
FT                   KAYLNMDSKSALKRIFMFFVAGMVFGGLAAWLVHQFTG"
FT   gene            complement(414929..416164)
FT                   /locus_tag="Shal_0352"
FT   CDS_pept        complement(414929..416164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0352"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="PFAM: sodium:dicarboxylate symporter; KEGG:
FT                   shm:Shewmr7_3722 sodium:dicarboxylate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74928"
FT                   /db_xref="GOA:B0TPQ7"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPQ7"
FT                   /protein_id="ABZ74928.1"
FT                   /translation="MGIAHKWNDFMWQKIKPYRSSIILLSALMLGGLIGILFPVFALKL
FT                   KPLGQIFLNLLFMIIVPLVAISVTSSIARMTDLKKLGVILVTIFMVSIVMAIIPTIGII
FT                   GLASIYDPAQGVTLDLHQQVSTGSGSMDFVNLLTTNDFVGLLSKSNILALIIMSVISGI
FT                   AIGQSGKDGEKVSAMLDSLNTVIMKIVSILMIVAPVGLGAYFASTMASQDTELLSTFAR
FT                   AIGLFFIAAALYYTLGSTLYAWLGGGINGIKQFWRNAIEPSATALGTSSSLASLPVNIR
FT                   AANKMGIREEIADICLPLLVNLNKGGAAMTTALKIVFIYSILGLDFTADIFALTVLISV
FT                   LSAFVIGGVPGGAFLGEIFIVTTLGLPIEVIPILVIIGAVTDAPATVINVIHDLNATQI
FT                   IERINGKRYARS"
FT   gene            complement(416340..417749)
FT                   /locus_tag="Shal_0353"
FT   CDS_pept        complement(416340..417749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0353"
FT                   /product="glutamine synthetase, type I"
FT                   /note="TIGRFAM: glutamine synthetase, type I; PFAM:
FT                   glutamine synthetase catalytic region; glutamine synthetase
FT                   beta-Grasp; KEGG: shm:Shewmr7_3719 glutamine synthetase,
FT                   type I"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74929"
FT                   /db_xref="GOA:B0TPQ8"
FT                   /db_xref="InterPro:IPR001637"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPQ8"
FT                   /protein_id="ABZ74929.1"
FT                   /translation="MSAESVLQQLKELEVKFVDLRFTDTIGKEQHVTIPTHQVDADFFE
FT                   DGKMFDGSSISGWKGINESDMVLMPDPASFVLDPFTAETTANIRCDILNPGTMTGYNRD
FT                   PRSIAKKAEDYLRSTGIADTVLVGPEPEFFLFDDVKFGADMSGCFYKVDAEEAAWNSGT
FT                   SYENGNKGHRPGVKGGYFPVAPVDSSQDIRSAMCLVLEEMGQVVEAHHHEVATAGQNEI
FT                   ATRFNTLTLKADEVQVLKYVVHNVAHAYNKTATFMPKPIVGDNGSGMHVHQSLAKDGVN
FT                   LFAGDKYGGLSETALFYIGGVIKHARAINAFANPSTNSYKRLVPHFEAPVMLAYSAANR
FT                   SASIRIPVVPSAKGRRIEIRFGDPVANPYLAFSAMLMAGLDGIQNKIHPGEAMDKDLYD
FT                   LPAEEAAEIPTVATSLENALECLDADREFLTRGDVFTNDFIDSYITLKSADVERINQTT
FT                   HPVEFELYYSL"
FT   gene            418452..420263
FT                   /locus_tag="Shal_0354"
FT   CDS_pept        418452..420263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0354"
FT                   /product="GTP-binding protein TypA"
FT                   /note="TIGRFAM: small GTP-binding protein; GTP-binding
FT                   protein TypA; PFAM: elongation factor G domain protein;
FT                   protein synthesis factor GTP-binding; elongation factor Tu
FT                   domain 2 protein; KEGG: saz:Sama_3415 virulence regulator
FT                   BipA"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74930"
FT                   /db_xref="GOA:B0TPQ9"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPQ9"
FT                   /protein_id="ABZ74930.1"
FT                   /translation="MLENLRNIAIIAHVDHGKTTLVDKLLAQSGTLESRGEATERVMDS
FT                   NDLEKERGITILAKNTAIKWNDYRINIVDTPGHADFGGEVERVLSMVDSVLLLVDAVDG
FT                   PMPQTRFVTKKAFAQGLKPIVVINKIDRPGARPDWVIDQVFDLFDNLGATDEQLDFPIV
FT                   YASALNGFATLDPDETSADMTPLFETIVEKVSSPDADAEGDFQMQISQIDYNSYVGVIG
FT                   IGRIKRGSVKTNQQVTIIGADGKKRNGKVGQVLGYMGLERHEVADATAGDIVAITGLGQ
FT                   LLISDTVCATTNVEALPPLSVDEPTLTMTFQVNTSPFAGKEGKYVTSRNILERLQQELV
FT                   HNVALRVEETDSPDRFRVSGRGELHLSILIENMRREGYELAVSRPEVIVKEIDGEMCEP
FT                   FETLTVDVEEQHQGAVIEKLGIRKGDMKDMQLDGKGRVRIDFVIPSRGLIGFQTEFMTA
FT                   TSGTGLIYHSFDHYGPLKGGDIGQRARGVLISNATGKALTFALFGLQERGRLFITHASE
FT                   VYEGQVVGLHARANDLTVNCLKGKQLTNMRASGTDEAQVLTPHIEMTLEQALEFIDDDE
FT                   LVEVTPLNIRVRKRFLTENERKRHNRK"
FT   gene            420918..422369
FT                   /locus_tag="Shal_0355"
FT   CDS_pept        420918..422369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0355"
FT                   /product="Disulphide bond formation protein DsbB"
FT                   /note="PFAM: Disulphide bond formation protein DsbB; KEGG:
FT                   she:Shewmr4_3658 disulphide bond formation protein DsbB"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74931"
FT                   /db_xref="GOA:B0TPR0"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPR0"
FT                   /protein_id="ABZ74931.1"
FT                   /translation="MNELTLNRIVSLAALALIALPVGIACIILGFGMGDTPCILCWQER
FT                   TAMVLVSLIAIFIMRYGLKPKYIGALIITAVYGLWAGYRHSSAHILRDIGQGFGPAIFG
FT                   VHTYVWVIVVFAIILLFAGVLMLLQGDKLVEKSDSSEWSLLNKITVNVFLVIIGFNIVQ
FT                   AFTQTGPFPYIGQSDPVRMTFDSEKTIWSTANWPTLSKLSARGAYSIEKPDFAAMTKND
FT                   ATKVTANGELTALDSVTLPAEIFGLATGISYNPQSQLFAVVTSNNWVYFLNAELTEILA
FT                   KVQIDAAFSAEISNLAGVTFDGETSVLVTADHKSFVRVEYDPSVKFDDTYGRFVEGTDG
FT                   VRELKRSRFATVRAKYNYVANVGWDANTQEYLMVTLPDLKRNNFVVSRLSGKDYELNSE
FT                   AIISIDAQAYPNITGISVADDKAYLLSHSGQQMLTMDLASNTVVAASDIAGLTNPQAMT
FT                   VVNGEFAVLDATEGNNRVNFYQVQQ"
FT   gene            422650..423513
FT                   /locus_tag="Shal_0356"
FT   CDS_pept        422650..423513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0356"
FT                   /product="pyridoxal kinase"
FT                   /EC_number="2.7.1.35"
FT                   /note="TIGRFAM: pyridoxal kinase; KEGG: vfi:VF2056
FT                   pyridoxine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74932"
FT                   /db_xref="GOA:B0TPR1"
FT                   /db_xref="InterPro:IPR004625"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR023685"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPR1"
FT                   /protein_id="ABZ74932.1"
FT                   /translation="MKRILSIQSHVVFGCAGNSSAVFPMRRLGMEVWPINTVQFSNHTQ
FT                   YAQGWTGTVMPAGQITELVQGLDNIGKLQTCDAILSGYLGSAEQGGEIVAAVKKMKALN
FT                   PNAIYFCDPVMGHPEKGCIVAPGVQEFLKTQALAEADIIAPNLLELETLTDRELHNLDE
FT                   VINACECLLEKGLEMVVVKHLAKAATCQEQFEMLLVTKAGSYLISRPLYEFEKQPVGVG
FT                   DLISGLMLANLQAGFSPVEAFERTNASVDAVLLETFNQGAYELQLIGAQDAIASPVIKA
FT                   HAKRVN"
FT   gene            complement(423905..425119)
FT                   /locus_tag="Shal_0357"
FT   CDS_pept        complement(423905..425119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0357"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="KEGG: slo:Shew_3549 4Fe-4S ferredoxin, iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74933"
FT                   /db_xref="GOA:B0TPR2"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPR2"
FT                   /protein_id="ABZ74933.1"
FT                   /translation="MSFIESLTLALALTYSVSLIYWSGKKWGALITGLLITGAIISSLY
FT                   WPLIAALAIAVVIIGLVYKFQPKVAQGDMRANNLRDGVQHLLALSMLLVGVQFAVNAAL
FT                   LKSGITPWLMRPDVGDAFLPIAGGIEIKAILSLGIWDQNHPAAAVMLTVVLLTGLLCKR
FT                   AFCGWACPLGLAGEYLYKLRKRFIKQELLPPAWIDWPLRMIKYLLLLALLYIIVGMPTM
FT                   SIPGYLNSNYHKIADLKMALFFITPGLVTLICFGFILGLAAWRRQGFCRYICPYGALLG
FT                   LLSFLSPFKIRRNTKHCLIETKGMSCDKCSRACPANIKVHNQINIRSDECQACMRCISA
FT                   CPKKEALQFSTRNGWKLSARGLTVMLLTIMFLLPLIAYLAGFWHSETPVEARMYLIQHL
FT                   DRIGH"
FT   gene            complement(425302..425949)
FT                   /locus_tag="Shal_0358"
FT   CDS_pept        complement(425302..425949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0358"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sbm:Shew185_0312 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74934"
FT                   /db_xref="InterPro:IPR021342"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPR3"
FT                   /protein_id="ABZ74934.1"
FT                   /translation="MKKLITTTILGTSLLLGGCQSAYYGAMEKVGYHKRDIMVDRVEDA
FT                   KESQEEAQEQFSSALEEMQALLNHDGGDLESAYNKAKDEYESAQDAADDVTNRIDKVED
FT                   VAEALFDEWQTEIGEISKASLRRNSESKLRETERSYTQLVKSMRRAESKMEPVLVAMKD
FT                   NMLYLKHNLNAQAIGAIKGEFASLQTDISGLIKEMNKSINESNKFIASLEGK"
FT   gene            complement(425981..426205)
FT                   /locus_tag="Shal_0359"
FT   CDS_pept        complement(425981..426205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0359"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3546 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74935"
FT                   /db_xref="GOA:B0TPR4"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPR4"
FT                   /protein_id="ABZ74935.1"
FT                   /translation="MSQQGSSGNVIAAIASFFFAGLGQLVQGRILAAILFCLTTYAAYG
FT                   IASFTLGIFLIIAIPLHIWCIVDAARYRS"
FT   gene            426342..427322
FT                   /locus_tag="Shal_0360"
FT   CDS_pept        426342..427322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0360"
FT                   /product="putative ribonuclease BN"
FT                   /note="TIGRFAM: putative ribonuclease BN; PFAM:
FT                   ribonuclease BN; KEGG: shm:Shewmr7_3708 putative
FT                   ribonuclease BN"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74936"
FT                   /db_xref="GOA:B0TPR5"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="InterPro:IPR023679"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPR5"
FT                   /protein_id="ABZ74936.1"
FT                   /translation="MINQVRSFLLSIWAFFLHLLSRFKEDQVNIKAGHLAYVTLLSLVP
FT                   IVAVMFSMLSAFPVFSGIREKLEAFVYNNFLPAAGDTVQIYINEFVANASKGTSVGIAA
FT                   LVVVALMLISAIDKALNSIWRTKEKRQAAVSFSMYWMVLTLGPVLVGASLVATSYIVSL
FT                   KVFNTSELSGVVPILIERLPMLFSVAAFLLLYMVVPIKKVKFLHALLGALVAAMLFELG
FT                   KKGFAYYVTQFPSYEAIYGALATIPILFVWVYVSWVIVLVGAEITAGLPEYLHECQLIR
FT                   EKVLAEDEAEELAQDSKQVSQIEQTSEQTREPAPDKQAESADRDK"
FT   gene            427328..428260
FT                   /locus_tag="Shal_0361"
FT   CDS_pept        427328..428260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0361"
FT                   /product="Prolyl aminopeptidase"
FT                   /EC_number="3.4.11.5"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: slo:Shew_3544
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74937"
FT                   /db_xref="GOA:B0TPR6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR005944"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPR6"
FT                   /protein_id="ABZ74937.1"
FT                   /translation="MPIAQPKAFRRVWLDVGDTHQLYVAQYGNPDGIPLLYLHGGPGAG
FT                   CSTEELKLFDLSVYQVILLDQRGAGRSRPRGELKHNNLSSLLDDIERVRCWLNISQWML
FT                   AGGSFGATLALLYSAYYPSRVISQVLWGLFIPNPAGIEWLYCNSGAARLFKDEYRAFAD
FT                   GVDPQQLTTLLTSYRSRLEDECQDVRHSATERWISWEMALAYPGFMVSEINAPFSQSLA
FT                   SIELYYVANDYFGAFEKLIVQLPLIQSQTYVLQGEMDWVCPFKVLQNFFKGRASQLIEV
FT                   TEIKGGYHALADVKMAKAVMNAIREMAKQ"
FT   gene            428281..428862
FT                   /locus_tag="Shal_0362"
FT   CDS_pept        428281..428862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0362"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sbm:Shew185_0316 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74938"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPR7"
FT                   /protein_id="ABZ74938.1"
FT                   /translation="MKKLILVGLTMGLTMSLTACTSTEKTAEAEVAVKAPDSVDLGGLS
FT                   NEEATTKLLEALLNKSYLASRAGPNGVAVNFDNSQFILQPSINPDGIDRIMMNRFYAIH
FT                   PKYVGSKEMLLMIGTLNQKLNFAKFVIRDQGAVIQVQGAATFVDTITMEELRRFILWID
FT                   EGLRQVGESLPEGAEDVIKPIPVMQNIQSI"
FT   gene            429455..429892
FT                   /locus_tag="Shal_0363"
FT   CDS_pept        429455..429892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0363"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /note="PFAM: D-tyrosyl-tRNA(Tyr) deacylase; KEGG:
FT                   shw:Sputw3181_0273 D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74939"
FT                   /db_xref="GOA:B0TPR8"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TPR8"
FT                   /protein_id="ABZ74939.1"
FT                   /translation="MIALIQRVSEAKVVVDGATIGEIDRGLLVLLGVEREDNIEKMQKL
FT                   ATKVMSYRVFSDENGKMNLNLEQAGGSLLVVSQFTLAADTGRGLRPSFSGAGTPEQARE
FT                   LYEAFIDFCKSKGVNTQTGQFAADMKVSLVNDGPVTFNLQV"
FT   gene            429920..430389
FT                   /pseudo
FT                   /locus_tag="Shal_0364"
FT   gene            complement(430407..430742)
FT                   /locus_tag="Shal_0365"
FT   CDS_pept        complement(430407..430742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0365"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG:
FT                   she:Shewmr4_0323 rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74940"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPR9"
FT                   /protein_id="ABZ74940.1"
FT                   /translation="MLNTQISKLSTKPASSQCWQLIEEGATVIDVRSPQEFASGHLPQA
FT                   INVPLDNLNKLDTWLHKVENRQQVFVLYCGAGIRAQKGCDILTANGLECVINGGALKDL
FT                   LGCQPKR"
FT   gene            complement(431309..432556)
FT                   /locus_tag="Shal_0366"
FT   CDS_pept        complement(431309..432556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0366"
FT                   /product="Beta-ketoacyl synthase"
FT                   /note="PFAM: Beta-ketoacyl synthase; KEGG: slo:Shew_3526
FT                   beta-ketoacyl synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74941"
FT                   /db_xref="GOA:B0TPS0"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPS0"
FT                   /protein_id="ABZ74941.1"
FT                   /translation="MSQATFPRRVVITGVGGISALGHDWPTIADSLKAQKNCVVRMDEW
FT                   DRFADLHTRLAAPITDFEVPSHYKRKKIRSMGRVSIMATRASELALIDANLLDDPVVTS
FT                   GAMGIAYGSSTGSTDPIVAFGDMLKDGDMSGVTATSYIRMMAHTTAVNVGVFFGLKGRV
FT                   HTTSSACTSGSQGIGYAYEAIKYGQQDLMLAGGGEELCPTEAVVFDTLFATSTKNDTPT
FT                   ETPRPFDKSRDGLVIGEGACTLVLEELEHAKARGAKIYAEIVGFGTNADGLHVTQPNSE
FT                   TMETAIRLALKDAAIDADKIGYVNAHGTATDRGDIAETQATHAVFGAKQPISSLKSYTG
FT                   HTLGACGALEAWVSIEMMNEGWFAPTLNLTEVDPECGELDYIKDKIRQLETDYVMSNNF
FT                   AFGGINTSLIFKRFKS"
FT   gene            complement(432553..433278)
FT                   /locus_tag="Shal_0367"
FT   CDS_pept        complement(432553..433278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0367"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) reductase,
FT                   putative"
FT                   /note="TIGRFAM: 3-oxoacyl-(acyl-carrier-protein) reductase,
FT                   putative; PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: shw:Sputw3181_0286
FT                   3-oxoacyl-(acyl-carrier-protein) reductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74942"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011285"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPS1"
FT                   /protein_id="ABZ74942.1"
FT                   /translation="MTKRVLITGSSRGIGKAIALKLAASGHDIAMHFHSNQTAADATKA
FT                   ELEQLEIKVSCLQFDIADRAAVKQAIEQDIEQHGAYYGVVLNAGINADTAFPAMTESEW
FT                   DSVVHTNLDGFYNVIHPTVMPMVQGRQGGRIITLASVSGIAGNRGQVNYSASKAGIIGA
FT                   TKALSLELAKRKITVNCIAPGLIETDMVSDIPKEMVNNLVPMRRMGKPSEIAGLANYLM
FT                   SDDAAYITRQVISVNGGMI"
FT   gene            complement(433388..433933)
FT                   /locus_tag="Shal_0368"
FT   CDS_pept        complement(433388..433933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0368"
FT                   /product="Beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabA/FabZ"
FT                   /note="PFAM: Beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabA/FabZ; KEGG: sfr:Sfri_0339
FT                   beta-hydroxyacyl-(acyl-carrier-protein) dehydratase,
FT                   FabA/FabZ"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74943"
FT                   /db_xref="InterPro:IPR016776"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPS2"
FT                   /protein_id="ABZ74943.1"
FT                   /translation="MTQQRQTKMLDVTPCDANKCDVTKFDVTRLAEQEVEKFIPHRQPM
FT                   ILISQLLHYSHDSLLTQTDISASSAYFDANLNGVPNYVGIEYMAQSIAALAGVEAHLRD
FT                   DIIRVGFLLGSRKLKMHIPQFELGQSYQTRVTRLYQEESGLAVFDCQILHNQEVVAEAN
FT                   VNVFQPQDALAYIAESTQ"
FT   gene            complement(433902..435200)
FT                   /locus_tag="Shal_0369"
FT   CDS_pept        complement(433902..435200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0369"
FT                   /product="Beta-ketoacyl synthase"
FT                   /note="PFAM: Beta-ketoacyl synthase; KEGG: sbl:Sbal_0330
FT                   beta-ketoacyl synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74944"
FT                   /db_xref="GOA:B0TPS3"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPS3"
FT                   /protein_id="ABZ74944.1"
FT                   /translation="MNSTTQIAITHLGLCCPLGQSPQAVLDNLVQASIAGMQWRDDLLF
FT                   EHPVLVGQVDVELPVIPSALKRFDTRNNQLTLLIARQIEQAVEQAKARYGCERIGIIIG
FT                   TSTSGIATGEAALSEHETHGEFPKEYDYAKQELGDTSQFLQAYFELTGPCYTVSTACSS
FT                   SAKVFASAKRLIDAEICDMVIVGGIDTLCKLTLNGFYSLESISSGHCQPFSANRDGINI
FT                   GEGGALFLLEKVTLEKLAPEKTAKDGEEKVIILSGIGESSDAHHISAPHPEGRGAVNAM
FT                   QAALTMANLKPEQIDYLNLHGTATPKNDAMESRAVHQVFSNNLPAASSTKPLTGHTLGA
FT                   AGAIEAAFCYLLLSDYNTHQQLPPQVWDGKQDPNDPSLPLVAKGQQASINHVMSNSFAF
FT                   GGSNASLILSRNSSSREALKNIDNDSTETNQDA"
FT   gene            complement(435223..435885)
FT                   /locus_tag="Shal_0370"
FT   CDS_pept        complement(435223..435885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0370"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shn:Shewana3_0330 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74945"
FT                   /db_xref="InterPro:IPR021675"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPS4"
FT                   /protein_id="ABZ74945.1"
FT                   /translation="MSKLSRRLAFVGLCLLITACSQTLQRQTCVELAADVSYCLAPVTQ
FT                   QVLGAKLIDDSLLEVSQTAVSATQKVSIQTQDSQHELLSQLELEPQQLTLVGLAPLGQA
FT                   LFTLTYDGNTLISEQSQLLGDQFKAEYLLAIMQLIYWPDASVNPHLQGAKMQSYDCDSA
FT                   LCRGLFFANNKAKNGTIDSAADNQPIIAIRYSSLDKWQAHVSLSIDAANFKLAISPL"
FT   gene            complement(435873..437180)
FT                   /locus_tag="Shal_0371"
FT   CDS_pept        complement(435873..437180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0371"
FT                   /product="tryptophan halogenase"
FT                   /note="PFAM: monooxygenase FAD-binding; FAD dependent
FT                   oxidoreductase; tryptophan halogenase; KEGG:
FT                   shm:Shewmr7_3686 monooxygenase, FAD-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74946"
FT                   /db_xref="GOA:B0TPS5"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPS5"
FT                   /protein_id="ABZ74946.1"
FT                   /translation="MMSTDQAVQDELERYPTEAVDIAIIGAGPSGSIAASLLHAQGKKV
FT                   LVLEKQHFPRFSIGESLLPCCMQVIDEANMLEAVNQAGFQFKNGAAFRHQDKYTSFDFT
FT                   DKFTQGPGTTFQVERANFDKLLADEAVSQGVEIRYGHTVESIDLSAEPSLSVSNGKGQT
FT                   QTINAKFVLDASGFGRVLPRLLDLEKPSTLPTRSAVFNHIHDNISDPNFDRNKILISVH
FT                   PDNQDIWYWLIPFSDGRCSVGVVGEPEQLSSLSGYASNGFSDEIGNSDLDKILKTMINQ
FT                   EPGLRALLADAELINESGLLKGYSANVKTLATDKFALLGNAGEFLDPVFSSGVTIAMQS
FT                   ASMAAKTVIRQLDGERVDWQQDYAEPLMKGVDTFRTYVEAWYDYSFQEAIFFDKPDPKI
FT                   KQMICSILAGYAWDDNNPFVSESKRRLNMVVELCRS"
FT   gene            complement(437167..439602)
FT                   /locus_tag="Shal_0372"
FT   CDS_pept        complement(437167..439602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0372"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_0291 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74947"
FT                   /db_xref="GOA:B0TPS6"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPS6"
FT                   /protein_id="ABZ74947.1"
FT                   /translation="MKPSLNQFLSHKTAKLRLLIWLTLIAITLATGLVLWQGGARVQSD
FT                   ILAMLPKVSESPMTQRAMAQVEQQLANRIYLGFISDNEQSAIDAAKTAMAKLKQPSKDG
FT                   TQVSHRESAFIDISSADMAQAEALNRYYFNHRFQLLTDEQQQLLERGQWQQLTQATLEK
FT                   LYNAFSYANSDLLSHDPLLLYPDNLIALAPSQQLSVKQGVLLKTIAPKVLNQSPQFAAI
FT                   VMAKGRDSAFNPNAQQLQLSALTAAFDAVKQQDSDIEIIKAGALFHATAATDNAKKEVS
FT                   TIGLISLLGVIALVWFAFRSFRPLTIALVTVSSSFLFAVVTTTAVFGELHLLTLVFGTS
FT                   LIGISIDYCFHYYCERLNHPSHSSDRVIQQIFIAISLALLTSVIAYSAIGLAPFPGMQQ
FT                   VAIFCASGLVGAYLTLLLAYPTLAARPLRDGNRALDYASRYQGFMLSLMPTVPRKRLLL
FT                   AVGTCMFIIIGFTQLTANDDIRQLQHTPADIQAEEDELRTLLSGGTDNQFLLVTADSEQ
FT                   QVTDELAQLEPLLKQAKQDNLIGNHLSLSRFLPSQSAQERHYQLQGQIYREYLDEILAR
FT                   LGLDPSIKGALVEQYQAAKGNFITADNLLNHAAGESFKPLWLSPQEGETGYGAIVLLGG
FT                   ITQLEALTQHFDALPHVELVDKVGDISTVMGHYRQITLGLLALALLIAGIIFTFRFGVR
FT                   LAAVVVAVPALSALLTLACLGVSNNPLTLFHALALILVFGIGIDYSLFFAESKQQTRGV
FT                   MMAVFMSAMSTLLAFGLLAFSQTPAINAFGLTLLLGIGFTFLLSPFIQIFTRKSNDVD"
FT   gene            complement(439608..440375)
FT                   /locus_tag="Shal_0373"
FT   CDS_pept        complement(439608..440375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0373"
FT                   /product="outer membrane lipoprotein carrier protein LolA"
FT                   /note="KEGG: slo:Shew_3519 outer membrane lipoprotein
FT                   carrier protein LolA"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74948"
FT                   /db_xref="GOA:B0TPS7"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPS7"
FT                   /protein_id="ABZ74948.1"
FT                   /translation="MKRLFPLTQARALALTQALLLSVLISSYAQADTNADYSELFQHEA
FT                   SSAELTKLTTQLSPSAQAKGDFSQYRYLKVLKKPLVSQGEFIFAKDLGVIWQQNMPFSS
FT                   TLILKDKQLIQIDSQGNININNAEQAGSGNQISDVMPKLLNALLSGDIQQLEQHFSLSL
FT                   LLEPNTEGQAPQQWQLGLKPTDPLLEKAMPQMVLAGNEQIQTLVLFSRNGDRSRIEFSA
FT                   IDESPLTAADKQRFSPASLSDPSVNNAPNIEGK"
FT   gene            complement(440372..440818)
FT                   /locus_tag="Shal_0374"
FT   CDS_pept        complement(440372..440818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0374"
FT                   /product="conserved hypothetical 4-hydroxybenzoyl-CoA
FT                   thioesterase"
FT                   /note="KEGG: sfr:Sfri_0345 conserved hypothetical
FT                   4-hydroxybenzoyl-CoA thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74949"
FT                   /db_xref="GOA:B0TPS8"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPS8"
FT                   /protein_id="ABZ74949.1"
FT                   /translation="MKGILHTELEVEIPFHDVDSMGITWHGNYLRYFELVRCKLLDKIG
FT                   YGYRAMQDSGFSWPIVDVQIKYVQSSTFEQTIIVKATLVEWENRLKINYQVVDAQTGKR
FT                   ITKGHTIQAAVDMQTQELCFVTPAVFQQKIAHLLPQLSSSEQSE"
FT   gene            complement(441080..442642)
FT                   /locus_tag="Shal_0375"
FT   CDS_pept        complement(441080..442642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0375"
FT                   /product="Histidine ammonia-lyase"
FT                   /EC_number="4.3.1.3"
FT                   /note="PFAM: phenylalanine/histidine ammonia-lyase; KEGG:
FT                   slo:Shew_3517 histidine ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74950"
FT                   /db_xref="GOA:B0TPS9"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR022313"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPS9"
FT                   /protein_id="ABZ74950.1"
FT                   /translation="MTQHNTYNLSQQTVEFGYNSLSLEDVVAIAKGATAKLNQTGEYRA
FT                   YIQKGAQFIDSLLKEEGVVYGVTTGYGDSCTVTVGLDLVHELPLHLTRFHGCGMGEILS
FT                   PMQARAVMACRLSSLAVGKSGVSYELLARIETLLNLNITPVIPEEGSVGASGDLTPLSY
FT                   LAAVLIGERDVIYQGERCPTGDVYKELNIVPLKLRPKEGLALMNGTAVMTALACLAFDR
FT                   AQYMARLASRITAMASLTLKGNSNHFDEILFAAKPHPGQNQIAAWIREDLNHHIHPRNS
FT                   DRLQDRYSIRCAPHVIGVLQDALPFMRQFIETELNSANDNPIVDGEGEHILHGGHFYGG
FT                   HIAFVMDAMKNAVANIADLIDRQMALVMDQKFNNGLPANLSGAQGKRKAINHGFKAVQI
FT                   GVSAWTAEALKNTMPASVFSRSTECHNQDKVSMGTISARDCMRVLQLTEQVAAAALLAM
FT                   SQGIRLRIAQEELVPSSITPSLGKTLAQVEADFELLTEDRPLEQTLRSTVDKIQNGYWE
FT                   VCS"
FT   gene            complement(442639..444369)
FT                   /locus_tag="Shal_0376"
FT   CDS_pept        complement(442639..444369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0376"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; lipid A
FT                   biosynthesis acyltransferase; KEGG: slo:Shew_3516 glycosyl
FT                   transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74951"
FT                   /db_xref="GOA:B0TPT0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPT0"
FT                   /protein_id="ABZ74951.1"
FT                   /translation="MRLALVIPNYNHRGAIEQTLERLAAFELPCYLINDGSDDDTRFLL
FT                   IELAEKYDWVTLIHHPFNRGKGAAVMTGLRTAYRDGFTHALQVDADGQHDLNDIPAMIA
FT                   RAESAPEVLISGLPQYDESVPKGRLYGRYITHFWVWIETLSFDIQDSMCGFRIYPLAAT
FT                   EKLFLSHALGERMDFDIEVLVRLYWQGVPVIHLPTRVIYPEDGVSHFQGLKDNVRISLM
FT                   HSKLFFGMLLRQPKKLWHKLTRPSQNKHWSSMRERGSYWGIKLLAQSYRLGGHWLCRAI
FT                   MYPVICYFFITGTTARAASKQFLTHVKLKQPNHPQLGEPLSWRDSLKHFFAFGNAALDR
FT                   IDAWCDRIKLEEVDFPNREMLASELAAGNGAVLLVSHLGNLELCRAISIHQRQVKVNVM
FT                   VLTQNAENFNRVLKQLNPDSSLNLIQVTELGPSTSMLLQQKIEAGELVVIAGDRTSSQT
FT                   AGRVIYQEFLGEQAAFPQGPFILAGLLDCPVYTMFCLRQNGRYHVHLEHFADTLKGPRA
FT                   GRAERLEQAVNEFSSRLEHFALSEPLQWFNFYDFWRKDEEFQRADAQSSDCSSKGQASK
FT                   "
FT   gene            complement(444369..444755)
FT                   /locus_tag="Shal_0377"
FT   CDS_pept        complement(444369..444755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0377"
FT                   /product="Beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabA/FabZ"
FT                   /note="PFAM: Beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabA/FabZ; KEGG: shn:Shewana3_0337 thioester
FT                   dehydrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74952"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR016962"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPT1"
FT                   /protein_id="ABZ74952.1"
FT                   /translation="MIKSKLPTIISCSKAQDSVTWRLDIAADLDYFNGHFPEQPVLPGV
FT                   TQLDWAIKLGCEHFGYPIDVATLEVLKFQQLMLPGSQVDLNVSHNAAKAKLTFAYSDGD
FT                   KRFASGRIALNSEAAPFTNSTDSH"
FT   gene            complement(444752..446131)
FT                   /locus_tag="Shal_0378"
FT   CDS_pept        complement(444752..446131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0378"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3514 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74953"
FT                   /db_xref="GOA:B0TPT2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPT2"
FT                   /protein_id="ABZ74953.1"
FT                   /translation="MTELLKSWLCQGPAAQQLISFNHHDIVTGSAFTAQVAQLQQQLTD
FT                   SDSQRWLLCCDSSDLFAVGLCAGLLAGKQIILPANTQAGTLSELTHEYDGVLANMPICE
FT                   GKAFLRLDKDLNPPTSDWPQTDKWGELVLFTSGSSGKPKRVVKSIDQLDAEVSVLEQTF
FT                   AQHLPHCSVISTVSHQHIYGLLFKILWPLAASRPFLSDLVEYPETLNYYANLFPNLCLI
FT                   SSPAQLSRLPDALDNERQLRAPSLVFSSGGPLSFDASKGVANCYGQAPIEVFGSTETGG
FT                   IAYRRQQQPNADWQAFAPIEIQQDPRDGALLLKSPYLPDNQWLKCDDKIDLHADGKFTL
FT                   QGRLDRIIKVEEKRLSLVQMESLLESHPYVAKAALLMLEQPKVQLGAAIELSEQGLEQL
FT                   EANGKLALNNQLKNHLLSQFERVTLPRRWRYVEQLPLDQQGKRVQSCMLALFDIDKFKS
FT                   K"
FT   gene            complement(446128..446676)
FT                   /locus_tag="Shal_0379"
FT   CDS_pept        complement(446128..446676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0379"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3513 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74954"
FT                   /db_xref="GOA:B0TPT3"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPT3"
FT                   /protein_id="ABZ74954.1"
FT                   /translation="MRLFLQIVTTLVVIGYPLAVYFGLHYLPAGSIALALCAILVLRLV
FT                   LQQQKVKALMLPILVGIGLTAGSFIAKENHWLLFYPVVINLTMLTLFGYSLKRGPSMIE
FT                   RFARLKEPELPDEAIGYLKKVTLIWCGLFIFNGAMALYTALYTSIETWTLYNGLIAYLL
FT                   IGSLLGGEWLYRTFWLKKS"
FT   gene            complement(446676..446924)
FT                   /locus_tag="Shal_0380"
FT   CDS_pept        complement(446676..446924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0380"
FT                   /product="phosphopantetheine-binding"
FT                   /note="PFAM: phosphopantetheine-binding; KEGG:
FT                   slo:Shew_3512 phosphopantetheine-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74955"
FT                   /db_xref="GOA:B0TPT4"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPT4"
FT                   /protein_id="ABZ74955.1"
FT                   /translation="MQSREQILEMLTQILVEEFEVDAEEITPEASLYEELDLDSIDAVD
FT                   LVIKLQQMTGKKIKPEEFKAVRTVNDVVSAIEGLVKE"
FT   gene            complement(446934..447188)
FT                   /locus_tag="Shal_0381"
FT   CDS_pept        complement(446934..447188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0381"
FT                   /product="acyl carrier protein, putative"
FT                   /note="KEGG: slo:Shew_3511 acyl carrier protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74956"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPT5"
FT                   /protein_id="ABZ74956.1"
FT                   /translation="MSLDNEVKQLIIDCLDLEDVSIEDIDSQAPLFGEGLGLDSIDALE
FT                   LGLAIKKQFDVKIEANSDTTKQHFYSVASLVSFIESQRV"
FT   gene            complement(447185..448003)
FT                   /locus_tag="Shal_0382"
FT   CDS_pept        complement(447185..448003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0382"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; KEGG:
FT                   slo:Shew_3510 phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74957"
FT                   /db_xref="GOA:B0TPT6"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPT6"
FT                   /protein_id="ABZ74957.1"
FT                   /translation="MTKPVTYKQPLAPKLTGLAYIPRWLGGTACYMAFALGGLLSSLTI
FT                   LPILRFWPGSPQQRIERVQRAVHLMFKGFVKMLTWAGVINLSHGDLSRLRDARGVIVTA
FT                   NHPTLVDVVVLISLMPNAGCIVKQGLWRNPFLRGVVSCAGYIPNRGAELLLEDCKSVLE
FT                   RGTNVIIFPEGTRTVIGEKINPFARGAANITLRTHSDLLPVFLKTNTVGLSKQQAWYQV
FT                   PRRTIGMHIEIGETLPYLRYDANAGGDAKMARQMTRDLENYYKQQLDRYL"
FT   gene            complement(447996..448733)
FT                   /locus_tag="Shal_0383"
FT   CDS_pept        complement(447996..448733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0383"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_3674 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74958"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPT7"
FT                   /protein_id="ABZ74958.1"
FT                   /translation="MHLKFSILSWGAWSPQCQQASDWLNWPTIASDDSAQQSAVPKLTH
FT                   VPAMQRRRLSKLTKIILEAVSQSAPPEQCRSIFASQHGEINRTIGLLNDIVAESPLSPT
FT                   GFSQSVHNTASGIFSILTGNQASSTSIAAGKNTFSQGFIEAFGQLHADPAPLLLVYADE
FT                   PVPQVYRQFSADPKWPIAGAFMLAPENCSQAALATLSLTADTREHKNDHEQLSLEQLIS
FT                   SLATKQNASGYLAGWHWELTCSD"
FT   gene            complement(448992..449858)
FT                   /locus_tag="Shal_0384"
FT   CDS_pept        complement(448992..449858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0384"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3508 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74959"
FT                   /db_xref="GOA:B0TPT8"
FT                   /db_xref="InterPro:IPR021382"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPT8"
FT                   /protein_id="ABZ74959.1"
FT                   /translation="MQLSQEDRISPQEKSSGTNGLAILAIVAVVALSAGGYYYLSGNEK
FT                   VEELQVIAPIVIPDPIPEQPLETEAVPEPEVIVEAESVQLPEVDPVPQVEPLPALADSD
FT                   EFVHQKVTNVADGMAIEPLLIEDNLVRQFVVFVDNLAQGELARKVSPLKAPNNSFTVSE
FT                   IANKTYINPDSYHRYDLYADFLASLNDEELAKTYKELTPLLSEAFVELGYNDISFNERM
FT                   QQAIEVMLDAPIIEQPIELDGVSVNYQFVDPKLEALPNAQKLMVRMGPENSRKVKSALR
FT                   RLQKHLN"
FT   gene            complement(450002..452092)
FT                   /locus_tag="Shal_0385"
FT   CDS_pept        complement(450002..452092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0385"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /note="KEGG: shn:Shewana3_0348 ATP-dependent DNA helicase
FT                   RecG; TIGRFAM: ATP-dependent DNA helicase RecG; PFAM:
FT                   helicase domain protein; nucleic acid binding OB-fold
FT                   tRNA/helicase-type; DEAD/DEAH box helicase domain protein;
