(data stored in SCRATCH3701 zone)

EMBL: CP000934

ID   CP000934; SV 1; circular; genomic DNA; STD; PRO; 4576573 BP.
XX
AC   CP000934;
XX
PR   Project:PRJNA28329;
XX
DT   20-JUN-2008 (Rel. 96, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Cellvibrio japonicus Ueda107, complete genome.
XX
KW   .
XX
OS   Cellvibrio japonicus Ueda107
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Cellvibrionales;
OC   Cellvibrionaceae; Cellvibrio.
XX
RN   [1]
RP   1-4576573
RX   PUBMED; 18556790.
RA   Deboy R.T., Mongodin E.F., Fouts D.E., Tailford L.E., Khouri H.,
RA   Emerson J.B., Mohamoud Y., Watkins K., Henrissat B., Gilbert H.J.,
RA   Nelson K.E.;
RT   "Insights into plant cell wall degradation from the genome sequence of the
RT   soil bacterium Cellvibrio japonicus";
RL   J. Bacteriol. 190(15):5455-5463(2008).
XX
RN   [2]
RP   1-4576573
RA   DeBoy R.T., Mongodin E.F., Fouts D.E., Tailford L.E., Daugherty S.C.,
RA   Khouri H.M., Emerson J.B., Mohamoud Y., Watkins K.L., Henrissat B.,
RA   Gilbert H.J., Nelson K.E.;
RT   ;
RL   Submitted (24-JAN-2008) to the INSDC.
RL   J. Craig Venter Institute, 9712 Medical Center Dr, Rockville, MD 20850, USA
XX
DR   MD5; 1fb23ff66fadb8926076b4692994f5d3.
DR   BioSample; SAMN02603448.
DR   EnsemblGenomes-Gn; CJA_3844.
DR   EnsemblGenomes-Gn; CJA_3849.
DR   EnsemblGenomes-Gn; CJA_3854.
DR   EnsemblGenomes-Gn; CJA_3857.
DR   EnsemblGenomes-Gn; CJA_3859.
DR   EnsemblGenomes-Gn; CJA_3860.
DR   EnsemblGenomes-Gn; CJA_3861.
DR   EnsemblGenomes-Gn; CJA_3862.
DR   EnsemblGenomes-Gn; CJA_3863.
DR   EnsemblGenomes-Gn; CJA_3864.
DR   EnsemblGenomes-Gn; CJA_3865.
DR   EnsemblGenomes-Gn; CJA_3866.
DR   EnsemblGenomes-Gn; CJA_3867.
DR   EnsemblGenomes-Gn; CJA_3868.
DR   EnsemblGenomes-Gn; CJA_3870.
DR   EnsemblGenomes-Gn; CJA_3872.
DR   EnsemblGenomes-Gn; CJA_3881.
DR   EnsemblGenomes-Gn; CJA_3882.
DR   EnsemblGenomes-Gn; CJA_3883.
DR   EnsemblGenomes-Gn; CJA_3884.
DR   EnsemblGenomes-Gn; CJA_3885.
DR   EnsemblGenomes-Gn; CJA_3886.
DR   EnsemblGenomes-Gn; CJA_3888.
DR   EnsemblGenomes-Gn; CJA_3889.
DR   EnsemblGenomes-Gn; CJA_3890.
DR   EnsemblGenomes-Gn; CJA_3891.
DR   EnsemblGenomes-Gn; CJA_3892.
DR   EnsemblGenomes-Gn; CJA_3894.
DR   EnsemblGenomes-Gn; CJA_3895.
DR   EnsemblGenomes-Gn; CJA_3902.
DR   EnsemblGenomes-Gn; CJA_3903.
DR   EnsemblGenomes-Gn; CJA_3912.
DR   EnsemblGenomes-Gn; CJA_3913.
DR   EnsemblGenomes-Gn; CJA_3914.
DR   EnsemblGenomes-Gn; CJA_3915.
DR   EnsemblGenomes-Gn; CJA_3916.
DR   EnsemblGenomes-Gn; CJA_3917.
DR   EnsemblGenomes-Gn; CJA_3918.
DR   EnsemblGenomes-Gn; CJA_3919.
DR   EnsemblGenomes-Gn; CJA_3922.
DR   EnsemblGenomes-Gn; CJA_3923.
DR   EnsemblGenomes-Gn; CJA_3924.
DR   EnsemblGenomes-Gn; CJA_3931.
DR   EnsemblGenomes-Gn; CJA_3932.
DR   EnsemblGenomes-Gn; CJA_3933.
DR   EnsemblGenomes-Gn; CJA_3934.
DR   EnsemblGenomes-Gn; CJA_3935.
DR   EnsemblGenomes-Gn; CJA_3936.
DR   EnsemblGenomes-Gn; CJA_3937.
DR   EnsemblGenomes-Gn; CJA_3938.
DR   EnsemblGenomes-Gn; CJA_3944.
DR   EnsemblGenomes-Gn; CJA_3945.
DR   EnsemblGenomes-Gn; CJA_4117.
DR   EnsemblGenomes-Gn; CJA_4119.
DR   EnsemblGenomes-Gn; CJA_4122.
DR   EnsemblGenomes-Gn; CJA_4123.
DR   EnsemblGenomes-Gn; CJA_4133.
DR   EnsemblGenomes-Gn; CJA_4146.
DR   EnsemblGenomes-Gn; EBG00001016377.
DR   EnsemblGenomes-Gn; EBG00001016378.
DR   EnsemblGenomes-Gn; EBG00001016379.
DR   EnsemblGenomes-Gn; EBG00001016380.
DR   EnsemblGenomes-Gn; EBG00001016381.
DR   EnsemblGenomes-Gn; EBG00001016382.
DR   EnsemblGenomes-Gn; EBG00001016383.
DR   EnsemblGenomes-Gn; EBG00001016384.
DR   EnsemblGenomes-Gn; EBG00001016385.
DR   EnsemblGenomes-Gn; EBG00001016386.
DR   EnsemblGenomes-Gn; EBG00001016387.