FT                   SMART: DEAD-like helicases"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74960"
FT                   /db_xref="GOA:B0TPT9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPT9"
FT                   /protein_id="ABZ74960.1"
FT                   /translation="MSANRLQRLDLVPITDLKGVANKMAERLAKLSITTVQDLLFHLPL
FT                   RYEDRTQVYPIASLYPGSYGTIEAVIQSSQIIQGRKRMLTCTVRDDTGSLTLRFFNFSV
FT                   AQRNGLEIGMTIRAYGEIRRGKHFAEIIHPEYKLISPGEDLQLSDTLTPVYPTTEGLKQ
FT                   ASWIKLTEQALAMLDNGGLQELLPPNLQPNNLDLKQALQILHRPNNQVSLFELEQGTHP
FT                   AQQRLIQEELLAHNLSMLRLRQRSNRDKAVSMHATGQLLNPFLASLPFKPTGAQQRVVA
FT                   DITQDLAKHEPMMRLVQGDVGSGKTLIAALAALQAIESGYQVAMMAPTELLAEQHALNF
FT                   SSWFEPLGLKVGWLAGKLKGKARAQSLADIESGDAHIVIGTHAIFQEQVVFNKLALIII
FT                   DEQHRFGVHQRLGLREKGISQGFHPHQLIMTATPIPRTLAMTAYADLDTSIIDELPPGR
FT                   TPVTTVAISEQRRDEVIDRVRQAAINDKRQTYWVCTLIEESEVLECQAAEDTAEELKRV
FT                   LPELKVGLVHGRMKPAEKQQIMADFKAGELNLLVATTVIEVGVDVPNASLMIIENPERL
FT                   GLAQLHQLRGRVGRGAVASHCVLLYKPPLSATATKRLGVLRQSNDGFVIAQQDLEIRGP
FT                   GEVLGTKQTGIADMKIADLMRDEALIPHVQKLAAHVMQQAPTSVDAIIERWLGDREQFV
FT                   QA"
FT   gene            complement(452235..453161)
FT                   /locus_tag="Shal_0386"
FT   CDS_pept        complement(452235..453161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0386"
FT                   /product="Na+/Ca+ antiporter, CaCA family"
FT                   /note="TIGRFAM: Na+/Ca+ antiporter, CaCA family; PFAM:
FT                   sodium/calcium exchanger membrane region; KEGG:
FT                   shw:Sputw3181_3775 Na+/Ca+ antiporter, CaCA family"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74961"
FT                   /db_xref="GOA:B0TPU0"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPU0"
FT                   /protein_id="ABZ74961.1"
FT                   /translation="MFILLSILGGFLILTVGAEALVRGASQIALRLGLTPLLIGLTIVA
FT                   FGTSAPELAVSVKSAIAGNSGIALGNVIGSNIANIGLILGITALIRPIKIESQMVRRDI
FT                   PIMIAASLLFWSLLLDGGLSFWDGAILSALLVAYLTFSYLTAEKQTDDDIEDAQQNPML
FT                   SVLFIVIGISMLVGGGILFVDGAVAMAKSFGISEVIIGLTIVAIGTSMPELVTSIVAAL
FT                   KGQSDIAIGNVVGSNIFNVLGILGVTALIHPIIGSEISNLDWAAMIALAVLLLPFAYTG
FT                   LRIGRREASLLIAGYVAYIGYIVSQAV"
FT   gene            complement(453340..454995)
FT                   /locus_tag="Shal_0387"
FT   CDS_pept        complement(453340..454995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0387"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   slo:Shew_3502 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74962"
FT                   /db_xref="GOA:B0TPU1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPU1"
FT                   /protein_id="ABZ74962.1"
FT                   /translation="MESSMKTPIEMLEHWVEKQGDQVYLKQPIDGQYKTFTWRDVQTKM
FT                   QQIAGALRHLGLNPGDKIAVLSKNCAEWFITDLALMHGGYISVPIYPTANADTIRYTLE
FT                   HSESKAIFIGKLDYWADQEAGVGGDILRIAMPYDTMPSQYHWDKMLTLGQPLIDAPLPT
FT                   AEQVMTIIYTSGSTGRPKGAIQNFASYVWTCTAVVRDLKTGVEDRLLSYLPLAHITERV
FT                   AIEGSSFYSGSSVAFVESLDSFVADVQRARPTVFFSVPRLWSLFQKNIIDKIGYSKLNF
FT                   LLKVPIISGIVKRKIHQGLGLEHCHLLGSGSAPIPPSLVEWYHKIGLDISEAWGMTENC
FT                   AYSIINYPFDPRKIGSVGRAIEGCEAKCSDVGELLVKSPGLMQGYYKQEEESAKCFDKE
FT                   GFFHTGDLCTIDDEGNVSITGRVKDNFKTSKGKYVAPVPIERKLAQDPHIEMLCVIGSG
FT                   LPHPIALVQLSEGAAVQPREEVRLSLKNTIDSVNPHLESHETVDAIVIVTEAWDVENDV
FT                   LTPTLKIKRHVLEKKFSDKVDGIRGGKVCWEDEI"
FT   gene            complement(455259..455945)
FT                   /locus_tag="Shal_0388"
FT   CDS_pept        complement(455259..455945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0388"
FT                   /product="tRNA guanosine-2'-O-methyltransferase"
FT                   /EC_number="2.1.1.34"
FT                   /note="PFAM: tRNA/rRNA methyltransferase (SpoU); KEGG:
FT                   slo:Shew_3501 tRNA guanosine-2'-O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74963"
FT                   /db_xref="GOA:B0TPU2"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR022724"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR033671"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPU2"
FT                   /protein_id="ABZ74963.1"
FT                   /translation="MSPERFARINQMLDNRQPDLTVCLDTVHKGNNIAAVLRTADAAGI
FT                   HEVHAVWSELEMRVSGNTASGSQQWVKTRVHQSMQQAVDEFRGKEMQILATTFSDTAVD
FT                   FREIDYTRPTAIILGNERDGVSPAGIAAADQHIIIPMIGMVQSLNVSVAAALIMYEAQR
FT                   QRTAAGMYGTRKLDDAYCQIKLFEEGHPIYAKACRRKKLPYPAIDEAGQIVADEDWWQK
FT                   MRAPLD"
FT   gene            complement(456021..456404)
FT                   /locus_tag="Shal_0389"
FT   CDS_pept        complement(456021..456404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0389"
FT                   /product="putative endoribonuclease L-PSP"
FT                   /note="TIGRFAM: putative endoribonuclease L-PSP; PFAM:
FT                   Endoribonuclease L-PSP; KEGG: slo:Shew_3500 putative
FT                   endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74964"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPU3"
FT                   /protein_id="ABZ74964.1"
FT                   /translation="MAEKIIIATDKAPQAIGTYSQAVKVGSTVYLSGQIPLNPETMQIV
FT                   SDEFEAQVVQVFNNLIAVCEAAGGSLSDIVKLNIFMTDLSNFATVNEIMGRYFDQPYPA
FT                   RAAIGVKQLPKDALVEMDGVMEI"
FT   gene            complement(456435..458540)
FT                   /locus_tag="Shal_0390"
FT   CDS_pept        complement(456435..458540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0390"
FT                   /product="(p)ppGpp synthetase I, SpoT/RelA"
FT                   /EC_number="2.7.6.5"
FT                   /note="KEGG: slo:Shew_3499 (p)ppGpp synthetase I,
FT                   SpoT/RelA; TIGRFAM: RelA/SpoT family protein; PFAM: amino
FT                   acid-binding ACT domain protein; TGS domain protein;
FT                   metal-dependent phosphohydrolase HD sub domain; RelA/SpoT
FT                   domain protein; SMART: metal-dependent phosphohydrolase HD
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74965"
FT                   /db_xref="GOA:B0TPU4"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPU4"
FT                   /protein_id="ABZ74965.1"
FT                   /translation="MYLFEGLKESASGYLEPEQVELLKQAYQVARNAHEGQMRTSGEPY
FT                   ITHPVAVARILADMRLDHETLMAALLHDTIEDTPVTKEELAELFSESIAELVEGVSKLD
FT                   KLKFRDKKEAQAENFRKMMMAMTQDIRVILIKLADRTHNMRTLGALRPDKRRRIARETL
FT                   EIYAPIANRLGIHNIKIELEDLGFQAYYPMRYRVLKEVVKAARGNRKELIQSIEAAIHT
FT                   RLEDTGLEGAVKGREKHLYSIYNKMRNKELQFQEVMDIYAFRVIVDSIDTCYRVMGAMH
FT                   GLYKPHPGRFKDYIAIPKANGYQSLHTSLFGPHGVPVEIQIRTEDMDQMADKGVAAHWL
FT                   YKKGSSAEQGTTTQVRARKWMQSLLELQQSASTSFEFVENFKTELFPEEIYVFTPEGRI
FT                   LELPVGATPVDFAYEVHTDVGNTCVGAKVNRQAYPLSQPLISGQTVEIIIANGARPNAA
FT                   WLNFVVTGKARAKIRQLLKSLKEDDAILLGKRLLNHALGEAKLDSLSAEQIDKVVKDTK
FT                   HDSLDSLLADIGLGNAMSIVIAQRLLGDQIAPEESKENHTMSIRGAEGMLVTFANCCRP
FT                   IPGDAVIAHVSPGKGLVVHMESCANIRGYQGEPDKYIPVQWDSAEGVEYQANLRVEIVN
FT                   HQGALAKITSIIASAGSNIHNLTTEERDGRVFLINLRISVRDRIHLANVMRRIRVLPEV
FT                   LRTSRNR"
FT   gene            complement(458554..458835)
FT                   /locus_tag="Shal_0391"
FT   CDS_pept        complement(458554..458835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0391"
FT                   /product="DNA-directed RNA polymerase, omega subunit"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, omega subunit;
FT                   PFAM: RNA polymerase Rpb6; KEGG: slo:Shew_3498 DNA-directed
FT                   RNA polymerase, omega subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74966"
FT                   /db_xref="GOA:B0TPU5"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TPU5"
FT                   /protein_id="ABZ74966.1"
FT                   /translation="MARVTVEDAVNQIGNRFDMILVAARRARQIAVQGKDPMVEEENDK
FT                   PTVIALREIELGLVTADTLDADERQTVREREAAEIAAVAAIAEGRNAI"
FT   gene            complement(458897..459556)
FT                   /locus_tag="Shal_0392"
FT   CDS_pept        complement(458897..459556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0392"
FT                   /product="Guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /note="KEGG: shm:Shewmr7_0330 guanylate kinase; PFAM:
FT                   guanylate kinase; SMART: guanylate kinase/L-type calcium
FT                   channel region"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74967"
FT                   /db_xref="GOA:B0TPU6"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0TPU6"
FT                   /protein_id="ABZ74967.1"
FT                   /translation="MALIVQSSDMQLMTARGNLFIVSAPSGAGKSSLISALLRDQPLDM
FT                   QVSVSHTTRQPRPGEENGQHYHFVNQDEFKGLITDGAFFEWAEVFGNYYGTSRVTIEQT
FT                   LEQGIDVFLDIDWQGAQQVKQLMPESIGIFILPPSKTELERRLTGRGQDSEEVIAGRMA
FT                   QAVSEMSHYNEYDFVLVNDDFDKALADLLAIIRSQRLTSASQIHTQNDMIKDLLAG"
FT   gene            459858..460988
FT                   /locus_tag="Shal_0393"
FT   CDS_pept        459858..460988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0393"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3496 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74968"
FT                   /db_xref="GOA:B0TQH5"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQH5"
FT                   /protein_id="ABZ74968.1"
FT                   /translation="MQVKSFFCVNGLDSGQRFATISGLIYFTLLLAVVIFSPSLALYFV
FT                   GLLLTPVLAFTSLRRLRDCAKPPQLALLTLVPFWLALITLVHVHSMMLLLTLLVIAGLA
FT                   IGYLAVLPAASRVDYVQGYAGPVDMSSSKGSGRMANFRVRVEPTLGGEEVAESMAINST
FT                   DETYPRAEEQQAPEAAREYQQHSRRGKKQAALNMAQLQSLLLTNKKIVFIAAGSVVGVM
FT                   LMVSLLSLIPASEADIETASDSDSKVVNETLELVPVNRISTSMPDGFSLALEDDVLIMR
FT                   WLGETGSPVNLWSLATAKGDKTCSLMRFNNGTEYRPLMVDLLADTGTEARFSPLDTEAI
FT                   IVDMARRGNVSLCGYNFSLKGSQAALGKVAAFRTYL"
FT   gene            461132..462037
FT                   /locus_tag="Shal_0394"
FT   CDS_pept        461132..462037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0394"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_0332 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74969"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQH6"
FT                   /protein_id="ABZ74969.1"
FT                   /translation="MGNNKQDLTLVILAAGLGSRFGGDKQLAQLGPNGETMLELSIQSA
FT                   YKAGFSRAVLVIRSELASMLDEALAGKFSDDFSCQYCVQSLDDLPASAREFADASQRQK
FT                   PWGTAHALWSARNHVVGPMAVINADDFYGDSAFSLLSEGLSTANDDWMMVAYPIGLTLS
FT                   DNGGVNRGLCQVEAGKLIDVAEWLDIRCEPSGLTGTLDGERLTIADDAVVSMTCWGFKP
FT                   DIFEVIEQQFSHFLEHNGHHPKAECYLPTVVQARLDAPSDAQANKVVNVSVAKESWYGV
FT                   TYPEDVQWVRQKLQQTLCSN"
FT   gene            462129..463199
FT                   /locus_tag="Shal_0395"
FT   CDS_pept        462129..463199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0395"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   sbm:Shew185_0356 aminoglycoside phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74970"
FT                   /db_xref="GOA:B0TQH7"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQH7"
FT                   /protein_id="ABZ74970.1"
FT                   /translation="MIDFIRQNILSHFGIDAASAKVSPLGNGHINHTFLVRGNDNEFVL
FT                   QKINTDVFKTPSALVNNADKISQHLQMKAAAGEYQLQVVSPELTASDELFVDLGEQGFW
FT                   RAINYLPFSHSIDVVGSEADAEMAAKAFGHFSCALTELDAELLEDVIPNFHHLPGRIEL
FT                   LAQAVEADSHGRLVECKLWVDFVMSQSELLQELAEVEGKLPRRICHNDTKINNMLFDKR
FT                   DMTSLAIIDLDTCMKGYLMYDFGDMVRTFYSPEEEDSTALDKVLVRESIFGAICSGYLS
FT                   ELGAVLSEQERKSLWLGARVMCLMIGVRFLTDHLNGDVYFQIHHAGHNLERAANQFTLY
FT                   QSLLSQQEVLCKFLQS"
FT   gene            463660..464946
FT                   /locus_tag="Shal_0396"
FT   CDS_pept        463660..464946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0396"
FT                   /product="acetyl-CoA hydrolase/transferase"
FT                   /note="PFAM: acetyl-CoA hydrolase/transferase; KEGG:
FT                   slo:Shew_3493 acetyl-CoA hydrolase/transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74971"
FT                   /db_xref="GOA:B0TQH8"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR038460"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQH8"
FT                   /protein_id="ABZ74971.1"
FT                   /translation="MAPIICGSALEAVSLIESGETLWTHSMGATPTLLLNALAEHALTK
FT                   KDLTLLQLHTECAESLSDEKLKGHLRHRCFFGGLPTRLLLQQGDADYVPIFLSEVPKLF
FT                   RSGEQPIDTAIIQVSPPDKHGICSLGISVEATLAACQMAGKIIAHINPQMPRTHGDGFI
FT                   HYSKFTAVYEQSMPLPQHPLAASDQTSLAIGKNVAQLVRDGDCLQMGIGAIPDAVLSCL
FT                   TEHKDLGVHTELFSDGVLNLVELGVITNRFKKVHPGKTVTGFALGSQRLYDFVDDNPSV
FT                   IFMDIEQVNDTAIIRKNPNVMAINSALQVDISGQICADSLGTRIYSGVGGQMDFIRGAG
FT                   LSEGGRSVIALPSTAARGSVSRIATVLSPGAGVVTTRAHVHYIVTEFGIANLRGKSLRE
FT                   RARALIDIAHPDFRELLCRETFDMWGLTV"
FT   gene            complement(465034..465732)
FT                   /locus_tag="Shal_0397"
FT   CDS_pept        complement(465034..465732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0397"
FT                   /product="protein of unknown function DUF159"
FT                   /note="PFAM: protein of unknown function DUF159; KEGG:
FT                   maq:Maqu_3372 protein of unknown function DUF159"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74972"
FT                   /db_xref="GOA:B0TQH9"
FT                   /db_xref="InterPro:IPR003738"
FT                   /db_xref="InterPro:IPR036590"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQH9"
FT                   /protein_id="ABZ74972.1"
FT                   /translation="MCGRLNIIDDMFVQTLMDDLRISNQQEMLFGRFKMPTNDISIVRE
FT                   IDGERRLQTATWWLLLETCYEGFKPSRYTSFNTRFDKLNTPNSAGFQPFRESRCLVIAS
FT                   GFGETEKRGKDTYYHDFIAENSAIAFGGLFRDWQHPKTGEVTTSCSIITNPPHPDLLPY
FT                   HSKASPMILPQNDEVIDAWLNPANQQVEMFDDLLKPALRHDFMVQQINKPSQHQPIGQA
FT                   TRLIPNDYLV"
FT   gene            465927..467195
FT                   /locus_tag="Shal_0398"
FT   CDS_pept        465927..467195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0398"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase; KEGG: vha:VIBHAR_06184
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74973"
FT                   /db_xref="GOA:B0TQI0"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQI0"
FT                   /protein_id="ABZ74973.1"
FT                   /translation="MKKLIINANVFNGTDNQLIENVAVLIEDNLISKISRQDDIDLSIA
FT                   DEVIDAKGGTVMPGLMDAHVHITLSAPFNVIDTMTREEVAIRSARISEEMLMRGFTTIR
FT                   DVAGNTLGLKNSIDKGYAKGPRILPSMAAVSQTSGHSDYRQNQAQERIGKHEDSPMMKL
FT                   GAMKVADGRSEVLKAVREQLFMGASQIKIMAGGGASSTFDPLDTLQFTLDEMKAAVEAA
FT                   TDYGTYVAAHIHTADAMRRAAEAGVMSFEHATIMDDDIAQTIKDKGIWVIPSYFTSSLI
FT                   AERKIPLPNEETYRKTERVGKAMLKSAELIKKYQIDNIAFGTDCVGEASVHATQLNELG
FT                   AIEQTFDTITALRMATSNCGRLFEMSTYQHPYQEGCLGKVVEGAYADLLIIEGNPLEGV
FT                   ACVADTNKQKVIMKDGVIYKNTL"
FT   gene            467410..468852
FT                   /locus_tag="Shal_0399"
FT   CDS_pept        467410..468852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0399"
FT                   /product="Pyridoxal-dependent decarboxylase"
FT                   /note="PFAM: Pyridoxal-dependent decarboxylase; KEGG:
FT                   ppr:PBPRB0277 hypothetical amino acid decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74974"
FT                   /db_xref="GOA:B0TQI1"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR021115"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQI1"
FT                   /protein_id="ABZ74974.1"
FT                   /translation="MSHHFKDYRGSLERSLDHAVSYLESLDERPVAKDITSAQLRDLIA
FT                   GELPQQGVAAEQVIDEMAYALDAGLVASGGPRFFGYAIGGTFPAALAADWLVSAWDQNV
FT                   PYYVSSPAMAVAEEAAAEWMVELLGLTKGSAVGFTSGAQEAIYTSLITARNSLLENAGW
FT                   DVATKGLYGAPQVNVVVSDQIHSTIKRALSMIGLGIETIVKVPTDDNLRLIPEELTRVL
FT                   ADISGPTLVCAQAGCIDSGAFDPFDEIADAVAKHGNAWLHVDGAIGLWAAASDKQKHLL
FT                   KGIERADSIDTDGHKWFNMPYDCGMVIVKDPAKITTAVGGGNMGDYLNDAMDKPDRNAI
FT                   NFGIAASRRARGLPVYAAFKSLGKQGIVNHLDNCCALAKRMADILREVDGVTILNDVVS
FT                   NRFSAQFGIGDVEYRNELTARVVHRLQQEGYLYPSTSGYKGLKTMLFSVLNYHTSIEDI
FT                   DISANKIIEAFNIEKALLPKSV"
FT   gene            468890..469324
FT                   /locus_tag="Shal_0400"
FT   CDS_pept        468890..469324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0400"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppr:PBPRB1867 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74975"
FT                   /db_xref="GOA:B0TQI2"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQI2"
FT                   /protein_id="ABZ74975.1"
FT                   /translation="MTQQRFVGYSLAVLVYLTVLNFFNEYWQWVNIESFSVSLVAALLL
FT                   LTLLKLSIKTEHKVAAFFKAKPGRAAKVYRGISTYIILVGSKFMILEAINVMFGEKVSF
FT                   SGPFNGVVAFFAVVFVILISEFMVSKIYAALSDTNELQVA"
FT   gene            complement(469485..470939)
FT                   /locus_tag="Shal_0401"
FT   CDS_pept        complement(469485..470939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0401"
FT                   /product="permease"
FT                   /note="PFAM: permease; KEGG: mbb:BCG_2984 putative integral
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74976"
FT                   /db_xref="GOA:B0TQI3"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQI3"
FT                   /protein_id="ABZ74976.1"
FT                   /translation="MEHSLSDLVIHLFSTFGNMVWQIYWPLVFGLILSSWIRNIIPVSS
FT                   VVKHLGKTSLTSLALTTVLGMVSSSCSYAAASLSHTLLEKKSTVANAMAFLVSSTNLIL
FT                   EMFIVLVALMGWTFLWGEILGGLILIVTVGFLFHRFYPKDVEQELRQHFNASQQATANT
FT                   AMDMSKMKEGSRGADMDMSKMKEGSCGADMDMSKMKESSRGADMDMSKMKEGSCGADMD
FT                   MSKMKEGSCGADMDMSKMKEGSCGADMDMSKMKEGSCGADMDMSNMKEGGSGANMSAPE
FT                   PVAGFMAKVSKSAGFFHMDIAMIGKEILIGVVISSILIAIVPLDGWRSLFISNDVGLPI
FT                   WLHSVIDVLIGIFVAMLAYVCSVGNLILAAALWHGGISFGGVIGFILSDVLTIPMIRVY
FT                   TKYYGVRPTKWIVGLLFIAIFFTALCIDAIFNGFGWIIASGGERTINQAGLGWNFTSIM
FT                   NLIFIPLSIWYYYLGKKANANMHMSM"
FT   gene            complement(471098..471766)
FT                   /locus_tag="Shal_0402"
FT   CDS_pept        complement(471098..471766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0402"
FT                   /product="ERCC4 domain protein"
FT                   /note="PFAM: ERCC4 domain protein; SMART:
FT                   Helix-hairpin-helix DNA-binding class 1; KEGG:
FT                   spc:Sputcn32_3619 ERCC4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74977"
FT                   /db_xref="GOA:B0TQI4"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR006166"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQI4"
FT                   /protein_id="ABZ74977.1"
FT                   /translation="MNKPPIEIVYDDRERAEILIKQLSKQTDLRLVRKRLNLGDYQINE
FT                   WLIERKTLSDFVISLCDGRLFSQVSRLSKSPNNTALLIEGSSRDIAAYGITREAVMGAL
FT                   CSIAINFNMPILRSLSQAESAKILYFCATQLNSWETGVISNGRKPKRHKNRQLFILQSL
FT                   PQVGPKLAKRLLIHFESIEAVFTAPEEELLKVEGIGQEKARGIRGILTSTNKRGHNQPD
FT                   "
FT   gene            complement(472030..472743)
FT                   /locus_tag="Shal_0403"
FT   CDS_pept        complement(472030..472743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0403"
FT                   /product="cytoplasmic chaperone TorD family protein"
FT                   /note="PFAM: cytoplasmic chaperone TorD family protein;
FT                   KEGG: sfr:Sfri_3126 cytoplasmic chaperone TorD family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74978"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQI5"
FT                   /protein_id="ABZ74978.1"
FT                   /translation="MLALHSLNEESNCGKHTMSSEQLINHKDEIQAIDDDLILASLNLL
FT                   YRFFYFEPEDSLLLKVEESHILHFWQAEMGISTLETEIFLSQASALEQLQSDHLSLFVG
FT                   IGMPKAMPWGSVYLSEDNLLLQKSTYALAGFLEDKHLRFQLDEKQPLDHIGLCLSALAS
FT                   LLERHIRAKDASSERCVCEFLCVHILPWSFRFTELLTKNAETALYRLLGKITLHTLTQL
FT                   QAKWQLTPVQRQLYY"
FT   gene            complement(472769..475192)
FT                   /locus_tag="Shal_0404"
FT   CDS_pept        complement(472769..475192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0404"
FT                   /product="anaerobic dimethyl sulfoxide reductase, A
FT                   subunit, DmsA/YnfE family"
FT                   /note="TIGRFAM: anaerobic dimethyl sulfoxide reductase, A
FT                   subunit, DmsA/YnfE family; PFAM: molybdopterin
FT                   oxidoreductase; molydopterin dinucleotide-binding region;
FT                   molybdopterin oxidoreductase Fe4S4 region; KEGG:
FT                   ent:Ent638_1418 anaerobic dimethyl sulfoxide reductase, A
FT                   subunit, DmsA/YnfE family"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74979"
FT                   /db_xref="GOA:B0TQI6"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR011888"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQI6"
FT                   /protein_id="ABZ74979.1"
FT                   /translation="MFNKQKNTLSTESQGVSRRGFLKLGASLGVSAFISTQPLNAIAAM
FT                   VIDKHVGEVAKWHNCWAHCHSSCLLKIITQDGQIKRIETDDQGDDVFGRHQVRACLRGR
FT                   SLHKRTFSPDRLKYPMKRVGKRGEGKFKRISWDEALTEVHSQMSKIITEHGNQAIFSRV
FT                   GYGKPHGPYHYVPRFLNQIGGFLSPSGNYSSHQIDTASLYTYGDKSYTIGSAPTEIAHS
FT                   DLVVYFGNNPANTRMSGGSDTYHYQESKSQSSARTIIIDPQYTDTACGREDLWLAIRPG
FT                   TDAALVEAVAWVLINEKYVDEAFLKSHCYGYDAEPGDVSKGIPSLDQSLSYKAYILGKG
FT                   ADGIEKTPEYTAAICGIPKEQIYQMARSLGQAKAPFIAQGWGPQRHAAGEQTARAIYML
FT                   PILLGQLGLPGTNNGGSDFLFHKTDIMQMPTGANPVKAKVPCFKWLEAVERGHEMTEFT
FT                   DGITGADKLTSDVKCVFMYQGNWLLNQHSDCNATAKILADESKLEFIFVMDNHMTASAK
FT                   YADILLPDITWLENSRIVAFSTHLTKTEHVLDPMYECRHPYEVFADLADKFGIRQQFTQ
FT                   GRSWDDWQRHLYEQSRLNHPQFPPFEVLDKHKTIRIPFDPNEERYTLKEFREDPLTNPL
FT                   KTESGKIQIYSHKLAKFAATWTLPVGDKISPLPEYTPTWESYADKKQLVEHPLQLIGFK
FT                   SKGRPHSTFHNVPWLREVIEDALMMNPIDAKDRQLKQGQLVHVYNNRGTIRIPVRITPR
FT                   IMPGVVAMGEGAWYSPNELGVDVGGCINTLTNLRPTALAKANPQGTNLVEVCGI"
FT   gene            complement(475223..476062)
FT                   /locus_tag="Shal_0405"
FT   CDS_pept        complement(475223..476062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0405"
FT                   /product="putative anaerobic dimethyl sulfoxide reductase,
FT                   subunit C"
FT                   /note="KEGG: stm:STM4307 putative anaerobic dimethyl
FT                   sulfoxide reductase, subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74980"
FT                   /db_xref="GOA:B0TQI7"
FT                   /db_xref="InterPro:IPR007059"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQI7"
FT                   /protein_id="ABZ74980.1"
FT                   /translation="MHEIPLVIFTVLAQAVAGSFILLCALRLAYPQQLGGNSQLLQRCF
FT                   LCLWSIFAIAGLAATTHLGQPLRAANVLFGLAHLSPMSVEIIMVSIFGALGTGSSLLLW
FT                   RKADSRLVNILLLTAALAAIGQLFAIANVYSLPTVYLWSNHWTPINLVFSGLITGSMLT
FT                   SLLLNTCQIQPVKTPLKLSALKPILAIIFLLTLVLSTAYAMQLTEQLHKLGASLPVWLQ
FT                   LLQIGRISLLAIGFISCLVIKLNTYKSTPLLLATLTVLTAEILGRILFYELGLLQQL"
FT   gene            complement(476065..476688)
FT                   /locus_tag="Shal_0406"
FT   CDS_pept        complement(476065..476688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0406"
FT                   /product="Dimethylsulfoxide reductase chain B"
FT                   /note="TIGRFAM: Dimethylsulfoxide reductase chain B; PFAM:
FT                   4Fe-4S ferredoxin iron-sulfur binding domain protein; KEGG:
FT                   vfi:VFA0081 anaerobic dimethyl sulfoxide reductase chain B"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74981"
FT                   /db_xref="InterPro:IPR014297"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQI8"
FT                   /protein_id="ABZ74981.1"
FT                   /translation="MKLEYGFYVDSSKCTGCKTCQVACKDKNELPIGVNYRRVYEYAGG
FT                   EWLKGLDDTWQQNVFAYYLSISCNHCAEPACTKACPTGAMHKRSQDGLVVVDTDVCIGC
FT                   RYCEMACPYGAPQYNPEKKHMTKCDGCYELLAQNKKPICVSSCPLRALDFGPIDELRAK
FT                   YGEFADIAPLPDSSLTKPSLVIKPNRHAKPTGDKSGALCNKAEL"
FT   gene            complement(476840..477514)
FT                   /locus_tag="Shal_0407"
FT   CDS_pept        complement(476840..477514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0407"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; response regulator
FT                   receiver; Sigma-70 region 4 type 2; KEGG: spc:Sputcn32_0666
FT                   response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74982"
FT                   /db_xref="GOA:B0TQI9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQI9"
FT                   /protein_id="ABZ74982.1"
FT                   /translation="MIMTNTNLYLVDDDESVLDALDFALQGEGYQPLSFNSAEAFWLWA
FT                   KQHADKMNEGGCLILDSRMPGMSGQELQYQLSQTDCSLGIVFLTGHGDVPMAVDALKLG
FT                   AVDFLQKPIEITKLLKAVSQAFDASTSSKELKSAIRCYEELTLRERDILQLLAQGKTNQ
FT                   QLAELLFISARTVEVHRSNMLKHLQMDSLAKMVRLYTLVEPYLSSIAPPPLRIRRKTKH
FT                   ND"
FT   gene            complement(477495..479276)
FT                   /locus_tag="Shal_0408"
FT   CDS_pept        complement(477495..479276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0408"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: ppr:PBPRB0007
FT                   hypothetical histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74983"
FT                   /db_xref="GOA:B0TQJ0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQJ0"
FT                   /protein_id="ABZ74983.1"
FT                   /translation="MRFLYLASLLLCLLVPIKTLQSQPIAQTQTAKTDQIVAVGVFADR
FT                   GLDEAVQRWQPTIDWLSQHIEGYQFKLIPLSLSQLQNELSQQKLQFIIINPSESIRIAR
FT                   RQSLSWLATLLSPLNGGTSIATGSVIWVKSDSPYQNLHQLAGQKIGTASPQAFGGYMAM
FT                   QRELQRLGRDSDLLINTKVIGYPHESVVAELQEGDIAAAILPVCLVESMIRKGQISPNE
FT                   LRPINDMTPSGFECRVSTRLYPNWGFAMTGSADRTLAREILQSLLAIPKNSNTAQAAQS
FT                   LGWTVPESQIELDNLFNDLGVHPLQQPWWQLLWSWVQTHYYLIILMLIVATFLPIQHLI
FT                   LTLRYRRNSRKLGLAQANLQQAQRRALVDKMGSSLAHELNQPLSAIRLYTEGELSRRQK
FT                   GSSQTDIDQLLGKIRRQVIRVDEVVSRFRQLLHKQAVQKSQLDIALLLRDTVSLVELYA
FT                   HTHKVEITFHPTHDEMMFFGDRAGLEQLLVNLLTNAIDASASSSKKQVWVTLTLASSRI
FT                   KISIQDTGQGLERPIAELLTPFVTTKKEGVGLGLSICKEVAESHLGHLSFNNLDNGGCC
FT                   VSIEFPIPNIRDDNDKH"
FT   gene            complement(479557..480678)
FT                   /locus_tag="Shal_0409"
FT   CDS_pept        complement(479557..480678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0409"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: rca:Rcas_3855 mandelate racemase/muconate
FT                   lactonizing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74984"
FT                   /db_xref="GOA:B0TQJ1"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQJ1"
FT                   /protein_id="ABZ74984.1"
FT                   /translation="MLKITDIEVIHLRVPAMDADCEWGEDAVIVKVHTDKGIVGIGEAD
FT                   SSPLVVQACIEAPQTNFYCNGLKRLLIGENALEIERLWNKMYWGSNYMGRRGAGIHAIS
FT                   AIDIALWDIAGQFYGVPVHTLLGGKYREKIRCYGTFIPADKPEDNVAIVQGLKDQGFTS
FT                   IKFGGGVMGDDPDTDYAIVKAVREAAGPEMEVQIDLASKWHTCGHSAMMAKRLEEFNLN
FT                   WIEEPVLADSLISYEKLSRQVSQKIAGGESLTTRYEFQEFITKSNADIVQPDITRCGGI
FT                   TEMKKIYDIAQMNGTQLIPHGFSTGILLHASVHFLAACEQGTLMEFSQSSSPLFTSLVK
FT                   NQLQFDNGFVAVSDAPGLGIELDEELIAKYRVN"
FT   gene            complement(480682..482274)
FT                   /locus_tag="Shal_0410"
FT   CDS_pept        complement(480682..482274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0410"
FT                   /product="choline/carnitine/betaine transporter"
FT                   /note="TIGRFAM: choline/carnitine/betaine transporter;
FT                   PFAM: BCCT transporter; KEGG: pen:PSEEN2131
FT                   betaine/choline/glycine transport protein (BCCT family)"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74985"
FT                   /db_xref="GOA:B0TQJ2"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQJ2"
FT                   /protein_id="ABZ74985.1"
FT                   /translation="MTDITTTPVTDETVTQQSPVQNDKVQNDKLLISVSLAVVFAVVMM
FT                   LIFNPDQVQAAGKTAFAALTNTFGSFIQLFAFASVCTMLYIAVSRYGTIKLGEGQPEYS
FT                   NMSWLFMFICAGLGSATMYWAFMEWAYYYNGIGLNIEGQSNEALRTSLSYVMFHWGITP
FT                   WAIYGLASITMAYHFHVNRAKGLNLSSLMVSILGMKEDSTASRVMGRSLDLIFLFATFG
FT                   GLILTTTVTVNTVSTGFAELFGMENTFAIKAILLALITLTFTLSSYIGIAEGLQKIAHA
FT                   ACGMCFVFAVFVLVLGDTGFIVDFFVNSLGLTLSNFVEMSLFTDATNDGTFNKDWTVFY
FT                   WLYWFTYTPAVAIFVTRISKGRTIRQVVLGLIAGGCGGCWFFFGALTGYSVDAMVDGVV
FT                   NAPALLNSATGDIAVAQLIANLPFGTILSVFYFVLMMLFLASHLDATAFTVAAVSTKNL
FT                   KQGQDPTRELRVFWCVMLSLLPLAMLYINASLDTLKTAVTLTAAPFVVVLMLCMYGLKK
FT                   FLSNHKFDDCSEK"
FT   gene            482797..483132
FT                   /locus_tag="Shal_0411"
FT   CDS_pept        482797..483132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0411"
FT                   /product="putative carbohydrate hydrolase (N-terminus)"
FT                   /note="KEGG: cdf:CD3003 probable carbohydrate hydrolase
FT                   (N-terminus)"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74986"
FT                   /db_xref="GOA:B0TQJ3"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQJ3"
FT                   /protein_id="ABZ74986.1"
FT                   /translation="MKKAIQLDPVDNVATLLVDAVKGDEIEIISTNNQVIDVVTCLQGI
FT                   TFGNKVALTDIADQQLITKAGYPVGVAIMAIPRGELAHVQNVRSQRLDIPDNIIEEIIK
FT                   QMRIEQA"
FT   gene            483129..484310
FT                   /locus_tag="Shal_0412"
FT   CDS_pept        483129..484310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0412"
FT                   /product="D-galactarate dehydratase/Altronate hydrolase
FT                   domain protein"
FT                   /note="PFAM: D-galactarate dehydratase/Altronate hydrolase
FT                   domain protein; KEGG: cdf:CD3002 probable carbohydrate
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74987"
FT                   /db_xref="GOA:B0TQJ4"
FT                   /db_xref="InterPro:IPR007392"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQJ4"
FT                   /protein_id="ABZ74987.1"
FT                   /translation="MMSSFIGFGRADGSVGIRNHVLIMAVDECCDGIARAIADSIDNGI
FT                   VVTNYNTCMYGGNEEMINTMVHTGNNPNVAGVLVLAMGCGSIDPEIVAAPIRVSGRPAF
FT                   SLVCMKQQGTRATITQGKALAQELQQVAQAAPRIETPISKLVIGVKCGGSDTSSGIASN
FT                   PSVGRAVDKLVDLGATAIAGELIELVGCETILRQRAVSPEVADKLERLIHEEEARWHVD
FT                   GAEVETMSIGNSVGGLTTLEEKSFGALSKTGTRPIQDVLQINHLVHEKPKAAGFYLSEA
FT                   THLCGSAGMHFASLGAHLILWTTGGAGFNNPIVPVIRISGNQYLLNEDIDIDASGIMRA
FT                   EEGVESVAERIVAKVGTVAQGGQTNIEEIGYSYCSLYQKDQRLETLLRFKPGC"
FT   gene            484396..485298
FT                   /locus_tag="Shal_0413"
FT   CDS_pept        484396..485298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0413"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bur:Bcep18194_C7696
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74988"
FT                   /db_xref="GOA:B0TQJ5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQJ5"
FT                   /protein_id="ABZ74988.1"
FT                   /translation="MNTTQVSPSARLPQLSWFMAFKAVADKQSFTEASRELCLTQSAIS
FT                   QQVAKLEAVLRTKLFYRGGRQIQLTEDGQRLLLQINQPIQELMGVVDGFHHDAEHYTLH
FT                   IEMEPVFSRQVISKLLPKFLAKYPKLLVGQMLTTNHFDFLPQTELAIKWGDGEWEGFDS
FT                   QFLCSLDYVPVCSPEYLKRKPLTVPADLANANIIHDRDNFDWKYWLNYYPVAKLELQKC
FT                   HYASESQVVMSLAMSGLGVAVCAYQQIQEQLADGSLVMPFPELKVRHQRAYYILTRKNK
FT                   SLSPQATSFMQFVREAMLT"
FT   gene            485367..486035
FT                   /locus_tag="Shal_0414"
FT   CDS_pept        485367..486035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0414"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: reu:Reut_B4119 regulatory protein GntR,
FT                   HTH:GntR, C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74989"
FT                   /db_xref="GOA:B0TQJ6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQJ6"
FT                   /protein_id="ABZ74989.1"
FT                   /translation="MHQLFEPSVNDMKITKESLESQAVRYLRTHILEGHIKLGEKLVES
FT                   ALAKQLELSRSTVRMALNSLVNEGLVIQKPYSGWQVVEINQQDLWELYHLRVALESEAA
FT                   AMAAKWASCDDKALLADFFQEYQLLCLQHSGDTRRISEMDWQLHQMIIEMCGSERMQSQ
FT                   YKQILYPLQAYIALTHQDYDLSDSASSHQALVQAICAGDAETAAQQARANITPMTRSAD
FT                   "
FT   gene            complement(486132..487418)
FT                   /locus_tag="Shal_0415"
FT   CDS_pept        complement(486132..487418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0415"
FT                   /product="ammonium transporter"
FT                   /note="TIGRFAM: ammonium transporter; PFAM: Rh family
FT                   protein/ammonium transporter; KEGG: dsy:DSY4261
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74990"
FT                   /db_xref="GOA:B0TQJ7"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQJ7"
FT                   /protein_id="ABZ74990.1"
FT                   /translation="MSILNTGDTAFMLLCTALVLLMTPGLALFYGGLVRERNMLTIMLQ
FT                   NFICMGVIAIIWVFGGFSLAFGDDIAGVIGSLSQYFGMYHIGAVPNEHYASSIPFIIFF
FT                   AYQMMFAIITPALMTGAFAGRLQFPAYLKFIILWSLLVYIPVAHWMWGGGFLSTIGAVD
FT                   FAGGIVVHTTAGMSALAAAVYVGKRRSTRLGETESAASLPLVAIGAGLLWFGWFGFNSG
FT                   GAYAANQLAAYAFTNTTLAGSTAMLMWMFWEWRENGRPSFSGTLVGAVAGLATITPAAG
FT                   YVEPASAIFIGLIGATACYFAKAIQKKLGVDDALEVWRAHGVGGILGSLLVGLLASDAI
FT                   DEVQAGASQFLIQLVAVVVVAIYSWFITTLILKIIDRNGSLKVPDDIQESGLDYAELGS
FT                   NAYSRDDAKPVSQATQTKQQERPEDKHTK"
FT   gene            complement(487711..488979)
FT                   /locus_tag="Shal_0416"
FT   CDS_pept        complement(487711..488979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0416"
FT                   /product="nucleoside transporter"
FT                   /note="TIGRFAM: nucleoside transporter; PFAM: Na+ dependent
FT                   nucleoside transporter; nucleoside recognition domain
FT                   protein; Na+ dependent nucleoside transporter domain
FT                   protein; KEGG: son:SO_3706 NupC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74991"
FT                   /db_xref="GOA:B0TQJ8"
FT                   /db_xref="InterPro:IPR002668"
FT                   /db_xref="InterPro:IPR008276"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR011657"
FT                   /db_xref="InterPro:IPR018270"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQJ8"
FT                   /protein_id="ABZ74991.1"
FT                   /translation="MQILISIVGIITLLAVAFLASENRKAINYRTVGLAFLLQLVMGAF
FT                   VIYSSFGQAVIFNMAEAVSTVIGYSNEGMSFMFGGLVSDKMYELFGPGGFVIAFKVLPI
FT                   IVFFSAISAILYYLGIMQWVVRIVGGALQKILNTSKAESMSASANIFLGVTEAPLLIKP
FT                   YIPKMSRAELFAVMCGGLASIAGTMLAGYAQLGIKMEYLLAASFMAAPGGLLFAKLLIP
FT                   QTEKVNDQDLTVVEENPPANIIDAATTGTMNGLSLAMAVGAMLFAFVSLVALMNGMLGG
FT                   IGNWFGFEGLSLQLILGYLFAPIAWLMGIAWDEALLAGSFIGQKIVINEFFAYINLAPY
FT                   LSGDAIVEATGMPMSERTQVILSFALCGFANLGTVAIAIAGIGGLVPERRSEIASLGLK
FT                   ALLAGVLSNLMAATIAGLFMSLA"
FT   gene            complement(489231..490070)
FT                   /locus_tag="Shal_0417"
FT   CDS_pept        complement(489231..490070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0417"
FT                   /product="purine or other phosphorylase family 1"
FT                   /note="PFAM: purine or other phosphorylase family 1; KEGG:
FT                   son:SO_3705 5-methylthioadenosine
FT                   nucleosidase/S-adenosylhomocysteine nucleosidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74992"
FT                   /db_xref="GOA:B0TQJ9"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQJ9"
FT                   /protein_id="ABZ74992.1"
FT                   /translation="MPTCEQLLTEKLNSEHLNPEQLHNEKLPSKMLNPILVQGAMDVEV
FT                   ETLVAALSDVKQKTFGAWTFWQGLLDGYPVVVSRTEIGLANAAASTTLGIAHYQPKVII
FT                   NQGTSGGHDPKLFRSDIVIGATSFNMGAYKIEFVEKGQGIHPTTWQNFDMPMYLRENGV
FT                   VVEHNHFKADPALVEIALSQASSYTHGKVVVGRIGSCDEWNREVDRINWFHETMGTSVE
FT                   EMETSAAAQVAEAYKLPFVSIRVLSNTDQHKQDFEPQTAIDCQVYVLDVIKALIKTF"
FT   gene            complement(490530..493748)
FT                   /locus_tag="Shal_0418"
FT   CDS_pept        complement(490530..493748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0418"
FT                   /product="type III restriction protein res subunit"
FT                   /note="PFAM: helicase domain protein; type III restriction
FT                   protein res subunit; DEAD/DEAH box helicase domain protein;
FT                   SMART: DEAD-like helicases; KEGG: cps:CPS_3374 putative
FT                   helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74993"
FT                   /db_xref="GOA:B0TQK0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR021835"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQK0"
FT                   /protein_id="ABZ74993.1"
FT                   /translation="MIKAFFMNQTGIYEQLITQLVEQKLDRKAFYVGERSLENGEAASW
FT                   LSRFLTRIIEIAIDSVPNGNDRVFEQISLANKVIEWLSSNIGDSELITENLIDTQGKIL
FT                   TALLDKQNPISSDLPKYIDGIMPLTGLTQSELFCGSNVGVSLETEIKREIQSSDKIYWL
FT                   LSFIKWAGIRIFKKELEEFTRSGKQLKVITTSYMGATDAKAVEFLASLPNTQVKLSYNT
FT                   NRERLHAKSYLFMRNSSFHTGYIGSSNLSHSALTSGLEWNLKITSQEIPHIIEKSLSTF
FT                   ETYWESPDFEYFDGKTQSKERLISALQYAKGTYDSAEPSFYFDIKPHSHQRAILDKLKV
FT                   ERELHSRYRNLVVAATGTGKTIISAFDFAEFYAANPEAKFLFLAHREEILKQARSAYRG
FT                   VLKSNQFGELLVGQNKPQKFNQLFASIQSLNNQLATIQLTEDYFDYIVIDEVHHIAASS
FT                   YRPVLQHFKPQILVGLTATPERHDGADILKDFCNVIAAEIRLPEAINQRHLSPFQYFAV
FT                   DDDTDLTKISWAKGRYDIAELTKLYTYNDQRVLRILQSLEEIVTDISQMRALAFCVSKD
FT                   HANFIAQKFNLKNIPCGVLTSDNSKEREILQQRLKSKEINVLFVVDIFNEGVDIPELDT
FT                   LLFLRPTESLTVFLQQLGRGLRLTKDKECCTVIDFVGNSRPEYDFSHKFRALIGKTNQS
FT                   ISKEVKQGFPHLPLGCRIELQEKTQQMILRNISLATLNKNRLLNLISNYPHVTDLPLTL
FT                   SNFLHIYPDLSLEDIYKVKVGKFGGWQALVATSHGEEIKQSEQDVYAAYYRAINNRLLS
FT                   CTSISYLLFIKGLCESNFSLPNHACDESVAEKHNQLFSLMCHYDFWDKTGKQAGFNTLE
FT                   NSLCALKHNQLQYELSDVISLLIERLATQEFSMPAAGNAVVDNSPLKMHVRYPKEHILV
FT                   AFGDSTFDRKSSSREGVLNIAEANTELLFVTLDKCEKQFSATTMYHDYAISPTLFHWQT
FT                   QNSAKPTSGRGQGYITQKENNKTFILFVREQAKDEYGKTMGFVNFGPVDFVKYEGSQPM
FT                   NITWKLKQPMPAYMWHDAAKLAVG"
FT   gene            complement(494094..495401)
FT                   /locus_tag="Shal_0419"
FT   CDS_pept        complement(494094..495401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0419"
FT                   /product="HipA domain protein"
FT                   /note="PFAM: HipA domain protein; KEGG: sbm:Shew185_0650
FT                   HipA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74994"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQK1"
FT                   /protein_id="ABZ74994.1"
FT                   /translation="MSGSNFHALEMHFRGMIIGSIGFDIDTEQFSIEYTKAWQENGFPI
FT                   SPKLPLNGQASSSQISIYLTNLLPENKGLDHLIEALGIAKSNTFGLIKGIGFDTSGAIL
FT                   YLPENTKPPVTSFTPISKEDLIKRIEDPEHWPMEIWDGKPRLSVAGVQSKINLFHTDTE
FT                   YGFGEGQLCSTHIIKFEKNSQQYLVLNEFITMTLAGLIGIQVAKVEIMPIGKYKALSVT
FT                   RFDRMYDPERHIVMRRHQIDACQALGFSVARKYERHLGSGRDVRDIREGVSLEKLFSIA
FT                   EYCANPAKAKFDMLRWTIFNLLVCNADSHGKNYSFYVTANGLEPTPWYDLVNVQMYPDF
FT                   DQELAMAIGGEFEADKIHAYQLMTFAEECGIKQNILELTLKQLAKAIIANLDKAAKQAG
FT                   ELTDAESKYVGTYKATIQARCEYYLAQVEEMKHIEL"
FT   gene            complement(495388..495636)
FT                   /locus_tag="Shal_0420"
FT   CDS_pept        complement(495388..495636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0420"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   slo:Shew_0478 transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74995"
FT                   /db_xref="GOA:B0TQK2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQK2"
FT                   /protein_id="ABZ74995.1"
FT                   /translation="MVTQLDPSTLGKLIKDRRKAANMTQEVAASFCGVTKKTLIRVEKG
FT                   EDVYFSTIVKILSGLGIKLTVDTPNSKNNLGGSNEWF"
FT   gene            complement(496113..496976)
FT                   /locus_tag="Shal_0421"
FT   CDS_pept        complement(496113..496976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0421"
FT                   /product="YicC domain protein"
FT                   /note="PFAM: YicC domain protein; domain of unknown
FT                   function DUF1732; KEGG: slo:Shew_3489 YicC N-terminal
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74996"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQK3"
FT                   /protein_id="ABZ74996.1"
FT                   /translation="MIQSMTAYARIEHKADWGTASWEIRSVNQRYLETYLRLPEHFRSL
FT                   EPVLRDRLRKRLNRGKIEVNLRYDLNEKNDSELQLNQDLAKQIINAANWVKNEAGQGEL
FT                   NVVDVLRWPGVMSGSEQDMDALGKELLVAFDAAIDQFIEARGREGDAINTMLQTRLDQI
FT                   VEQVGIVRGHMPTVMQWQRDKLTNRLAEITGELDPARMEQEMVLLAQKMDVAEEMDRLD
FT                   AHVAETRRILKKGGAQGRRLDFMMQEFNRESNTLASKSISAEVTSAAVELKVLIEQMRE
FT                   QIQNVE"
FT   gene            497250..497963
FT                   /locus_tag="Shal_0422"
FT   CDS_pept        497250..497963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0422"
FT                   /product="ribonuclease PH"
FT                   /EC_number="2.7.7.56"
FT                   /note="KEGG: slo:Shew_3488 ribonuclease PH; TIGRFAM:
FT                   ribonuclease PH; PFAM: 3' exoribonuclease; Exoribonuclease,
FT                   phosphorolytic domain 2"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74997"
FT                   /db_xref="GOA:B0TQK4"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TQK4"
FT                   /protein_id="ABZ74997.1"
FT                   /translation="MRPSNRTPAQSRPVTITRQFTAHAEGSVLVEFGDTKVLCTASFEE
FT                   GVPRFLKGQGQGWVTAEYGMLPRSTHSRMQREAARGKQSGRTQEIQRLIGRSLRAAVDM
FT                   KLLGENTIVIDCDVIQADGGTRTAAITGACVALVDALNWARGKGILKTNPLKFLIAAVS
FT                   VGIYKGEPICDLEYIEDSAAETDMNVVMTETGKIIEIQGTAEGEPFSHEELLSLLELAK
FT                   HGIREIVDIQKASLS"
FT   gene            498083..498724
FT                   /locus_tag="Shal_0423"
FT   CDS_pept        498083..498724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0423"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="KEGG: slo:Shew_3487 orotate
FT                   phosphoribosyltransferase; TIGRFAM: orotate
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74998"
FT                   /db_xref="GOA:B0TQK5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQK5"
FT                   /protein_id="ABZ74998.1"
FT                   /translation="MKAYQREFIEFALERQVLRFGEFTLKSGRTSPYFFNAGLFNTGRD
FT                   LARLGRFYAAALVDSGIEYDLLFGPAYKGIPIATTTAVALCDHHDIDMPYCFNRKEKKD
FT                   HGEGGSLVGSELQGRVMLVDDVITAGTAIRESMEIIAAHKASLAGVLIALDRQEKGKGE
FT                   LSAIQEVERDFGCDIVSIIKLEDLINYLSEKSGMEAQLASVSAYRDQYGI"
FT   gene            complement(499051..499710)
FT                   /locus_tag="Shal_0424"
FT   CDS_pept        complement(499051..499710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0424"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /note="PFAM: GTP cyclohydrolase I; KEGG: slo:Shew_3486 GTP
FT                   cyclohydrolase I"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ74999"
FT                   /db_xref="GOA:B0TQK6"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQK6"
FT                   /protein_id="ABZ74999.1"
FT                   /translation="MTSKNAILSESAQIVKSALIERGLETPMLPSELTAEERKDKIEQH
FT                   MREILTLMSLDLSDDSLADTPRRVAKMYVDEIFSGLDYANFPKITVIENKMGFDEMVKV
FT                   NGINLTSTCEHHLVTIDGLATVAYLPRKNIIGLSKINRIVRFFAQRPQVQERLTQQVLV
FT                   ALQALLGTKDVAVKMDAVHYCVKSRGVMDSTSSTTTTALGGIFKSNPATRAEFLSN"
FT   gene            complement(499947..501911)
FT                   /locus_tag="Shal_0425"
FT   CDS_pept        complement(499947..501911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0425"
FT                   /product="peptidase S9 prolyl oligopeptidase active site
FT                   domain protein"
FT                   /note="PFAM: peptidase S9 prolyl oligopeptidase active site
FT                   domain protein; dienelactone hydrolase; KEGG: slo:Shew_3485
FT                   peptidase S9, prolyl oligopeptidase active site domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75000"
FT                   /db_xref="GOA:B0TQK7"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQK7"
FT                   /protein_id="ABZ75000.1"
FT                   /translation="MKLIKTIGLACLAWLSCHASANTDDAANLFSRSAEFSQVKISPGG
FT                   DYLSAITKKDGKNMLLILNASDKNPVHAVFFESNAQVGHYEWVNDERVVLQKEYLKGWS
FT                   DHPLYYGELMAVNADGSKAIYLFGYQGGEQQVGSNIKKNTPIRATAYILDPMPEDERYM
FT                   LVQALPWGSGGSNMAENTQQVYRVDVYKGRRKKVASSPIPYSSFLTDHDGDVRFVSGTR
FT                   DFVNSKLYYRDDGSWIDTDKLNLGLDGIKPIAFSDDKDSLYVTASEAGKPAGVYLVNIK
FT                   TGDKKLVSQDKVVDPSNVWINATTKKLYAVEYENGYPTYEFVDSKDPSAKYIKQLLASL
FT                   PGHQIHLVSQTTDADKIIIKAFNDRNPGDYYLFNTKAKKLEYLVSKKKWIDSNKMAEIK
FT                   PIHFTSRDGVEIHGYITLPQGVEAKNLPLVVNPHGGPHGPRDWWGFDPQNQMIASQGAA
FT                   VLQINFRGSGGYGNGFENAGHQKWGTNIQYDIIDATKYVIEQGMVDKDRICIVGGSFGG
FT                   YSAIQSSAIEPDLFKCAIGFAGVYDLQLMFDEGDVQGRRAGKRYLKEVLGEDQNLLKSM
FT                   SPTHNVDKLKANIMLVHGGEDERAPIEQFEALEDALKKQKYPFKKLVMDDEGHGFYDDA
FT                   HRAKYYNEMLGFLKENLNL"
FT   gene            complement(502045..502638)
FT                   /locus_tag="Shal_0426"
FT   CDS_pept        complement(502045..502638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0426"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: slo:Shew_3484
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75001"
FT                   /db_xref="GOA:B0TQK8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023769"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TQK8"
FT                   /protein_id="ABZ75001.1"
FT                   /translation="MAASPKINRREHILQCLATMLETSPGQRITTAKLAAEVGVSEAAL
FT                   YRHFPSKARMFEGLIEFIEESLLSRINLIMDEEKDTMKRCQQLLQLLLVFAERNPGISR
FT                   VLNGDALLGENERLRSRISQLFAKIETHLKQILREKSLREGKGFNLDEAVLANLLLAVA
FT                   EGRIAQFVRSEFKLKPTKHFNEQWTFIQQQLLQS"
FT   gene            complement(502739..503197)
FT                   /locus_tag="Shal_0427"
FT   CDS_pept        complement(502739..503197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0427"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase
FT                   Dut"
FT                   /EC_number="3.6.1.23"
FT                   /note="KEGG: slo:Shew_3483 deoxyuridine 5'-triphosphate
FT                   nucleotidohydrolase Dut; TIGRFAM: deoxyuridine
FT                   5'-triphosphate nucleotidohydrolase Dut; PFAM: deoxyUTP
FT                   pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75002"
FT                   /db_xref="GOA:B0TQK9"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TQK9"
FT                   /protein_id="ABZ75002.1"
FT                   /translation="MKTPIELKILDSRIGTEFPLPAYATPGSAGMDLRAITDTQLVIQP
FT                   GETVLIPTGIAIHVADPSLAAIILPRSGLGHKHGIVLGNLVGLIDSDYQGPLMVSCWNR
FT                   GSEPFTIEIGDRLAQLVFVPVVQAEFKLVDEFNQSDRGTGGFGHSGTK"
FT   gene            complement(503197..504390)
FT                   /locus_tag="Shal_0428"
FT   CDS_pept        complement(503197..504390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0428"
FT                   /product="phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase"
FT                   /EC_number="4.1.1.36"
FT                   /EC_number="6.3.2.5"
FT                   /note="KEGG: sfr:Sfri_3829 phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase;
FT                   TIGRFAM: phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase; PFAM:
FT                   flavoprotein; DNA/pantothenate metabolism flavoprotein
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75003"
FT                   /db_xref="GOA:B0TQL0"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQL0"
FT                   /protein_id="ABZ75003.1"
FT                   /translation="MGLNNKKVLLGIGGGIAAYKSADLVRKLKERGADVRVVMSQSAQE
FT                   FITPLTLQALSGYPVATDLLDPTAEASMGHIELARWADLVIIAPATANLIARINAGMAD
FT                   ELITTTCLATEAPVVLCPAMNQQMYRNGATQANLKQVAERGIHIWGPESGSQACGEVGP
FT                   GRMLEPVAIADKAVNFFGPKLLQGMSLLLTAGPTREAIDPVRYISNHSSGKMGFALAKA
FT                   AAEMGAEVTLVAGPVNLATPNGVTRINVESAQEMLDAVMPQVEKHQIFIGCAAVADYRI
FT                   ADVAESKIKKSAEQMQLALVRNPDILASVASHANRPFTVGFAAETNDVEQYARGKLTRK
FT                   KLDMIAANDVSNSAIGFNSDSNALSVFWSDGSTDLPAVNKDTLAKQLLTLIANKIKN"
FT   gene            504539..505216
FT                   /locus_tag="Shal_0429"
FT   CDS_pept        504539..505216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0429"
FT                   /product="DNA repair protein RadC"
FT                   /note="PFAM: DNA repair protein RadC; KEGG: slo:Shew_3481
FT                   DNA repair protein RadC"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75004"
FT                   /db_xref="GOA:B0TQL1"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TQL1"
FT                   /protein_id="ABZ75004.1"
FT                   /translation="MAIKDWPVGEGPREKLLNQGVKQLSDAELLAVLLRVGLKGLSAVE
FT                   LARTMINEFGGLRGLLAASQTQVCRLDGIGPVKFAQMQAAVELGTRISQENLQRGKILS
FT                   DPDLTRDYLMRQLSDRAYEVFAILLLDSQHRVIQFVELFRGTINSASVYPREVVSLVLE
FT                   KKAAAVIVCHNHPSGIAEPSTADRRITERLKQALQTIDVSLLDHMVVGDREIVSFAERG
FT                   WID"
FT   gene            505345..505581
FT                   /locus_tag="Shal_0430"
FT   CDS_pept        505345..505581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0430"
FT                   /product="ribosomal protein L28"
FT                   /note="PFAM: ribosomal protein L28; KEGG: saz:Sama_0328
FT                   ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75005"
FT                   /db_xref="GOA:B0TQL2"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TQL2"
FT                   /protein_id="ABZ75005.1"
FT                   /translation="MSRVCQVTGKRPMVGNNRSHAKNATRRRFLPNLQNHRFWLENEKR
FT                   FVQLRISTKGMRIIDKKGIEVVIAELRARGEKV"
FT   gene            505588..505761
FT                   /locus_tag="Shal_0431"
FT   CDS_pept        505588..505761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0431"
FT                   /product="ribosomal protein L33"
FT                   /note="PFAM: ribosomal protein L33; KEGG: sfr:Sfri_3826
FT                   ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75006"
FT                   /db_xref="GOA:B0TQL3"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TQL3"
FT                   /protein_id="ABZ75006.1"
FT                   /translation="MAKAKGNREKIKLVSSANTGHFYTTEKNKRNMPEKMEIKKFDPVV
FT                   RQHVMYKEAKIK"
FT   gene            506236..507558
FT                   /locus_tag="Shal_0432"
FT   CDS_pept        506236..507558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0432"
FT                   /product="amino-acid N-acetyltransferase"
FT                   /note="TIGRFAM: amino-acid N-acetyltransferase; PFAM:
FT                   GCN5-related N-acetyltransferase;
FT                   aspartate/glutamate/uridylate kinase; KEGG: slo:Shew_3478
FT                   amino-acid N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75007"
FT                   /db_xref="GOA:B0TQL4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR010167"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR033719"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQL4"
FT                   /protein_id="ABZ75007.1"
FT                   /translation="MRTTELVDGFRHSASYVNAHRGKTFVVMLGGEAIAQQQFRAIIND
FT                   IALLHSLGIKIVLVHGARPQIDEALAERSLAAEYYNGVRVTEEDALKVIKQVVGALHLD
FT                   ITARLSMSLSNTPMQGAQINVVSGNFVIAQPLGVEDGVDYCLSGKVRRIDSLGLKRQLD
FT                   SGGIVLLGPVAASVTGESFNLTAEEVATQIAIKLKADKMIGFSAEKGILDNYGQVVAEL
FT                   MPTEAQKILNEFPEVSPLCVGTKAFLEASIDACRNGVSRCHFVSYLDDGALLQELFSRD
FT                   GIGTQIVTESAERLRRATISDIGGILDLIRPLEQKGILVRRSREQLEVEIEQFMLIERD
FT                   SLVIGCAAFYPFEEDNAGEFACLVVHPDYRDADRGSLLLQNIIGQARVRGYSRLFALTT
FT                   RSIHWFLEHGFNMVEVEALPEKKKQLYNYQRKSKILALDLY"
FT   gene            507652..508158
FT                   /locus_tag="Shal_0433"
FT   CDS_pept        507652..508158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0433"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_0369 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75008"
FT                   /db_xref="GOA:B0TQL5"
FT                   /db_xref="InterPro:IPR027783"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQL5"
FT                   /protein_id="ABZ75008.1"
FT                   /translation="MPQVYALAPLTSGGYWSFIALLAILVGLLTFIYFSTLPEISKIIS
FT                   FGLLLLTLFAFSWVFYKADDSKLIIGDDTLTLDVPFYAITLPLAEVKIKEIQRLDWQRD
FT                   PDLKLESRHNGVGMAGYQLGWFKLSNKQKAFVAMSEEQNLVMIPTLRGYRIILSLQEPD
FT                   RLLSR"
FT   gene            complement(508207..509094)
FT                   /locus_tag="Shal_0434"
FT   CDS_pept        complement(508207..509094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0434"
FT                   /product="RarD protein, DMT superfamily transporter"
FT                   /note="TIGRFAM: RarD protein, DMT superfamily transporter;
FT                   PFAM: protein of unknown function DUF6 transmembrane; KEGG:
FT                   shw:Sputw3181_0370 RarD protein, DMT superfamily
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75009"
FT                   /db_xref="GOA:B0TQL6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004626"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQL6"
FT                   /protein_id="ABZ75009.1"
FT                   /translation="MQETEYRKGIIYAICAYTLWGFAALYFKLLDKVPAAEILLHRVLW
FT                   SFVFVTILIALFGGFARLRNLLKQPKQLAVLCVTSVLIAGNWLLFIWAVNNDHMLDASL
FT                   GYFINPLVNVSLAMIFLGERLRKLQWAAVALAATGVMIQLISFGSIPLVSLGLACSFAF
FT                   YGLLRKKVNVDAKTGLLVETAILMPIALIYLVTNMGDSLTHLLTNDLNLNLLLVAAGIV
FT                   TTIPLLCFASAAVRIPFSMLGFFQYIGPSIMFVLAIALFNEPFDAEKGITFAFIWAALL
FT                   LFTVDMFYKRKPKL"
FT   gene            complement(509260..509724)
FT                   /locus_tag="Shal_0435"
FT   CDS_pept        complement(509260..509724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0435"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   son:SO_4242 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75010"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQL7"
FT                   /protein_id="ABZ75010.1"
FT                   /translation="MSQQIQQETLRRVAEIFDQHVPFHNLLGMDIKRYDMDGVEIQVTM
FT                   KPELIGNIHQQILHGGVTATVLDVVGGLTAFSGLVASRDDWSQEELENRIKTLGTIDLR
FT                   IDYLRPGRGEIFTGTGTVIRAGNRVSVSRMELHNEKGDHIAFGTGTYMVG"
FT   gene            509886..511709
FT                   /locus_tag="Shal_0436"
FT   CDS_pept        509886..511709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0436"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /note="KEGG: shw:Sputw3181_0372 ATP-dependent DNA helicase
FT                   RecQ; TIGRFAM: ATP-dependent DNA helicase, RecQ family;
FT                   ATP-dependent DNA helicase RecQ; PFAM: helicase domain
FT                   protein; HRDC domain protein; DEAD/DEAH box helicase domain
FT                   protein; Helicase superfamily 1 and 2 ATP-binding; SMART:
FT                   DEAD-like helicases"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75011"
FT                   /db_xref="GOA:B0TQL8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQL8"
FT                   /protein_id="ABZ75011.1"
FT                   /translation="MDQAALDNSVDQLSSTLQSVFGYRTFREGQREVIEQICAGQDCLV
FT                   IMPTGGGKSLCYQLPALIMPGLTVVVSPLISLMKDQVDSLIQTGVSAAYLNSSLPREES
FT                   LQVLQKMRYGELKLLYVSPERLLQASFIDRLHELNVSLFAIDEAHCISQWGHDFRPEYA
FT                   ALGRLRQQFPQVPIMALTATADKATRADICERLTITPHSLLTSFDRPNIRYTVAEKLNA
FT                   ANQLRQFVDAQNGTSGIVYCSSRRRVDEVAERLRLQGHQAEAYHAGKTQEERADVQDRF
FT                   LKDQLDIVVATVAFGMGINKSNVRYVVHYDIPKSVEAYYQETGRAGRDGLDSEALMLFD
FT                   PADIGRVRHLIEQSEPGPQQQVEFHKLNTMAAFAEAQTCRRQVLLHYFDEPALKACGNC
FT                   DICLDPPKKYNGIQDAQKVLSCIYRIGQRFGINHLIEVLRGSKSASVIERGHDKLSTWG
FT                   IGKEKSHEHWLSVIRQLIHLGLANQDITRGSSVTLNPSARAVLKGEVELLLAEPRIVIQ
FT                   TTKRRSNNSRAPLNYDRKLFARLKLLRRTLAEELDVPPYLVFNDATLAEMAAILPTSPG
FT                   EMLAVNGVGERKLERFGGEFLDEIADYLAEG"
FT   gene            complement(512014..513795)
FT                   /locus_tag="Shal_0437"
FT   CDS_pept        complement(512014..513795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0437"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: slo:Shew_3473 response regulator receiver
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75012"
FT                   /db_xref="GOA:B0TQL9"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQL9"
FT                   /protein_id="ABZ75012.1"
FT                   /translation="MDFRIIVLSFSLWLSPAYSLTLEQLEQLNTSVFQYPSKALNNIHD
FT                   IEQQLHAYLDPKVLQLRMSAFKCETYLQLGENAAAINLARFNDAKAKRLKLEQARPYFL
FT                   NCMAQAYVNYGNYQQALPLIHSSITLSRRLEQPQALINGLWLRSQLDAKVQHNDTAIED
FT                   LRLALDLYPQVEQQNEQWLLTPIAYLNVSMAKLLMGENEQKEANGFLDKALKDEGSAGK
FT                   IALNLSIDAANLALSNNHPKLRDHYVQIARSKLPELGSPFELAEAYKQIAFIDFSSGKY
FT                   SSAEQLLHLSINTFKKESNASATISALHLLAQVKLAQGQESLGLEQMTEAIVIADQKNR
FT                   YTDLKLCYAVLAKYFAEKGSFALAYDYQLKQFQAAENEALFIQNIWLSHLKSDLSRQQQ
FT                   ASEELQSSDAVVMPRQLIPNSFLPIIFVLFSLAIFITWYHRQTPKTSPETKEPIQIKPN
FT                   ATGKQKLEDMLSVSKHAHYPLSLLVLDPSGVLSSDIAVMIEQLKTKLREQDLLFLQSEQ
FT                   QLLIMLPHTSEDAAINVIEQLSGIVAVWQNDSKVSIGLASMQQFDNLQSMVKRANVSQL
FT                   RRLKPVSKRFSVTTANE"
FT   gene            514383..515954
FT                   /locus_tag="Shal_0438"
FT   CDS_pept        514383..515954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0438"
FT                   /product="2-isopropylmalate synthase"
FT                   /note="TIGRFAM: 2-isopropylmalate synthase; PFAM: pyruvate
FT                   carboxyltransferase; LeuA allosteric (dimerisation) domain;
FT                   KEGG: slo:Shew_3472 2-isopropylmalate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75013"
FT                   /db_xref="GOA:B0TQM0"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005671"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TQM0"
FT                   /protein_id="ABZ75013.1"
FT                   /translation="MSNRVIIFDTTLRDGEQALAASLTVKEKLQIALALERLGVDVMEV
FT                   GFPVSSPGDFESVQTIAKTIKNSRVCALSRALESDIDAAAQALSVAEQFRIHTFISTST
FT                   IHVENKLKRSFDQVLDMAVGAVKYARRFTDDVEFSCEDAGRTPIDNLCRMVEEAIKAGA
FT                   RTINIPDTVGYTVPSEFGGIIQTLFNRVPNIDQAVISVHCHDDLGLSVANSITAVQHGA
FT                   RQIECTVNGIGERAGNCSLEEIAMILSTRKGELGLETGINAKEIHRTSSLVSQLCNMPV
FT                   QANKAIVGANAFTHSSGIHQDGMLKAQNTYEIMTPESIGLNRNNLNMTSRSGRHVIKHR
FT                   MSELGYGEQDYDMDVLYEEFLALADKKGQVFDYDLEALAFMEAQAEDDDHFELQQLVVH
FT                   SDSTEGSATATVKVAVNGETITEAATGNGPVDAAYKAVARASGCKTNITSYQLSAKGEG
FT                   HNALGQVDITAKYREQNFHGVGLATDVVEASAKALIHVMNLTWRADKVADCKQRIQQNK
FT                   QEFGSV"
FT   gene            516033..517127
FT                   /locus_tag="Shal_0439"
FT   CDS_pept        516033..517127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0439"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /EC_number="1.1.1.85"
FT                   /note="KEGG: slo:Shew_3471 3-isopropylmalate dehydrogenase;
FT                   TIGRFAM: 3-isopropylmalate dehydrogenase; PFAM:
FT                   isocitrate/isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75014"
FT                   /db_xref="GOA:B0TQM1"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQM1"
FT                   /protein_id="ABZ75014.1"
FT                   /translation="MSYQIAVLAGDGIGPEVMVEARKVLKATEERFALSIEYTEYDVGG
FT                   AAIDNHGCPLPDATLKGCEAADAILFGSVGGPKWEHLAPNDQPERGALLPLRGHFELFC
FT                   NMRPAKLHAGLEHMSPLRSDISSRGFDVLCVRELTSGIYFGKPKGRIGEGENEEAFDTM
FT                   RYSRKEIRRIAKIAFETAQGRRKKVTSVDKANVLACSVLWREVVEEVAKDFPDVELEHI
FT                   YIDNATMQLLRRPDEFDVMLCSNLFGDIISDEIAMLTGSMGLLSSISMNSAGFGLYEPA
FT                   GGSAPDIAGQGIANPVAQILSAALLLRHSLKQEEAATVIENAVGKALSDGYLTGELLAI
FT                   EERHNAKSTSEMGDYIAKLVREGV"
FT   gene            517130..518530
FT                   /locus_tag="Shal_0440"
FT   CDS_pept        517130..518530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0440"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="KEGG: slo:Shew_3470 3-isopropylmalate dehydratase,
FT                   large subunit; TIGRFAM: 3-isopropylmalate dehydratase,
FT                   large subunit; PFAM: aconitate hydratase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75015"
FT                   /db_xref="GOA:B0TQM2"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TQM2"
FT                   /protein_id="ABZ75015.1"
FT                   /translation="MAKTLYEKVWDNHIVFAGEGEAPIIYVDRHLVHEVTSPQAFSGLK
FT                   VAGRKLRAPEKTFATMDHNTSTTSASLDALSPMARTQVETLERNCKEFGVRLYDIHHKN
FT                   QGIVHVMGPELGITLPGTVIVCGDSHTATHGAFGALAFGIGTSEVEHVMATQTLRQLKA
FT                   KTMKIEVRGKVADGITAKDIVLAIIGKIGMDGGTGYVVEFCGEAIEALSMEGRMTVCNM
FT                   AIEMGAKAGMIAPDTTTAEYLEGREFAPKGASWEQAVEAWSQLKTDADAVFDATVVIEA
FT                   KDIAPQLTWGTNPGQVVAIDQLVPNPLDATNPTVRTSIENALQYVDLTAGTLMTDVSIN
FT                   KVFIGSCTNSRIEDLRAAAVHAKGRKVADGVKAIVVPGSGLVKEQAEAEGLDKIFLEAG
FT                   FEWRLPGCSMCLAMNDDKLEVGDRCASTSNRNFEGRQGRGSRTHLVSPAMAAAAAVAGH
FT                   FVDIRKPY"
FT   gene            518540..519145
FT                   /locus_tag="Shal_0441"
FT   CDS_pept        518540..519145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0441"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="KEGG: slo:Shew_3469 3-isopropylmalate dehydratase,
FT                   small subunit; TIGRFAM: 3-isopropylmalate dehydratase,
FT                   small subunit; PFAM: aconitate hydratase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75016"
FT                   /db_xref="GOA:B0TQM3"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TQM3"
FT                   /protein_id="ABZ75016.1"
FT                   /translation="MQPFISHTGLAVILDSANVDTDQIIPKQFLSKVTRDGFGVHLFHD
FT                   WRYLDEAGDKPNPDFNLNQPRYKGASILVSQENFGCGSSREHAPWALADFGFKVIIAPS
FT                   FADIFYGNSINNGLLPVRLTDAEVKQLMAEVEAKEGAEIDVDLQALTVTSPSGALFHFE
FT                   IAQSARHNLLNGLDAIGLTLSHVDTIANYEANIPSWRG"
FT   gene            519659..520945
FT                   /locus_tag="Shal_0442"
FT   CDS_pept        519659..520945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0442"
FT                   /product="membrane protein involved in aromatic hydrocarbon
FT                   degradation"
FT                   /note="PFAM: membrane protein involved in aromatic
FT                   hydrocarbon degradation; KEGG: son:SO_4232 long-chain fatty
FT                   acid transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75017"
FT                   /db_xref="InterPro:IPR005017"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQM4"
FT                   /protein_id="ABZ75017.1"
FT                   /translation="MNKRLITLAVSAALLGTVTQVQAAGFQLAEYSATGLGRAYAGEAA
FT                   MADNAAAQFRNPAMLTYLEGTQVSTGAILVMPDIDVDGEVTSNGVTTPSSAKDIAGDAV
FT                   VPNFYVSHQLNEQWYLGLALGSNFGMATELDDSFLGTQFGNEASIMAIEINPNVAYRIN
FT                   EQFSVGAGVRLVLGEGSFGAQAPVSQGPLQGKTLKYMEGDDISWGWQLGGAWQINANNR
FT                   IGFNYRSEVEQNLEGEAKGLGFDVAMIMQGKAPSSQYAGSMELALPATAEIASFHQLTD
FT                   KLAIHASVNWTDWSSFEKLEAMIPEISADPILVKQENWEDNYRFAVGATYQLSQKSTLR
FT                   TGVAYDQAAVSDANRTTTIPEVDRLWLSVGYGYQYSDNLDFDFGATYIFADESPIHEHD
FT                   EQSAMFGGTFEGQVSGNIILVGVQATYRF"
FT   gene            521230..521766
FT                   /locus_tag="Shal_0443"
FT   CDS_pept        521230..521766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0443"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3467 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75018"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQM5"
FT                   /protein_id="ABZ75018.1"
FT                   /translation="MKPKIWLLAIGSALISVSPLVSASDPLPIETQQPDSVTVVKQFIQ
FT                   GFNNHSVEQLLQQTTPNVHWFNLSGTKMDVETSTQHELGAAMTDYFAHLTDAKAALRQI
FT                   VVSANYVSTVEEVTWSHEGELSSQCSLGVYQLSGDKISAIWYYPAHACDETIWVDGSDP
FT                   EIVQPEIGLLKETRQ"
FT   gene            521778..523259
FT                   /locus_tag="Shal_0444"
FT   CDS_pept        521778..523259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0444"
FT                   /product="glycerol kinase"
FT                   /note="TIGRFAM: glycerol kinase; PFAM: carbohydrate kinase
FT                   FGGY; KEGG: slo:Shew_3466 glycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75019"
FT                   /db_xref="GOA:B0TQM6"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TQM6"
FT                   /protein_id="ABZ75019.1"
FT                   /translation="MSKKYIIALDQGTTSSRAIVFDHSTNMVASCQREFSQMYPKPGWV
FT                   EHDAMEIWASQSSTLIEALARADIHSEDVAAIGITNQRETTVIWDKATGKPVYNAIVWQ
FT                   CRRSKAICDELKTQGLEDYVKQATGLLLDPYFSGTKIKWILDNVDGVRERAEKGELLFG
FT                   TIDTWLVWKLTEGQAHVTDPTNASRTMLFNIHTQEWDETLLKALNIPRSILPEVKPSSA
FT                   VYGHTRIVGEGSHIAIAGMAGDQQAALFGQLCIEEGMAKNTYGTGCFLLMNTGTEAVQS
FT                   QHGLLTTIAIGANGEVNYALEGSVFMGGATVQWLRDELGLIRDAQDTEYFASKVEDTHG
FT                   VYLIPAFVGLGAPYWDPDARGALVGLTRGANRNHIIRAALEAIAYQSRDLLDAMAKDSR
FT                   VELKQIKVDGGAVANDFLMQFQSDITNVEVQRPDLTETTAMGAAFLAGLAVGFWDSTDE
FT                   LKLKAGVERSFTPQITAQKRDSLYQGWQNAVARTR"
FT   gene            complement(523288..523752)
FT                   /locus_tag="Shal_0445"