DR   EnsemblGenomes-Gn; EBG00001016388.
DR   EnsemblGenomes-Gn; EBG00001016389.
DR   EnsemblGenomes-Gn; EBG00001016390.
DR   EnsemblGenomes-Gn; EBG00001016391.
DR   EnsemblGenomes-Gn; EBG00001016392.
DR   EnsemblGenomes-Gn; EBG00001016393.
DR   EnsemblGenomes-Gn; EBG00001016394.
DR   EnsemblGenomes-Gn; EBG00001016395.
DR   EnsemblGenomes-Gn; EBG00001016396.
DR   EnsemblGenomes-Gn; EBG00001016397.
DR   EnsemblGenomes-Gn; EBG00001016398.
DR   EnsemblGenomes-Gn; EBG00001016399.
DR   EnsemblGenomes-Gn; EBG00001016400.
DR   EnsemblGenomes-Gn; EBG00001016401.
DR   EnsemblGenomes-Gn; EBG00001016402.
DR   EnsemblGenomes-Gn; EBG00001016403.
DR   EnsemblGenomes-Gn; EBG00001016404.
DR   EnsemblGenomes-Gn; EBG00001016405.
DR   EnsemblGenomes-Gn; EBG00001016406.
DR   EnsemblGenomes-Gn; EBG00001016407.
DR   EnsemblGenomes-Gn; EBG00001016408.
DR   EnsemblGenomes-Gn; EBG00001016409.
DR   EnsemblGenomes-Gn; EBG00001016410.
DR   EnsemblGenomes-Gn; EBG00001016411.
DR   EnsemblGenomes-Gn; EBG00001016412.
DR   EnsemblGenomes-Gn; EBG00001016413.
DR   EnsemblGenomes-Gn; EBG00001016414.
DR   EnsemblGenomes-Gn; EBG00001016415.
DR   EnsemblGenomes-Gn; EBG00001016416.
DR   EnsemblGenomes-Gn; EBG00001016417.
DR   EnsemblGenomes-Gn; EBG00001016418.
DR   EnsemblGenomes-Gn; EBG00001016419.
DR   EnsemblGenomes-Gn; EBG00001016420.
DR   EnsemblGenomes-Gn; EBG00001016421.
DR   EnsemblGenomes-Gn; EBG00001016422.
DR   EnsemblGenomes-Gn; EBG00001016423.
DR   EnsemblGenomes-Gn; EBG00001016424.
DR   EnsemblGenomes-Gn; EBG00001016425.
DR   EnsemblGenomes-Gn; EBG00001016426.
DR   EnsemblGenomes-Gn; EBG00001016427.
DR   EnsemblGenomes-Gn; EBG00001016428.
DR   EnsemblGenomes-Gn; EBG00001016429.
DR   EnsemblGenomes-Gn; EBG00001016430.
DR   EnsemblGenomes-Gn; EBG00001016431.
DR   EnsemblGenomes-Gn; EBG00001016432.
DR   EnsemblGenomes-Gn; EBG00001016433.
DR   EnsemblGenomes-Gn; EBG00001016434.
DR   EnsemblGenomes-Gn; EBG00001016435.
DR   EnsemblGenomes-Gn; EBG00001016436.
DR   EnsemblGenomes-Gn; EBG00001016437.
DR   EnsemblGenomes-Gn; EBG00001016438.
DR   EnsemblGenomes-Gn; EBG00001016439.
DR   EnsemblGenomes-Gn; EBG00001016440.
DR   EnsemblGenomes-Tr; CJA_3844-1.
DR   EnsemblGenomes-Tr; CJA_3849-1.
DR   EnsemblGenomes-Tr; CJA_3854-1.
DR   EnsemblGenomes-Tr; CJA_3857-1.
DR   EnsemblGenomes-Tr; CJA_3859-1.
DR   EnsemblGenomes-Tr; CJA_3860-1.
DR   EnsemblGenomes-Tr; CJA_3861-1.
DR   EnsemblGenomes-Tr; CJA_3862-1.
DR   EnsemblGenomes-Tr; CJA_3863-1.
DR   EnsemblGenomes-Tr; CJA_3864-1.
DR   EnsemblGenomes-Tr; CJA_3865-1.
DR   EnsemblGenomes-Tr; CJA_3866-1.
DR   EnsemblGenomes-Tr; CJA_3867-1.
DR   EnsemblGenomes-Tr; CJA_3868-1.
DR   EnsemblGenomes-Tr; CJA_3870-1.
DR   EnsemblGenomes-Tr; CJA_3872-1.
DR   EnsemblGenomes-Tr; CJA_3881-1.
DR   EnsemblGenomes-Tr; CJA_3882-1.
DR   EnsemblGenomes-Tr; CJA_3883-1.
DR   EnsemblGenomes-Tr; CJA_3884-1.
DR   EnsemblGenomes-Tr; CJA_3885-1.
DR   EnsemblGenomes-Tr; CJA_3886-1.
DR   EnsemblGenomes-Tr; CJA_3888-1.
DR   EnsemblGenomes-Tr; CJA_3889-1.
DR   EnsemblGenomes-Tr; CJA_3890-1.
DR   EnsemblGenomes-Tr; CJA_3891-1.
DR   EnsemblGenomes-Tr; CJA_3892-1.
DR   EnsemblGenomes-Tr; CJA_3894-1.
DR   EnsemblGenomes-Tr; CJA_3895-1.
DR   EnsemblGenomes-Tr; CJA_3902-1.
DR   EnsemblGenomes-Tr; CJA_3903-1.
DR   EnsemblGenomes-Tr; CJA_3912-1.
DR   EnsemblGenomes-Tr; CJA_3913-1.
DR   EnsemblGenomes-Tr; CJA_3914-1.
DR   EnsemblGenomes-Tr; CJA_3915-1.
DR   EnsemblGenomes-Tr; CJA_3916-1.
DR   EnsemblGenomes-Tr; CJA_3917-1.
DR   EnsemblGenomes-Tr; CJA_3918-1.
DR   EnsemblGenomes-Tr; CJA_3919-1.