FT   CDS_pept        complement(523288..523752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0445"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: slo:Shew_3465 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75020"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQM7"
FT                   /protein_id="ABZ75020.1"
FT                   /translation="MISLDSVYAMLAKPVLSKLKTKAIVKRIDNSAAISADSHEPPQSQ
FT                   LPPHLERRSSTDDRRKDQQIAYQLDPGLERRKGSRGDRRTKETEDEELAQSQTAQSTES
FT                   TESTESTESTESTESTEPAISTERGESSAKQRESSTKLKESTHTKIDINV"
FT   gene            524257..524715
FT                   /locus_tag="Shal_0446"
FT   CDS_pept        524257..524715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0446"
FT                   /product="MraZ protein"
FT                   /note="TIGRFAM: MraZ protein; PFAM: protein of unknown
FT                   function UPF0040; KEGG: saz:Sama_0345 MraZ protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75021"
FT                   /db_xref="GOA:B0TQM8"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TQM8"
FT                   /protein_id="ABZ75021.1"
FT                   /translation="MFSGASAINLDTKGRIAIPKRYREPLHACHNSQLVITVDIQSSCL
FT                   LLYPIQEWEKVAAKLALLSDTQPTERAIKRMLLGYAHECELDGNGRMLLPTPLRQYANL
FT                   DKRAMLVGQLNKFELWDEAAWQQQIEQSRLAILNEDLAANERLADFSL"
FT   gene            524745..525692
FT                   /locus_tag="Shal_0447"
FT   CDS_pept        524745..525692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0447"
FT                   /product="S-adenosyl-methyltransferase MraW"
FT                   /note="TIGRFAM: S-adenosyl-methyltransferase MraW; PFAM:
FT                   methyltransferase; KEGG: slo:Shew_3461
FT                   S-adenosyl-methyltransferase MraW"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75022"
FT                   /db_xref="GOA:B0TQM9"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TQM9"
FT                   /protein_id="ABZ75022.1"
FT                   /translation="MTQEFEHLSVLLTETVAGLNIKPDGIYIDGTFGRGGHSRKVLEEL
FT                   GPNGRLIAIDRDPQAIAAAEQFKDDSRFQIVHGGFGQLADYVEDLGLKGKIDGVLLDFG
FT                   VSSPQLDDAERGFSFLRDGPLDMRMDNSQGQTAAQWLARAEIEDMAWVFKTYGEEKNSR
FT                   HIARCIAADREKAPFLRTKELADLIARITKNKERNKHPATRVFQAIRIYINSELEQIDQ
FT                   ALEGALTVLAPEGRLSVISFHSLEDRMVKRFIRRNSQGESVPHGLPITEEEINKSRKLK
FT                   GVGKAIKPSAEEIERNARARSSVLRIAQRLPYEA"
FT   gene            525710..526024
FT                   /locus_tag="Shal_0448"
FT   CDS_pept        525710..526024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0448"
FT                   /product="cell division protein FtsL"
FT                   /note="PFAM: cell division protein FtsL; KEGG:
FT                   slo:Shew_3460 cell division protein FtsL"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75023"
FT                   /db_xref="GOA:B0TQN0"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQN0"
FT                   /protein_id="ABZ75023.1"
FT                   /translation="MSKSQLNLTRIVLLDLWHHKWVMILALLVVLNAIAVVYTSYEGRK
FT                   YTSQWDQLLQERDRLDIEWRNLLLEEQSRSEHSRITRIATKELNMNRPLPKDEVVVRVP
FT                   "
FT   gene            526021..527757
FT                   /locus_tag="Shal_0449"
FT   CDS_pept        526021..527757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0449"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: penicillin-binding protein transpeptidase;
FT                   Penicillin-binding protein dimerisation domain; KEGG:
FT                   slo:Shew_3459 peptidoglycan glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75024"
FT                   /db_xref="GOA:B0TQN1"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="InterPro:IPR037532"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQN1"
FT                   /protein_id="ABZ75024.1"
FT                   /translation="MSKQAKRKQKPQLIQWRLYVVVAFVCLLFTSLVGRAAYIQIIEPE
FT                   MLRHQSDMRTLRTTSREVQRGLITDRNGEMLAVSVPVKAVYADPKVIHDEDGFADMRRW
FT                   QALADVLHEPKEDILKRVQSNPRKRFTYLKRQVTPAVANYIQQLDLPGVYLKPESRRYY
FT                   PTGEITAQLVGITNIDDKGIEGLENTYDDWLTGTPSKQKVRKSRDGHVVERLDMVQEGE
FT                   SPNDLVLSIDQRIQQLAYRELKKATEINQATSGSIVVLDVLTGEVLAMANTPSYNPNSR
FT                   ENLQSYRMRNRALTDAYEPGSTIKPFVVAAALDAGTIKTDQIIKTNPGRMRIGGKIVRD
FT                   GRNYGDLSLSGVLVHSSNVGMTKIALSMPVQELLGAYQTMGLGNYSGINLEGESAGLIH
FT                   DRRRWSEFERATLSFGYGLMATPLQLARMYATLGNKGVQYPVSILKLKQAPQGTQVISP
FT                   QVAQDVMEMLVGVTEKGGTARKAHIEGYPVAGKTGTARKAVAGGYGEDYVAIFAGVAPV
FT                   HTPKLAITVVINEPKGDRYYGGDVAAPVFAAVMSGALQMLNVEPISKREKVRLAANSRS
FT                   VE"
FT   gene            527757..529223
FT                   /locus_tag="Shal_0450"
FT   CDS_pept        527757..529223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0450"
FT                   /product="UDP-N-acetylmuramyl-tripeptide synthetase"
FT                   /note="TIGRFAM: UDP-N-acetylmuramyl-tripeptide synthetase;
FT                   PFAM: cytoplasmic peptidoglycan synthetase domain protein;
FT                   Mur ligase middle domain protein; KEGG: slo:Shew_3458
FT                   UDP-N-acetylmuramyl-tripeptide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75025"
FT                   /db_xref="GOA:B0TQN2"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQN2"
FT                   /protein_id="ABZ75025.1"
FT                   /translation="MLIRDLLAPWFHYSGAEEFSELTLDSRAVQSGSLFVAIPGYQVDG
FT                   RKFITAAFERGASAVLVHTDSPEEHGKLVHEAGLQILFFQLNRQISALAAQAYPLSQVR
FT                   PQIIGVTGTNGKTSVTQLIAQLQLLQGKQTAVMGTLGNGLWGELVDSGNTTADPITLIK
FT                   QLQNFEQRGADTCAMEVSSHGLVQGRVEAVPFDVAVFTNLSRDHLDYHHTMDAYGAAKK
FT                   RLFQFATLRAGLINCDDALGREWLTDLASDKVIGFSIKGDSKAAIYCKDCHFHDGGVSC
FT                   TLVWPTGEAKLNSPLLGDFNLSNLLAALGALYLLGEDMHALVALAEKLEPVAGRMERFT
FT                   TKDEVTLVVDYAHTPDAIEQALKALRVHCKGKLWCVFGCGGDRDRGKRPMMAASAEQFA
FT                   DRVMVTSDNSRSEDPNAIIADILAGLQHPKNALTQVDRQTAIKDVVAQAVAGDMVLLAG
FT                   KGHETYQEINGERLNYDERAFAKAIAEGEA"
FT   gene            529220..530599
FT                   /locus_tag="Shal_0451"
FT   CDS_pept        529220..530599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0451"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate--D-alanyl-D-alanyl ligase"
FT                   /note="TIGRFAM: UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate--D-alanyl-D-alanyl ligase; PFAM:
FT                   cytoplasmic peptidoglycan synthetase domain protein; Mur
FT                   ligase middle domain protein; KEGG: slo:Shew_3457
FT                   UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate--D-alanyl- D-alanyl ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75026"
FT                   /db_xref="GOA:B0TQN3"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQN3"
FT                   /protein_id="ABZ75026.1"
FT                   /translation="MISVSLSELATRLKGQLIGDDLFIDSVSSDSRAVNSQTLFVALKG
FT                   ENFDGHAFAQAAVDAGANALLVERELPINATQLIVNNSQKAMGEIGAYVREQVAPTCVA
FT                   LTGSNGKTSVKEMIATILSQKHQVLYTAGNFNNEIGVPLTLLRLQQGDEFGVFELGANH
FT                   AGEIDYTSSLVKPSVAMVNNVASAHLEGFGSLEGVAKAKSEIFNHISTGGTAVINADDA
FT                   FADVMLQASSHVKQLCFGVKNEASRDLDVFATDLIADTYGRYAFSLCYDAEVHRVELPL
FT                   AGRHQVSNALAATSICIALGLSLPLICQGLSLLQPVKGRMLPSQLGRVTVIDDSYNANP
FT                   ASVGAAIDWLQEIKGNRCLVLGDLGELGDNAALLHRELGELAKAKGVSALFCVGTLSEG
FT                   ASHAFGSKHYHDIDGLVAGLVQYINELPADITVLVKGSRSARMERVVEALTTAYGRGEF
FT                   V"
FT   gene            530599..531681
FT                   /locus_tag="Shal_0452"
FT   CDS_pept        530599..531681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0452"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /EC_number="2.7.8.13"
FT                   /note="KEGG: slo:Shew_3456
FT                   phospho-N-acetylmuramoyl-pentapeptide-transferase; TIGRFAM:
FT                   phospho-N-acetylmuramoyl-pentapeptide-transferase; PFAM:
FT                   glycosyl transferase family 4"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75027"
FT                   /db_xref="GOA:B0TQN4"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TQN4"
FT                   /protein_id="ABZ75027.1"
FT                   /translation="MLVYLAEYLTQFYSGFNVFSYVTFRAILGLMTALMFSLWWGPKMI
FT                   ARLQLMQIGQVVRNDGPESHFSKRGTPTMGGLLILAGVFISVLLWGDLDSRYVWVVLFV
FT                   LGSFGLIGFIDDYRKVVRKDTKGLIARWKYLLQSLAALLIAVYLYASAQSPGETQLVVP
FT                   FFKDVMPQLGGFFIVLVYFTIVGSSNAVNLTDGLDGLAIMPTVMVAAAFALIAYLSGHV
FT                   QFASYLHLPYLPGAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLSLGAALGTIA
FT                   VLVRQEILLVIMGGVFVMETVSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIV
FT                   RFWIISLFLVLLGLATLKLR"
FT   gene            531711..533030
FT                   /locus_tag="Shal_0453"
FT   CDS_pept        531711..533030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0453"
FT                   /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
FT                   /note="TIGRFAM: UDP-N-acetylmuramoylalanine--D-glutamate
FT                   ligase; PFAM: cytoplasmic peptidoglycan synthetase domain
FT                   protein; Mur ligase middle domain protein; KEGG:
FT                   sbl:Sbal_0400 UDP-N-acetylmuramoylalanine--D-glutamate
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75028"
FT                   /db_xref="GOA:B0TQN5"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQN5"
FT                   /protein_id="ABZ75028.1"
FT                   /translation="MAQQYSHIVLGLGATGLSVVRYLCGQGIVPLVMDSRNQPPGADTL
FT                   AAEFPQVELVTGGFDCRYLVQAQQIIISPGIACETPEVRVAFDMGIEVIGDVELFAREV
FT                   SQGSAKVIGITGSNGKTTVTTLVGEMAKACGCSYAVGGNIGVPALDLLLEPKELYILEL
FT                   SSFQLETTHSLQCTAATCLNISEDHMDRYSDLESYRQAKLKLYKQSKMVLFNREDALTV
FT                   PNNPTNQESFGLDAPEMDAWGISGGMIVHGSSQIMAVSDVALVGSHNHANIIAAMALAT
FT                   AAGIERDFQIEVAKTFSGLAHRCEVVAEIAGVTYVNDSKATNIGATVAAIDGLSEHLGE
FT                   LILIAGGDGKGADFKPLEPVLEKVSQLIVLGKDADKIAALKPEAIKVTTMAEAVLKANE
FT                   LATAGDIVILSPACSSLDMYPNFMARGDEFRSLVEALHGE"
FT   gene            533020..534240
FT                   /locus_tag="Shal_0454"
FT   CDS_pept        533020..534240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0454"
FT                   /product="cell division protein FtsW"
FT                   /note="TIGRFAM: cell division protein FtsW; PFAM: cell
FT                   cycle protein; KEGG: slo:Shew_3454 cell division protein
FT                   FtsW"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75029"
FT                   /db_xref="GOA:B0TQN6"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQN6"
FT                   /protein_id="ABZ75029.1"
FT                   /translation="MASSEKQLSLFSNRFKWSLPNLFNDNSAPGMQLYDRALLFAVLSL
FT                   ICFGFVMVMSASMPEAQTLTGNPFHFVWRHGAYLIGCVIIAAVVLQIEMRHWQHFSPWL
FT                   LVVVGIMLVAVLFVGTTVNGATRWLSIGPIRIQVAEVAKFAFAIYMAGYLVRRHQEIRE
FT                   NAKGFYKPIAVFAVYAFLILMQPDLGTVVVLFVGTVGLLFLAGARLLDFFALILTGILA
FT                   FVALVLLEPYRMRRVTSFLDPWQDPFGSGYQLTQSLMAYGRGDWFGQGLGNSIQKLEYL
FT                   PEAHTDFIFAVIGEELGFIGIIAVLAVLLFVALRAIKLGSMCLALERAFEGYLAYGIGI
FT                   WICFQTVVNVGASIGMLPTKGLTLPFISYGGSSLWVMTAAAMLLIRIDHERRLSVIQAV
FT                   EGRTSKQ"
FT   gene            534249..535346
FT                   /locus_tag="Shal_0455"
FT   CDS_pept        534249..535346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0455"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /EC_number="2.4.1.227"
FT                   /note="KEGG: shw:Sputw3181_0390
FT                   UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase; TIGRFAM:
FT                   UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase; PFAM: glycosyl transferase family 28;
FT                   Glycosyltransferase 28 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75030"
FT                   /db_xref="GOA:B0TQN7"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TQN7"
FT                   /protein_id="ABZ75030.1"
FT                   /translation="MTNQAEEKRILIMAGGTGGHVFPALAVAKYLSQQGWKVRWLGTAE
FT                   RMEARLVPQHGFDIDFIDIKGVRGNGLMRKLAAPFKIIRSVMQARAVIKKFKPHVVMGM
FT                   GGFASGPGGVAAKLSGIPLVLHEQNAIPGMTNRLLSRIASEVLCAFDGTFTDIKAETVG
FT                   NPIRKELIALGEKRKPVCDDDSLKVLVVGGSLGAKIFNDVMPSVLEGVSKTHSMTVWHQ
FT                   VGRDNLATVKAEYQRLGQDGSVSVAEFIDDMEAAYRWADVVVCRSGALTVSELAAVGLP
FT                   SLLVPYPHAVDDHQTKNAKVLVNAGAAFLLPQPIVDTSKLMTKLSMLASDKQELCNMGQ
FT                   RARDVAILDATQRVANVCIRLAEKG"
FT   gene            535348..536817
FT                   /locus_tag="Shal_0456"
FT   CDS_pept        535348..536817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0456"
FT                   /product="UDP-N-acetylmuramate--alanine ligase"
FT                   /note="TIGRFAM: UDP-N-acetylmuramate--alanine ligase; PFAM:
FT                   cytoplasmic peptidoglycan synthetase domain protein; Mur
FT                   ligase middle domain protein; KEGG: slo:Shew_3452
FT                   UDP-N-acetylmuramate--alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75031"
FT                   /db_xref="GOA:B0TQN8"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TQN8"
FT                   /protein_id="ABZ75031.1"
FT                   /translation="MSNKAEKYSQLRSMIPEMRRVKHIYFVGIGGAGMGGIAEVLVNEG
FT                   YKLSGSDIAESAVTQRLAQLGATIYIGHDASQVKGMDVVVVSTAISADNPELVAAKELR
FT                   IPVVRRAEMLAELMRYRHGVAVAGTHGKTTTTSLIASIYGEAERDPTFVIGGLLNSAGT
FT                   NARLGHSRYLIAEADESDASFLHLQPMVSVVTNIEADHMDTYEGDLEKLKTTFVDFLHN
FT                   LPFYGVAVVCIDDPIVRELIPRIGRRIVTYGFSDDADVQALDFKQTGYSCEFTVKRAGL
FT                   ADLRLSVNLPGEHNVLNALAAIAVATEDDIEDAAIIKALAEFQGIGRRFQQIGEFATSK
FT                   GEIKLVDDYGHHPSEVAATIKAARLGWPERRLVMIYQPHRYSRTRDLYEDFVEVLSQVD
FT                   CLLMLDVYAAGEAPIPGADSRALCRSIRVRGQVEPVFVASTEQLETILPEILQGGDLLL
FT                   TQGAGSIGLLSRSLTESNLGFAATGKDEKNA"
FT   gene            536923..537687
FT                   /locus_tag="Shal_0457"
FT   CDS_pept        536923..537687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0457"
FT                   /product="Polypeptide-transport-associated domain protein
FT                   FtsQ-type"
FT                   /note="PFAM: cell division protein FtsQ;
FT                   Polypeptide-transport-associated domain protein FtsQ-type;
FT                   KEGG: slo:Shew_3451 polypeptide-transport-associated domain
FT                   protein, FtsQ-type"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75032"
FT                   /db_xref="GOA:B0TQN9"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026579"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQN9"
FT                   /protein_id="ABZ75032.1"
FT                   /translation="MSWREKGQRVRVLLSQADWYLCFGVVFLLCVLIGLSMAVMKLNAV
FT                   LNDADALPIEAVAIKGERLYTDDKEIQIALQDLMQRSFFSADVTQVQEALEALPWVYKA
FT                   SVRREWPAKLKVYLVEQKPVAHWNGDAWLNIYGEVFDAPVKEGISNLPLLTGPEEQSKS
FT                   VLTTYQQLGELLRINGFNLQSLSLSPRHAWHAELNNGIKLELGREDKMARIQRFIHVYP
FT                   KLAKQDKQVAIVDLRYDTGLAVGWDDAQKESR"
FT   gene            537691..538926
FT                   /locus_tag="Shal_0458"
FT   CDS_pept        537691..538926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0458"
FT                   /product="cell division protein FtsA"
FT                   /note="PFAM: cell division protein FtsA; KEGG:
FT                   slo:Shew_3450 cell division protein FtsA"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75033"
FT                   /db_xref="GOA:B0TQP0"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQP0"
FT                   /protein_id="ABZ75033.1"
FT                   /translation="MTKNLDRNLIVGLDIGTSKVAVIIGEVLPDGEISIVGLGNHPSRG
FT                   MDKGGVNDLDSIVRSVQRALDQAELMADCQVSSVYLSISGKHIECQNENGMVSINDEEV
FT                   TQEDVDNVIHTARSVKIPTERRILHVLPQEYAIDVQDGIKSPIGMSGMRMEAKVHIVTC
FT                   ANDMAKNITKSVERCGLKVDDLVFSAIASADSVLTDDEKDLGVCLVDIGGGTTDIAVYT
FT                   NGALRHCAVVPVAGNQVTNDIAKIFRTPLSHAEQIKVQHASARSAMVSREDSIEVPSVG
FT                   GRPSRSMSRHTLAEVVEPRYQELFELILKQLRDSGLEDQVAAGIVITGGTASIEGAVDI
FT                   AEATFGMPVRMAQPLPVKGLHEYVDQPIYSTGVGLLHYGARRVIERQFERPERQGVTSL
FT                   WNRVQSWFKGEF"
FT   gene            538958..540145
FT                   /locus_tag="Shal_0459"
FT   CDS_pept        538958..540145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0459"
FT                   /product="cell division protein FtsZ"
FT                   /note="TIGRFAM: cell division protein FtsZ; PFAM:
FT                   Tubulin/FtsZ GTPase; Tubulin/FtsZ domain protein; KEGG:
FT                   slo:Shew_3449 cell division protein FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75034"
FT                   /db_xref="GOA:B0TQP1"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQP1"
FT                   /protein_id="ABZ75034.1"
FT                   /translation="MFEIMDSHSDEAVIKVIGVGGGGGNAVEHMVKHNIEGVEFVATNT
FT                   DAQALRKSAASTTIQLGRDVTKGLGAGANPEIGRLAAEEDRENIRNAIKGSDMIFIAAG
FT                   MGGGTGTGAAPVVAEIAREEGILTVAVVTKPFPFEGKKRMAYADQGIELLAKHVDSLIT
FT                   IPNEKLLKVLGRGTSLLDAFAAANNVLLGAVQGIAELITRPGLINVDFADVKTVMSEMG
FT                   NAMMGTGVASGEDRAEEAAEAAVASPLLEDIDLAGARGVLVNITAGMDMSIEEFETVGN
FT                   HVKAYASDNATVVVGAVIDPEMSDELRVTVVATGIGAEKKPDIQLVSKPAPRPEPIVPA
FT                   EPRVESFAAEDAIAPTMSHGNTAAATQPQVATPVAEKKNELDYLDIPAFLRKQAD"
FT   gene            540323..541243
FT                   /locus_tag="Shal_0460"
FT   CDS_pept        540323..541243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0460"
FT                   /product="UDP-3-0-acyl N-acetylglucosamine deacetylase"
FT                   /note="PFAM: UDP-3-0-acyl N-acetylglucosamine deacetylase;
FT                   KEGG: slo:Shew_3448 UDP-3-0-acyl N-acetylglucosamine
FT                   deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75035"
FT                   /db_xref="GOA:B0TQP2"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TQP2"
FT                   /protein_id="ABZ75035.1"
FT                   /translation="MIFQRTVKEMVKTTGVGLHSGNKVTLTIKPAPVNTGIKLVRTDLS
FT                   PAVEIPAVADQVRETTMCTALVNDDGVRISTIEHLFAALAGLGIDNAVIEVDAPEIPIM
FT                   DGSASPFVFLLQSVGIQEQSAAKKYIKITKPIRVEDGDKWAELKPFKGFRVDFAIDFNH
FT                   PEIARSQQHMVMDFSSSAFIKDISRARTFGFMRDIEYLRANNLALGGSMENAVVLDEYR
FT                   VLNPDGLRYEDEFVKHKILDAFGDLYVAGHAIVGEFCAFKTGHALNNQLVRAMLAQQDA
FT                   WEIVSFEKEADAPVSFSVPAGAVFA"
FT   gene            complement(541251..541703)
FT                   /locus_tag="Shal_0461"
FT   CDS_pept        complement(541251..541703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0461"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3447 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75036"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQP3"
FT                   /protein_id="ABZ75036.1"
FT                   /translation="MKKPPQDLSQLLHQQGTMPNLAEKAELLLHLDHYVKQVLTGPVTE
FT                   QLKVANLRQGILVIETTTAAWAARINFQKPKILQLLQAETLPMLTAIEVKVNPSLLLYA
FT                   TKPKVVHNLISENAAAHIEALAEHTEGTLAVKLKRLAALASRSRQS"
FT   gene            541731..542630
FT                   /locus_tag="Shal_0462"
FT   CDS_pept        541731..542630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0462"
FT                   /product="peptidase M23B"
FT                   /note="PFAM: peptidase M23B; KEGG: slo:Shew_3446 peptidase
FT                   M23B"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75037"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQP4"
FT                   /protein_id="ABZ75037.1"
FT                   /translation="MSVTVFIQGRNGATRWQPGKRWLLLPILLIAAGTGLYQHNAKQLT
FT                   QQQATVDGERMAREEQKDELIALKSATETQLSMLVAHVARMQAKLTRLEVLGQQVALNN
FT                   QLEDQFDFSSEVGVGGISDLGTNIELDQLIADMDKLVSRIDNNNVQLSLLETVASNLHI
FT                   DEERYISGRPIHKGWLSSPYGLRNDPFNGKRTMHKGIDFAGKEGVDVIATAGGVVTWAD
FT                   KMFGYGELVEIDHGNGLSTRYGHNKALSVNVGDVVAKGDKIAVMGSTGRSTGPHVHYEV
FT                   LRGGQQIDPQKYVYRKAG"
FT   gene            542691..545414
FT                   /locus_tag="Shal_0463"
FT   CDS_pept        542691..545414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0463"
FT                   /product="preprotein translocase, SecA subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecA subunit; PFAM:
FT                   helicase domain protein; SEC-C motif domain protein; SecA
FT                   DEAD domain protein; SecA Wing and Scaffold; SecA
FT                   preprotein cross-linking region; KEGG: slo:Shew_3445
FT                   preprotein translocase, SecA subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75038"
FT                   /db_xref="GOA:B0TQP5"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQP5"
FT                   /protein_id="ABZ75038.1"
FT                   /translation="MFGKLLTKVFGSRNDRTLKAFGKVVTKINALEAEYEKLSDEELKA
FT                   KTLHFRERLDGGETLEGVLPEAFATVREASKRVFEMRHFDVQLIGGMILDSNRIAEMRT
FT                   GEGKTLTATLPAYLNGLTGKGVHVITVNDYLAGRDAENNRPLFEFLGLTVGINVAGLGQ
FT                   VEKKAAYDADITYGTNNEFGFDYLRDNMAFSPSERVQRPLHYALIDEVDSILIDEARTP
FT                   LIISGAAEDSSELYIKINTLIPNLIAQDKEDTEDEIGVGDYSVDEKSKQVHMTERGQEK
FT                   VEVLLTERGMLAEGDSLYSAANISLLHHVNAALRAHTLFEKDVDYIVQDNEVVIVDEHT
FT                   GRTMPGRRWSEGLHQAVEAKEGVHIQNENQTLASITFQNFFRQYEKLAGMTGTADTEAF
FT                   EFQHIYGLDTVVVPTNRPMVRKDHADLVYLTAEEKYAAIVKDIVGCRERGQPVLVGTVS
FT                   IEQSELLHSLLKKEKIPHEILNAKFHEREADIVAQAGRTGAVTVATNMAGRGTDIVLGG
FT                   NWNMEIEVLANPTTEQKAKIKADWQIRHDEVVGAGGLHILGTERHESRRIDNQLRGRSG
FT                   RQGDAGSSRFYLSMEDSLMRIFASDRVSSMMKKLGMEEGEAIEHPWVSRAIENAQRKVE
FT                   ARNFDIRKQLLEFDDVANDQRQVVYAQRNELMDADSIQDTITNIQEDVVNGLVDQYIPR
FT                   QSVEELWDIEGLEQRLKQEYAMSLPIQEWLDKEDDLHEETLRERIVDTWVNAYKAKEEM
FT                   VGEQVLRQFEKAVMLQTLDGLWKEHLSAMDHLRQGIHLRGYAQKNPKQEYKRESFELFQ
FT                   QMLESLKHDVISILSKVQVQAQSDVEEMEERRRQEDAKIRRDYQHAEAEALVGAEESAA
FT                   LAATQPTVRDGEKIGRNDPCPCGSGKKYKQCHGKLS"
FT   gene            546241..547775
FT                   /locus_tag="Shal_R0005"
FT   rRNA            546241..547775
FT                   /locus_tag="Shal_R0005"
FT                   /product="16S ribosomal RNA"
FT   gene            547851..547927
FT                   /locus_tag="Shal_R0006"
FT                   /note="tRNA-Ile1"
FT   tRNA            547851..547927
FT                   /locus_tag="Shal_R0006"
FT                   /product="tRNA-Ile"
FT   gene            547993..548068
FT                   /locus_tag="Shal_R0007"
FT                   /note="tRNA-Ala1"
FT   tRNA            547993..548068
FT                   /locus_tag="Shal_R0007"
FT                   /product="tRNA-Ala"
FT   gene            548444..551338
FT                   /locus_tag="Shal_R0008"
FT   rRNA            548444..551338
FT                   /locus_tag="Shal_R0008"
FT                   /product="23S ribosomal RNA"
FT   gene            551528..551643
FT                   /locus_tag="Shal_R0009"
FT   rRNA            551528..551643
FT                   /locus_tag="Shal_R0009"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(552397..552786)
FT                   /locus_tag="Shal_0464"
FT   CDS_pept        complement(552397..552786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0464"
FT                   /product="mutator MutT protein"
FT                   /note="TIGRFAM: mutator MutT protein; PFAM: NUDIX
FT                   hydrolase; KEGG: sbm:Shew185_3948 mutator MutT protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75039"
FT                   /db_xref="GOA:B0TQP6"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003561"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQP6"
FT                   /protein_id="ABZ75039.1"
FT                   /translation="MSQQIHVAVGVIQDSDNRILIAKRPEHLHQGGKWEFPGGKVEDSE
FT                   TTSQALIRELKEEVNLDVVETFPLMEIHHDYGDKQVFLDIHWVTNFSGEAKGLEGQQVS
FT                   WVEKAQLRQYEFPEANKAILEKILG"
FT   gene            complement(552783..553022)
FT                   /locus_tag="Shal_0465"
FT   CDS_pept        complement(552783..553022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0465"
FT                   /product="protein of unknown function DUF329"
FT                   /note="PFAM: protein of unknown function DUF329; KEGG:
FT                   slo:Shew_3443 protein of unknown function DUF329"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75040"
FT                   /db_xref="GOA:B0TQP7"
FT                   /db_xref="InterPro:IPR005584"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TQP7"
FT                   /protein_id="ABZ75040.1"
FT                   /translation="MSLTVKCPTCQAPVTWSADSEFKPFCSERCKLIDLGDWASEKNVI
FT                   PVKSEFDPEMLDQLGYDEADFFLDENPFKDDKNQ"
FT   gene            complement(553082..553816)
FT                   /locus_tag="Shal_0466"
FT   CDS_pept        complement(553082..553816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0466"
FT                   /product="protein of unknown function DUF1342"
FT                   /note="PFAM: protein of unknown function DUF1342; KEGG:
FT                   slo:Shew_3442 protein of unknown function DUF1342"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75041"
FT                   /db_xref="GOA:B0TQP8"
FT                   /db_xref="InterPro:IPR009777"
FT                   /db_xref="InterPro:IPR027462"
FT                   /db_xref="InterPro:IPR036268"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQP8"
FT                   /protein_id="ABZ75041.1"
FT                   /translation="MTELIYEQPLNEKTRSYLRLEYLAQQLQANLDQDHQHRCFYPLFS
FT                   LCELTERCDYRGEVIKDLDRQLFALSKWQSLPSINDEQVELYISKLSTCRDILQASQRP
FT                   GHELKQDRFLSALRQRFNMPGASCNFDLPQLHYWLAKPWEVRQSEYQDWVGHFASLLAP
FT                   VNLLLDLTRQTTEYQVKQASGGFYQGSSEQALSLIRVKLSAEQGCYPTISGHRNRYAIH
FT                   FVQFDQQKHSDQAIEFELATCS"
FT   gene            complement(553825..554430)
FT                   /locus_tag="Shal_0467"
FT   CDS_pept        complement(553825..554430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0467"
FT                   /product="dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /note="KEGG: slo:Shew_3441 dephospho-CoA kinase; TIGRFAM:
FT                   dephospho-CoA kinase; PFAM: Dephospho-CoA kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75042"
FT                   /db_xref="GOA:B0TQP9"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQP9"
FT                   /protein_id="ABZ75042.1"
FT                   /translation="MADYIVGLTGGIGSGKTTVANLFARLGITLVDADIISRDVVAKGS
FT                   TGLSEIVKHFGNTVLLSDGNLNRSMLREKIFEEDSERVWLNNLLHPMIRETMLQQCKQA
FT                   QSSYVIMIVPLLFENGLDSLVDRTLLVDISPDLQQQRTISRDTVSAQQVKNIIGSQASR
FT                   AEKLSKADDVIDNQGEISALKCKVEALHNFYLKLSSNS"
FT   gene            complement(554459..555370)
FT                   /locus_tag="Shal_0468"
FT   CDS_pept        complement(554459..555370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0468"
FT                   /product="Prepilin peptidase"
FT                   /EC_number="3.4.23.43"
FT                   /note="PFAM: peptidase A24A prepilin type IV; peptidase
FT                   A24A domain protein; KEGG: sbm:Shew185_3944 prepilin
FT                   peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75043"
FT                   /db_xref="GOA:B0TQQ0"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="InterPro:IPR010627"
FT                   /db_xref="InterPro:IPR014032"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQQ0"
FT                   /protein_id="ABZ75043.1"
FT                   /translation="MTELISVFGQNPWLFIALSFVFAAVIGSFLNVVIHRMPVMMKRDW
FT                   QQECNHYLSEYKKEVFDSNKKQLEAPIDAFPEKYNLVVPGSACPKCKANIKAVHNLPIL
FT                   GWLMLKGKCATCSTKISPRYPIVELITGALVAFLAWHFGPTLEFALTSLLTFCLVALTG
FT                   IDLDEMLLPDQITLPLLWLGLIINLSGTFATTSDALIGAAAGYLSLWSVFWLFKLLTGK
FT                   DGMGYGDFKLLAVFGAWFGWQVLPLVILLSSLVGAVVGIALIVFKKLNHGNPIPFGPYI
FT                   AAAGWIAMIWGESITNWYLSTL"
FT   gene            complement(555448..556710)
FT                   /locus_tag="Shal_0469"
FT   CDS_pept        complement(555448..556710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0469"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   sfr:Sfri_3784 type II secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75044"
FT                   /db_xref="GOA:B0TQQ1"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQQ1"
FT                   /protein_id="ABZ75044.1"
FT                   /translation="MATATMKTKKPSAKKTKNQPKVLTFQWKGTNRDGAKTSGELRGVS
FT                   SAEIRAQLKAQGVVPKNVRKKSAPLFKSEKKIKPMDIAMMTRQIATMLAAGVPIVTTLE
FT                   LLGKGHEKAKMRELLATIVNDVQSGIPLSDSLRPHRKYFDDLYVDLVAAGEHSGSLDAV
FT                   FDRIATYREKSEALKSKIKKAMFYPAAVVIVAIMVTALLLLFVVPQFEDIFNGFGAELP
FT                   AFTQFIISISRWLQASWYIFVIAIIVGIWSFRRAHLNSQKFRDRVDEFVLKIPAIGDIL
FT                   HKGAMARFARTLATTFAAGVPLIDGLESAAGASGNAVYRKAILKIRTEVMSGMQMNVAM
FT                   RTTGLFPDMLIQMVMIGEESGSLDNMLNKVANIYEMQVDDAVDGLSSLIEPVMMVVIGT
FT                   VVGGLIVGMYLPIFEMGNVVG"
FT   gene            complement(556756..558462)
FT                   /locus_tag="Shal_0470"
FT   CDS_pept        complement(556756..558462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0470"
FT                   /product="type IV-A pilus assembly ATPase PilB"
FT                   /note="TIGRFAM: type IV-A pilus assembly ATPase PilB; PFAM:
FT                   type II secretion system protein E; General secretory
FT                   system II protein E domain protein; KEGG: slo:Shew_3438
FT                   type IV-A pilus assembly ATPase PilB"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75045"
FT                   /db_xref="GOA:B0TQQ2"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR013374"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQQ2"
FT                   /protein_id="ABZ75045.1"
FT                   /translation="MPTTGLHLGLSTLFIRKGLLSEEQIASAISTSRKHKTSLVSTIIS
FT                   NKLISARDIAELCYEEYGTPLLDLDEFDIGSIPEEFLNKKLIEKHKCLPLFKRGNRLYI
FT                   ATSDPTNIAALEDFQFSAGLHAEAILVEDDKLIKALETILEEDISALDLDGIDEESLAG
FT                   IEVTDTDKRDEEENSGKDDAPIVIYINKILTDAIRKGASDLHFEPYEKRYRIRFRIDGI
FT                   LHEVSEPPVNLSGRISARLKVMSKLDIAERRVPQDGRIKMKLSRTKSIDFRVSTLPTIW
FT                   GEKIVMRILDSSSAQLGIEKLGYEEDQRLLYEEMLQKPQGMILVTGPTGSGKTVSLYTG
FT                   LNILNTEERNISTAEDPVEINLEGVNQVHINLKAGLTFASALRSFLRQDPDVVMVGEIR
FT                   DLETAEIAIKAAQTGHLVLSTLHTNSAAETLTRLINMGVPGYNIASSVNLIIAQRLSRR
FT                   LCPNCKAPEDIPAAELLKLGFNQQQVDAGITPHKPVGCDQCSGGYKGRVGIYEVMKMSD
FT                   EIARTIMEGGNSLQILKQAKHQGMRDLRDSGLLKVIQGVTSIAEINRVTSF"
FT   gene            complement(558537..558989)
FT                   /locus_tag="Shal_0471"
FT   CDS_pept        complement(558537..558989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0471"
FT                   /product="prepilin peptidase dependent protein D"
FT                   /note="KEGG: pha:PSHAa0384 prepilin peptidase dependent
FT                   protein D"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75046"
FT                   /db_xref="GOA:B0TQQ3"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQQ3"
FT                   /protein_id="ABZ75046.1"
FT                   /translation="MKSMMKSNMNNAKGFTLIELMIVVAIIGILAAIALPAYQDYTKKA
FT                   KFAEVVTSVGAARSAVELCFQTEGALANCDAGYRGIPAAVVTTTYENLDTMGIANGVIT
FT                   AVGTAGVDSANYIATPTIADGETVLTWTATSTTTPSCIDKGWCSEF"
FT   gene            complement(559772..560656)
FT                   /locus_tag="Shal_0472"
FT   CDS_pept        complement(559772..560656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0472"
FT                   /product="nicotinate-nucleotide pyrophosphorylase"
FT                   /EC_number="2.4.2.19"
FT                   /note="KEGG: shn:Shewana3_0422 nicotinate-nucleotide
FT                   pyrophosphorylase; TIGRFAM: nicotinate-nucleotide
FT                   pyrophosphorylase; PFAM: Quinolinate phosphoribosyl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75047"
FT                   /db_xref="GOA:B0TQQ4"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQQ4"
FT                   /protein_id="ABZ75047.1"
FT                   /translation="MLENDIRLSVKAALDEDLGHQDTKSTLSSTQRSNADITAQLISAD
FT                   KTAQATLITREEGVFCGKAWAEQVFNQLGGEVALHWHVDDGDLVLPNQLLCELEGPARA
FT                   ILTGERTAMNFIQTLSGVATLTKHYVDKLAGTHTRLLDTRKTIPGLRTAQKYAVSCGGG
FT                   QNHRIGLYDAFLIKENHIMACGGIAKAIEAARALHADKLVEVEVENLNELKQALDAQSD
FT                   IVMLDNFDITMMIEAVELNNSYKTKGQGVKLEVSGDVTIDTIANFAKTGVDYISVGALT
FT                   KHVRALDLSLRLK"
FT   gene            560903..561445
FT                   /locus_tag="Shal_0473"
FT   CDS_pept        560903..561445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0473"
FT                   /product="N-acetylmuramyl-L-alanine amidase, negative
FT                   regulator of AmpC, AmpD"
FT                   /note="PFAM: N-acetylmuramoyl-L-alanine amidase family 2;
FT                   KEGG: slo:Shew_3434 N-acetylmuramyl-L-alanine amidase,