DR   EnsemblGenomes-Tr; CJA_3922-1.
DR   EnsemblGenomes-Tr; CJA_3923-1.
DR   EnsemblGenomes-Tr; CJA_3924-1.
DR   EnsemblGenomes-Tr; CJA_3931-1.
DR   EnsemblGenomes-Tr; CJA_3932-1.
DR   EnsemblGenomes-Tr; CJA_3933-1.
DR   EnsemblGenomes-Tr; CJA_3934-1.
DR   EnsemblGenomes-Tr; CJA_3935-1.
DR   EnsemblGenomes-Tr; CJA_3936-1.
DR   EnsemblGenomes-Tr; CJA_3937-1.
DR   EnsemblGenomes-Tr; CJA_3938-1.
DR   EnsemblGenomes-Tr; CJA_3944-1.
DR   EnsemblGenomes-Tr; CJA_3945-1.
DR   EnsemblGenomes-Tr; CJA_4117-1.
DR   EnsemblGenomes-Tr; CJA_4119-1.
DR   EnsemblGenomes-Tr; CJA_4122-1.
DR   EnsemblGenomes-Tr; CJA_4123-1.
DR   EnsemblGenomes-Tr; CJA_4133-1.
DR   EnsemblGenomes-Tr; CJA_4146-1.
DR   EnsemblGenomes-Tr; EBT00001542491.
DR   EnsemblGenomes-Tr; EBT00001542492.
DR   EnsemblGenomes-Tr; EBT00001542493.
DR   EnsemblGenomes-Tr; EBT00001542494.
DR   EnsemblGenomes-Tr; EBT00001542495.
DR   EnsemblGenomes-Tr; EBT00001542496.
DR   EnsemblGenomes-Tr; EBT00001542497.
DR   EnsemblGenomes-Tr; EBT00001542498.
DR   EnsemblGenomes-Tr; EBT00001542499.
DR   EnsemblGenomes-Tr; EBT00001542500.
DR   EnsemblGenomes-Tr; EBT00001542501.
DR   EnsemblGenomes-Tr; EBT00001542502.
DR   EnsemblGenomes-Tr; EBT00001542503.
DR   EnsemblGenomes-Tr; EBT00001542504.
DR   EnsemblGenomes-Tr; EBT00001542505.
DR   EnsemblGenomes-Tr; EBT00001542506.
DR   EnsemblGenomes-Tr; EBT00001542507.
DR   EnsemblGenomes-Tr; EBT00001542508.
DR   EnsemblGenomes-Tr; EBT00001542509.
DR   EnsemblGenomes-Tr; EBT00001542510.
DR   EnsemblGenomes-Tr; EBT00001542511.
DR   EnsemblGenomes-Tr; EBT00001542512.
DR   EnsemblGenomes-Tr; EBT00001542513.
DR   EnsemblGenomes-Tr; EBT00001542514.
DR   EnsemblGenomes-Tr; EBT00001542515.
DR   EnsemblGenomes-Tr; EBT00001542516.
DR   EnsemblGenomes-Tr; EBT00001542517.
DR   EnsemblGenomes-Tr; EBT00001542518.
DR   EnsemblGenomes-Tr; EBT00001542519.
DR   EnsemblGenomes-Tr; EBT00001542520.
DR   EnsemblGenomes-Tr; EBT00001542521.
DR   EnsemblGenomes-Tr; EBT00001542522.
DR   EnsemblGenomes-Tr; EBT00001542523.
DR   EnsemblGenomes-Tr; EBT00001542524.
DR   EnsemblGenomes-Tr; EBT00001542525.
DR   EnsemblGenomes-Tr; EBT00001542526.
DR   EnsemblGenomes-Tr; EBT00001542527.
DR   EnsemblGenomes-Tr; EBT00001542528.
DR   EnsemblGenomes-Tr; EBT00001542529.
DR   EnsemblGenomes-Tr; EBT00001542530.
DR   EnsemblGenomes-Tr; EBT00001542531.
DR   EnsemblGenomes-Tr; EBT00001542532.
DR   EnsemblGenomes-Tr; EBT00001542533.
DR   EnsemblGenomes-Tr; EBT00001542534.
DR   EnsemblGenomes-Tr; EBT00001542535.
DR   EnsemblGenomes-Tr; EBT00001542536.
DR   EnsemblGenomes-Tr; EBT00001542537.
DR   EnsemblGenomes-Tr; EBT00001542538.
DR   EnsemblGenomes-Tr; EBT00001542539.
DR   EnsemblGenomes-Tr; EBT00001542540.
DR   EnsemblGenomes-Tr; EBT00001542541.
DR   EnsemblGenomes-Tr; EBT00001542542.
DR   EnsemblGenomes-Tr; EBT00001542543.
DR   EnsemblGenomes-Tr; EBT00001542544.
DR   EnsemblGenomes-Tr; EBT00001542545.
DR   EnsemblGenomes-Tr; EBT00001542546.
DR   EnsemblGenomes-Tr; EBT00001542547.
DR   EnsemblGenomes-Tr; EBT00001542548.
DR   EnsemblGenomes-Tr; EBT00001542549.
DR   EnsemblGenomes-Tr; EBT00001542550.
DR   EnsemblGenomes-Tr; EBT00001542551.
DR   EnsemblGenomes-Tr; EBT00001542552.
DR   EnsemblGenomes-Tr; EBT00001542553.
DR   EnsemblGenomes-Tr; EBT00001542554.
DR   EuropePMC; PMC2493263; 18556790.
DR   EuropePMC; PMC2650518; 19064894.
DR   EuropePMC; PMC5536142; 28798934.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01999; group-II-D1D4-2.
DR   RFAM; RF02084; STnc130.
DR   SILVA-LSU; CP000934.
DR   SILVA-SSU; CP000934.
DR   StrainInfo; 344762; 1.
XX
CC   Bacteria available from The National Collection of Industrial,
CC   Marine and Food Bacteria (NCIMB) at ww.ncimb.co.uk/index.php
CC   accession number 10462.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4576573
FT                   /organism="Cellvibrio japonicus Ueda107"
FT                   /strain="Ueda107"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:498211"
FT   gene            1..1605
FT                   /gene="dnaA"
FT                   /locus_tag="CJA_0001"
FT   CDS_pept        1..1605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="CJA_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="identified by match to protein family HMM PF00308;
FT                   match to protein family HMM TIGR00362"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82876"
FT                   /db_xref="GOA:B3PEM2"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:B3PEM2"
FT                   /protein_id="ACE82876.1"
FT                   /translation="MVVLPQSVWRLCAASLQDELPSQQFNTWIRPLQIDESAGPDQLRL
FT                   LAPNRFICDWVAEKFLQRIRELVSHYQQGCMLQVAVAVLPRTGLIPPQFPPPVRQSPAV
FT                   MPSRQIDVPSFTEALNTGSDTYIPRAAGRQDVSAPELEAAVQYAAETVVDNAANARDSG
FT                   SVLRASPVFNEEPPESATLRTGDVEVEGGLKHSNYLNSACTFATFVEGKSNQLGLAAAR
FT                   QVAENPGGAYNPLFIYGGVGLGKTHLMQAVGNAMVARNPNAKVVYLHSERFVADMVKAL
FT                   QLNAINDFKRYYRSMDALLIDDIQFFAGKERSQEEFFHTFNSLLEGGRQIILTCDRFPK
FT                   EINGLEERLKSRFGWGLTVAVEPPELETRVAILIKKAEQANIDLPHEAAFFIAQRIRAN
FT                   VRDLEGALKRVIASANFTGRSIDVELVREALKDLLALQDKQVGIDNIQRVVCEYYKIKM
FT                   NDMISKRRSRSVARPRQVAMALAKELTNHSLPEIGEAFGGRDHTTVLHACRKIKELQEE
FT                   TADIREDMKNLLRSLTT"
FT   gene            1676..2779
FT                   /gene="dnaN"
FT                   /locus_tag="CJA_0002"
FT   CDS_pept        1676..2779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="CJA_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00712;
FT                   match to protein family HMM PF02767; match to protein
FT                   family HMM PF02768; match to protein family HMM TIGR00663"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACE86135"
FT                   /db_xref="GOA:B3PEM3"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:B3PEM3"
FT                   /protein_id="ACE86135.1"
FT                   /translation="MKFAVSREALLKPLQLVAGVVERRQTLPVLSNVLIQLEGDQLSLT
FT                   GTDLEVEIIGRLTLEQAGQSGEITVPARKLVDICRSLPDGSTIEFFLEENRILVKSGRS
FT                   RFTLSTLPASDFPNVEDAPGNLRFSCAQAEVKRLIERTAFAMAQQDVRYYLNGMLWEVR
FT                   QDHLRVVATDGHRMAMCTRAIAVNTDDVVQAILPRKGVLELSRLLDDSSAQVEVVLSAN
FT                   HIRVTSVDYTFTSKLVDGKFPEYERVLPRGGNKVVIGSRLELKQAFARTAILSNEKYRG
FT                   VRLLLSNGVLTIVANNPEQEEAEEQVTVDYTGESLEIGFNVSYLQDVANVISNENIKIT
FT                   LLDANSSALLEEPENSDSLYVVMPMRL"
FT   gene            2813..3910
FT                   /gene="recF"
FT                   /locus_tag="CJA_0003"
FT   CDS_pept        2813..3910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="CJA_0003"
FT                   /product="RecF protein"
FT                   /note="identified by match to protein family HMM PF02463;
FT                   match to protein family HMM TIGR00611"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84963"
FT                   /db_xref="GOA:B3PEM4"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PEM4"
FT                   /protein_id="ACE84963.1"
FT                   /translation="MSLARLRVHHLRNLESVDIEPSSRVNLIYGLNGSGKTSLLEAINV
FT                   LALGRSFRSHKHKPLISHQQLAFTIFGRVLADDAAEIPIGIQRNQQGEVMLKANGANVG
FT                   SIADLAIFLPVQVINSDTFLLLEGSPKVRRQFMDWLVFHVEHQFYPQWKSLQRCLKHRN
FT                   SLLRRDRIDPFELSTWDQELVQLTEQIHCFREQCMALFVPVFEQLLQEFVVLEGLELHY
FT                   QRGWDKHKDYAQVLQDSFERDKRLGVTHAGSHRAELRITLNGQDAAEILSRGQQKLLVC
FT                   ALKIAQGLVFSQVTGRKCIYLVDDLPAELDEQHRQRLVDWLYRMDTQVFITGVERQALL
FT                   AGWLDKPEITPKMFHVEHGRVSCPA"
FT   gene            3980..6400
FT                   /gene="gyrB"
FT                   /locus_tag="CJA_0004"
FT   CDS_pept        3980..6400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="CJA_0004"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="identified by match to protein family HMM PF00204;
FT                   match to protein family HMM PF00986; match to protein
FT                   family HMM PF01751; match to protein family HMM PF02518;