FT                   negative regulator of AmpC, AmpD"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75048"
FT                   /db_xref="GOA:B0TQQ5"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQQ5"
FT                   /protein_id="ABZ75048.1"
FT                   /translation="MSLTLLDGWVTQARFCPSPHFNIRPDNEVSLLVIHNISLPAGCFG
FT                   EPYIDQLFQGCLDIEADKSFKALQGLAVSAHFLIRRDGELVQYVCCDDRAWHAGVSEFE
FT                   RRSNCNDFSIGIELEGTDSLTYPDLQYQSLIELTKSLMIHYPEITSTRITGHSDIAPGR
FT                   KTDPGNSFDWQRYKAAL"
FT   gene            561542..562393
FT                   /locus_tag="Shal_0474"
FT   CDS_pept        561542..562393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0474"
FT                   /product="signaling modulator of AmpD, AmpE"
FT                   /note="KEGG: sbm:Shew185_3936 signaling modulator of AmpD,
FT                   AmpE"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75049"
FT                   /db_xref="GOA:B0TQQ6"
FT                   /db_xref="InterPro:IPR031347"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQQ6"
FT                   /protein_id="ABZ75049.1"
FT                   /translation="MALFALLVAILVERLRLLPNAWQFDALLSKYHKPLVNEQQKQSLS
FT                   MVTLAILLPAAIVYLLSWLVSGLLWGSISLALWVAIAVLCFSHNAQRQAFKSYIQAACR
FT                   ADPQACFHYANELDSSQCLDSVNEKELGEKVGQSVAWINYRYYGAIALYLIILGPVGAV
FT                   LYCTVRFYSEQSRKSEVSLPVVDSLLFVLDWLPSRLFSFGYVLSGHFRLAISTWLPLAL
FT                   NPKSSARDMITHVAVAAETLPESSSAPICLQSTIALLQLSKRNFILLITVLSLMTIFGV
FT                   VS"
FT   gene            562753..563505
FT                   /locus_tag="Shal_0475"
FT   CDS_pept        562753..563505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0475"
FT                   /product="regulatory protein GntR HTH"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: sbm:Shew185_3935 regulatory protein GntR
FT                   HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75050"
FT                   /db_xref="GOA:B0TQQ7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQQ7"
FT                   /protein_id="ABZ75050.1"
FT                   /translation="MAYSKINQPKISDVIMGQLEQMILEGSIQPGQKLPPERELALQFE
FT                   VSRPSLREAIQKLEAKGLLMRRQGGGTYVKEQLWQSLADPIVELMHSDSESQYDLLEFR
FT                   HATEGMMAYFAALRGTDADMQNIKRTILEVEAAKDVEAQANAIVRFYRAVAEASHNVAM
FT                   LHLVLSLSPVLHKNVTQNLELLSRREEASTTANDHRRALLAAIIRRDPEAAREASNEHL
FT                   SYIEEVMLSVREEDSRLQRSLRRLKSGV"
FT   gene            563572..566235
FT                   /locus_tag="Shal_0476"
FT   CDS_pept        563572..566235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0476"
FT                   /product="2-oxo-acid dehydrogenase E1 subunit, homodimeric
FT                   type"
FT                   /EC_number="1.2.4.1"
FT                   /note="TIGRFAM: 2-oxo-acid dehydrogenase E1 subunit,
FT                   homodimeric type; KEGG: slo:Shew_3431 2-oxo-acid
FT                   dehydrogenase E1 subunit, homodimeric type"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75051"
FT                   /db_xref="GOA:B0TQQ8"
FT                   /db_xref="InterPro:IPR004660"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR035807"
FT                   /db_xref="InterPro:IPR041621"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQQ8"
FT                   /protein_id="ABZ75051.1"
FT                   /translation="MSEHMLQDLDPLETQEWVDSLQAVLEQEGPERAHYLLEKLIDKAR
FT                   RNGTHLPYKATTAYLNTIPAGQEPHMPGNQEMERRIRAIVRWNALAMVLRGSKKDLELG
FT                   GHISSFASSATIYDVCFNHFFRGPNEKDGGDLVYFQGHIAPGIYSRSFLEGRITEDQMN
FT                   NFRQEVDGKGLSSYPHPKLMPDYWQFPTVSMGLGPIQAIYQARFLKYLTDRGIKDCSEQ
FT                   TVYCFLGDGECDEPEALGAIGLAAREELDNLCFIVNCNLQRLDGPVRGNGKIIQELEGE
FT                   FRGAGWEAVKVIWGRYWDPLLARDTSGKLLQLMEETVDGEYQNCKAKGGAYTREHFFGK
FT                   YPETAEMVANMSDDDIWRLNRGGHDPVKIFAALQHAKNTKGRPTVILAKTVKGYGMGDA
FT                   GEGKNIAHNVKKMGIESLRYFRDRFNIPISDEQLEDIPFYHPGADSEEVQYLKARRAEL
FT                   HGMIPARRAKFSQELEVPSLKIFDSILKGSNGREISSTMAFVRILTALLKDKKIGKQIV
FT                   PIIPDEARTFGMEGLFRQVGIYAHEGQKYVPQDSDQVAYYREDKSGQVLQEGINELGAM
FT                   SSWVAAATSYSVNDTPMIPFYIYYSMFGFQRIGDMAWAAGDMRARGFMVGGTSGRTTLN
FT                   GEGLQHQDGHSHILANTIPNCISYDPTYGYEIAVVVQDGIRRMYGEQEDVFYYLTTMNE
FT                   NYEQPAMPEGAEEGIVKGIYKLETLKGSGKGSVQLMGSGTILEQVRKAAVALSKDFGIT
FT                   ADVYSVTSFNELTRDGQAAERYNMLHPTETAKVPYITQVLASDAPAIVATDYMKIYGEQ
FT                   LRAYVPTDYKVLGTDGFGRSDSRENLRHHFEVDAKFIVIASLKALVDRNELPVDVLTKA
FT                   IKEYGIDVDKINPQYA"
FT   gene            566248..567915
FT                   /locus_tag="Shal_0477"
FT   CDS_pept        566248..567915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0477"
FT                   /product="pyruvate dehydrogenase complex dihydrolipoamide
FT                   acetyltransferase"
FT                   /EC_number="2.3.1.61"
FT                   /note="KEGG: sfr:Sfri_3776 pyruvate dehydrogenase complex
FT                   dihydrolipoamide acetyltransferase; TIGRFAM: pyruvate
FT                   dehydrogenase complex dihydrolipoamide acetyltransferase;
FT                   PFAM: biotin/lipoyl attachment domain-containing protein;
FT                   catalytic domain of components of various dehydrogenase
FT                   complexes; E3 binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75052"
FT                   /db_xref="GOA:B0TQQ9"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006256"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQQ9"
FT                   /protein_id="ABZ75052.1"
FT                   /translation="MAELKEVLIPDIGGDEVQVIEICAAVGDTLAAEESIITVESDKAT
FT                   MDIPAPFAGVLSELKVAVGDTVSEGTLIAMMSAAGAQAPTEVESTPAAPDAVQAPVAAQ
FT                   APAPEEAPAASVASTTQVIEVSVPDIGDASDVDVIEVLVAVGDKIDADTGLITLETDKA
FT                   TMEVPAPSAGIVKELKVAVGDKVSMGSLVLMLEVSDAAPAAPVVAAPATSTPAPVAPAP
FT                   VAQAASANKPPVPHHPSAGSQPKTGAVHASPAVRRLAREFGADLTLVKGTGRKGRILKE
FT                   DVQAFIKYELSRPKASAATAVAGGAGGLSVIAAPKVDFAKFGEVEEVPLSRIQKISGPN
FT                   LHRNWVTIPHVTQFDEADITELEAFRKDQNAVAAKKKADYKITPLVFMMKAVAKTLAEF
FT                   PVFNSSLSADGESLIQKKYFHIGVAVDTPNGLMVPVVRDVDKKGIVELSRELTEISVKA
FT                   RDGKLKAADMQGSCFTISSLGGIGGTAFTPIVNYPDVAILGVSKSEIKPKWNGKEFEPK
FT                   LMLPLSLSYDHRVIDGAMAARFSVTLSSILSDIRTLIL"
FT   gene            568136..569563
FT                   /locus_tag="Shal_0478"
FT   CDS_pept        568136..569563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0478"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /note="TIGRFAM: dihydrolipoamide dehydrogenase; PFAM:
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; glucose-inhibited division protein A;
FT                   pyridine nucleotide-disulphide oxidoreductase dimerisation
FT                   region; KEGG: slo:Shew_3429 dihydrolipoamide dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75053"
FT                   /db_xref="GOA:B0TQR0"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B0TQR0"
FT                   /protein_id="ABZ75053.1"
FT                   /translation="MSNEIKTQVVVLGAGPAGYSAAFRAADLGLDTVIVERFSTLGGVC
FT                   LNVGCIPSKALLHVSKVIEEAKAVADHGVVFGEPKIDLDKLRGFKEKVIGQLTSGLGGM
FT                   SKMRKVDVVNGLGKFTGPNTLEVQGEDGVKVVHFEQAIIAAGSRPIQLPFIPHEDPRVW
FT                   DSTDALELKEVPGKLLVMGGGIIGLEMGTVYSSLGSEIDVVEMFDQVIPAADKDVVRVY
FT                   TKKIKKKFNLMLETKVTAVEAKEDGIYVTMEGKKAPAEPVRYDAVLVAIGRIPNGKGLD
FT                   AEKAGVKIDERGFINVDKQMRTNVPHIFAIGDIVGQPMLAHKGVHEGHVAAEVISGLKH
FT                   FFDPKVIPSIAYTDPEVAWVGLTEKEAKDQGVAYETATFPWAASGRAIASDCADGMTKL
FT                   IFDKETHRVIGGAIVGVNGGELLGEIGLAIEMGCDAEDLALTIHAHPTLHESVGLAAEI
FT                   YEGSITDLPNPKAKKKK"
FT   gene            569720..574183
FT                   /locus_tag="Shal_0479"
FT   CDS_pept        569720..574183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0479"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="KEGG: slo:Shew_3428 diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC and GAF sensor(s);
FT                   TIGRFAM: PAS sensor protein; diguanylate cyclase; PFAM:
FT                   GGDEF domain containing protein; EAL domain protein; Two
FT                   component regulator propeller; PAS fold-3 domain protein;
FT                   PAS fold-4 domain protein; SMART: PAC repeat-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75054"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B0TR82"
FT                   /protein_id="ABZ75054.1"
FT                   /translation="MRITIKKIWLSLLLLVITYAVPALASGAVQRVFTANDGLNNATVW
FT                   DISFDKHGFTWLATEEGLYRVSSNKVRRIDKLGLNSRLGDSALYLAEPLGLHHILVSGA
FT                   YQIYLYDIHRNEFIEFGSSKLFPEYRGGGIVSQVEESGGDRIFLTYDGELLRFNYQNMT
FT                   LQRINFLPSNPDHPWRIMLPLSENRLLVGKESHLEVRDINGVRLEVLPWSDAWGEIKNV
FT                   FKHSSGRAWITTSKGLFEIDQKTLSITRVEQLEHYITNIAEDKHGYLWLSTRAGLLRWF
FT                   PDAEKGTLYGNELKLKSNIDYTYDIAVDDTGLIWVGGSGDGVAILTVEPNFLKDKYTKT
FT                   APYKIKDEVIWTIYAEDNHVWFGTDAGLILVDNLTQKSYLINPHGISLNDSIYKIDSLN
FT                   KDFLLLSTTNGLSVVNKSTFHSQSFASWSGGQSSLEYKVVYNTYFDPFIEGRIWFATSS
FT                   GLYYWEQGFKEPKPVRIGSALNSHVLVEITAVTRDSSNRLWLGGNRIFGYLDAQLTFHP
FT                   KMEPLSTQGVESSVRFIKEVGPDELWLGLKSHGLLSFNMHTGELKNLTDSWNVTCQGVY
FT                   FIEEVSHYRLIGCPQSLIRQNMINGELITISSLDGLISDELNEGAYFSSEEGFFLGTPD
FT                   GAMLIDIDLLKNRVTNESVLLESIEIYFEDRTELSLLPESDYHILPGAQLVSFQLARRN
FT                   YLDAKPMRLKYRLRQGASDDEASYIFLEGKSHLNISGLGSGSYVLDIISLDNNIWSETP
FT                   FSFHFYVEQYWWQTSWFKSVLLLILLLVGLGGALIRQRQVKAFREINLALTDSENRLKQ
FT                   ALKGSNSERWEWQLGSNLFCLENIAGLFSDGEPQVYLKLEQFPIHRDDASEVMAAWQDM
FT                   LLERTDRFEVEYRYCRADNTWGWVRVMGRPVERNHLTGVIERVAGIYSDISEQRKLKDD
FT                   VYLLAQAFENTSEAVLIFDSAERVQVTNKAAKNMMGLDSKRLIGLQFSQVLQGGEKNSS
FT                   IVNLLDQGLSWAGECFINAEDSLRCAVWLNVSSILNTNGDTTHYVVVFSDITERKRTEA
FT                   DLRRLANYDVLTGLPNRSLFSSKLSQSVYQAERDGGNLALLFLDLDRFKHVNDSYGHSM
FT                   GDALLVEASNRLQALISDEHVLCRFGGDEFVILLRNNPDIDVINHLCDALLASIELPFE
FT                   LYGREFYISTSIGVSLWPEDAKQPESLIKNADLAMYHAKEEGKGNFKYYSEERNAEALY
FT                   HLRLEAELRKAIERNELELHFQPQIDILQNDKLVGVEALLRWNHPKEGLVRTDIFIKVA
FT                   EACGLIVEIDRWVMREACIYGARWAALLPEPLKVSVNISALHFRQPDFIKGVQQVFAET
FT                   SMPNTALSFEITEGVLMKELKVAKQHIQELKSLGVNVAIDDFGTGYSSLAYLRHFEVNT
FT                   LKIDRSFLIDIATNKADQAIASSIIELARNLKLDVVAEGVETHEQLEQVFSRGCYVIQG
FT                   YYFAKPMPAAEIESYMGLNQALSLEV"
FT   gene            574277..576493
FT                   /locus_tag="Shal_0480"
FT   CDS_pept        574277..576493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0480"
FT                   /product="Patatin"
FT                   /note="PFAM: Patatin; surface antigen variable number
FT                   repeat protein; KEGG: she:Shewmr4_0432 patatin"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75055"
FT                   /db_xref="GOA:B0TR83"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:B0TR83"
FT                   /protein_id="ABZ75055.1"
FT                   /translation="MIHRIIILCLAIASPHVAFAEERPKIGLVLSGGGAKGAAHIGVLK
FT                   VLEEKQIPIDYITGTSIGAYVGGMYALGYSAAEIEAIMMNTDWSQGYSDTIPRESLSYR
FT                   DKETRDQFNIPLNVGYSDEQVKTPAGLLRGQTMSQLLRSSTDLVHQFGDFDDLSIPYRA
FT                   VATNLATSEPVVLSSGSVVAAMQASATVPGALQPAVIDGKLLVDGGIANNMPIDVVKAM
FT                   GADIVIAVDIGSPLMDKSELNSTIAVLNQLSTILTNASSDRQKALLTDHDILIRPNIGE
FT                   LSTTDFSIMPIALPLGEIAAREQVGKLEQYSVENTEYKQYLADKKEKSLQWLADIDRPL
FT                   IKVIYDNDSKISEKLLADNLELDVGDNVTVEALEAGLDRIYALNKFERVDAEFTDTEDG
FT                   RVLTVTTKAKSWGPNFFQLGFSWEDDFSLDSVISLDMAYTMTELTENGGEWRNEVSLGF
FT                   DKLIASEFYQPLVKDQTYFSRARVEYELKDWSFFENNNRVLELKQTAYRTELGIGINYT
FT                   QNGMVEIGILGEMGDLENDLWGFGKVDYDGYGGYFKFAYDDLNSINFPTSGNRFTFNVY
FT                   MRKEGYELDGVGDSSDFSMQYEADWRGAVGVGNHAFVGIASLATVDKDGAFTVNVSELG
FT                   GFLNLSGYHKNALYGSHKIFGAFVYQYDLGRDVLGMTEYPLYLGTSIEAGNVWNQKDSV
FT                   SLEDLIYAGSLYLGIDTSVGPAAFGFGASDDGEKTVFLFIGKNW"
FT   gene            complement(576654..577319)
FT                   /locus_tag="Shal_0481"
FT   CDS_pept        complement(576654..577319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0481"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: sfr:Sfri_3772 HAD-superfamily hydrolase,
FT                   subfamily IA, variant 3"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75056"
FT                   /db_xref="GOA:B0TR84"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B0TR84"
FT                   /protein_id="ABZ75056.1"
FT                   /translation="MSIPELKAVIFDMDGVLIDSEPVWQIAEHKVLTELGLNVSIEDMT
FT                   LTTGLRIDQVVDYWYARFPWSNDNHQQTAQAIVDQVVSHISADGEPMKGVIQALKACQK
FT                   HDLKIGLATSSSSDIIHAVLNRLEIGTYFHAINSAEHLAYGKPHPEVYLSCAQALDIDP
FT                   INCLAIEDSFNGLVSARAACMQTIAIPEAKHAALSKWVIAHQQLNSLEALPDFLAKRC"
FT   gene            577723..580320
FT                   /locus_tag="Shal_0482"
FT   CDS_pept        577723..580320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0482"
FT                   /product="aconitate hydratase 2"
FT                   /note="PFAM: aconitate hydratase domain protein; aconitate
FT                   hydratase 2; KEGG: slo:Shew_3424 aconitate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75057"
FT                   /db_xref="GOA:B0TR85"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004406"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015929"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR015933"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="InterPro:IPR036288"
FT                   /db_xref="UniProtKB/TrEMBL:B0TR85"
FT                   /protein_id="ABZ75057.1"
FT                   /translation="MLEAYRKHVAERASEGVVPKPLDAQQVAQLVELVKNPPAGEEAFI
FT                   LDLLENRIPPGVDEAAYVKAGFLDAVAKCEIASPILSSQRAVELLGTMQGGYNIEPLIA
FT                   QLDNDAQAPLAVKALSHTLLMFDSFHDVVDKMQAGNDYAKQVVHAWADAKWFLSRPKLA
FT                   EKISLTVFKVSGETNTDDLSPAPDAWSRPDIPLHALAMLKNARDGIVPDEAGVVGPIKE
FT                   IESLKTKGFPLVYVGDVVGTGSSRKSATNSVLWFMGDDIPNVPNKRAGGFCLGGKIAPI
FT                   FFNTMEDAGALPIELDVSKMEMGDVIDIYPYEGIVKRHGTDEVISQFSLKTDVLMDEVR
FT                   AGGRIPLIIGRGLTDRARETLNLEASTEFVRPKDVADTGKGFTLAQKMVGKACGVTGIR
FT                   PGQYCEPKMTSVGSQDTTGPMTRDELKDLACLGFSADLTMQSFCHTAAYPKPVDVNTHH
FT                   TLPDFIMNRGGVSLRPGDGVIHSWLNRMLLPDTVGTGGDSHTRFPIGISFPAGSGLVAF
FT                   AAATGVMPLDMPESILVRFKGEMQPGITLRDLVHAIPHKAIEMGLLTVEKKGKINAFSG
FT                   RVLEIEGLEQLKVEQAFELSDASAERSAAGCTIKLDKEPIIEYLNSNIVMLKWMISEGY
FT                   GDRRTIERRITAMQEWLATPELMEADSDAEYAEVIEIDLNEIKEPILCAPNDPDDAILL
FT                   SSVVNTKIDEVFVGSCMTNIGHFRATGKMLDKFASTLPTRLWIAPPTKMDRDQLTEEGY
FT                   YAIFGRVGARIEIPGCSLCMGNQARVAEGATVVSTSTRNFPNRLGTGANVYLASAELAS
FT                   VAALLGRLPSPDEYQTYAKELDATAADTYRYLSFDKIASYTAKADEVIFQTAV"
FT   gene            complement(580452..580919)
FT                   /locus_tag="Shal_0483"
FT   CDS_pept        complement(580452..580919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0483"
FT                   /product="regulator of RpoD, Rsd/AlgQ"
FT                   /note="PFAM: regulator of RNA polymerase sigma(70) subunit
FT                   Rsd/AlgQ; KEGG: slo:Shew_3423 regulator of RpoD, Rsd/AlgQ"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75058"
FT                   /db_xref="GOA:B0TR86"
FT                   /db_xref="InterPro:IPR007448"
FT                   /db_xref="InterPro:IPR038309"
FT                   /db_xref="UniProtKB/TrEMBL:B0TR86"
FT                   /protein_id="ABZ75058.1"
FT                   /translation="MLRNLEKAEQKWGGSNTLIDQWLNNRRNLLINYCQIAGIPPYEVT
FT                   DKSLPAFASVKQFCDQLMDYVSEGHFEIYDQVVTACEKNGSSSQELAQQLVPQISETTD
FT                   TALDFNDKYTEAEDEQVLFHLDKDLSSLGHAMETRFELEDKLLEVLHAKHS"
FT   gene            581451..582515
FT                   /locus_tag="Shal_0484"
FT   CDS_pept        581451..582515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0484"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /note="KEGG: sfr:Sfri_0482 uroporphyrinogen decarboxylase;
FT                   TIGRFAM: uroporphyrinogen decarboxylase; PFAM:
FT                   Uroporphyrinogen decarboxylase (URO-D)"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75059"
FT                   /db_xref="GOA:B0TR87"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TR87"
FT                   /protein_id="ABZ75059.1"
FT                   /translation="MAELKNDRYLRALLKQPVDRTPVWMMRQAGRYLPEYKATRAEAGD
FT                   FMSLCKNQDLACEVTLQPLRRYDLDAAILFSDILTVPDAMGLGLYFETGEGPRFERPTD
FT                   TIDSIKKLCIPDPEDELGYVMRAVSTIRRELKGEVPLIGFSGSPWTLATYMVEGGSSKA
FT                   FEKIKKMAYEEPATLHMLLDKLADSVTLYLNAQVANGAQSLMIFDSWGGALSHHAYREF
FT                   SLRYMQKIVDGLTRHADGRQVPVTLFTKGGGLWLESMAETGCDALGLDWTVDIGDARRR
FT                   VGHKVALQGNMDPSVLYGTPERIHQEVDQILSSYGEGTGHVFNLGHGIHQHVDPERAGS
FT                   FINSVHELSAKYHK"
FT   gene            582852..585419
FT                   /locus_tag="Shal_0485"
FT   CDS_pept        582852..585419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0485"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="KEGG: slo:Shew_3416 diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC sensor(s); TIGRFAM:
FT                   PAS sensor protein; diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; histidine kinase
FT                   HAMP region domain protein; PAS fold-4 domain protein; PAS
FT                   fold domain protein; SMART: PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75060"
FT                   /db_xref="GOA:B0TR88"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B0TR88"
FT                   /protein_id="ABZ75060.1"
FT                   /translation="MQIGKKAVLVIFGICIPLLVAASFIAISWLHSEVDAIRSYVIEKE
FT                   LESIQSRIDRDLERFQLQLETSSLHPQSGVPISLLPEITVFGSTQVQQVIDGKFQPIDK
FT                   SKPMEPMLPTALLASKQTKSGVYFDSRQAVGYVIGIQAESDIRPERLVLISRLTDNYLA
FT                   TLGLADFATKIEIEAGSAKHGGGLRGNTVIAQLNVPALLNQEQAHLSITFSNQFFSGMT
FT                   RLYSAQTFGLLGLVSVLLLLVFFWLRSAVIRPLNQLSEQVLSLEPNSKDRQYIKSAGDN
FT                   ELSQVTKNINQLLERHYRQEKLSQVTLESITDMVILTDIHYNVSYINPYAEHLLKLSNE
FT                   QAQGKKLHELLPGNQSLNNKITTFMQSSSLSIDSIRLRLNIDSPKLMSGTFGHFCNHSG
FT                   DIIGAVLVLKDTTQEVLLKQQLQRQAYLDPVTGLLNRAAFEERLVGYAQSSQFIAVVYF
FT                   DLEQFKLINDSCGHNAGDKMLSKVAKAIESSLSSNMLLGRIGGDEFGLIIKDSSALAVA
FT                   KLIKKIIASVGCQSIEHNDTSYRVGLSAGVALARFNQQTDALELLKDADIACLAAKRKG
FT                   SNQVHFYDSRDKDLSYQRNAPKWAVRIVQAIEHNELILYYQKIKCLSSHSHRQRLEILL
FT                   RIQDAGGRILPPAQFIAAAERFKLIVEVDKEVIRKTFLWLSLNEQVWSDHCLSINLSGN
FT                   SLGAEGMIDFILLQQKRFGIPSSCVCFEITETSAIQNHSRALKMIADLRRRGFAFALDD
FT                   FGSGFASYGYLKEMPVDYVKIDGCFVKNLASNAKDYAIVKSVNDVCRVMGIETVAEFVE
FT                   NQEIIDRLEVIGVNYAQGYGIGRPQALDSYQSETVSEQVMATY"
FT   gene            complement(585409..585627)
FT                   /locus_tag="Shal_0486"
FT   CDS_pept        complement(585409..585627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0486"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shn:Shewana3_0438 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75061"
FT                   /db_xref="UniProtKB/TrEMBL:B0TR89"
FT                   /protein_id="ABZ75061.1"
FT                   /translation="MKYSIGDLIYQGETSGVHNWDTLSGSSFYWHPDWLHIAENMTGHN
FT                   ATAHIEASAEKATKAEATEAIVKHLNK"
FT   gene            complement(585995..587296)
FT                   /locus_tag="Shal_0487"
FT   CDS_pept        complement(585995..587296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0487"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="KEGG: sfr:Sfri_0492 phosphoribosylamine--glycine
FT                   ligase; TIGRFAM: phosphoribosylamine--glycine ligase; PFAM:
FT                   phosphoribosylglycinamide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75062"
FT                   /db_xref="GOA:B0TR90"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:B0TR90"
FT                   /protein_id="ABZ75062.1"
FT                   /translation="MRVLIIGGGGREHALAWKAAQSTQVETVFVAPGNAGTALEPKLEN
FT                   VAINVEEISALVAFATEQKVAITIVGPEVPLALGVVDAFNEAGLPIFGPTKGAAQLESS
FT                   KAFTKDFLARHNIPTAAYSNFTEIAPAKAYVTQVTGLTGFPIVIKADGLAAGKGVIIAA
FT                   DQVEADAAIEDMLAGNKFGEAGSRVVIEEFLRGEEASFIVMVDGKNILAMATSQDHKAR
FT                   DNGDHGPNTGGMGAYSPAPVVTQAVHDWTIEHVIRPTVDGMAAEGNVYTGFLYAGLMIS
FT                   PDGSAKVLEYNCRFGDPETQPIMMRLQSDIVELCLASTRGELDQVTAEFDDRAAVGVVL
FT                   AAGGYPDAYRKHDVIEGLTLGNNHAKVFHAGTCMKEGLVVTNGGRVLCATALGNTVTEA
FT                   QQSAYALVDAVHWDDAYFRTDIAYRAIARENGEG"
FT   gene            complement(587494..589083)
FT                   /locus_tag="Shal_0488"
FT   CDS_pept        complement(587494..589083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0488"
FT                   /product="phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase"
FT                   /EC_number="2.1.2.3"
FT                   /note="KEGG: slo:Shew_3412
FT                   phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase; TIGRFAM:
FT                   phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase; PFAM: MGS domain
FT                   protein; AICARFT/IMPCHase bienzyme formylation region"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75063"
FT                   /db_xref="GOA:B0TR91"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TR91"
FT                   /protein_id="ABZ75063.1"
FT                   /translation="MNNARPIRRALLSVSDKTGILEFAQALHAQGVELLSTGGTARLLA
FT                   DNGVPVIEVSDYTGHPEIMDGRVKTLHPKVHGGILARRGIDEIVMEQNNIKPIDLVAVN
FT                   LYPFAATVAAEGCTLADAIENIDIGGPTMVRSTAKNHKDTTIIVNANDYGRVIAEMQAN
FT                   QGSTTLETRFDLAIAAFEHTAAYDGMIANYFGTKVPAHSKDECHEDSKFPRTYNTQLVK
FT                   KQDLRYGENSHQTAAFYVDTHLDEASVATAVQLQGKALSYNNIADTDSALECVKEFDEP
FT                   ACVIVKHANPCGVAIGENLLEAYNRAFQTDPTSAFGGIIAFNGELDAATASAIVERQFV
FT                   EVIIAPKVSQAARDVIAAKANVRVLECGQWASKTTSLDYKRVNGGLLLQDRDQGMVGID
FT                   DVKVVSKRQPTASEMKDLMFCWKVAKFVKSNAIVYAKNSMTIGVGAGQMSRVYSAKVAG
FT                   IKAADEGLEVQDSVMASDAFFPFRDGIDAAAEAGISCIIQPGGSIRDEEIIAAADEHGM
FT                   AMVFTGMRHFRH"
FT   gene            589431..589946
FT                   /locus_tag="Shal_0489"
FT   CDS_pept        589431..589946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0489"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="TIGRFAM: Zn(II)-responsive transcriptional
FT                   regulator; PFAM: regulatory protein MerR; Transcription
FT                   regulator MerR DNA binding; KEGG: slo:Shew_3411
FT                   transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75064"
FT                   /db_xref="GOA:B0TR92"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011788"
FT                   /db_xref="UniProtKB/TrEMBL:B0TR92"
FT                   /protein_id="ABZ75064.1"
FT                   /translation="MYRIGELAQQCEVKTDTLRFYEKHGLLSPSSRTDSGYRIYTEADA
FT                   QRLRFILRAKAVGFTLAEITELLSIELDRSNWACADVKGLVDVKLANVEAKIAELNHFQ
FT                   LSLQRLSQACCGGPESAEHCSILEALESNTDSIRCENDKHRHGEQEFTKTCSDKSIAKS
FT                   ITKKTHEK"
FT   gene            589949..591298
FT                   /locus_tag="Shal_0490"
FT   CDS_pept        589949..591298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0490"
FT                   /product="permease"
FT                   /note="PFAM: permease; KEGG: slo:Shew_3410 permease"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75065"
FT                   /db_xref="GOA:B0TR93"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:B0TR93"
FT                   /protein_id="ABZ75065.1"
FT                   /translation="MLFENFIELFLESAPWLLLGLVLAGMLKMFVPMVWMQKQLGGHGF
FT                   KTTVKAAILGAPLPLCSCGVIPAAVGLRRSGASKAATTSFLVSTPETGVDSVTVSYVLL
FT                   GPFMAIVRPIAAVISAIVAGLLVGRDDDDGKPVVSEQAKAGAAPKSESAASCCSSKKSA
FT                   PKVEPVASCCSNNKGEAKVEPVASCCSSKKVEYKAEKASCCSSKKAPAVEAVVAEKSSC
FT                   CSSKKAESSSHVHGQADTEAEGCCESTRDIATELKGTSVISRIGKGLHYAATDLVRDTT
FT                   IWLLIGLFFAALVQTYVPADFMAKWGDGILAMLVMVLISVPMYICATASTPIAAGLLLA
FT                   GVSPGAVLVFMLAGPATNIATLGVVTKELGKRALYGYLGGVLGVALVSGILVNYLVDTF
FT                   GFVVMPQIGEQHELLPAGIVYTSGVILAILMAKVFLDKLPKNWWRRDCCS"
FT   gene            591473..592141
FT                   /locus_tag="Shal_0491"
FT   CDS_pept        591473..592141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0491"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: maq:Maqu_3568 DsbA
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75066"
FT                   /db_xref="GOA:B0TR94"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B0TR94"
FT                   /protein_id="ABZ75066.1"
FT                   /translation="MKKRLVSLFLTFAMIACSEPSKLDVDGNLVEGFVEGVHYRTLATP
FT                   IPASNDDISVTEFFWYGCPHCQLFEKPLHDWEKTMADGVTLVQSPAVWSEAMKLHAKVF
FT                   FIVQQMENMQQVHAALFEEIVGLREVRDLNEQQAKLGVFLSGYGLTQQKFNEKLNSADI
FT                   ISKLKQAIQLMSSAEINGTPTILVNGRYIVLNDSASSAKQVMDIASYLVELEKARLANP
FT                   "
FT   gene            592862..593443
FT                   /locus_tag="Shal_0492"
FT   CDS_pept        592862..593443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0492"
FT                   /product="molybdopterin oxidoreductase Fe4S4 region"
FT                   /note="PFAM: molybdopterin oxidoreductase Fe4S4 region;
FT                   KEGG: sbm:Shew185_0099 molybdopterin oxidoreductase Fe4s4
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75067"
FT                   /db_xref="GOA:B0TR95"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="UniProtKB/TrEMBL:B0TR95"
FT                   /protein_id="ABZ75067.1"
FT                   /translation="MDRRQFFKLCACGATTSAISALGLMPGTAMAAPREYKLLRAKETR
FT                   NNCCYCSVGCGLLMYSNGSNGKNAEQAIFHIEGDADHPVNRGALCPKGAGLVDYVNSPN
FT                   RNHFPEVREAGSNEWKRISWNEAFGRIARLMKDDRDANLIEKNSDGTTVNRWLSTGMMT
FT                   SSAQPNEGGFITHKFARSLGLVAIDTIARN"
FT   gene            593492..595879
FT                   /locus_tag="Shal_0493"
FT   CDS_pept        593492..595879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0493"
FT                   /product="formate dehydrogenase, alpha subunit"
FT                   /EC_number="1.17.1.9"
FT                   /note="KEGG: sbm:Shew185_0099 molybdopterin oxidoreductase
FT                   Fe4s4 region; TIGRFAM: formate dehydrogenase, alpha
FT                   subunit; PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75068"
FT                   /db_xref="GOA:B0TR96"
FT                   /db_xref="InterPro:IPR006443"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:B0TR96"
FT                   /protein_id="ABZ75068.1"
FT                   /translation="MTNHWIDIKNANVVVIMGGNAAEAHPVGFGWVTEAMEHNNAKLVV
FT                   VDPRFNRSAALADCYAPLRSGTDIAFLLGLCRYLIETKQINYDYVKAYTNASYIVRDDY
FT                   EFNEGLFSGFDDKSRTYDKETWYYELDEDGYAKVDDTYEHQRCVWNLLKHHVDRYDFET
FT                   VSNITGTPVEDYEKVCALIGSTHVHNKAATFLYALGWTHHTKGAQNIRSMALVQLLLGN
FT                   IGVLGGGVNALRGHSNVQGATDMGLLCQNLPGYLKLPNDNDTDLATYLENYTPKALRPG
FT                   QTNYWSNYPKFFISQMKSFWGENATAANNFGYDWLPKWDLQYDYTKHIDMMYHGQVNGY
FT                   FVQGVNAINSMPNRNKTLAALCKLKYLVVMDPLATETSVFWKKAGEYNNVDPSDIQTQV
FT                   FRLPTTLFAEEEGCIVNSGRWMQWHWKGANPPGESKPDAEILSGIMMQLRELYKAEGGV
FT                   LPEPIDAVKWDYHNPHTPHGEEVAKELNGIDLKTGKQLDSFSQLKDDGSTSCGCWIYSG
FT                   SWTEQGNMMARRDNSDTSGKGITPGWAFSWPANRRVLYNRASCDVNGKPWDPSRVIVEW
FT                   TNGKWHGIDVGDFNMKLSPKESAHPFIMQPEGVGRFFALKMLAEGPFPEHYEPMETPIG
FT                   TNPLHPNVISNPAVRMLPGVAETLGSHNEFPYVCTTYSLTEHFNFWTIHCRLAAISMPE
FT                   TFVELDEILAAAKGINNGDWVKVSSKRGSLMTKALVTKRLQPLKVNGQMVHTVGLPRHG
FT                   GYNGLTRRSSSCNVLTTEVGDANTQAPEYKAFLVDITKAEGV"
FT   gene            595882..596784
FT                   /locus_tag="Shal_0494"
FT   CDS_pept        595882..596784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0494"
FT                   /product="formate dehydrogenase, beta subunit"
FT                   /note="TIGRFAM: formate dehydrogenase, beta subunit; PFAM:
FT                   4Fe-4S ferredoxin iron-sulfur binding domain protein;
FT                   Formate dehydrogenase transmembrane domain protein; KEGG:
FT                   sbm:Shew185_0101 formate dehydrogenase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75069"
FT                   /db_xref="GOA:B0TR97"
FT                   /db_xref="InterPro:IPR006470"
FT                   /db_xref="InterPro:IPR014603"
FT                   /db_xref="InterPro:IPR015246"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR038384"
FT                   /db_xref="UniProtKB/TrEMBL:B0TR97"
FT                   /protein_id="ABZ75069.1"
FT                   /translation="MSAQDIILSSGTSELTPAAQVRRKLSKVAKLFDATKCSGCKACQV
FT                   SCSEWNDLRAPVGSFQGSYQNPMDLSSECWTLMKYNEIEQDNKLRWNFTHSACMHCADP
FT                   ACLTACSTKGAIVQRANGVVDFESDKCTGCGYCVSACPFDVPRLDPIDQKAYKCSMCSD
FT                   RLQVGQEPACVKSCVTGALKYGTREDMLFIADLRIKELHKQGFTKAGLYSPEGVGGTGM
FT                   MMILHDVSQPENYGLPADPKTSVPVKLWQDVVKPLGTAGILATVAVACLHRITVGRNIV
FT                   EEDEPAAFDHTHSDKSDKE"
FT   gene            596790..597434
FT                   /locus_tag="Shal_0495"
FT   CDS_pept        596790..597434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0495"
FT                   /product="formate dehydrogenase, gamma subunit"
FT                   /note="TIGRFAM: formate dehydrogenase, gamma subunit; KEGG:
FT                   she:Shewmr4_0104 formate dehydrogenase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75070"
FT                   /db_xref="GOA:B0TR98"
FT                   /db_xref="InterPro:IPR006471"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:B0TR98"
FT                   /protein_id="ABZ75070.1"
FT                   /translation="MHKQNMILRHKLFDRICHWFVVAAGLVTFLTGFAFFFPSFQWLGS
FT                   IAGTPQMARFVHPIAGLLMCLPLMLMLVRYYHHNKWEKNDLTWMLAIKDVMFENEDKIP
FT                   AIGHYNPGQKVLFRTFVVTSIGLTITGFMMWQPYFAPHFAAITIQWAILIHAICAVIML
FT                   IFVIVHFWMATWVEGSVAGMLYGYVSRAWCKKHHPNMLNDPELKTNKQEKH"
FT   gene            597437..598417
FT                   /locus_tag="Shal_0496"
FT   CDS_pept        597437..598417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0496"
FT                   /product="formate dehydrogenase accessory protein FdhE"
FT                   /note="TIGRFAM: formate dehydrogenase accessory protein
FT                   FdhE; PFAM: formate dehydrogenase accessory protein; KEGG:
FT                   son:SO_0104 fdhE protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75071"
FT                   /db_xref="GOA:B0TR99"
FT                   /db_xref="InterPro:IPR006452"
FT                   /db_xref="InterPro:IPR024064"
FT                   /db_xref="UniProtKB/TrEMBL:B0TR99"
FT                   /protein_id="ABZ75071.1"
FT                   /translation="MSTAILDAEKIPTQSLEIKTVIPADPKAVYQFRAQRLAELAEESG
FT                   LAEYFGLLEQLVGAQQKVAALYGEAAKSCFGPKPKLDLSQSQPMAQQHFEWGNYWQSVL
FT                   LELISELMPKVSTDLHVVLKELAKAEADVLQGYAKSMLSGRFAEVPAQYSLFIWAALSV
FT                   YWSHWAVEVAQGLADAAQAHKRLCPVCGSHPVGSVIKEVPRTGLRYLHCSLCETEWHEV
FT                   RAECTSCGESKGVFLWAETETKAAIRVESCDTCKGYTKMFFTDINPRLEVAADDLATLV
FT                   MDSHLVEQGYSATTVNPLLLAHEQEPQLENEPQESVVQPKVGNIH"
FT   gene            598563..600011
FT                   /locus_tag="Shal_0497"
FT   CDS_pept        598563..600011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0497"
FT                   /product="L-seryl-tRNA(Sec) selenium transferase"
FT                   /EC_number="2.9.1.1"
FT                   /note="PFAM: L-seryl-tRNA selenium transferase; KEGG:
FT                   she:Shewmr4_0106 L-seryl-tRNA selenium transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75072"
FT                   /db_xref="GOA:B0TRA0"
FT                   /db_xref="InterPro:IPR004534"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR018319"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRA0"
FT                   /protein_id="ABZ75072.1"
FT                   /translation="MTQAINSTQALYRCLPAMDSLLLIPQVIRFTDQQGKPWIKSLLAQ
FT                   MLKDARQQIAKSRSLPSWCLNQTKIVTELERRLVLALRQSMTPVFNLTGTILHTNLGRS
FT                   QMCEAAIDAVTKVMRHPVPLEFDMGQGKRGHRDSAISALIHELTGAQSCCIVNNNAAAV
FT                   LLMLAATSAGKEVIVSRGELVEIGGAFRIPDIMAQAGCKLVEVGCTNRTHLKDYAAAIT
FT                   DNTAAIMKVHTSNYHISGFTKVTEEAELAALCQERGIALISDLGSGALTDLSRFGLSKE
FT                   PMPQQMLSDGVNLVSFSGDKLLGGPQAGLVVGDSELIAKLQAHPLKRALRCDKMTLAAL
FT                   EATLMQYRNPESLDSLLPIFKKLSRPQPELEQLAEQLLIVCTEFLSHFNVTIKASQTQV
FT                   GSGSQPDVLLDSVSLCFSQKPDSQLSLQQLDSHFKTAQIPIIGRITANQLWLDLRGSDN
FT                   DEQLAQVLVQIAANIAAQCSGVSQ"
FT   gene            600008..601924
FT                   /locus_tag="Shal_0498"
FT   CDS_pept        600008..601924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0498"
FT                   /product="selenocysteine-specific translation elongation
FT                   factor"
FT                   /note="TIGRFAM: selenocysteine-specific translation