FT                   match to protein family HMM TIGR01059"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84304"
FT                   /db_xref="GOA:B3PEM5"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:B3PEM5"
FT                   /protein_id="ACE84304.1"
FT                   /translation="MSEENNYDSSSIKVLKGLDAVRKRPGMYIGDTDDGSGLHHMVFEV
FT                   VDNSIDEALAGYCTEVRVTIHPDETVSVSDNGRGIPVDMHEEGVSAAEVIMTVLHAGGK
FT                   FDDNTYKVSGGLHGVGVSVVNALSEYLKLTIRRAGKIHEQIYCHGVPDAPLTVVGDSVT
FT                   TGTEIHFKPSAETFTNIEFQYDILAKRLRELSFLNSGVRIVLKDERSGKEEIYQYEGGL
FT                   KAFVEHLNKNKTTINKMVHFVASGREDGIGVEVALQWNDSFQENLFCYTNNIPQRDGGT
FT                   HLAGFRAALTRLLNTYIEKEGIGKNAKVATTGDDAREGLTAIISVKVPDPKFSSQTKDK
FT                   LVSSEVKTAVEQEMAEHFSSYLLENPNDAKAVVGKMIDAARAREAARKAREMTRRKGAL
FT                   DIAGLPGKLADCQEKDPALSELYLVEGDSAGGSAKQGRARKTQAILPLKGKILNVEKAR
FT                   FDKMLSSAEVGTLITALGCGIGKEDYNPEKLRYHSIIIMTDADVDGSHIRTLLLTFFFR
FT                   QMRELIERGHIYIAQPPLYKIAKGKQEQYLKDEAAMTEFLTQAALDGSSLHVNLTAPGI
FT                   SGEALEKLVQQYRKVMATIERLSRLYPADVLEKMIYMPSLRAEHLADQGHIQQWCDQLL
FT                   ARFSLDARDGSQKYIISVREDQERHLFLPEVEIIAHGISTHYPFNHDFFASGEYAQIVA
FT                   LGEELETLIEEGAYVQRGERKQTIASFAEGLEWLMKESRKGYNIQRYKGLGEMNPEQLW
FT                   ETTMNPETRRMLRVTIQDAITADQIFTTLMGDQVEPRRDFIETNALAVANLDV"
FT   gene            6530..6703
FT                   /locus_tag="CJA_0005"
FT   CDS_pept        6530..6703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0005"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85129"
FT                   /db_xref="UniProtKB/TrEMBL:B3PEM6"
FT                   /protein_id="ACE85129.1"
FT                   /translation="MSEKRVTKVLLSQLEDVLEERDGDDRRKRDRGLPAHVNEDRRKGD
FT                   RRAASKDEKPKA"
FT   gene            complement(6857..9640)
FT                   /gene="amy13G"
FT                   /locus_tag="CJA_0006"
FT   CDS_pept        complement(6857..9640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amy13G"
FT                   /locus_tag="CJA_0006"
FT                   /product="alpha-amylase, putative, amy13G"
FT                   /EC_number="3.2.1.1"
FT                   /note="identified by match to protein family HMM PF00128"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACE86338"
FT                   /db_xref="GOA:B3PEM7"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B3PEM7"
FT                   /protein_id="ACE86338.1"
FT                   /translation="MKTFLKLAILAALWLSQGVYADWYFRGTPNNWATTAMTATSSTQF
FT                   TTCQTFGAASTNPRFKIDRLGDWSESYPSADYTVTANQSYNIQFNSSTKAISIQAVSNC
FT                   DSIGFTQNFASLYFRGTPNSWGTTAMALVANNTWTVQVTFDGQANQRFKFDVTGNWATN
FT                   YGDSNNDGVLNQNGSDIYTSLVGTYQVQVNDATLAYSLTPVTANSSSSSSTLSSSSSSQ
FT                   VSSSSSSTAADSWYFRGTPNNWGSTAMALDNGLYCTQQTFGAASTNPRFKIDHYANWTE
FT                   SYPSSDYLVSADTSYKICFNAGTKAITLTNLTSSSASSSSSSSQASSATSSVISGDFRS
FT                   ETIYFLLTARFYDGDANNNYYNRDRYKAGDPHWRGDFKGLIEKLDYIKDLGFTAIWVTP
FT                   PVENRSGLDYHGYHAYDFYKVDPRLESPGAGYQEFINAAHAKGLKVIQDVVINHSSQYG
FT                   LRGQVWIDHLPIKYYVPAGGTQGQVVNGPYLGNLGDYKSEFRDDNDNPVAPAWFRERHT
FT                   SDAAGTVPLVDPKTGATVPQAGYNPNRFFGIDATTLDPNWYHQDGFMSGGDWESPLALQ
FT                   KKHMAGDCIDLATGRQNVKDYLNGAIRMYLDMGVDAIRIDTVKHVERNELLTYVNNWKA
FT                   HKPGLFVFGENLVKGTGFGSEIASDNASAVIRPWWYTRTTSDPANPNGGGDSGFSVLDF
FT                   SVFSTFRDNVTRGHFGGIGGVLAMDWVYGDATQLVTFFQNHDVGPDNDFKYRYGGAQGN
FT                   AAMAYNLLWTNRGIPTLYYGEEIMFQGGLPQDIAGNNDTIDQTGRAYFGPHLDNLATTQ
FT                   AHPLYQHIKRLNQIRKAVPALQKAPTTQVNEWGAGMSFVRDLYSQGSYAVVGLASSSDQ
FT                   SVSVSGVRNGTYRDAVTGNTVTVNNGTLSFTVKAYSAGIYVLNGPGKIGVDGSFLR"
FT   gene            10299..12284
FT                   /gene="cbp2A"
FT                   /locus_tag="CJA_0007"
FT   CDS_pept        10299..12284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbp2A"
FT                   /locus_tag="CJA_0007"
FT                   /product="carbohydrate binding protein, cbp2A"
FT                   /note="identified by match to protein family HMM PF00553;
FT                   match to protein family HMM PF00801"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83535"
FT                   /db_xref="GOA:B3PEM8"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:B3PEM8"
FT                   /protein_id="ACE83535.1"
FT                   /translation="MSLHRPCLGSLSLSGLSLALCLGIASASYASSSAVSTSAQNSSVA
FT                   VSSSPASQSASSNPNGSSSRPGSSSGYCGYSSVSSSGQTSSAQAYALTCTLNVTNSWNS
FT                   AYQASVIVKNNSATPVEGWKLAVENPGISLGSAWNVQHLETTANSVTFGNLGWNGLVAP
FT                   GGTVEFGAIFNHSGSGQPQPVCRIIPPGVVSSSPAANQPPVADFATTVKGASVHVLTIN
FT                   AHDPDGDNLRYLVDFGDGTRIAYPDAWHTYKTPGTYTITQTVGDGQLSHVQTREVTVGE
FT                   PGANRAPVAIFSHYGYGSQVSVNGGGSADIDGDSLTYTWDFGSGPLVGNQRSSGTVVNG
FT                   LVTLTVFDGELGDTRQETAGTLPCTYYDPRPLPDFTYRIEGATVYLDASNSRIVDSFRW
FT                   DFGDGTVGTGTYTSHTYAEPGAYTIELYANGGMMSNRVSQVIQIEAGDNGGENLPPVAA
FT                   LSCTEQLVIGDDFENGIAYYTYTTRCSAAGSSDPENSPLSYRIDWGDGSSSPVSTNTNF
FT                   AHNYTESGYYTITLHVSDGVNTSSKTLDWQASRSYSTGPQPEPGPTRCEFKITSSWNSG
FT                   FTGWLRVYNDSNAPVSGWEAEITLAANQQISSSWNGTLSGASPVKVSSVAWNATINPGS
FT                   FAEVGFQILSSNNPHPVPHLGGQSCL"
FT   gene            complement(12342..13754)
FT                   /locus_tag="CJA_0008"
FT   CDS_pept        complement(12342..13754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0008"
FT                   /product="transcriptional regulatory protein"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF00158; match to protein
FT                   family HMM PF00785; match to protein family HMM PF02954;
FT                   match to protein family HMM TIGR00229; match to protein
FT                   family HMM TIGR01199"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83818"
FT                   /db_xref="GOA:B3PEM9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B3PEM9"
FT                   /protein_id="ACE83818.1"
FT                   /translation="MDAEGRATFVNPAAERILGWKAEALIGHNIHLAIHHSHTDGSDYC
FT                   VQDCPIFAAFRDGSVRRVDDEVFWCRDGHPVPVEYTSTPVYDQGKLVGAVVIFRDVSER
FT                   KSAETRLRSTMEELRQALEQVEHLKHKLELENAYLQQEISEGFNSHHIVGRSPAVQQIN
FT                   YQIQLVAPTVATALITGESGTGKELIARAIHRASERNQRPLIRVNCAAIPPELFESEFF
FT                   GHVRGAFSGAVSARLGRFEVADGGTLFLDEIGELPLALQGKLLRVLQDGEFERVGESIT
FT                   RKVDVRVIAATNRDLKQRVEQGLFREDLYFRLNVFPIRSAPLRERLEDIPLLVTHFLKA
FT                   TCQRFHKPELKISLAQIQRLQEYHWPGNIRELENRIERQVIVSQGDKLILDDLPSPASH
FT                   IEHPGQSSAPCLTEQDCRQVQYQATVDALRKTGGKIYGEEGAAQLLGIKPTTLASRLKK
FT                   WGIGKQVFSAQG"
FT   gene            14174..15616
FT                   /gene="nrtA"
FT                   /locus_tag="CJA_0009"
FT   CDS_pept        14174..15616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrtA"
FT                   /locus_tag="CJA_0009"
FT                   /product="ABC transporter nitrate-binding protein"
FT                   /note="identified by match to protein family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85431"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:B3PEN0"
FT                   /protein_id="ACE85431.1"
FT                   /translation="MSNKSLGDPYQSEVSLIHSKRCRCDSCRFAGDERTYSQALEQQAD
FT                   QSSTHRESNAHPCEFQSAEEVMDRAIENTIVRAVFGQDDHSRRRFIRAVGGGTLAAALS
FT                   SVLPMGAIKAAAKEAGGPLEKKKLNVGFVPITCATPIIMAHPMGFYAKHGLEVEVIKTA
FT                   GWAVARDKSLAGEYDASHMLTPMPLAMSLGIGSTAKNFIMPAVENINGQAIVLHVDHKD
FT                   KRDPKQWKGFKFGVPFEYSMHNFLLRYYVAEHGLDPDKDIQIRVVPPPEMVANLRAGNL
FT                   DGYLSPDPFNQRAVWEKVGFIHTLTKDLWDGHPCCAFACSQEFALTHPNTYGALLKSIV
FT                   EATHYSSKTENRKDIAAAIAPANYLNQPVPVIEQVLLGRYADGLGEVKHVPDRIDFDPF
FT                   PWHSMAVWILTQMKRWGYIKGNVDYQTIARQVYLASDCEKVLKELGYPVPSGTNKNYFI
FT                   MGKEFDVTKPDDYINSFTIRRT"
FT   gene            15619..16446
FT                   /locus_tag="CJA_0010"
FT   CDS_pept        15619..16446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0010"
FT                   /product="possible nitrate transport system permease
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR01183"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84189"
FT                   /db_xref="GOA:B3PEN1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005889"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B3PEN1"
FT                   /protein_id="ACE84189.1"
FT                   /translation="MHSLNLRALLLSISLLVVVLGIWEIAVQPPAVSEAQSEYELLMGG
FT                   AAQEARVPPPSAIIQRAWEQLSNPFYDAGPNDKGIGIQLGYSIYRVLTGFSLALFIAIP
FT                   VGFLIGMSPLMYRALNPYIQVLRPISPLAWMPLALFIIKDSETSAIFVIFICSIWPMLL
FT                   NTAFGVANVREDWINVARTHELSPLRTAFTVILPAAAPTILTGMRISIGIAWLVIVAAE
FT                   MLVGGTGIGYYVWNEWNNLDLTSVIFSILMIGLVGMLLDLALTAVTRLVQYEE"
FT   gene            16451..17368
FT                   /gene="nrtC"