FT                   elongation factor; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain 2 protein;
FT                   Elongation factor SelB winged helix 3; KEGG:
FT                   she:Shewmr4_0107 selenocysteine-specific translation
FT                   elongation factor"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75073"
FT                   /db_xref="GOA:B0TRA1"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004535"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR015190"
FT                   /db_xref="InterPro:IPR015191"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRA1"
FT                   /protein_id="ABZ75073.1"
FT                   /translation="MIIVTSGHVDHGKTSLIQALTGTDADRLPEEKQRGMTIELGYAFM
FT                   DLADDKRLAFVDVPGHSKFINTMLAGVSCAKHALLIIACDDGVMPQTHEHLAILQLLNL
FT                   EHLIVVLTKQDKVDSERVEIVKLEVSELLAHHHRQSVIYVVSAQTGFGITELSLAIKLL
FT                   AEAQTKTLNQLSVESSFRMAIDRAFSVKGAGLVVTGTVISGQVSQGQSLYLSGQRKAVK
FT                   VRSLHSQGRVTDKAHHCQRVALNLTGVDQHRGAQRGDWLTALEPAVAVIEAPKVICGVF
FT                   ESSSSFKHWQAVQVHLGNSHTTARLGLLQSLADGKALVELQCEQSLHCVEQDRIIVRDS
FT                   AAKTTLGALRVLDINPPKRGKRSPERLAYIEALKECSSVKRSLQVQTQDHCVKKSDFMW
FT                   ANQLTDQARLLADEQLLELDGYLLSHTLKQQIETQLLTLVEDYHQASPELLGLSINRLQ
FT                   RMTHGKYPLAVLLKLTDSLREQQLLQSTRGLLHLPRHSLSLSEQEQQQWLSIKQLMLAA
FT                   NGPLWSSDLAKELNLELTVVRLLCRKLIQLGYLSAIIKDRFMLTESLYFYADVIRQQIN
FT                   VCGEIKTADFNSIIKLGRKASIQLLEFYDRSGLTWRKRKDNSRVIRDSSIFISSDLAEE
FT                   HRS"
FT   gene            complement(601906..601996)
FT                   /locus_tag="Shal_R0010"
FT                   /note="tRNA-SeC(p)1"
FT   tRNA            complement(601906..601996)
FT                   /locus_tag="Shal_R0010"
FT                   /product="tRNA-Sec"
FT   gene            602282..603145
FT                   /locus_tag="Shal_0499"
FT   CDS_pept        602282..603145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0499"
FT                   /product="formate dehydrogenase family accessory protein
FT                   FdhD"
FT                   /note="TIGRFAM: formate dehydrogenase family accessory
FT                   protein FdhD; PFAM: formate dehydrogenase subunit FdhD;
FT                   KEGG: shn:Shewana3_0108 formate dehydrogenase family
FT                   accessory protein FdhD"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75074"
FT                   /db_xref="GOA:B0TRA2"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRA2"
FT                   /protein_id="ABZ75074.1"
FT                   /translation="MTELVCGLNNITEQTAVTCFRNDREQALIETVAKEVRVALIYNGI
FT                   SHVVMMACPTALKEFAIGFSLSESIIEDVKEIRSIEIETIATGVLVHIEISQRSFMQLK
FT                   EHRRSLAGRTGCGLCGIEQIEQTVKPIVKVTGAEKFNLNSLKIALSNLYKHQNAFNLTG
FT                   ATHAAAMLSTEGDIMCCFEDVGRHVALDKLIGHISCDNQARHSALLLTSRASFEMVQKA
FT                   AIANISIIFAISSATSLAIDIANRSNITLVGFCRENRVTIYTHPERLYLCNETLSNIDN
FT                   NNLAVM"
FT   gene            603217..604458
FT                   /locus_tag="Shal_0500"
FT   CDS_pept        603217..604458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0500"
FT                   /product="protein of unknown function DUF395 YeeE/YedE"
FT                   /note="PFAM: protein of unknown function DUF395 YeeE/YedE;
FT                   KEGG: sbm:Shew185_0107 protein of unknown function DUF395
FT                   YeeE/YedE"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75075"
FT                   /db_xref="GOA:B0TRA3"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRA3"
FT                   /protein_id="ABZ75075.1"
FT                   /translation="MWLTFKNQFFIKFWSPFAAVIAAGILSTYFFGLTGSLWAVTGEFT
FT                   RWGGHILQWFGAEPESWQYFKIIGLQGTPLDRVGGVMIIGMFGGCLAAVLWANNMKLRM
FT                   PSSKKRIAQALIGGMIAGFGARLAMGCNLAAFFTGIPQFTLHAWIFAFAAAAGTYIGAK
FT                   ITLLPFFRSTATVKLGGLKKIAKPNPNQVQNRFRLGWVVFAAMIVGSLYIMQSSTKLGI
FT                   AMLMGIIFGLLIERAQICFTSAFRDMWITGRTHMAKAIILGMAVSVIGIYSYVQLGMTP
FT                   KTLWAGPNAVIGGLLFGIGIVIAGGCETGWMYRALEGQVHFWWVGLGNIIGATILAYYW
FT                   DDIAAPLATDWDKINLLDLFGPLGGLGVTYLLLGLSFVLILVWEQRFFKKQNSLKEAAL
FT                   ANVAHQAEAASVKG"
FT   gene            604534..604770
FT                   /locus_tag="Shal_0501"
FT   CDS_pept        604534..604770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0501"
FT                   /product="SirA family protein"
FT                   /note="PFAM: SirA family protein; KEGG: ypi:YpsIP31758_3809
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75076"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRA4"
FT                   /protein_id="ABZ75076.1"
FT                   /translation="MPATIVPDYNLEIYGEPCPYPAVATLEAMQSLKPGEVLEVITDCS
FT                   QSINNIPNDAKNHGYEVLDISQQGVMLRYLLKK"
FT   gene            complement(604869..605597)
FT                   /locus_tag="Shal_0502"
FT   CDS_pept        complement(604869..605597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0502"
FT                   /product="protein of unknown function DUF28"
FT                   /note="PFAM: protein of unknown function DUF28; KEGG:
FT                   slo:Shew_3408 protein of unknown function DUF28"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75077"
FT                   /db_xref="GOA:B0TRA5"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRA5"
FT                   /protein_id="ABZ75077.1"
FT                   /translation="MGRAYQNKKESMAKTAGQKTRIYSRYGKELYVCAKNGGFDPDGNL
FT                   ALRTMIAKAKKDQVPAHVIERAIEKARGGGGEDYETARYEGFGPGGCMVIADCLTDNVK
FT                   RTFTEVRQAFVKNDAKLGGPGTVGHMFDHQAVFVFAGDDEDAILEMLMMADVDVTDVEL
FT                   EDGMISVYAPHTEFFKVKTALAAELPEDTDYVMEEITFLPQTMTAITDAEEIEQFEKFL
FT                   AALEDCDDVQNVYHNAELPQ"
FT   gene            606401..608467
FT                   /locus_tag="Shal_0503"
FT   CDS_pept        606401..608467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0503"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_2580 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75078"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRA6"
FT                   /protein_id="ABZ75078.1"
FT                   /translation="MRKFNKCSVALIVATAFGLAACSDGKDGSDDEDGISPLPPVVDAT
FT                   EITNVEVLSHTLEEGVVRFEFEVTNEEGLLVSGLEKVSAEVAELTDKGIARSRPDFEGT
FT                   IAGGNANEETEGASLNMTENGRYEFLAPMPAVNAGTEGIIRLAVGGGENIAKSNYIVVD
FT                   KTESLHTTSTATCHGCHVDYAASKLKHPSYTAINTDGETDLVAGCMVCHGNVVRDKGGY
FT                   AKNTMQKIGHINHQKFEKDFEPANCYTCHAEPITKVNSMDTCTDCHDAAGVGTTSVAMT
FT                   YSSFDETDDVRQFHKKVGERADIRAQHYTTTSAPYTNSSLEWDDHETTGGWCTDIALFN
FT                   TDSGTDVQLNIAQLYAAGTLTYAGAYIHAYDNDSIVGRPSPRDSGGVTNSQYIENPDGS
FT                   RAACYVRLDGIDAGFANAGFTASSRVTFKQQDDDGGYDGVSLTSYSDVVDRNEEKLQEY
FT                   NRRHSVTLDSCTTCHNNETNYHKNGSYSDGGLDCVACHNNGQDRAGQRVVAMDAFETDS
FT                   FRINAGYTIAVKNSDGEQTGWKANSAPGFGPLVHAQHWGLQSVIGSEISRDNEVALTNS
FT                   AAKLNADNCVACHADGIDLNAVPNQYMLSRAFNGGNAGESGVASSPITANCFACHNNDQ
FT                   ALNHMISNGGELNLEVNKAGDWFTQGTSESCATCHAEGRSYGIEKYHVFDRKE"
FT   gene            complement(608594..609541)
FT                   /locus_tag="Shal_0504"
FT   CDS_pept        complement(608594..609541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0504"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: sbm:Shew185_3844 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75079"
FT                   /db_xref="GOA:B0TRA7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRA7"
FT                   /protein_id="ABZ75079.1"
FT                   /translation="MIDLNRIQMFAQVVEQGSFTRAANALGLTKATVSRKVAELEADAG
FT                   VQLLHRTTRALKLTEAGADYFHRVNRILTDLKNAEDQLSARQQTIKGHLKIVCPIEMGQ
FT                   LYFGRVFAQFLALYPDITIEAELTNRQVDVIAEGVDLLFQITAETDDRLKSYALINTPK
FT                   ILMASPEYLDKFGEPTTPEQLQEHQCIRISSPHIDGNWTLFNGKEWVTIEPESRLETNN
FT                   ITLMREAALEGLGIAAIPLVIANDALEKGKLVTVLNDFPMKQSLVTMSMPQRVYLPRRY
FT                   RVFIEFLYQALFNNWQDKVLDLPDFIERPEFNNN"
FT   gene            609636..610709
FT                   /locus_tag="Shal_0505"
FT   CDS_pept        609636..610709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0505"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   sbm:Shew185_3843 secretion protein HlyD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75080"
FT                   /db_xref="GOA:B0TRA8"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRA8"
FT                   /protein_id="ABZ75080.1"
FT                   /translation="MSKTKLFFGIPVLIIALLTGGYYWWTQVRNFESTDNAYVESDISH
FT                   ISVKVPGYVTATFVTDNQHVKKGQLLAQLEDNQFRAKVAQNQAVLASAKAKLQTLNAQI
FT                   DLQQALITQAQASVVAAEAERVRSQQQLTRATKLKVKNYSSQDAVDEAQAAFESATAHV
FT                   DEIHAVLVAKQRELKVFNAQLVEADSSVEQAKAGLQLAQIQLADTQITAPFTGIIGKRG
FT                   AQQGQYVQPGQAIYSLVPDEAVWITANFKETQIAKMHAGQKVTIELDAFSGKEFSGVID
FT                   SLSPASGAKFSLLPAENATGNFTKIVQRIPVRIRLDSNAAEKLEQGRIVPGLSALVKVD
FT                   TASDGLDSAIVANRVQQ"
FT   gene            610709..612298
FT                   /locus_tag="Shal_0506"
FT   CDS_pept        610709..612298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0506"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   shn:Shewana3_0523 drug resistance transporter, EmrB/QacA
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75081"
FT                   /db_xref="GOA:B0TRA9"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRA9"
FT                   /protein_id="ABZ75081.1"
FT                   /translation="MSATQAGVAKLDGAMTQQVEPGGRRAWIAVFGGLIGAFMAILDIQ
FT                   ITNASMKEIQGGLGATLEEGSWIATAYLVAEMIAIPLSGWLSKGLDIRRYMLWNSAIFI
FT                   FASLLCSIAWNLESMIAFRAMQGFFGGALIPMAFRLILEYLPDSKRAVGMALFGVTATF
FT                   APSIGPTLGGWLTEQFSWHYLFYINVPPGIVVMSMLAYGLVKKPINWPELKNVDVSSII
FT                   TMALGMGCLEVVLEEGNRKDWFGSDFIRNLAIVAAVNIALFVYLQLKSKAPLVNLKLLA
FT                   NRDFSISTIAYFLLGLALFSSIYMVPLYLSQIQDYNSLEIGEVLMWLGFPQLLILPFMP
FT                   MLMQRFDNRYLAAFGFFMFGVSYYMNSHMTADFAGPQLIASMVVRAIGQPFIMVPIGML
FT                   ATARLQKHENASASTVLNVVRNLGGAVGIAMVSTLTDNLGRVHLARMKETLPAVSPLAN
FT                   DYLSSTAAMLQAAGSDPVTASQQASALLGQTMQQQAMVQAYNDVFFIMAGLLVVAVVAV
FT                   LSIHKPIPQQAG"
FT   gene            612455..612913
FT                   /locus_tag="Shal_0507"
FT   CDS_pept        612455..612913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0507"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   slo:Shew_3397 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75082"
FT                   /db_xref="GOA:B0TRB0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRB0"
FT                   /protein_id="ABZ75082.1"
FT                   /translation="MLWKSLSFSELSLNELYDLLKLRVDVFVVEQNCAYPELDDKDRHS
FT                   QTQHLLGLNEQGVIQAYARVLAPGVSYPDASVGRVIVAESARGGGVAHVLMQKAIAIST
FT                   KKWPEHNIQLGGQEHLKGFYQQLGFEPVSEMYLEDGIPHIDMLLTLNN"
FT   gene            complement(612991..613242)
FT                   /locus_tag="Shal_0508"
FT   CDS_pept        complement(612991..613242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0508"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3396 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75083"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRB1"
FT                   /protein_id="ABZ75083.1"
FT                   /translation="MNMLVALHSKEKRGATLDHDTHWDAMSAEQKIALYDLHKFGFRLL
FT                   FVRHLTSGPLAFIMQNKTLAVISKNGDVDYSPDVKLRA"
FT   gene            613404..613520
FT                   /locus_tag="Shal_0509"
FT   CDS_pept        613404..613520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0509"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_3496 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75084"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRB2"
FT                   /protein_id="ABZ75084.1"
FT                   /translation="MLNYIEPVFRPPSEWKSLILQVTNGCSWNQCSFCEYNP"
FT   gene            613638..615047
FT                   /locus_tag="Shal_0510"
FT   CDS_pept        613638..615047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0510"
FT                   /product="phage integrase family protein"
FT                   /note="KEGG: sfr:Sfri_3495 phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75085"
FT                   /db_xref="GOA:B0TRB3"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRB3"
FT                   /protein_id="ABZ75085.1"
FT                   /translation="MFHPLVIRTTIHIEEKNEIRLPVIYTQNGVLKSYLDYSIYKRNKS
FT                   MSWIDASARAVCLLVEFVEFNSTYFKYPADLFSAFSDKLFSGTINQNGEDPTGLRWRKR
FT                   SIQNGNKIISYVTQYSDWLCDHKELNNKDNLNPWREATSHEERLNWAAYSHKHKNAFLA
FT                   HTWSKKTAQDRNKSSRNVRYQQDHRANDNNSALNRFPDEYIDDLIHKGFVKPGVLATAP
FT                   AYTRLELRDILITMLLHFGGLRRSEPFHLWLEDIELHPENSNEALVLVYEPEIGQSPVS
FT                   YTNGRIEVREETLAKNFQLLPRNKYEKSKKVYAGWKNNKLSPSKKNYMVVNWFEPSAGE
FT                   QFLFYWRLYLSKQRVSPHKNRKHPYAFTNQFGDPYSIDAFERKYKKAIERVGLVFEKDL
FT                   GTTPHGHRYAYINRLEKAGVGNLFVANAVHHKSIKSQDSYKSLSPKEIRSEFKCLESKT
FT                   KRILELRSAYE"
FT   gene            615040..618558
FT                   /locus_tag="Shal_0511"
FT   CDS_pept        615040..618558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0511"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: sfr:Sfri_3494
FT                   phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75086"
FT                   /db_xref="GOA:B0TRB4"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR024965"
FT                   /db_xref="InterPro:IPR028229"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRB4"
FT                   /protein_id="ABZ75086.1"
FT                   /translation="MSKYTTIEEASKAAIKLGIKRRSEYMKRYKEDPRLPSSPGEFYSD
FT                   DWQAFGTWYGFLGNDIPDYYPTIGAASTAAIKLGIKRQPEYMKRYKEDPRLPSSPSKFY
FT                   SDDWQAFGTWYGFLGNEIPDYYPTIEAASTAAIKLGIKSQPDYAERYKEAPRLPSNPGE
FT                   FYSDDWQAFGKWYGFLGSDIPDSYPTIEAASKAAIKLGIKSQSEYMKRYKEDPRLHSCP
FT                   NRLYRDDWQAFGRWYGFLGNDIPNYYPTIEAASKAAIKLGIKSRADYIKRYKEDPRLPS
FT                   GPLVLYSDDWQAFGKWYGFLGNDIPDYYPTIEAASKAVIKLGIKTQPEYMKRYKEDPRL
FT                   HSSPDRFYSDDWQAFGTWYGFWGQQKPYTRADISQKFNRWADLFDSFIELSQRGIVTKK
FT                   RVCIGFICRFIMENNYPSKPEEFLLKTTKINKNQYEEFLKFFGEQEKSKFHVIVLEFLQ
FT                   YCLSQLCTLEDEDEVIIHPDFRNPLSKFQSPLLEIKPSRLSESDKPLLAYTYVVKAREW
FT                   VLPPESKNLRDLNHLHDLMENDWFDVDPSLIDKSDPDCVYRYVEKDRRKGKHTGALIGA
FT                   YNETVCQVWSPARFFALYTLLSVPARGQQILWCDSGEADKKVPEFVNGKVEWVANTGLL
FT                   AGRAKKQGFIKEYSETEQGLHFTTNKTSYHEGGYDIPWVPENFDYWMIKLRNWQSKYNA
FT                   ITEPTKWTDLTLRVPIGNRILEQRGANCFLFRVGNSCQPHQQPIFSKLLAYVLHQIESK
FT                   DNPLTNKVSSTGNVGSYKSDYTPHAMRVSLITAFVVDAKVPIHIVQKLVGHARLVMTIY
FT                   YTKVGHAEIRDELNAANKRALAAAPLRVQQQIRNKQFEAIRDSLVPNDLLAFKNLNNDY
FT                   PASAFSFTDIGICPMGGGKCEQGGEVENSEVKNKKYLPVASGHLGEKNCIRCRFFITSP
FT                   AFLGGLTAVFNEISLKQFYIKQKEQNLIIHIESLEDERYDAEKKEKVFTKSMELDKAAS
FT                   NLELIAKETSMYATDTVHIARLIMQCSNLLNQSIEAEEDTGTMLVANTESSSIDWSIDE
FT                   TNSEFHQLSTVCENAAIFTLSDASLANARRSQLIDKMAHQNGIQPWLCMLSPEQQLEVG
FT                   NQMSELLKSRLKSWENVEKLMRAEILLSDFNDDNQLMPLHDEVKKILLQSQANQLNINK
FT                   PLLEAV"
FT   gene            618555..619193
FT                   /locus_tag="Shal_0512"
FT   CDS_pept        618555..619193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0512"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_3493 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75087"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRB5"
FT                   /protein_id="ABZ75087.1"
FT                   /translation="MSHEPHELCEALKQISTPKTASSIELIHQICTEQSERGSCDFTIA
FT                   TIGRLSEAVNGPKTQAIRNKTGEKYRALIQSWAEYKKPLKVITSKVKEQNAWVDDIDDA
FT                   RIKWLVMDLIAQNSKLTGQLQLAKELSNINIDLRPVANNNAMESSSHLSLTKSNLLPTE
FT                   VEAISYSIDPDRFEKNGWIADKRGRVKDRNGNTIFKAGYVDAIEKILSL"
FT   gene            complement(619550..619957)
FT                   /locus_tag="Shal_0513"
FT   CDS_pept        complement(619550..619957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0513"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75088"
FT                   /db_xref="GOA:B0TRB6"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRB6"
FT                   /protein_id="ABZ75088.1"
FT                   /translation="MDWGVIGVAVLGGGIVGQVFTVFCTNYLTDKREYKKWRLIERHKA
FT                   SSELLDILASNPQNESELSKWTHNIRNGSLKVHILYRNGVAPEKLNHALEVAFKLAQRE
FT                   KDGVSSENWSQEFRVSVSELRKQLSNHINHD"
FT   gene            complement(620220..621074)
FT                   /locus_tag="Shal_0514"
FT   CDS_pept        complement(620220..621074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0514"
FT                   /product="RNA-directed DNA polymerase (Reverse
FT                   transcriptase)"
FT                   /note="PFAM: RNA-directed DNA polymerase (Reverse
FT                   transcriptase); KEGG: mms:mma_0801 RNA-directed DNA
FT                   polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75089"
FT                   /db_xref="GOA:B0TRB7"
FT                   /db_xref="InterPro:IPR000123"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRB7"
FT                   /protein_id="ABZ75089.1"
FT                   /translation="MTGVSNLFYRQFPLKKRSGGIRTIESPYPKLAYVQRWIKNHILEI
FT                   KPISSNALAYVQGSSHIENAKRHIGAKELLKIDLVDFFEYIKLSTVKSIFTECGYTEKV
FT                   SHQLAKLCTLRDRLPQGAPSSPVISNLVLVELDKRLQSISKKHELVYTRYADDLCFSGH
FT                   AISDEFFSLVKDEIESEGFVVNQNKSGVVRGHKRKLITGLVVSEYGVRVPKKMRREYRK
FT                   QAHYMLKNGIEQLNGNMGMLNPLHIDEVIGKGQYILSVEPGNAYVKDSLCMLLKLKNKL
FT                   LIK"
FT   gene            complement(621748..622620)
FT                   /locus_tag="Shal_0515"
FT   CDS_pept        complement(621748..622620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0515"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: reu:Reut_A0005 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75090"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRB8"
FT                   /protein_id="ABZ75090.1"
FT                   /translation="MTIYTPRNSIESDFYEVGDLQAQISWLNDPRYEKGLHGLLEEYKS
FT                   PEERQALMILFERFIHHEQRDRLDAVDYLVEVIQTKGFTHEDTLLVATSDGKESDGSTA
FT                   GLYNFKEALSQIDQHWKEKNLVPSLAESFDKFKNHNIKNVVIFDDFIGSGKTIVKKVNE
FT                   FRQEMRNRDILHVKIYVFSYVGMKFGVKHATQKLSIEIFCPLQLQKGISDYKNSNPEIL
FT                   KSTVLGMENKLGKNWKKLQLQDFKLGYKESESLYQLFRSNCSNNVFPIFWWPKNVSKKH
FT                   RVTIFNRLY"
FT   gene            622764..624056
FT                   /locus_tag="Shal_0516"
FT   CDS_pept        622764..624056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0516"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vei:Veis_1180 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75091"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRB9"
FT                   /protein_id="ABZ75091.1"
FT                   /translation="MHFKPLLLIYLSVKQLTLNQIESSDEIKKWLGQLPVDKQPIATQL
FT                   LTRLRFVSRDGYAQWFNSALNSLSMTGNYAMYSVRKLPKNTPLWDRSGAIQLRPGTSQG
FT                   SEDLVYSLISNASRRTQNALDHPSIADLKQNRIKNILLIDDSIGSGDRVASFINAMLQH
FT                   DSFLSWWSLGLMHITVLSYARPAGAQAKIIDQVKGSDHGKRVYPKSEKITFNSHFVFNQ
FT                   EELSKRWGDNYQSILDLCYSIKLIPKWALRGYGRVMGNIIFEHSVPNNIPGLLWFQDRQ
FT                   NRWNALLPERALPDWFILLINSNACIVSNSSRGVSEQMQALLTLIKKGVKNTTIIAHRL
FT                   NCEHKLILAYFDMAEKSGFINQNHRLTKVGYELVFKFTRNKKLEKRNRKLYIPTSWCAD
FT                   STSNQPQTLLQKASNDSSNDQEEFADSIWDF"
FT   gene            624205..625347
FT                   /locus_tag="Shal_0517"
FT   CDS_pept        624205..625347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0517"
FT                   /product="RNA-directed DNA polymerase"
FT                   /note="KEGG: vei:Veis_1181 RNA-directed DNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75092"
FT                   /db_xref="GOA:B0TRC0"
FT                   /db_xref="InterPro:IPR000123"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRC0"
FT                   /protein_id="ABZ75092.1"
FT                   /translation="MESWSAHHLNKKALETLSNDEVKDLTFYARNLISKNTPVIFTLKH
FT                   LSEIMEKRYTFLRSTVERKREHSNYKMFSISKRSGGRRFIHAVSNQLQPVQQWINTEIL
FT                   QKQKPHNASFAFHANGGIKKCAAMHCGARWILKFDISNFFYCINETDVYQFFVSLGYRP
FT                   LLAFELARICTTLRLPIQHQKYIRSRNSSRLEYKFYYQPEGCRGVLPQGAPTSPMLSNL
FT                   IATKLDEQLTQYALENGFTYTRYADDLAFSAIDLPEKKSIGKIQFEITGIMKAQGFKEN
FT                   EKKTSVAGPGSKKMILGLLVDGEQPRLSKQMYKKLDRYLYAIEKFGLDSVATHEKFDST
FT                   FGFYNHLCGYISFVKSVDAPRGEEFEKRMNNITPPWTSHP"
FT   gene            complement(625443..625997)
FT                   /locus_tag="Shal_0518"
FT   CDS_pept        complement(625443..625997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0518"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aav:Aave_1701 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75093"
FT                   /db_xref="InterPro:IPR010330"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRC1"
FT                   /protein_id="ABZ75093.1"
FT                   /translation="MLWHWAHRSRKNCDQWWENETEWHRSWKDLFPDDWQEVAEKDPYT
FT                   GEIHVADIKTPNGLVIEFQHSTINSDELISRELFYKKMIWVVDGCKNEFDMYNFSNMRS
FT                   RPDAEGIANFHWFGRSTLFKRWYSRKPIFIDFGPKGFWRVLRFDLKTKKGLVGIVDKSD
FT                   FASLIIKDTTDFSDCGGPASN"
FT   gene            complement(626708..626914)
FT                   /locus_tag="Shal_0519"
FT   CDS_pept        complement(626708..626914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0519"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   sfr:Sfri_3420 transcriptional regulator, XRE family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75094"
FT                   /db_xref="GOA:B0TRC2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRC2"
FT                   /protein_id="ABZ75094.1"
FT                   /translation="MKDLAIQFGTKLRDKRKALGISQDKLALLAEIDRSYAGRIERGEV
FT                   NITLEKAYQLAEVLECDVRELLP"
FT   gene            627047..627586
FT                   /locus_tag="Shal_0520"
FT   CDS_pept        627047..627586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0520"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_3419 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75095"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRC3"
FT                   /protein_id="ABZ75095.1"
FT                   /translation="MSKPSIKINAQLNAILQDENFDDFNVTQLRDAYLAMSSTVEEPIE
FT                   ARKYVYRQILRLLKKGLLLKKGTKSSKRVVYQKADLFFKTNFVVQSTTEDKVNRPKAVT
FT                   VGINTTVEQLEKRLKESEVDLLTSIGESEEYMRLYQSFPEMKAHLESQYLQARENSSKL
FT                   LGQIKAIKSVLAHQRK"
FT   gene            627591..629000
FT                   /locus_tag="Shal_0521"
FT   CDS_pept        627591..629000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0521"
FT                   /product="type III restriction protein res subunit"
FT                   /note="PFAM: helicase domain protein; type III restriction
FT                   protein res subunit; KEGG: sfr:Sfri_3418 type III
FT                   restriction enzyme, res subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75096"
FT                   /db_xref="GOA:B0TRC4"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRC4"
FT                   /protein_id="ABZ75096.1"
FT                   /translation="MHLRQWQSECVNHALEHFSAKQKHFLCLATPGAGKTIMASEVAFH
FT                   LLEQDLIDFVLCFSPSINISQGIKQTFSTRLECRFDGVIGAVGCSYTYQSMLSFKADFW
FT                   QLLKQNRVLVIFDEIHHCSGSSLEDANAWGEEILLNIQSQAEYTLALTGTPWRSDQAPI
FT                   ALSRYTDPDNQIQCDYIYGLREAVADGVCRSPKIVLIDNERISVTDEENETKTFNCLDA
FT                   LFKGSLVSYQSIIKNDVAIRHALTLATSKLDDIRLHNPNAAGLVVASSIEHATYILNML
FT                   RNEYGETAEIVTYKEELPSLKINEFRNSTTNWIVSVGMISEGTDIPRLQVCCHLSRVKT
FT                   ELYFRQVLGRILRTNKSKNQEAWLYTFAAPKLVEFANRIAEEIPDVPIIFRESETVTVS
FT                   VKQGESKIVRTSFLSQNEHKVRFSTPHINQSHFPILAPPNNQNLTWVNSPSFEILGGFR
FT                   EKVVSTFNSPF"
FT   gene            complement(629102..632233)
FT                   /locus_tag="Shal_0522"
FT   CDS_pept        complement(629102..632233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0522"
FT                   /product="ATPase involved in DNA repair-like protein"
FT                   /note="KEGG: chu:CHU_0040 ATPase involved in DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75097"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRC5"
FT                   /protein_id="ABZ75097.1"
FT                   /translation="MKIKKVEIEAFRAYKSKSDGTFDFTNQGDIPSNFVAIYAPNGFGK
FT                   SSFYDAVEWAVTNHLERLGGEYNRSNFVDAAKITKDKNVGQKILRNKYVDDKVVTKVVV
FT                   STTRAGLFERKLPKTRSNSRDLRFGVKSQRENEFFRRVILSQDEIDRFLREAKPKERYT
FT                   KFMTSFGGDIEIARQELSVLISDNETELNNLNNQHELLIKEIKQPIDLSVFEHFNSVAA
FT                   ELNAVGENIILPDEKFSSQNEHLLNAHLVSRQHELNTSFQANTETTEALVNRLEKIPEI
FT                   EIHVRDLAEHSPDLTRLSKGITDADKYQALLDSHEKYVTAQKQAHARLNSLIVIAESTD
FT                   TFLQIESRLLELSTQKKALTEERSKTSTQLEALNQTLSELNTELKAVDNRTLLLRTSID
FT                   NASPVYTEISNRRAHFAALGLQIAEKEIAIQKEKVQFNVLNRELSEISTLKITPDLLLT
FT                   GKVDALLFEQGKIDQLTRCYADLDLIEVNITALHTTKKALTEQMELHERLLSIGLDYLS
FT                   VQPSNICPLCTSPHASVEALQDKIKNRNLLSDLSQENTKKLSLSSKRQKELRDIIQSIV
FT                   QQAIEAQVKQLNGLHNKVNEVGARLTQTERDKSTLEAEYKSIENRVVELEKSVWGLSHV
FT                   ELVSRVEAELKELLIKRSNLLEQKTSATTQITLFTKSFKAKDLELQSLISEVERKGSEH
FT                   AYVTVQAYLNENAIVASSLQKHCEIKRKELDTEVLKYKVEVESLTSQCNALQQEMQVGG
FT                   TWINFPQLKQQKEALELRLAHSQSAVNAFYGSLSHIILVRSEDTLEKVKEFITGAIEER
FT                   QRRSEELNILSSKIKLLSELLASFKPYIRRISLQEELTDVERQLEQRSQVYETLAAEKE
FT                   VVVGYLKTLINNFFYEDLINSIYRKIDPHPAFKKVEFKPDFDSGEPSLNIVVSDGDGEL
FT                   ISPILFFSTAQINILSLSVFLASALHARDDEDKPIDVILIDDPIQSMDSINILSTIDLL
FT                   RSISLQFDKQVIISTHDENFFGLLQRKIPAEVLGSKFLKLEKFGVVVPVEPFLN"
FT   gene            complement(632223..632762)
FT                   /locus_tag="Shal_0523"
FT   CDS_pept        complement(632223..632762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0523"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75098"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRC6"
FT                   /protein_id="ABZ75098.1"
FT                   /translation="MKLLTKEVDLSFLSDHYENIRFHMFCSDDPLSFISCIACVCETSA
FT                   EVVESWSEIQSMVSVYYQPSGNLASWNVYLALITVESVPIWEKYQIENNKYAARKIILD
FT                   GLPEIPCIDQMAIELQKQLLGSDLALYPQVNESREALLSIEEYIRGTPLDSKKESKNKR
FT                   ALVIDNIIELLNNNEN"
FT   gene            complement(632746..634089)
FT                   /locus_tag="Shal_0524"
FT   CDS_pept        complement(632746..634089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0524"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sun:SUN_0730 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75099"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRC7"
FT                   /protein_id="ABZ75099.1"
FT                   /translation="MMRSDLNNTDAEIMQSYTVMVNGGSGVLVNAMTLDYSYVLTAAHV
FT                   IRKKKGDIAVLDLDDINVLDYKSEKLKVLAVLIDPAPHDAEDPTYDCAILKVEYQARVL
FT                   QRCFAASRLPHLAAIILVGYPATERGSADQIKQYDGHKTSVVNKLVILTINGVPAKSTI
FT                   QGMSGGGVYHIQAGSPFLIGVEFQMDGTGEEQQYGRVQCHSLARFEEIITACTSAQMIP
FT                   AHLECFSRMREMIFAFNVIDPNNVHQLKVALEGFADSLIRGGIPAPYEVMEQYDLQLLV
FT                   DSKRPDELKNQELWVAYLEFLVICALMDNVGAADANYIKNIERKRRLLYTSDGSNWLRR
FT                   LEELLKTARKYLDKNGTLIVASPEAAAQLLPPNFTLKNVISNIAVVPNEGPLAIDTVES
FT                   AIYTSFKLTHLEGLRKNCVIDSEDEYQGLPSGRAQLQLFKDKLNEIIN"
FT   gene            complement(634067..635122)
FT                   /locus_tag="Shal_0525"
FT   CDS_pept        complement(634067..635122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0525"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: plu:plu4347 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75100"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRC8"
FT                   /protein_id="ABZ75100.1"
FT                   /translation="MSIVVRVLKANHGDCILVSHEGPSSVFNLLIDGGTSTTFRHGPRQ
FT                   RYAGALCNALDDLKKRGQHVDLAILTHIDDDHIHGLIKAFEKPGYLGQLVKSIWFNSSR
FT                   LITRHFNVPEISENNILLTDDSPETSVSQGKELETLLDDIGCERAPLIMAGQSYEVGPF
FT                   TLKILSPEPRQLERLLHKWPTEVESGATSSHDNDYHLSLSEIWAEDKFKPDPSIYNGSS
FT                   VAFILEADGKKMLFLGDAHDQVVAENLRAFGYSDTNKLKLDLVKVSHHGSQNNTSNEFL
FT                   SLLDSSRYVISTNGSKHGLPNKRTIARIMKSTSGNVLFNYRDVITPLLLAHEIESYSSR
FT                   LEVLDDEIRFE"
FT   gene            complement(635495..636106)
FT                   /locus_tag="Shal_0526"
FT   CDS_pept        complement(635495..636106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0526"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vvy:VVA0312 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75101"
FT                   /db_xref="GOA:B0TRC9"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRC9"
FT                   /protein_id="ABZ75101.1"
FT                   /translation="MTINEIITLIKDIVLGLCALGTVSVAVYGVKNWARELKGKADFEV
FT                   SRQLIRAVYKFRDEIEYSRSPMTLPSEFPANYDPMNRAAKYKAESWSYVFSNRWKPVVE
FT                   AVQELEVQGLEAEALWGAEIKQLVQELRKNARLLRVGMQAVVDNEMQDNENFKCNSDLG
FT                   KTMKNRVWKSMFEENDEITVAINSTVEKLENYVRPHLKRN"
FT   gene            complement(636194..637411)
FT                   /locus_tag="Shal_0527"
FT   CDS_pept        complement(636194..637411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0527"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lwe:lwe1072 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75102"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRD0"
FT                   /protein_id="ABZ75102.1"
FT                   /translation="MYFRETNVERDWNDFKGMYGNKEGARAAFEKVCGALLRNKYPNRA
FT                   YEVEVSNGDDGIDIFVGNGIFDKSLEVFQCKFFIDGFFSSQKQQMKSSFDSIINNDKYS
FT                   VKKWYIALPITLNKEQHKWFDKWKLERSKEHAIDPGNIILWDGDYLLDQLKESGLYNTW
FT                   FKIEDSNKIKEIHEYILNKDDKTLKIKGDNEIKGLSEHLNRTSSFIPSETRLDFTKVLA
FT                   ELAQNATQHGGGNFISVCSNNGQVELKYDGKRFNSLDFVVEEYHGLGIRSLKCFLEIYK
FT                   DSVECSYKYDKSNILTFKFLDNLLPHQTDNPCFIFTSHSIHSLSSDVFRAINHDCEEVE
FT                   IDLISTHMHFSNLHILINDCVAKTRKFNTKFKFIIGDRAMNKHMVSHLDSRFSSEDLSR
FT                   VEWVFK"
FT   gene            637905..638684
FT                   /locus_tag="Shal_0528"
FT   CDS_pept        637905..638684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0528"
FT                   /product="Elongator protein 3/MiaB/NifB"
FT                   /note="SMART: Elongator protein 3/MiaB/NifB; KEGG:
FT                   sbl:Sbal_0486 radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75103"
FT                   /db_xref="GOA:B0TRD1"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRD1"
FT                   /protein_id="ABZ75103.1"
FT                   /translation="MYTEPQKRFRAQKADKIEQDLIAVANSQAHISRVFLADGDAMTLP
FT                   FARLEAICLLIKQYLPNVTRISSYCLPRNIDNKTPEQLQRLRELGLTLLYIGCESGDDE
FT                   VLARINKGETFDSSLAALLKIKAAGIKASVMILNGLGGVELSKLHAENSAKLMNAAQPE
FT                   YLSTLVVTLPLGTERMDKAFGGHFQLPSQAQLFEEMHILLSKLELNKTVFRSDHASNYL
FT                   VLKGVLGKDKQALVAQVEAAMNTPSKIELRQEWQRGL"
FT   gene            complement(638700..639638)
FT                   /locus_tag="Shal_0529"
FT   CDS_pept        complement(638700..639638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0529"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: rso:RSc0144 probable transcription
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75104"
FT                   /db_xref="GOA:B0TRD2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037402"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRD2"
FT                   /protein_id="ABZ75104.1"
FT                   /translation="MNPTDLKIIQQCDLNLLLSLAILIEEQSVSKSADRLDISQPAMSQ
FT                   NLKKLRNMFDDPLFVKQGQGIRATSKALRLYASLTEWLQMSDRLISQIAFDPMESHGVI
FT                   RIAFMDDLTQTMIPMMLDRILAFAPNVELEFVHKPRDVFSLLESGEIDIAAAGTDAPPA
FT                   NIHGRHISTDNYCAAYSLKHPLAKIAQPTLAQIFSYDTAEYSASNLVEIEITQLALQHQ
FT                   LQRKITFATGSFLVLLQGLLAGKHVGFLPQRVLHSAKWRSQLKGVVFTDLPQLDSTLYW
FT                   HARVHKDPLIQWFKDQCLDIVSQLQLQRGGG"
FT   gene            complement(639635..640567)
FT                   /locus_tag="Shal_0530"
FT   CDS_pept        complement(639635..640567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0530"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: cps:CPS_0420 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75105"
FT                   /db_xref="GOA:B0TRD3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRD3"
FT                   /protein_id="ABZ75105.1"
FT                   /translation="MLTQLNLERLKNCDLNLLLALAVLLNEAHVSNAAKQLGLSQSAMS
FT                   QMLKRLRLMFADPLLLKSNNGMTLTNKAQAIALELTPLLDKTARILEAEHFTPKTAQGR
FT                   IRFIMSDVTAQLIIAPLIELMSEKAPGIELEYISQNANGFQLLRRGQVDAVIGFYDNVP
FT                   SPIVSEPIGLAPWQMVTHKVTNKQNIHADKDAIKLLRYQFQEHNQLHSIEALEHLDALD
FT                   AAYALTTNSLSTLLYALQTNNTVTLLPHFAMGILAEDETKNFDWLGSPINLELKICWDR
FT                   HQRAPELQQWFRRQLVTLFHKHFPLEQAL"
FT   gene            complement(641159..642199)
FT                   /locus_tag="Shal_0531"
FT   CDS_pept        complement(641159..642199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0531"
FT                   /product="OmpA domain protein transmembrane
FT                   region-containing protein"
FT                   /note="PFAM: OmpA domain protein transmembrane
FT                   region-containing protein; OmpA/MotB domain protein; KEGG:
FT                   sfr:Sfri_2899 OmpA/MotB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75106"
FT                   /db_xref="GOA:B0TRD4"
FT                   /db_xref="InterPro:IPR000498"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRD4"
FT                   /protein_id="ABZ75106.1"
FT                   /translation="MMNKTLIALALMGTCGYANAADIDNTWYIGAGAGQSNYESVDAAS
FT                   HLGDDSDLAWNALVGYQLNKYLAFEAGWQDLGTNDDTHLWGGLDGSQEIDVDGFTLGVV
FT                   GTLPLSEKWFLTGEAGAYQYHLAHQMSANKYVSATDTAPYFGAGVGYNITDSLAISAKY
FT                   RRFANIDETAWNTANMDAQTVGLQLTYRFGVKAATTTAVVLPAVIEKQTKPMPRPEPKP
FT                   EPKYEIHTEKSSVAVLFSFDSSELTSAAKAKLDQVIQLSKSKDQDVILLNGQSDNQGDS
FT                   QYNLKLSEKRVQHVEAYLVSHGVEVKKIDTQAVGEQDAHANLRKDRALERRVIVTLTSQ
FT                   EKVLAS"
FT   gene            complement(642441..643277)
FT                   /locus_tag="Shal_0532"
FT   CDS_pept        complement(642441..643277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0532"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   sbm:Shew185_0463 MscS mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75107"
FT                   /db_xref="GOA:B0TRD5"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR008910"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRD5"
FT                   /protein_id="ABZ75107.1"
FT                   /translation="MNDQGLDQEIAQLQNAYTAITEFLVQYSFSILGAVIIFLIGLWIA
FT                   AKAANLVTRIFEKHKIDITLSNFTSNFVRILVIVMVGVIALGKLGISVTPMVAAIGAAS
FT                   LGAGLALQGMLSNYAAGITIIVTRPFIVGNTIEIKGVGGLVKDIHLGMTVLTNEEGEEI
FT                   NIPNKHIVGEILHNSFANKLVETKFNISYQSEPQQVIALLTKVLSDSSRVYQGTKAQVG
FT                   VNDFNSIGIEIGIRYWVATQSYYQDKYQTNAALFKALKEADIEIPYPVQQIHIQQS"
FT   gene            643489..643947
FT                   /locus_tag="Shal_0533"
FT   CDS_pept        643489..643947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0533"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_3632 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75108"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRD6"
FT                   /protein_id="ABZ75108.1"
FT                   /translation="MRALIFVLSSLLATSVWANTYQVGDQITDIKLQDQNEAQYQVDSS
FT                   TTRVLFSRSMDGGTVIQEALEAEPELVKDNSLVYVADISGMPSLIARFVALPQFKKFPY
FT                   RVALDNEGEQTKPLPAQKDQATLVELNNNQITKIAFYETADALLADLK"
FT   gene            complement(644046..644261)
FT                   /locus_tag="Shal_0534"
FT   CDS_pept        complement(644046..644261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0534"
FT                   /product="protein of unknown function DUF465"
FT                   /note="PFAM: protein of unknown function DUF465; KEGG:
FT                   sbm:Shew185_0466 protein of unknown function DUF465"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75109"
FT                   /db_xref="InterPro:IPR007420"
FT                   /db_xref="InterPro:IPR038444"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRD7"
FT                   /protein_id="ABZ75109.1"
FT                   /translation="MFPEYRELISQLKTSDSHFQKKFHKHNELDEEIKNLEKNIASDYN
FT                   SEVHELKVKKLHLKEEIYDILKGHSA"
FT   gene            644757..645515
FT                   /locus_tag="Shal_0535"
FT   CDS_pept        644757..645515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0535"
FT                   /product="uridine phosphorylase"
FT                   /note="TIGRFAM: uridine phosphorylase; PFAM: purine or
FT                   other phosphorylase family 1; KEGG: sbm:Shew185_0467
FT                   uridine phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75110"
FT                   /db_xref="GOA:B0TRD8"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010058"
FT                   /db_xref="InterPro:IPR018016"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRD8"
FT                   /protein_id="ABZ75110.1"
FT                   /translation="MSDVFHLGLTKEMLDGASLAIVPGDPERVKRIAELMENATFLASH
FT                   REYTSYLAYIDGKPVVVCSTGIGGPSTSIAVEELAQLGVRTFLRVGTTGAIQPHVNVGD
FT                   VIVTQASVRLDGASLHFAPMEYPAVANFECTTAMVAASREAGLEPHIGITASSDTFYPG
FT                   QERYDTVSGRITRQFKGSMQEWQDLGVLNYEMESSTLFTMCSSQGWRAACVAGVIVNRT
FT                   QQEIPDEATMKKTEVSAVSIVVAAAKKLLA"
FT   gene            complement(645593..646345)
FT                   /locus_tag="Shal_0536"
FT   CDS_pept        complement(645593..646345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0536"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3389 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75111"
FT                   /db_xref="GOA:B0TRD9"
FT                   /db_xref="InterPro:IPR018013"
FT                   /db_xref="InterPro:IPR036777"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRD9"
FT                   /protein_id="ABZ75111.1"
FT                   /translation="MNNKLLCLALLVSPTAMADNMVNWWDVSVTALYGENYDLAPSEKQ
FT                   TTLTFETAGDWKYGDWFAFQDVTYFNGSNVSKDNTTYGEISTRFSAGKILGKTVGFGPV
FT                   TDLSLALTLEEGEGPVKAFLYGVGMDIKIPYFSYFQLNTYRRHAISSDNISDGWQLTPA
FT                   FRMDFPIGNSNIVFDGFIDWVFVADEAVYETNFHFNPQLKYDLGAVMLGEHQKNKLFVG
FT                   IEYDYWKNKYGVDGIEQNTFSVIAKYHF"
FT   gene            646741..647220
FT                   /locus_tag="Shal_0537"
FT   CDS_pept        646741..647220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0537"
FT                   /product="protein of unknown function DUF107"
FT                   /note="PFAM: protein of unknown function DUF107; KEGG:
FT                   shm:Shewmr7_0449 protein of unknown function DUF107"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75112"
FT                   /db_xref="GOA:B0TRE0"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRE0"
FT                   /protein_id="ABZ75112.1"
FT                   /translation="MEFSNPILIWVCIGIFLMLTEIILPGGIVILIGAACLVVAGALAI
FT                   GLVEGIVQSLTLWFIAAMVLLLVFRQITQKLVGGDAHIDNTDEELDIYDQLATVKQTIG
FT                   PAQQMGRVEFQGCEWSALGDGSEIAAGSVVRIICRDNIALVVEPIKAEDEHCAEK"
FT   gene            647249..648178
FT                   /locus_tag="Shal_0538"
FT   CDS_pept        647249..648178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0538"
FT                   /product="band 7 protein"
FT                   /note="PFAM: band 7 protein; KEGG: slo:Shew_3387 band 7
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75113"
FT                   /db_xref="GOA:B0TRE1"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR032435"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRE1"
FT                   /protein_id="ABZ75113.1"
FT                   /translation="MFAFTLFVLFVFFILYKLLLIVPMREVNVIERLGKFRTVLQPGFH
FT                   FLIPFFDRVAYKHEIREQVLDVPPQSCISKDNTQLEVDGLVYLKVMDGKLASYGIEDYR
FT                   RAAVNLAQTTMRSEIGKLSLSQTFSERDSLNESIVREIDKASDPWGIKVLRYEIKNITP
FT                   SRKVIHTLEKQMEAERSKRAEITLANAEKAAMINLSEGERQEAINLSEGEKQRRINEAK
FT                   GTAQEIAIVARAKAEGMELVSAALAKDGGNEAMNMQLKEQFITQVGKILAEADVSVVPA
FT                   ELAKIEGFFEGMEQVTNAVSANSVKGAR"
FT   gene            648178..649116
FT                   /locus_tag="Shal_0539"
FT   CDS_pept        648178..649116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0539"
FT                   /product="band 7 protein"
FT                   /note="PFAM: band 7 protein; KEGG: slo:Shew_3386 band 7
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75114"
FT                   /db_xref="GOA:B0TRE2"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRE2"
FT                   /protein_id="ABZ75114.1"
FT                   /translation="MMIAGIDTDLIVMGIWGLIFAIFVVKLFQSIRLVPTKSAYIVERL
FT                   GKYHSTLDAGFHALVPFVDKVAYIHDLKEETIDVPPQECFSCDEVNVEVDGVIYISVVD
FT                   PVKASYGVTDYRYAAIQLAQTTTRSVIGTLDLDRTFEERDVISAKVVEVLDQAGALWGI
FT                   RVHRYEIKNITPPETVKNAMEMQVNAERERRALLAKSEGDKQSKINRSEGIKAETINHS
FT                   EGEMQRRINEAEGKGEEILTIARATAESIERMATVIAAPGGKNVVRMQLGAQYLKQLDG
FT                   VSSGQSKVILPGNMMDFDHWMNSIGLEETPK"
FT   gene            649449..649898
FT                   /locus_tag="Shal_0540"
FT   CDS_pept        649449..649898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0540"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: shn:Shewana3_0463 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75115"
FT                   /db_xref="GOA:B0TRE3"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRE3"
FT                   /protein_id="ABZ75115.1"
FT                   /translation="MPCLSAAKLSLSDQIFILIGISSHAVIISKDLPEPSVLLLKADYG
FT                   SGAWGVPGGALDPEETIHEALLRECVEELGVLVQINYLTGVYYHKAYNSRVFIFLCELP
FT                   QAAQICLSDEHSEYRFAPISSLPDVQKQRVEDCLYYNGTVISRKY"
FT   gene            complement(649940..652024)
FT                   /locus_tag="Shal_0541"
FT   CDS_pept        complement(649940..652024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0541"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="KEGG: cps:CPS_1933 sensory box/GGDEF/EAL domain
FT                   protein; TIGRFAM: PAS sensor protein; diguanylate cyclase;
FT                   PFAM: GGDEF domain containing protein; EAL domain protein;
FT                   SMART: PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75116"
FT                   /db_xref="GOA:B0TRE4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRE4"
FT                   /protein_id="ABZ75116.1"
FT                   /translation="MKTNTNFPINSGYLCLTMVIFNACIGLFCLLGLPAQSSTLPLTIL
FT                   LPLANIIVFGVIFSRFYNQHKHACTLSEAPLNTNELSLKVDHKTAQLNQLRKTELSART
FT                   VSKNVQLEVEVEQAQTIMTLKDDLQLLSAILDSTAVAIYAVDNKGLCIFANPQCALLLG
FT                   YSHPSQLLKSNMQQLVNQRAESPNTESSIQDLENIKEDIFWKADGSSFPVEYNSQPLTL
FT                   NSHVNGAVISFYDNSERREAEELIRRQAHYDTLTDLPNRFLALKRLEQLVESSERSGKM
FT                   LAVIFLDLDDFKKINDSLGHEAGDLLLITASERLLKTTRAEDTVGRLGGDEFIILLDGL
FT                   SSANDAQPIAENLIGGFRKPFYIDNRQLILTASIGIAIYPNDGETPSELLRNADSAMYH
FT                   TKSIGRNTYSYFTHAMNKEVSRRLAIEEQIHGALERGEIRVHYQIQLDIRDGSIMGAEA
FT                   LLRWNNPTLGSVSPAEFIPIAEQTGMIEPMGEFVLQQALETAHIWQRKFNDKFRVAINL
FT                   SPRQFRNPKLVQTIIDKVEKLGMHPSDLELEITEGVLLSGHAYTLGALMQLSEAGFYIS
FT                   MDDFGTGYSSLSYLKTYPFTILKIDRSFIHDMNKDDKSNDLIIATIEMAHALGIRVIAE
FT                   GVETQEQLDELSFMMCDYAQGFLISKPVPLKELLKIGSRYRKMHEQNTFQGESEALNIV
FT                   "
FT   gene            652389..652742
FT                   /locus_tag="Shal_0542"
FT   CDS_pept        652389..652742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0542"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: ppr:PBPRB1933
FT                   putative translation initiation inhibitor, YjgF family"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75117"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035709"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRE5"
FT                   /protein_id="ABZ75117.1"
FT                   /translation="MTIERIETAARMSRIVKHNGTVYLCGQVAKDAEQGIAEQTRTMLE
FT                   KVDSLLEQAGSDREHILSATIYIKDMQYFAEMNEVWDAWVPAGHAPARACVEAKMARDA
FT                   LLVEISVVAAEKA"
FT   gene            652884..655049
FT                   /locus_tag="Shal_0543"
FT   CDS_pept        652884..655049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0543"
FT                   /product="DNA helicase II"
FT                   /note="TIGRFAM: DNA helicase II; PFAM: UvrD/REP helicase;
FT                   KEGG: slo:Shew_3385 DNA helicase II"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75118"
FT                   /db_xref="GOA:B0TRE6"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005753"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRE6"
FT                   /protein_id="ABZ75118.1"
FT                   /translation="MDVSSLLDGLNDKQREAVGAPQSSMLVLAGAGSGKTRVLTHRIAW
FT                   LMQVEQQSPYAILAVTFTNKAAKEMRERVEKVAGGNMSRMWIGTFHGLAHRLLRTHYKD
FT                   ANLPESFQILDSDDQLRLIKRILKSLNLDEKQYPPRQAQGYINGKKDLGLRPSHIDAGG
FT                   FPIEQNLLKIYQIYQDSCDRAGLVDFAEILLRAHELWLNKPHILDHYQDRFKHILVDEF
FT                   QDTNAIQYAWIRVLAGSTANVMIVGDDDQSIYGWRGAQVENLHKFLADFPAAQTIRLEQ
FT                   NYRSSGNILNASNQLIANNPDRMGKKLWTDDKDGEPIGLYCAFNEMDEARFIVGRITDW
FT                   QDEGGKLEDCAILYRSNAQSRVLEEALLHKGIAYRIYGGLRFFERQEIKDAMGYLRLIN
FT                   NKNDDAAFERVVNTPTRGIGDRTLEIIRTTARQQEMTLWEASLRLIEEKVLNGRAANAV
FT                   RGFMDLIIAMRMDSDELSLQRTTDHVIQTSGLKAMYEAEKSEKARARVENLEELVTAAR
FT                   SFVMPEEIEDMGELNAFLSHAALEAGEGQADEFTDAVQLMTLHSAKGLEFPMVFMAGVE
FT                   EGLFPSQMAIDEGDRLDEERRLCYVGMTRAMQKLYITYAESRRIYGRESFARPSRFVKE
FT                   IPEQYVQEIRMRTQVSAPAVSSRFSKQDDSFNDSGFKIGQRVMHPKFGEGTVTNYEGSG
FT                   AQARIQVNFFDVGSKWLVIAYARLEAL"
FT   gene            655192..656055
FT                   /locus_tag="Shal_0544"
FT   CDS_pept        655192..656055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0544"
FT                   /product="4-hydroxybenzoate polyprenyl transferase"
FT                   /note="TIGRFAM: 4-hydroxybenzoate polyprenyl transferase;
FT                   PFAM: UbiA prenyltransferase; KEGG: slo:Shew_3384
FT                   4-hydroxybenzoate polyprenyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75119"
FT                   /db_xref="GOA:B0TRE7"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TRE7"
FT                   /protein_id="ABZ75119.1"
FT                   /translation="MSFRDKLDVYMRLARMDRPIGTLLLLWPCLMALTFAAGGLPDLKV
FT                   FIIFVIGVVVMRACGCIINDYADRDLDSHVERTKARPLASGEISSKEALLLFGVMGLFA
FT                   FSLVLMLNPLVVQLSVVGIILTIIYPFTKRYTNMPQMFLGTVWSWSIPMAYAAQTGTVP
FT                   IEAWWLFAANWCWTVAYDTMYAMVDRDDDLKVGIKSTAILFGRYDRQIIAAFQLAALSC
FT                   FIIAGMLAGRGEIYGLGILAFIGFAVYQQKLIYGRERGPCFTAFLNNNWAGMVLYIALT
FT                   LDYLIL"
FT   gene            complement(656167..657153)
FT                   /locus_tag="Shal_0545"
FT   CDS_pept        complement(656167..657153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0545"
FT                   /product="putative esterase"
FT                   /note="PFAM: putative esterase; KEGG: sfr:Sfri_3395
FT                   hydrolase of the alpha/beta superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75120"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRE8"
FT                   /protein_id="ABZ75120.1"
FT                   /translation="MSSRNCNAPLLRLMLCSILLASFFPTTCMANKPVIEASAHLTTPF
FT                   SIPRSHTVQINDKERNYKLYIKLPKGYKSSANRDRQYPVIYLTDAMYTFQIMSGVTRFP
FT                   MNSKQMQPTIIVGISWELGLRSDHSRVRDYTPTVDTSWKKVTGGADRHLHFLKSKIIPY
FT                   MEQNFRTVPEQRTYVGNSLGGLFGAYILLKQPELFSNYLLGSPSLWWQKRQFLTQFAKN
FT                   IASLREIDANVFIGIGALEHNGEDGDSQHNMVADAQHFKALLNNLEVNNPALNSKLLII
FT                   DEAHHAIAFATTAVHGMDWLFNSKRGKSIGNQTALTQELATTKEERF"
FT   gene            complement(657383..657961)
FT                   /locus_tag="Shal_0546"
FT   CDS_pept        complement(657383..657961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0546"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_0343 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75121"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="InterPro:IPR023292"
FT                   /db_xref="InterPro:IPR033653"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRE9"
FT                   /protein_id="ABZ75121.1"
FT                   /translation="MKLSALDQPLYDHLYRDIREFRSTFDLPIEDSNTLDDKADTLHTS
FT                   LAIEELTELAEADSRVEQADAIVDSVYVLMGRLVHLGATQVSDRLEISYVIDLLLHVAK
FT                   NREIDFVTCWDEVHSSNMSKVCRNEQELEETIAFYAKQGVEIVGSTKGDFIIAKCAKDV
FT                   DMAGKVVRQGKVLKSVYYRPADLEKLVKA"
FT   gene            658504..660033
FT                   /locus_tag="Shal_0547"
FT   CDS_pept        658504..660033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0547"
FT                   /product="Na+/H+ antiporter NhaC"
FT                   /note="PFAM: Na+/H+ antiporter NhaC; KEGG: slo:Shew_0344
FT                   Na+/H+ antiporter NhaC"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75122"
FT                   /db_xref="GOA:B0TRF0"
FT                   /db_xref="InterPro:IPR004770"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRF0"
FT                   /protein_id="ABZ75122.1"
FT                   /translation="MSSNNDLQQSESVTIDPLEDSRHTAPTLLDALIPIIALVMMLTAA
FT                   VYLFSSDSSYGANQIALIMAGCIGLLIGWKNGYSWAEMEQGIVRSIGVATGAILILFTV
FT                   GSLIGTWILAGTVPTMIYYGMLVLNPEYFYVACCLLCAVVAISIGSSWTVAGTLGIALV
FT                   GVASAMGLNVEITAGAIISGAYFGDKMSPLSDTTNLAPAVAGTDIFSHIRHMLWTTAPS
FT                   IIIAMIGFLFLGFNTQSGMDNNNFETTLSLIQADFNPGVHLLLPLLVVFILAWKKIPAF
FT                   PTVIIGTIAGAVCAALFQFDNVVKFADDETLMPVVALIKGIWVAMFNGYTASTGDEVLD
FT                   NLLSRGGMSTMMNTVWLILCAMTFGGIMEVTGLLKRILQSILSLVKSSGSLILTTLASG
FT                   IGANLITADQFIAIVLPGRMLKVEYAKRGLAPVNLSRALEDSATITSPLIPWNTCGAYM
FT                   ASTLGVATVAYLPYAFFNLVCPLISAAYAKYDFKIERLPEAEVPQAQEAVA"
FT   gene            complement(660391..660975)
FT                   /locus_tag="Shal_0548"
FT   CDS_pept        complement(660391..660975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0548"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   slo:Shew_0345 redoxin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75123"
FT                   /db_xref="GOA:B0TRF1"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRF1"
FT                   /protein_id="ABZ75123.1"
FT                   /translation="MNKTHLLSCLLVFSSLLIPAQAQVASNKVYSTGKAIEKPLIMSRF
FT                   IEMQSARSVPEVMFTDTKGEQISLKQYKGKLVLVNLWATWCAPCIKEIPQMENIRQVNK
FT                   NNNLVVVPISIDEESDKVQAFLERHELGHYQTWLDPQKTIDQIMPADVVPATYVFDGSG
FT                   NLIGFLRGYLDWGDKEVQPYLEKLTAKYAHR"
FT   gene            complement(660968..661414)
FT                   /locus_tag="Shal_0549"
FT   CDS_pept        complement(660968..661414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0549"
FT                   /product="cytochrome C biogenesis protein"
FT                   /note="PFAM: cytochrome C biogenesis protein; KEGG:
FT                   mms:mma_2804 cytochrome c-type biogenesis protein CycL"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75124"
FT                   /db_xref="GOA:B0TRF2"
FT                   /db_xref="InterPro:IPR005616"
FT                   /db_xref="InterPro:IPR038297"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRF2"
FT                   /protein_id="ABZ75124.1"
FT                   /translation="MSKAYTSTLMRLLAGLAILLCISISAQAASDKIHYTQDQIRDLGF
FT                   EIAHELRCPMSVNQNLFDSSAPIASELKGQIFLMLDQGESKAEIIDFLVQRYGEKIRYQ
FT                   PSFSSATALLWFGPLLLLFGIIAFAAIWIREQRKHQDIKANTHE"
FT   gene            complement(661411..663387)
FT                   /locus_tag="Shal_0550"
FT   CDS_pept        complement(661411..663387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0550"
FT                   /product="cytochrome c-type biogenesis protein CcmF"
FT                   /note="TIGRFAM: cytochrome c-type biogenesis protein CcmF;
FT                   PFAM: cytochrome c assembly protein; KEGG: son:SO_0478
FT                   cytochrome c-type biogenesis protein CcmF"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75125"
FT                   /db_xref="GOA:B0TRF3"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003567"
FT                   /db_xref="InterPro:IPR003568"
FT                   /db_xref="InterPro:IPR032523"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRF3"
FT                   /protein_id="ABZ75125.1"
FT                   /translation="MIPELGLIFLIISTVTAVLLAFIPLYASYTKNHYLFSYVKTLTAL
FT                   MTVTISASILCLLISFLLDDFSVAYVANHSNTQLATLYKVAAVWGSHEGSMLFWVVSIA
FT                   IWGCLIVFSSRYQDPLFIGRMIAILAFVIAGFNLFMLFTSNPFARLLPNFPVEGRDLNP
FT                   ILQDIGLIFHPPMLFLGYVGLTITFAAAIAALLGGKFTQQHAGYLRPWVLMAWVFLTGG
FT                   NAFGSWWAYNELGWGGWWFWDPVENASFIPWLVSTALLHSVVLSQQRSSFKITTLLLCL
FT                   LAFSLSLLGTFLVRSGIVQSVHAFASDPTRGMSILFLLGVFVCGALTLFALKAHLIKSK
FT                   SDFALISRDSVMLLGNIVLIVAAISVLLGTFYPLLFELLNLGTLSVGAPYFNSMFVPLT
FT                   FVAVLLMGAAPLIKWQQQTLNSLYPLLGLFAAAAVIGVLVAIQTRDGFNPWVWIGATSA
FT                   SWILLTLGYLMFNLRQQGLAVIANKAAMLIAHLGVAVTIIGATAVSNFETQELLRMGPG
FT                   QGKVVAGYTFVYEDTVDVDATSYTAIQANIRVTDSDDNFIGYITPQRQTFKTNAMETTQ
FT                   AGIMRNLARDLYVSSGQQLSETEYLVRISHKPLACWLWIGGLMMMFGGTIAAFSGLHNL
FT                   RQQKAKAHSSSSQVTSKYTEELA"
FT   gene            663943..665979
FT                   /locus_tag="Shal_0551"
FT   CDS_pept        663943..665979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0551"
FT                   /product="cytochrome c, putative"
FT                   /note="KEGG: slo:Shew_0348 cytochrome c, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75126"
FT                   /db_xref="GOA:B0TRF4"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR023155"
FT                   /db_xref="InterPro:IPR032897"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRF4"
FT                   /protein_id="ABZ75126.1"
FT                   /translation="MKSWKLKAAASVLFCFGAIGSVNAAGGKYNSVPEMGASAKNAIAN
FT                   YAGTEERTGVKSLHDYIVQEDELFDFLFQNHPMFKYQEEGNLIGDYHISDRGEEYLDTG
FT                   GSQAYSKRVGRPSAVQYRLGAKSTLDFPNNFVGPEKCGECHATQFEKWQRSRHANVVRF
FT                   PSEITDKEVPNGDLNAKLYGSDASMLPDGIRANDVYAIIGTPRTKYGFLDSWLVRGTYH
FT                   VRDGLLSEGTGKMVAGANQFSRGWAEWLTPEMAKKINKAIPEFPVTLEEFGATGSHQWG
FT                   MTSYGAKYEKEMLFQPGSSYCEMCHTYKFDFQNKQEFFDALGDAKKLQEHTISKGISCE
FT                   ECHGAGGHLDGGTGGMQSNCERCHQRFFFVDALADTEQAQEKMEYAFGVYMKSACPSCG
FT                   TEGSQMFASSHYEKGMRCTTCHDPHEVTDGDFLSGFSKPMLKKDCVDCHEAQAMIADNT
FT                   DTHSNQTCQSCHMPNMGSCENFAAIQFPDSAGFDAVRRSHMWKIDIDPERKTLNPPEGQ
FT                   PRDSGVKGWTVAKNEEGHNYLDLMWSCARTAISDKDVVDNKGCHSPFQSELETGMHYDD
FT                   QLEIYGEVMKMQTPVKDVYAKVEQALERIDTLLEVTKLSTEDKTQVLMLAEKAQETIDL
FT                   IKKDGSWGVHGFRYSQKRLDAALTYVTQAQNILDGVGYSAKKM"
FT   gene            666040..666468
FT                   /locus_tag="Shal_0552"
FT   CDS_pept        666040..666468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0552"
FT                   /product="Rhodanese domain protein"
FT                   /note="SMART: Rhodanese domain protein; KEGG:
FT                   shw:Sputw3181_0578 rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75127"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRF5"
FT                   /protein_id="ABZ75127.1"
FT                   /translation="MNRVLGSVVFTVLLSMLSAGSYAGGGQEMAPAKYYDEPLNTITMV
FT                   EAETLVGKEGVYFFDVNTLELWAEGFIPGAVYFNVKNWKDLLPKNKDAQLVLYCANRLC
FT                   NASEIAARHVMKLGYTNVRQMPDGIYGWRLSNRVTEKP"
FT   gene            666506..667306
FT                   /locus_tag="Shal_0553"
FT   CDS_pept        666506..667306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0553"
FT                   /product="peptidylprolyl isomerase FKBP-type"
FT                   /note="PFAM: FKBP-type peptidyl-prolyl isomerase domain
FT                   protein; peptidylprolyl isomerase FKBP-type; KEGG:
FT                   slo:Shew_0350 peptidylprolyl isomerase, FKBP-type"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75128"
FT                   /db_xref="GOA:B0TRF6"
FT                   /db_xref="InterPro:IPR000774"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR036944"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRF6"
FT                   /protein_id="ABZ75128.1"
FT                   /translation="MKKLKKSVLAVVSCLTLSVSVSCFANSDLTTDVEKESYSIGASFG
FT                   HHISSQVYGQTQLGAEVDMGQVVNGLLDALQDETKMSKEEIVTYLNQRAETLNAAKQVK
FT                   LDALTAKNLAAGEAFMAENAKNSDVKQTESGLQYEVITMGEGAMPQGNDVVTVHYKGTL
FT                   IDGTEFDSTYDRNEPNRFSLVTVIEGWQEALALMPQGSKFKLAIPPALAYGDRVVGMIQ
FT                   PHSTLVFEVELVKVEAPGEGAHGMGLSGMGMGGMMGGSMGANPH"
FT   gene            667341..668069
FT                   /locus_tag="Shal_0554"
FT   CDS_pept        667341..668069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0554"
FT                   /product="Cytochrome c biogenesis factor-like protein"
FT                   /note="KEGG: shn:Shewana3_0492 formate-dependent nitrite
FT                   reductase, NrfG protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75129"
FT                   /db_xref="GOA:B0TRF7"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRF7"
FT                   /protein_id="ABZ75129.1"
FT                   /translation="MNTVLISISITLFCSFAFLFCHHFKYGTRIQDLENEVGDCFGSNN
FT                   YITSNDVNSNNNYPFGFIGVFLISVSVFLYLMLGRYQDLDLAMADYNVDYLLVADINKG
FT                   QKLAEKNPDDPLVLLGLAQSYIDGGLYKDAIETLDQLLVINSENTEALGLKASSMYYRD
FT                   GRVISMDTSLVIARALTLHHEELNTRLLIANDAYLNGNYQKAIDNWNIVLTNKVQVFNS
FT                   DAINFAIEKSKQKLTQVDFD"
FT   gene            668155..668862
FT                   /locus_tag="Shal_0555"
FT   CDS_pept        668155..668862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0555"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: she:Shewmr4_0492 4Fe-4S ferredoxin,
FT                   iron-sulfur binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75130"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRF8"
FT                   /protein_id="ABZ75130.1"
FT                   /translation="MSENLERRRFLKGLGASSLILAPLGCSSVKDKEDTNKPHYVMVFD
FT                   QNKCVGCGECKEACNKANHLPEGKSRLLMEEQSSAIEGQPCPHCGKTNDCGCQRKFVRV
FT                   SCQQCKNAPCVTVCPTGAAHRDEKTGIVTMDAAKCAGCKYCIGACPYDARFINKETDVA
FT                   DNCDFCLNSKLAIGELPACVQQCRYDALIFGDANDPTSYVSKLLAVKDSVRIKPGFGTE
FT                   PSLRYIPIVKLGV"
FT   gene            668865..669812
FT                   /locus_tag="Shal_0556"
FT   CDS_pept        668865..669812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0556"
FT                   /product="Polysulphide reductase NrfD"
FT                   /note="PFAM: Polysulphide reductase NrfD; KEGG:
FT                   slo:Shew_0353 polysulphide reductase, NrfD"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75131"
FT                   /db_xref="GOA:B0TRF9"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRF9"
FT                   /protein_id="ABZ75131.1"
FT                   /translation="MDGNIEFTMGLSQGIAWPWPIAVYLFFAGISGGALAVALFIRFYK
FT                   KQTENTPFLKAASLVSLVTIAVGMLCLVIDLTNPLFFWRILVFYNLNSVMSVGVLVLNA
FT                   YIPLVALVTLFAFEEEIKACKPLHFLLPIIDKLRVIRAPSEKLVLVLAMSVCAYTGFLI
FT                   SALIRFPIINTSVLPALFVASGLSAGAAAAKMVAVSVFKEDLHSKDMHTLHAIEWPVMA
FT                   AEALFLFMIVMSLATGNAGAQSAFAAFHSGVWANVFWMGVVGIGFVGPLLLNFATGKAF
FT                   SHSAKAFFMSGMCAVVGMMCLRLFIIYAGQLNAI"
FT   gene            670161..670649
FT                   /locus_tag="Shal_0557"
FT   CDS_pept        670161..670649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0557"
FT                   /product="NosL family protein"
FT                   /note="PFAM: NosL family protein; KEGG: shm:Shewmr7_3536
FT                   NosL family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75132"
FT                   /db_xref="InterPro:IPR008719"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRG0"
FT                   /protein_id="ABZ75132.1"
FT                   /translation="MKKLICLLFLLPLMSACSDSSADATQYTAQAIHEHDRCHLCGMMI
FT                   TKYPGPKGQVHLKEQSIVPKFCSTRDMFNFALQSENKRQIEALFVHDVAATDWEQPKDD
FT                   AFTDATQAWYVYGSIKKAVMGPAVASFKNKADAVKFAQEFGGAVLPYEKIDIALLAGE"
FT   gene            670704..672062
FT                   /locus_tag="Shal_0558"
FT   CDS_pept        670704..672062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0558"
FT                   /product="periplasmic copper-binding"
FT                   /note="PFAM: periplasmic copper-binding; SMART: Parallel
FT                   beta-helix repeat; Carbohydrate-binding and sugar
FT                   hydrolysis; KEGG: shw:Sputw3181_0582 periplasmic
FT                   copper-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75133"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR006633"
FT                   /db_xref="InterPro:IPR007742"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR022441"
FT                   /db_xref="InterPro:IPR026464"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRG1"
FT                   /protein_id="ABZ75133.1"
FT                   /translation="MKKLMKNCGSELARNSLRKAAKQVCLSTWFCLFVSPLTVAANYSV
FT                   SNAEGLKQQLLMVKAGDTVVLKAGEYSGHFEIHQPIMLMGEKGAIIDAQGSGSAISVFV
FT                   SDVTISNLQVQNWGADLYELDSGILVQDNADRVRIESSHLKGDGFGIYSENSKHITVVN
FT                   NVITGNPALYKLDRGDGVYLKGVDAPVVHDNKISHVRDGVYLETSTNSLVFDNRFHSAQ
FT                   YGIHYMYTKHDEGYGNEVDNVDGGYAIMSSEFVNLHQNQASNTLDFGVLLNISNHCIVS
FT                   HNRLSLGHNPQGTAELGNEGKGIFIYGARDNEVSHNLFSTSDIGIYMAMGGEKNKVYGN
FT                   QFVNNKTQVKYVGDSLLEWSHQGRGNYWSGYMGWDANHDGIADKPYRPNDSLDKLFWLY
FT                   PEARFLMNSPVVALLRWVQGQFEVGAATGIVDSFPLISAGSTGSTGSVYRAQY"
FT   gene            672062..673027
FT                   /locus_tag="Shal_0559"
FT   CDS_pept        672062..673027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0559"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: slo:Shew_0356 ABC transporter-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75134"
FT                   /db_xref="GOA:B0TRG2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRG2"
FT                   /protein_id="ABZ75134.1"
FT                   /translation="MSTATPQPRGNHRSRAETTMSELAIQLTDVSLKYNDFTALDGVSF
FT                   DVEAGQTMALLGHNGAGKSSLIKIILGLIMPTSGTVNILGQNAQESQAHNSVRLGYLPE
FT                   DANFYDKLTGCEVLSYFAALKGVNQPRVASLIEEFGLEYAQHRQLKTYSKGMKQRLGVA
FT                   QAILSEPKVLLLDEPTVGLDPQASQFLYGKINQLKLAGCAVVISTHELSLAESHLDRAL
FT                   IMAKGKRLAIGSCAELRNASSIKTRIHFSELSERVKTNAYLQQFYQDGLLQFDADKKVD
FT                   IVKHLVSQCQIFDFEIKEPRLEDIYHDLMGQSLRSSVEQS"
FT   gene            673029..673874
FT                   /locus_tag="Shal_0560"
FT   CDS_pept        673029..673874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0560"
FT                   /product="copper ABC transporter, permease protein"
FT                   /note="KEGG: slo:Shew_0357 copper ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75135"
FT                   /db_xref="GOA:B0TRG3"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRG3"
FT                   /protein_id="ABZ75135.1"
FT                   /translation="MQMNRLKSPILIIAHKEICDSSRNRWLTFMGSIFLLLSLSVSFAG
FT                   SAVTGSLYLPELGSLMSSLSTISVFIIPLASILLCYDSFVGEEEAGTLLLLLSYPLTRS
FT                   QIIFGKLLGHITVMLTATGFAFGLTAALLLLVGEQYNGAELVAAFAQFLLSSNLLALTF
FT                   ILLSYIVSLKCTEKAKAIGCLLLLWFLFVLIYDLLLLTLLVSDFSFANQFLINILIAMS
FT                   PTDLYRAINLVAIEGEGATGSLAMIATTDWGLSAMYGLFLLWIVSLTLISHRIFKRKPL
FT                   "
FT   gene            674084..675367
FT                   /locus_tag="Shal_0561"
FT   CDS_pept        674084..675367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0561"
FT                   /product="transcriptional regulator, CadC"
FT                   /note="PFAM: transcriptional regulator domain protein;
FT                   KEGG: shm:Shewmr7_3532 transcriptional regulator, CadC"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75136"
FT                   /db_xref="GOA:B0TRG4"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRG4"
FT                   /protein_id="ABZ75136.1"
FT                   /translation="MLKITPYLELDTEAHQLVDHVSGKKVILTFSESAVLHRLLLSSKP
FT                   VCSKEELLSAGWPDRVVAVTSLTQCISTLRKKLDAYREVQLKTIARRGYQLHISTQSHV
FT                   KMLAVNDAESMRAAIFDVSLIVKISGIVIALLLLVLAWYFSDSHKAKQNLARWSADEQF
FT                   DLQVGGLKGNAQLLYKDDAPHLHPFMWEKHLLPDNSFLTCHEDFNAYVATDGENYSMAI
FT                   CPGSDKEQCAGKGLINLTSVDSEPAQLNLEEFVDLSSAMEQRIRYNRVMLPESTDTSGA
FT                   LLEHNYQADVYFPVKDELLIRADINMSLIYDSSDSGEFHSSTCITDQDCLTTPIKYKVR
FT                   GKFKQYSGMIDGLKADIFQVKVEQKDLIRPDKLNGSAVRFYRDLRKRNIKDEELYYIRI
FT                   HQDHKTAVWVIPLFGQVTAWYHYERFDI"
FT   gene            676135..676587
FT                   /locus_tag="Shal_0562"
FT   CDS_pept        676135..676587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0562"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75137"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRG5"
FT                   /protein_id="ABZ75137.1"
FT                   /translation="MRKILVLFMLFSLNSFAFENDQWKINGKWDCSPEANGEMALISIV
FT                   EYRTQDMSFTHNGKVTFIQKDGVESILESTTVGTFQLEYLTVKEQIDSIEIAIIKDETG
FT                   FLTGAEESLRKAMLADTASTITKSINENRWVQINSETNEITVCKKI"
FT   gene            676694..677131
FT                   /locus_tag="Shal_0563"
FT   CDS_pept        676694..677131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0563"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hch:HCH_03398 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75138"
FT                   /db_xref="InterPro:IPR015002"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRG6"
FT                   /protein_id="ABZ75138.1"
FT                   /translation="MRIIQAVKESWGWVGIDPIEIVGQNDFGNLMIEDSKGQYWRLCPE
FT                   DVYCELVAKNREDLDRLSTDQEFLEDWYMQALVEQANQHLGPLSEGDKYCLVTPSVLGG
FT                   EYAISNIKTAPLIELVRFSGDLANQIKDLPDGAQIQLKVVD"
FT   gene            677226..677543
FT                   /locus_tag="Shal_0564"