FT                   /locus_tag="CJA_0011"
FT   CDS_pept        16451..17368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrtC"
FT                   /locus_tag="CJA_0011"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM TIGR01184"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83153"
FT                   /db_xref="GOA:B3PEN2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005890"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3PEN2"
FT                   /protein_id="ACE83153.1"
FT                   /translation="MGQSFLQVQQLAKRFVSKSETLTVFENANFTLEKGEFVCIIGHSG
FT                   CGKSTIMNTLAGLDTPSEGVVIMDGREVSGPSLERGVVFQNYSLLPWLSALDNVIFGVR
FT                   ARWPQWSNAQIHQHSLRYLQMVGLKGVEQRKPAQLSGGMRQRVSIARAFATQPKLLLLD
FT                   EPFGALDALTRGVIQDELMNICAETRQTVFMITHDIDEAILLADRILLMSNGPGAVIAE
FT                   SVVVDLPRPRQRADIIHHPGYYQIRNHLVDFLVTRSKNLRTADNTAFPQTVNPIHMEFT
FT                   APDVKTTGEQEGAKPAPSIHVVNA"
FT   gene            17380..17820
FT                   /gene="cynS"
FT                   /locus_tag="CJA_0012"
FT   CDS_pept        17380..17820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cynS"
FT                   /locus_tag="CJA_0012"
FT                   /product="cyanate hydratase"
FT                   /EC_number="4.2.1.104"
FT                   /note="identified by match to protein family HMM PF02560;
FT                   match to protein family HMM TIGR00673"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82696"
FT                   /db_xref="GOA:B3PEN3"
FT                   /db_xref="InterPro:IPR003712"
FT                   /db_xref="InterPro:IPR008076"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR036581"
FT                   /db_xref="UniProtKB/TrEMBL:B3PEN3"
FT                   /protein_id="ACE82696.1"
FT                   /translation="MKKQDVVEAIVIAKQKMNLTWEGVAASIGMSPVWTTSVCLGMNSA
FT                   PADKAEALCKVFDLPETAKAALMQCPSKSWEHTIPQDPLIYRLYEMIGVYGPTMKAIIH
FT                   EKFGDGIMSAIDFSMEIGKEENPKGDRVIINLNGKFLPYKAW"
FT   gene            17829..18284
FT                   /locus_tag="CJA_0013"
FT   CDS_pept        17829..18284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0013"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07080"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85894"
FT                   /db_xref="InterPro:IPR009783"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:B3PEN4"
FT                   /protein_id="ACE85894.1"
FT                   /translation="MTTPTPTGVVDLAAVDPKPPLPPFTEATARQKVQAAEDAWNSRDP
FT                   ERVALAYTPDSEWRNHDQFFTGRTAIVNFLRAKWQKEQGYRLRKSLWAFTDNRIAVRFE
FT                   YEWHDHTGQWFRSYGNEMWEFAENGLMQRRFASINDVVIGKEDRRII"
FT   gene            18486..19334
FT                   /locus_tag="CJA_0014"
FT   CDS_pept        18486..19334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0014"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85260"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B3PEN5"
FT                   /protein_id="ACE85260.1"
FT                   /translation="MATRNLICDWSRAVLGLVLFSLCYVAQADQMPEPQAECAASPEYL
FT                   SKFERFFKSRGVSHDYSCLTDFPTISKNLKRYQLVDIRTNPVIPLKDSWNISVDELKLK
FT                   DFLANRPLLLLDEGFSRVQQASICTTLKQAGFTSVKILVGGIPQWYNATHRKTAQRNQF
FT                   VSAKDVVYEYFNGRILLVAATAAISRQLEELGFDEHKTLETNKFSELSNIVVSSSNGGY
FT                   DPVVYLGTKDDLNALDINQYLPNLYILNDGPKALLSQLRHNKLIDYARNAPQEVNFCAQ
FT                   K"
FT   gene            19321..20169
FT                   /locus_tag="CJA_0015"
FT   CDS_pept        19321..20169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0015"
FT                   /product="transglutaminase-like superfamily protein"
FT                   /note="identified by match to protein family HMM PF01841"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83677"
FT                   /db_xref="GOA:B3PEN6"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B3PEN6"
FT                   /protein_id="ACE83677.1"
FT                   /translation="MRKNNYVIICLILIFFTGLYFFLDKEPYVSTQKLLRFNYAVKNDS
FT                   GKPINDYQFTAVIPMEIKGIQTIKSIKSSHEYQLVNNSGRQSVYFLIENFSPFSTKIID
FT                   LTLALDLTDKPDTESGNINDYLQSQQYIETEASEIKDLAFQLKGKTSTETARNIYDWLV
FT                   NNITEANYTADSKGAIYLIKNKKGDCTEFMYGFVALARANGIPARGISGFWVPNQSTLI
FT                   NAADYHDWAEFYDGKKWVLVDVINRKFGNSAGDYIALNIVDENQFQRFYSNSSQIHLMT
FT                   N"
FT   gene            20181..32762
FT                   /locus_tag="CJA_0016"