FT   CDS_pept        677226..677543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0564"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fnu:FN1049 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75139"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRG7"
FT                   /protein_id="ABZ75139.1"
FT                   /translation="MNANEFVQNFKKEKDYCLELYTSGEPATAVSELIKQMGLSDHQQE
FT                   KMNAVIDGILNDVFYSILLGLDGCGTIGDIQHTYKIHDENGSIISECGDLEAEAWEPFN
FT                   E"
FT   gene            complement(678248..678907)
FT                   /locus_tag="Shal_0565"
FT   CDS_pept        complement(678248..678907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0565"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   cps:CPS_3142 transporter, LysE family"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75140"
FT                   /db_xref="GOA:B0TRG8"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRG8"
FT                   /protein_id="ABZ75140.1"
FT                   /translation="MDISLIGIFATVAFAHFLALISPGPDFVILVKSAVKNESKKAIGV
FT                   ALGISIANALYIALCLIGVGSLLASSVYIMIGLKIAGGLFLIYLAIQALRAKKSDYAGL
FT                   SSQVNRGDHNETTFFKEFIVGFMSAILNPKNILFYLSLFTVVLTKDVSLTFKIMLGIWM
FT                   TSIVFIWDSAIVIFLSGDKVRSKFSKLAYYIDKATGAILGLVGFTIVKAAFTKSNV"
FT   gene            679313..682120
FT                   /locus_tag="Shal_0566"
FT   CDS_pept        679313..682120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0566"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75141"
FT                   /db_xref="UniProtKB/TrEMBL:B0TRG9"
FT                   /protein_id="ABZ75141.1"
FT                   /translation="MAQFDKYVSIVVDPSSAESIANALAEYRQRLENGSAFRLTMNLLL
FT                   NVQFIKPDGSALTLDDAGSNHALVEQAINACRDEQKLSYISEPVLFGAALNFSELIPAV
FT                   VETIEALVAFARSRNDSNDLWIDDCNALGIEALYMLIESDASYSPLLGRFLVPYWDTQT
FT                   MTAPLCLLSNLVNKHGWSRDLIKAYVWCDGAEVRRYFYESDSFEDEGYNAAQPDLLAHL
FT                   QSHPDDYSYFKHELLARLQISPILVFADESTSLAEMLFEYYDSMGVWSVGCERWELEEQ
FT                   QEEWQDRVKQQLICGAKVEDEIIALAATLTETRNESEYFSVAEAQLNGLDNAYQVWMEP
FT                   AEVEAEEESEQESLSELAQVEPILWDEKSGRSFFSCLNPRLELLTQNRLERLSDELGYR
FT                   GGLEIVEALPYMPLHLGSSAYLAHRLLQQPSFAERDAIEQWLELHLSKLLTDFVLKYCD
FT                   VAEADTEVLRQWLTYVEKSGVGSDAEATQQNDAEMIELVRAGMAKDGGKSGPEISAKQA
FT                   AYWTLFNYDGGQRCMLTTLLLQSAGKLNQGEGSSPVVQLAKRHWQLWLSIAPQRVINRI
FT                   VKFKADYPLYAAINDQDTETALFNLLHQHGVSEAMLEAFTLMTDQQVADYRPADPRFAR
FT                   RYTDKVAQYAALDSADTSMIGRQQLKQFETLLQQLEYCREDQVLEFFQHVKAVNPEIEL
FT                   PIMPMFEAALINTLKEDFDDATAQTVYDKLMAYLVSGEGLQELSPQALKLSKLQGWNPY
FT                   PMYRGKVGPADFVWLLPSEMAEHLTLFLAQLGKRGLHWLGRCSVEEAYVTSRIQSGEIT
FT                   MAERWSHCEVGNERHGDCDMDSALDVAKQSWALNWLDRAGVPETSLVYFAVHEGYEQQE
FT                   FVLRLAAENRLPDMQDRLTANERVQLLEMLQGAESLTDITAQSFLQDCSSAVKQLAGKL
FT                   FSNRS"
FT   gene            682834..684864
FT                   /locus_tag="Shal_0567"
FT   CDS_pept        682834..684864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0567"
FT                   /product="cytochrome c, putative"
FT                   /note="KEGG: slo:Shew_0348 cytochrome c, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75142"
FT                   /db_xref="GOA:B0TS07"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR023155"
FT                   /db_xref="InterPro:IPR032897"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:B0TS07"
FT                   /protein_id="ABZ75142.1"
FT                   /translation="MRRWKHKVALSVLFCFGAIANANAAGKYDSIPQMGKTAKESIANY
FT                   QGTEQINGVKTLQDYIVQEDELFDFLFENHPMFKYQQSGNLVGDYHISDRGEEYLDTGH
FT                   SPAYSKGVGKPRAVQYRLGAKSILDYPNNFVGPEKCAECHATQYEKWQRSRHAKTIRFP
FT                   GEHPEVDNDIEKTMYNTKDTSILPDGITPDAIYATVGTPRTKYGFIDSWLVRGTYHIEG
FT                   GLLRDGTGKMVAGANQFSRGWAEWLTPEMSKKINDVIPDFPITLEGFGASGSHQQGMSS
FT                   YGAKYRTEMLFQPASSYCEICHTFKFDFQSKEEFFDALGDPKKLQEHTISRGIACEECH
FT                   GAGGHLDGGTGGMQSNCERCHQRFQYDPTLQDTPEAQEKGEYAFGVKMKSLCPSCGTEG
FT                   SQMYNSEHYEKGMRCTTCHDPHEVTDGSWMSGFTTPKLKKDCKDCHEAQTLIAENSDTH
FT                   NQQTCQSCHMPNMGSCENFKALQFPDQAGFDAVRKSHMWKIEVDPTLKTLNPPEGESRA
FT                   GGPSGVKGWTVAKNEEGRSYLDLMWSCARTSISDHDVVENKGCHSQFQSELEKGLHYED
FT                   QLEIYGEVMKMQTPVKEVFTKVEQALVRIDQLLEVTKLSVEDKTQVLMLAEKAQETVDL
FT                   IKKDGSWGVHGFRYSQKRLDAALTYVTQAQNILDGTGYAAK"
FT   gene            684889..685362
FT                   /locus_tag="Shal_0568"
FT   CDS_pept        684889..685362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0568"
FT                   /product="Rhodanese domain protein"
FT                   /note="SMART: Rhodanese domain protein; KEGG: slo:Shew_0349
FT                   rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75143"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B0TS08"
FT                   /protein_id="ABZ75143.1"
FT                   /translation="MHCTAIIAEAIERKIMKKALGQILVTFTLLASSASCLAGGGSDMA
FT                   PAPRYEHQLHTISMMEAESLIGKEGVYFFDVNTLELWAEGYIPGAIYFNVKDWKKLLPA
FT                   NKDALMVFYCANRLCNASEVAAHHTMKMGYTNVRQMPDGIYGWRLSNRVTERP"
FT   gene            685413..686207
FT                   /locus_tag="Shal_0569"
FT   CDS_pept        685413..686207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0569"
FT                   /product="peptidylprolyl isomerase FKBP-type"
FT                   /note="PFAM: FKBP-type peptidyl-prolyl isomerase domain
FT                   protein; peptidylprolyl isomerase FKBP-type; KEGG:
FT                   slo:Shew_0350 peptidylprolyl isomerase, FKBP-type"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75144"
FT                   /db_xref="GOA:B0TS09"
FT                   /db_xref="InterPro:IPR000774"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR036944"
FT                   /db_xref="UniProtKB/TrEMBL:B0TS09"
FT                   /protein_id="ABZ75144.1"
FT                   /translation="MIIMKKFTKTTLAVVTGFTLCMSANAMAQTELTSEVQKESYSIGA
FT                   SLGKYISGQIYNQTELGAEVNVDLVIEGVVDALKDNPRFSDEEILTYLNQRAEQLNTAR
FT                   EAAEAKLALESLTAGNEYLAENKKKEGVKETASGLQYEVISEGEGRKPDPQDVVTVHYK
FT                   GSLIDGTEFDSTYERNEPNRFALMSVIEGWQEGIPLMNEGSTYKLSIPAALAYGDKQVG
FT                   IIPPGSVLVFEVELVKVEAPGQNSHGMGLSGMGMGGMMGGGH"
FT   gene            686325..687038
FT                   /locus_tag="Shal_0570"
FT   CDS_pept        686325..687038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0570"
FT                   /product="tetratricopeptide TPR_2 repeat protein"
FT                   /note="KEGG: slo:Shew_0351 tetratricopeptide TPR_2 repeat
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75145"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:B0TS10"
FT                   /protein_id="ABZ75145.1"
FT                   /translation="MNSLAIGIAVTLCAVITLILRHHHSCQKHGVTLVANSFNDDQSNE
FT                   QADIKVAAGLSVVLFTSTLLIYSQIGHFDGWNKGVIDENIDYLITAEINKNAKKVNEQP
FT                   SNQIALLNLAQSYVDGGLYNESVQTFDELLKLTGDDAGILGMKANAMYYRDNREMSLDI
FT                   DLVIARALALDEYEPQSRLLLATHAYLNGEFEPAIEQWLKLLESDNQSINRASINNAIY
FT                   RAEQKIANRSVAASE"
FT   gene            687100..687810
FT                   /locus_tag="Shal_0571"
FT   CDS_pept        687100..687810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0571"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: she:Shewmr4_0492 4Fe-4S ferredoxin,
FT                   iron-sulfur binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75146"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B0TS11"
FT                   /protein_id="ABZ75146.1"
FT                   /translation="MSENIERRRFLKCLGASSLIIAPLGCSSVKEGESDANKPHYAMVF
FT                   DQHKCTGCGECKEACNLANNLPEGKSRLLMEQHSGAVEGQPCPHCGKTEECGCERKFVR
FT                   VSCQQCKNAPCVTVCPTGAAHRDEKTGIVTMDASKCAGCKYCIAACPYDARFINKETDV
FT                   ADNCDFCLNSKLAIGELPACVQKCRYDALIFGDVNDPTSYISKLLRVKDSVRIKPGFGT
FT                   EPSLRYIPIVKQGV"
FT   gene            687813..688760
FT                   /locus_tag="Shal_0572"
FT   CDS_pept        687813..688760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0572"
FT                   /product="Polysulphide reductase NrfD"
FT                   /note="PFAM: Polysulphide reductase NrfD; KEGG:
FT                   slo:Shew_0353 polysulphide reductase, NrfD"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75147"
FT                   /db_xref="GOA:B0TS12"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="UniProtKB/TrEMBL:B0TS12"
FT                   /protein_id="ABZ75147.1"
FT                   /translation="MDGNIEFTMGLSEGLAWPWPIAVYLFFAGISGGALATALFLRFYK
FT                   KQTTNTPFYKAAALISLVTISLGMLCLVLDLTNPLFFWRILVFYNLNSVMSIGVIALSV
FT                   YIPLVALICLYAFEEEIRSVPALKMLVPLVDKLQGIRRPCEVTVLVLALAVCAYTGFLI
FT                   SALIRFPIINTSVLPALFIASGISAGAAAAKMLAVSMFKEDLHSQDMKLLHGAEWPIMI
FT                   AEILFIFMIVTSLMTGNAGAQSAFTAFHTGEWAAVFWFGVVGLGFGGPLLLNFATGKSF
FT                   SHSAKAFYLSGVCAVTGMMCLRMFILYAGQNFAI"
FT   gene            688891..689421
FT                   /locus_tag="Shal_0573"
FT   CDS_pept        688891..689421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0573"
FT                   /product="NosL family protein"
FT                   /note="PFAM: NosL family protein; KEGG: sbm:Shew185_3871
FT                   NosL family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75148"
FT                   /db_xref="InterPro:IPR008719"
FT                   /db_xref="UniProtKB/TrEMBL:B0TS13"
FT                   /protein_id="ABZ75148.1"
FT                   /translation="MTSASSESLQVGTCMKKLMLILLFVPLMFACSQGDAVSQSAKAQA
FT                   IHEHERCHLCGMMIKKYPGPKGQLGLKNESIVPKFCSTRDMFNFALQPENKRQITYLKV
FT                   HDMSVADWENPDDNTFVDGASAWYVYGTSKKAVMGPAVASFATKEGATQFAQEFGGAVL
FT                   TYEQITIELLAGE"
FT   gene            689476..690795
FT                   /locus_tag="Shal_0574"
FT   CDS_pept        689476..690795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0574"
FT                   /product="periplasmic copper-binding"
FT                   /note="PFAM: periplasmic copper-binding; SMART: Parallel
FT                   beta-helix repeat; Carbohydrate-binding and sugar
FT                   hydrolysis; KEGG: son:SO_0486 copper ABC transporter,
FT                   periplasmic copper-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75149"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR006633"
FT                   /db_xref="InterPro:IPR007742"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR022441"
FT                   /db_xref="InterPro:IPR026464"
FT                   /db_xref="UniProtKB/TrEMBL:B0TS14"
FT                   /protein_id="ABZ75149.1"
FT                   /translation="MNISLLNVVSRASRAAIFRLFILAVTLGYSANNYAENLSVSSTEE
FT                   LKHALTHAKSGDRIILDTGRYQGPLQIHQSIILSSLGDSIIDANGIGSAIKVFAPNVEI
FT                   SGLRIENWGNDHYERDAGILVEPGNHGLRIHNNSLTGNGFGIRADELNDIKIHNNVIVG
FT                   NSSLYILDRGDGIHLQHVIGAEIWGNTISQVRDGVYLESGSKSKVYANQLFDQQYGIHY
FT                   MYTTDDEAFDNQSYQVDGGYALMDSKRIYLHRNQVWDAIDFGILLNMTKDSLVKSNRVE
FT                   QIINRSENQIQGQEGKGIFVYGARDNTIINNRFANNDIGFYMAMGGEGNQVYGNQFIDN
FT                   FSQVKYVGDVLLEWSQTGRGNYWSGYLGWGHSSDDVGNTAYRPNDNIDKLFWLYPEANF
FT                   LMDSPIVVVLRWVQSQFEITEPSGIVDSFPLLTPNPAFDY"
FT   gene            690888..691796
FT                   /locus_tag="Shal_0575"
FT   CDS_pept        690888..691796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0575"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: slo:Shew_0356 ABC transporter-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75150"
FT                   /db_xref="GOA:B0TS15"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0TS15"
FT                   /protein_id="ABZ75150.1"
FT                   /translation="MNPCLAVSARHISHQFTDFTALNDVSFEVERGQTMALLGHNGAGK
FT                   STLIKILLGLIKPTHGEVSILGQDLARLSDRAELKIGYLPENVSFYDKLTGKEILSYFA
FT                   ALKRVTKSRVGQLIEEFGLEYAQDRALKTYSKGMKQRLGFAQAILCEPELLLLDEPTVG
FT                   LDPVASLFLYGKIDQLKRQGCGIIVCTHELSLIENNIDIALILAKGKSLAKGSLAELRQ
FT                   NSGLKTRLTSPNLAMWVEQEPRLAPYYIDDALLLDVDSKAKVLQLLMSECQRFDFNLKE
FT                   PTLADIYHLYMGQCAQIEVVS"
FT   gene            691798..692628
FT                   /locus_tag="Shal_0576"
FT   CDS_pept        691798..692628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0576"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: slo:Shew_0357
FT                   copper ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75151"
FT                   /db_xref="GOA:B0TS16"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:B0TS16"
FT                   /protein_id="ABZ75151.1"
FT                   /translation="MMRQSPVMVIAKKEIKDSLRNRWVIFISLIFLILSLSVTFAGSAV
FT                   AGHLSLPEIDTLMSSLSTVSVFIIPLAAMLVSYDAFVGEDESGTLLLLMSYPISRLQIL
FT                   LGKLLGHSLIMSATSCFAFGLTAVLLLIFGEAYESQVILSKFAQFIFSSILLAITFILL
FT                   GYIVSLKSTEKAKAVGSILFVWFLFVLIYDLILLAILVADLAFMNQYMINFLIALNPTD
FT                   LYRAVNLIGSDVASGSLARLSSSTMGKLGFYCAMLLWILALLAIANRVFQRRTL"
FT   gene            692904..694187
FT                   /locus_tag="Shal_0577"
FT   CDS_pept        692904..694187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0577"
FT                   /product="transcriptional regulator, CadC"
FT                   /note="PFAM: transcriptional regulator domain protein;
FT                   KEGG: shn:Shewana3_0499 transcriptional regulator, CadC"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75152"
FT                   /db_xref="GOA:B0TS17"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B0TS17"
FT                   /protein_id="ABZ75152.1"
FT                   /translation="MHKVTPYLELDEEAKQLIDHANNTTITLTVSESAVLHRLILAISS
FT                   VCTKEELLAAGWPDRVVAATSLTQCVSTLRKKLEPYPEVMLRTIAGRGYQLNVSARSHI
FT                   KMLAVNDAESMRAAIVDVSLLVKISGIVIAILICLSLWYFSDYHGVIKAKNSWDADKKI
FT                   ELNIGGTKQDVQLIHKEDVSHLHASMWQKHLAPESNHLTDINQFKGFAVTDGNYYSMAV
FT                   CPEASGYGCSGKGLINITAIDLTPAGLNMQNFTELSHKMEQRIRYNRVIIPHDEPGTSG
FT                   FIEHHYHADVYFPVQGNMLVRSDISLSLIYDGENSGKFYSAACVTDEECKTTPIKYKIK
FT                   GDFKQYREQMNDLDVDVFHVKVSQKELVKPDQVSSSAMHFYREIRKHEIIDSDLYFYRI
FT                   YKDADTAVWVVPILGNLVAWYEYDKVKL"
FT   gene            694732..695151
FT                   /locus_tag="Shal_0578"
FT   CDS_pept        694732..695151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0578"
FT                   /product="RbsD or FucU transport"
FT                   /note="PFAM: RbsD or FucU transport; KEGG: vvy:VVA0568
FT                   ABC-type ribose transport system, auxiliary component"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75153"
FT                   /db_xref="GOA:B0TS18"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023064"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TS18"
FT                   /protein_id="ABZ75153.1"
FT                   /translation="MNKHALLNADMNYLVATLGHTDEVAICDAGLPIPAAVQRIDLALT
FT                   HGVPSFIATVKIWLASSQIEGVVLAQEFADVSPECHQALLVEIEAEQLATGRTFSIEYV
FT                   SHEAFKQRTHNSRAVIRTGECTPYANVIFKTGVVF"
FT   gene            695169..696674
FT                   /locus_tag="Shal_0579"
FT   CDS_pept        695169..696674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0579"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: vco:VC0395_0010 ribose ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75154"
FT                   /db_xref="GOA:B0TS19"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015861"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0TS19"
FT                   /protein_id="ABZ75154.1"
FT                   /translation="MTQAILQLQAIEKSFPGVKALDKASLNVYPGKVMALMGENGAGKS
FT                   TLMKVLTGSYNLDAGRIVYQGKARSFDGPRDSQQAGISIIHQELNLLPELTIAENIFLG
FT                   REITSRFGRILWDEMNAQAAALLTRLSVSHAPQTLLGKLSLGEQQMVEIAKAISFDSKV
FT                   IIMDEPTDALTDIETQSLFKVIHELREQGCGIVYISHRMQEIFTICDAVTVLRDGGFIH
FT                   ECAISDINEDQLIERMVGRKLAEQYPRIANTHQGCRLAVSELSGPGVENVSFTLNQGEI
FT                   LGFSGLMGAGRTELMKIIFGAGAKTQGQITLNGCDIKINNPQQALDAGIAYISEDRKGD
FT                   GLLLELSVKENMSICALAKLSSGLQLRHRDEMAEVDRFIDAFNIKTPSRDARIGNLSGG
FT                   NQQKVSIAKGLMTLPQVLILDEPTRGVDVGAKKEIYDLINRFKAQGMSIILVSSDMPEL
FT                   LGMSDRILVMHQGQISGEFDAAQADQETILACAVGKTLNKDIA"
FT   gene            696671..697645
FT                   /locus_tag="Shal_0580"
FT   CDS_pept        696671..697645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0580"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   vco:VC0395_0009 ribose transport system permease protein
FT                   RbsC"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75155"
FT                   /db_xref="GOA:B0TS20"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B0TS20"
FT                   /protein_id="ABZ75155.1"
FT                   /translation="MSQSITAQPFYKRINKEWLIEQKSLIALFSLIFVVSLLSPNFLTV
FT                   DNFLNILRQTSINGIIAVGMTIVILTAGIDLSVGSVLALSGAIVATLIGMDVPVMIALP
FT                   VALIAGAALGAISGIIVAKGKVQAFIATLVTMTLLRGVTMVYTDGRPVPTGFSETADSF
FT                   TWLGTGYVLGIPVPVWLMAIVFTGAWYLLNHTRFGRYIYAVGGNESAARLSGIAVDKVK
FT                   IAAYAICGSMAALAGIIVTARLSSAQPTAGMGYELDAIAAVVLGGTSLMGGKGRIVGTL
FT                   IGALIIGFLNNALNLLDVSSYYQMIAKASVILLAVLIDTKQKA"
FT   gene            697745..698644
FT                   /locus_tag="Shal_0581"
FT   CDS_pept        697745..698644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0581"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: vvy:VVA0571 ABC-type sugar
FT                   transport system, periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75156"
FT                   /db_xref="GOA:B0TS21"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B0TS21"
FT                   /protein_id="ABZ75156.1"
FT                   /translation="MKQPINKKVSVMLAAALLSSSVSFGASAQDAIAIVLSTMNNPFFV
FT                   TMKDGAEAKAKELGYKLIALDSQNDPSKELANVEDLTMRGVKAILINPTDAMAVTNAIR
FT                   TANRANIPVLTLDRTAERGDIASHIASDNIAGGELAGQFIADTLGANAKVIQLEGIAGT
FT                   SAARERGEGFSNAVKAHSLNMLSSQPADFDRSKGLNVMENMLAANGDVQAVFAQNDEMA
FT                   LGALRAIEAAGKEVMVIGFDGTDEGIAAVRRNQLSATIAQQPELLGATAIVMADKILKG
FT                   QQVEKSIPVALKIITATQ"
FT   gene            698769..699686
FT                   /locus_tag="Shal_0582"
FT   CDS_pept        698769..699686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0582"
FT                   /product="ribokinase"
FT                   /note="TIGRFAM: ribokinase; PFAM: PfkB domain protein;
FT                   Phosphomethylpyrimidine kinase type-1; KEGG: vvu:VV2_0065
FT                   ribokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75157"
FT                   /db_xref="GOA:B0TS22"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B0TS22"
FT                   /protein_id="ABZ75157.1"
FT                   /translation="MSQLIVLGSVNADHVLQVASFPRPGETLHGYNYQIIPGGKGANQA
FT                   VAAARLGADTGFIACVGDDGFGRNIRHTFEQDGMEVSAVHMVENTPTGIAMIQVADSGE
FT                   NSICIAAAANDALTTKVVEQHALKIEQAQYLLMQLETPLPGIELAASIAKAQGTQVILN
FT                   PAPARSLPDTLLAMVDIITPNETEAELLTGVAITDADSAAQAAKVLHDKGIVTVMITLG
FT                   SKGVYLSEQGEGKIIAGFKVQVTDTTAAGDTFNGAFVTALLEGQTIDKAIVFAHAAAAI
FT                   SVTRFGAQTSIPTREEVEQFLAAH"
FT   gene            699775..700779
FT                   /locus_tag="Shal_0583"
FT   CDS_pept        699775..700779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0583"
FT                   /product="transcriptional regulator, LacI family"
FT                   /EC_number="5.1.1.1"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG:
FT                   vco:VC0395_0006 ribose operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75158"
FT                   /db_xref="GOA:B0TS23"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B0TS23"
FT                   /protein_id="ABZ75158.1"
FT                   /translation="MATMKDVAKLASVSTSTVSHVMNATRFVSEDIAKRVQAAAQQLNY
FT                   HGPSAVARSLKQNCTKTIGMLVTTSTNPFYAEVVRSVEQACYQQGYNLILCNTEGDAQR
FT                   LKRSLTTLIERRVDGLIMMCAMLEGEDALIYRRLDSLPVVVMDWGQVDFPCDKIQGHSR
FT                   QGGILATQYLIDNGHTQIGCITGPRNRQQADLRYQGFVDAMQAANLPINPDWVVEGNFE
FT                   TEGGKAAFAKLQAVGSLPTALFVCNDMMAIGVLHEAQRTGVQIPEQLSVIGYDNIQLAK
FT                   FMTPALTSIHQSKARLGAAAVHALIARLQDPNLPPQFMDIEPRVTVRASVSQR"
FT   gene            complement(700936..701646)
FT                   /locus_tag="Shal_0584"
FT   CDS_pept        complement(700936..701646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0584"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; KEGG: shn:Shewana3_0505 oxidoreductase
FT                   FAD/NAD(P)-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75159"
FT                   /db_xref="GOA:B0TS24"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:B0TS24"
FT                   /protein_id="ABZ75159.1"
FT                   /translation="MNTISCTIEKVAPFNNAVYQVILKPSTPFDFKAGQYLCVVMGEKD
FT                   KRPFSIASAPDAEHIELHIGAAVSESYPMQVVERLKECLTSGSNIEVEVPGGDAHLRAD
FT                   SLRPRLLIAGGTGFSYIKSIVEQKIALGQEIETTLYWGCRNQEAMYFETIARQWHEAHP
FT                   WLHFVPVIEEATADWKGKEANLLEQIKNDFDNLSGYDIYIAGRFDMVGAAREVFRTMGV
FT                   DEDHLYGDAFAFIK"
FT   gene            complement(701758..703239)
FT                   /locus_tag="Shal_0585"
FT   CDS_pept        complement(701758..703239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0585"
FT                   /product="UbiD family decarboxylase"
FT                   /note="TIGRFAM: UbiD family decarboxylase; PFAM:
FT                   Carboxylyase-related protein; KEGG: slo:Shew_0360 UbiD
FT                   family decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75160"
FT                   /db_xref="GOA:B0TS25"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR023677"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0TS25"
FT                   /protein_id="ABZ75160.1"
FT                   /translation="MSFKDLRSFIDHLETNGELKRISHPVDPHLEMTEIADRVLRAKGP
FT                   ALLFENPVGNDMPVLANLFGTPKRVAMALGKEDPIALRDVGELLAFLKEPEPPSGFKDA
FT                   IAKIPMFKQALNMPPKTVRNPPCQQVVKTGEEVDLTKLPIQHCWPGDVAPLVTWGLTIT
FT                   KGPRQKRQNLGIYRQQLLGKDKLIMRWLDHRGGALDFKDFKEKHPGERYPVVVALGADP
FT                   VTILGAVTPVPDAMSEYAFAGLLRGERTEVCKALSCDLEVPATSEIILEGYIDPEEMAE
FT                   EGPYGDHTGYYNETDSFPVFTVTHMTHRKDAIYHSTYTGRPPDEPAMLGVALNEVFVPI
FT                   LRKQYPEIIDFYLPPEGCSYRMAVISIRKQYPGHAKRVMMGAWSFLRQFMYTKFIVVVD
FT                   EDVNCRDWNDVIWAITTRMDPKRDTVMIENTPIDYLDFASPVAGLGSKMGMDATNKWQG
FT                   ETDREWGTPIVMDEAVKQKVDAIWNDLGIDDAPTL"
FT   gene            703462..704016
FT                   /locus_tag="Shal_0586"
FT   CDS_pept        703462..704016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0586"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_3388 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75161"
FT                   /db_xref="UniProtKB/TrEMBL:B0TS26"
FT                   /protein_id="ABZ75161.1"
FT                   /translation="MPMSMITVKWSQSFLFVFGVSGAAAVEPPSQFANQQHRYLFANSS
FT                   AHNNVSVGVGWSNYDYRDPWRWNVGVSNSWYGYPYRSGYYRPGWRPGYSWGVGSRWRYP
FT                   YSYNNRYYSPYRYDRPTYKAPEPKVIAPPERVTTSVSYATGLNRLPENARVIQRDGRTI
FT                   YEWQGTEYVFDWKTKTYQKIN"
FT   gene            complement(704349..704873)
FT                   /locus_tag="Shal_0587"
FT   CDS_pept        complement(704349..704873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0587"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   sfr:Sfri_3606 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75162"
FT                   /db_xref="GOA:B0TS27"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B0TS27"
FT                   /protein_id="ABZ75162.1"
FT                   /translation="MSKLITKTARLIIREFNLDDIQAVYDFNADERVNRYTGDAGVVQS
FT                   LADAERIIRDIWLTEYLQFGYARWAVVLKETNSVIGFCGFKNDYRINETDIGYRFAPEH
FT                   WGKGYATEANQACIEYAKDHLDLDYIVGDVVEENLASINVLLKLGMTFNKKFQDMGFTV
FT                   IRYDMYLKSKS"
FT   gene            complement(704917..705501)
FT                   /locus_tag="Shal_0588"
FT   CDS_pept        complement(704917..705501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0588"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   cps:CPS_2140 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75163"
FT                   /db_xref="GOA:B0TS28"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B0TS28"
FT                   /protein_id="ABZ75163.1"
FT                   /translation="MTKTFKKDNNLVGIARLYVQSRLHQLKKWMPMKTLKLVLASLLML
FT                   TITGCATTESQPEYHTYVKVGDNVPVTQFVDTQGNSIDLAESKNHKLLILFATWCPDSQ
FT                   RAMKYLVKSDLHLSPNVDIIGIGREETNIELNKFGAEYELNFPLVADTDRQIYSQFANA
FT                   GIPRLILLDADNKVVKTIIGETENPIIEVVW"
FT   gene            705955..707157
FT                   /locus_tag="Shal_0589"
FT   CDS_pept        705955..707157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0589"
FT                   /product="aromatic amino acid transporter"
FT                   /note="TIGRFAM: aromatic amino acid transporter; PFAM:
FT                   aromatic amino acid permease; Amino acid transporter
FT                   transmembrane; KEGG: ppr:PBPRA2465 putative
FT                   tyrosine-specific transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75164"
FT                   /db_xref="GOA:B0TS29"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR013059"
FT                   /db_xref="InterPro:IPR013061"
FT                   /db_xref="InterPro:IPR018227"
FT                   /db_xref="UniProtKB/TrEMBL:B0TS29"
FT                   /protein_id="ABZ75164.1"
FT                   /translation="MNKSKIFGSMLIIAGTTIGAGMLALPLAASGLGFGMASIIMLLIW
FT                   SLMTYTALLMIEVHQHAPVDATLHTLAHKLLGRKGQVIASFAMMFLFYALCAAYIAGGG
FT                   EQIHSKLTNWFGLELPMQAGAIIFTLLIGTVVAIGTRSVDMINRSLFSLKLIALVVMLF
FT                   LLLPHVSVENLVALPVHQGLVFASLPVIFTSFGFHGSIPSVVRYLGKDTKALRWIIVVG
FT                   SALPLMIYVLWMLASQGVLPQQDLMASQSLNGFIGSLSRMLENPMIANAVSIFADLALA
FT                   TSFLGVSLGLFDFIGDLLKRSTKASHRVQVGLVTFLPPLGFALFYPQGFITALGYAAFA
FT                   LVILAVFLPVAMVSAQRKQAGLQGYRVKGGNLGLIAATLAGVLIISVQLMQIFNLLPAV
FT                   G"
FT   gene            707314..707404
FT                   /locus_tag="Shal_R0011"
FT                   /note="tRNA-Ser1"
FT   tRNA            707314..707404
FT                   /locus_tag="Shal_R0011"
FT                   /product="tRNA-Ser"
FT   gene            707746..707836
FT                   /locus_tag="Shal_R0012"
FT                   /note="tRNA-Ser2"
FT   tRNA            707746..707836
FT                   /locus_tag="Shal_R0012"
FT                   /product="tRNA-Ser"
FT   gene            708503..709846
FT                   /locus_tag="Shal_0590"
FT   CDS_pept        708503..709846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0590"
FT                   /product="Glutamate dehydrogenase (NADP(+))"
FT                   /EC_number="1.4.1.4"
FT                   /note="PFAM: Glu/Leu/Phe/Val dehydrogenase; Glu/Leu/Phe/Val
FT                   dehydrogenase dimerisation region; KEGG: aha:AHA_1626
FT                   NADP-specific glutamate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75165"
FT                   /db_xref="GOA:B0TS30"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0TS30"
FT                   /protein_id="ABZ75165.1"
FT                   /translation="MSCDLTLDSFLSTVAERNPNQPEFLQAVKEVLTSIWPFVAAHPEY
FT                   LDAGILERLVEPERLIQFRVSWVDDQGKVQVNRAFRIQHNSAIGPFKGGMRFHPSVNQS
FT                   VLKFLAFEQTFKNALTTLPMGGGKGGSDFDPKGKSDGEVMRFCQALMFELHRHLGADTD
FT                   VPAGDIGVGAREVGYMTGMMKKLTNSAECVFTGKGLTFGGSLIRPEATGYGLLYFVEAM
FT                   LKAKGETLEGKTVTVSGSGNVAQYAIEKAMEMGGKVITASDSSGVVFDPEGFTPEKLAK
FT                   LMEVKNDRRGRVADYAYENGLEYVTGGTPWQFAAEVALPCATQNELDSEHAKMLIANGV
FT                   QMVAEGANMPSTAEAIALMHEAKVLFAPGKAANAGGVATSGLEMSQNALRLSWSRDEVD
FT                   MRLRDIMYSIHATCEQYGREGTHINYELGANVAGFVKVADAMKAQGVY"
FT   gene            710749..712283
FT                   /locus_tag="Shal_R0013"
FT   rRNA            710749..712283
FT                   /locus_tag="Shal_R0013"
FT                   /product="16S ribosomal RNA"
FT   gene            712614..715507
FT                   /locus_tag="Shal_R0014"
FT   rRNA            712614..715507
FT                   /locus_tag="Shal_R0014"
FT                   /product="23S ribosomal RNA"
FT   gene            715692..715807
FT                   /locus_tag="Shal_R0015"
FT   rRNA            715692..715807
FT                   /locus_tag="Shal_R0015"
FT                   /product="5S ribosomal RNA"
FT   gene            716675..717793
FT                   /locus_tag="Shal_0591"
FT   CDS_pept        716675..717793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0591"
FT                   /product="Choloylglycine hydrolase"
FT                   /EC_number="3.5.1.24"
FT                   /note="PFAM: Choloylglycine hydrolase; KEGG: vfi:VFA0241
FT                   choloylglycine hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75166"
FT                   /db_xref="GOA:B0TS31"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029132"
FT                   /db_xref="UniProtKB/TrEMBL:B0TS31"
FT                   /protein_id="ABZ75166.1"
FT                   /translation="MNTNRYKIEIMKKSLLALLLTSAFSYHASACTGITLSTTDNDQVQ
FT                   ARTIEWGHSDLNSKLVISPRNHQYTSTMPDQQQGLTWKSQYGFAGISVSDDRFIAEGIN
FT                   EKGLTAGLFYFRNYGSLAKYDPKQTANNITDMDFVRWMLTQFETVAEVEAALDKIKIVT
FT                   VYFDQQGNASPTAHWRVSDKQGNSIVIEIMDHGKINIHKNTAKVLTNSPDYNWQVTNLN
FT                   NYINLHPGISPPQKINGVEAQSFGVGSNFVGLPGDISPPSRFVRAAFYVNTAPKLNTAE
FT                   QAVSQAFHILNNFDIPIGSEFNDKSHIPELPSATQWTSVIDQSHGLLFYKTMHDSTIKR
FT                   VDLKQLDFTVKQERKQKLDSGKFSYQEVGVSN"
FT   gene            718448..719074
FT                   /locus_tag="Shal_0592"
FT   CDS_pept        718448..719074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0592"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: pha:PSHAb0519
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75167"
FT                   /db_xref="GOA:B0TS32"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B0TS32"
FT                   /protein_id="ABZ75167.1"
FT                   /translation="MNLAILYYVYDPMCSWCWAYRPAWLVLQSKLQAAYPDLNIEYRLG
FT                   GLAPDSDEPMPEDMQQFLQQTWNKIALQLGTEFNFDFWKKCQPRRSTYSACRAALLARE
FT                   SGLEQEMLLAIQRAYYLEARNPSDSATLIELAKGLGLDSQQFATTLMSEESKVKLEEEI
FT                   SRTRHLPIQGIPSLVLLVNGEFYVIEVDYQDPQSSYQQIGSLLSE"
FT   gene            complement(719078..719413)
FT                   /locus_tag="Shal_0593"
FT   CDS_pept        complement(719078..719413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0593"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75168"
FT                   /db_xref="UniProtKB/TrEMBL:B0TS33"
FT                   /protein_id="ABZ75168.1"
FT                   /translation="MLAFSVLCLFIGYHAYLFIMPSVKVINQSGQLLTRVEVSLPSNNL
FT                   VFDNIGPSQSARIHHSTEQADGDYAYRIRLSSGKHINGRCGYVTHDQYMKVLKLTVNRD
FT                   AKVKCVE"
FT   gene            complement(719579..720241)
FT                   /locus_tag="Shal_0594"
FT   CDS_pept        complement(719579..720241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0594"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   shw:Sputw3181_0592 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75169"
FT                   /db_xref="GOA:B0TS34"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0TS34"
FT                   /protein_id="ABZ75169.1"
FT                   /translation="MILITGASSGLGAALAKQYGKESPICISGRNSERLQLVATEVCQS
FT                   CQTQVTDLCDADAVAALFDSLATSPSLIIHSAGSGYFGPIETQSPQAIQQLLNNNVTSA
FT                   IFLLREAVKRYKDQCVTVVIVMSTAALTAKAEESTYCAAKWAVKGLVESVRLELKNSPM
FT                   KLIAVYPGGMATDFWPTSGKSANTASFMTADEAASMLKQALQSTEHGYISDLTIARG"
FT   gene            complement(720297..720743)
FT                   /locus_tag="Shal_0595"
FT   CDS_pept        complement(720297..720743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0595"
FT                   /product="acetyl-CoA carboxylase, biotin carboxyl carrier
FT                   protein"
FT                   /note="TIGRFAM: acetyl-CoA carboxylase, biotin carboxyl
FT                   carrier protein; PFAM: biotin/lipoyl attachment
FT                   domain-containing protein; KEGG: vfi:VF2386 biotin carboxyl
FT                   carrier protein of acetyl-CoA carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Shal_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ75170"
FT                   /db_xref="GOA:B0TS35"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:B0TS35"
FT                   /protein_id="ABZ75170.1"
FT                   /translation="MDIRKIKKLIELVQESDIAELEIKEGEESVRICRHSPVPMPVNTQ
FT                   TFLAPASSVAAAIPHPTSSDNADDNEAHRLLSPMVGRVYLNDKASQVPLCTLGQNVTIG
FT                   EVVCIIEAMTMSNRITADKSGVISAILVEDGQQVDFEQAILEIE"
FT   gene            complement(720753..721208)
FT                   /locus_tag="Shal_0596"
FT   CDS_pept        complement(720753..721208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shal_0596"
FT                   /product="3-dehydroquinate dehydratase, type II"
FT                   /EC_number="