FT   CDS_pept        20181..32762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0016"
FT                   /product="Fibronectin type III domain protein"
FT                   /note="identified by match to protein family HMM PF00041;
FT                   match to protein family HMM PF00652"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83092"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:B3PEN7"
FT                   /protein_id="ACE83092.1"
FT                   /translation="MTLMRNIKFAFLEGKTNKIYLWSFFLLGLLANKAHSQQELDGWIV
FT                   IDQPTTINASDTTYHGQSILVDGTTLTISGSHVFSNIRIKNNGVLTTPVASSTSTQGIV
FT                   LEATSVVIEEGSSIDVSGKGRTADSGSGTYTGGSYGGKGGDYSSTQKALEPFGSYQEPI
FT                   DFGRGGQGTNAGRGGGALKLIADSVQLDGKILANGATATSYGGGGSGGSIWLDVGSLVS
FT                   SGTGEITARGGSHRSGYSGGGGGGGRIAIYYNNKSGLPDTKVTAFGGTGSSYHGGPGSV
FT                   YLKDKTGTVVHPFVITGTGSGTNYPVTTFRDLGNETHIQIHNASVSLRDIDPSVRLDIT
FT                   DSNVILEDTVFPGQLNAQNSVLNFAGDAVINNAQLGLVNSTINIAGNAQFNHAISLESG
FT                   TINITGNAEFTDTFVGTGAATSVINVNGQLTVPHNNLVVDSLTLSLAQNHSFNSIHIKN
FT                   NSVLTTPVASSTFTQGIILEATSIVIEEGSSIDVSGKGRTANSSSGNYAGGSYGGKGGD
FT                   YSSTQKALEPFGSYREPIDFGFGGRNGGLGGGALKLIADNMQLDGKILANGNDASSTGG
FT                   GGSGGSIWLDVGSLVSSGTGEVAAGGGSRRPSHSGGGGGGGRIAIYYNNKSGLLDTKVT
FT                   AFGGTGSSYHGGPGSVYLKDKTGTVVHPFVITGTGSGANYPITTFRDLGNETHIHIHNA
FT                   SVSLQDIDPSVRLDITNSQVTLADTDTLTGQLNAQNSVLNFAGDAVISNTQLGLVNSTV
FT                   NIAGNARFDRIISLQGGAINVTGHAEFTDTFVGTGAATSVINVNGQLTVPHNNLVVDSL
FT                   TLSLAQSHIFNSIHIKNNGVLTTPVASSTFTQGIILEAASVVIEEGSSIDVSGKGRAAD
FT                   PASGSYTGGSYGGKGGDYSSTYKALESFGSYREPIDFGFGGRNGGLGGGALKLIADSVQ
FT                   LDGKILANGVTATSHGGGGSGGSIWLDVGSLVSSDTGEIAADGGSHRPGYSGAGGGGGR
FT                   IAIYYTSKTGLLDTKVTASGGSGSGSTDSAYHGGPGSVYLKDKTGTVVHPFVITGNGSG
FT                   TNYPITTFRDLGNETHIHIHNASVSLRDIDPSVRLDITNSQVTLADTDTLTGQLNVQNS
FT                   VLNFAGDAVINNAQLGLVNSTINIAGNAQFNRAISLQGGAINVAGNAEFTDAVVGTGAD
FT                   TSFISIHGQLTVPNNDLVVDGITLSLAQSHSFNSIHIKNNGVLTTPVASSTFTQGITLT
FT                   ATTVIVEEGSSIDVSGKGRVADPASGSYTGGSYGGKGGDYSSTYKALESFGSYQSPTDF
FT                   GLGGNNGGRGGGALKLIADSMQLDGKILANGVTATSHGGGGSGGSIWLDVGSLVSSGAG
FT                   EITARGGSRRSGYSGGGGGGGRIAIYYTSKTGLLDTKVTASGGSGSGSTDSAYHGGSGS
FT                   VYLKDKTGTVVHPFVITGTGSGANYPITTFRDLGNETHIHIHNASVSLQDIDSSVRLDI
FT                   TNSQVTLADADTLTGQLNAQNSVLNFAGDAVINNAQLGLVNSTINIAGNAQFNRAISLQ
FT                   GGAINVNGNAEFTDTFVGTGAATSVINVNGQLTVPHNDLVVDGITLSLAQNHSFNSIHI
FT                   KNNSVLTTPVASSTFTEGIILEAASVVIEDGSSIDVSGKGRTADSGSGTYTGGSYGGKG
FT                   GDYSSTHKALEPFGSYQEPTDFGRGGQGTNGGLGGGALKLIAANVQLDGKILANGNDAS
FT                   NVGGGGSGGSIWLDVGSLVSSGTGEITARGGSRRAGYSGSGGGGGRIAIYYEVLSGITD
FT                   TKIVVSGGSGTNNGQPGTIYKQQTEAPPYVYATSLSAVTNQPIHEIRVDFSVPIDSSSL
FT                   TVDDVLVTDESNLVYYPVNITAHSDKSFTFTFAQAFSNGRYTLKVGPDIISVLGNNLDQ
FT                   NRNGISEGEIDAYFFNFEIDIDAPIAVTIDQLVAPNVNKTNTTQFTVSGAREADTSVWI
FT                   NNIQVIPIGSTNWSHTLVLPQGVTNLSVIAKDAAANTSPEVQLIVEVDSIAPSVNTVTP
FT                   SANTYLAIAPEFIRINVTENGSGIDGANSTIVVQQNNVPVGGGAQLNAKQFTWEPLTPM
FT                   SEGTYQVTSNILDYFGNASSHTYSFTIDQTPPAATQLDEYPSETSISTHTFKGTKEAYA
FT                   QVLLNGQVIISATSSTSWSYTKTLSGGANRLEFVVRDRAGNHSEPVIANIMYDNIPPGA
FT                   VPISVLNTGEGRELTISWILYNEILNGNDIANYRIYFSSNAFTHIDDAALIKEVPAGYT
FT                   ATTITGLTPGNIYYFAVVAVDKSNLFIPQVTAVAGQPIDTRAPEEITNLQVFAGLDQLE
FT                   IRWTPSLNKSGDLASYLVSYLGDGEIQTTTLNQSDIGDANPVTYTIADLQPATAHNLRI
FT                   SVVDQTGNISSGVTNPAITLLPNPSNITAEPGVESAKISWTPVPAYSLIKHYAIYISEN
FT                   AFTSVAGMTPRKIVNKGTSGQTTIETLVNGLVNGAAVYVAVTAVNNSNGEFKEVIPVTV
FT                   TPQSDTEGPTINSAEYISSVSIKSLDSNPVLDYSGTFAIQATDKSKISRVVFTLNHEPL
FT                   GNVLITNTQGAYVQALDVLSLTDSTYTLSVDVYDTYENVTSREYPFSLDLAPPALPTIV
FT                   SPAKNTTLNQASAQLTGKSAVGTEVIIALNGVDITDVISVDSNGDYSVSLDLVEGLNTL
FT                   SAKARYINRDKWSAYSPAHSVTVNTQIPDSPKGFSVTSAKQGQVYLQWHAVVSSDPNNQ
FT                   VKGYNIYRADTAFTEKTDTGVTRINNQWVTATSFSNLVAIDGNYFYAVSAVNQANNESA
FT                   LSTVISAIVDSAGPKITQLSFTPEGEFDAESQTYGRGMVNITATFDEPLRNAPYFAVVP
FT                   EAGLPLSIDLVKSYTNDTLYTGKFEITESTGSGIAYAVMSAFDKLGNRGTDIEQGGTLN
FT                   IDTQGPDITQLAISPVEPLKIDSSTGLQVNVSIRLREVIKSGTQVKLVPLVNGLPLVGY
FT                   SDGISLMADTDGLSFSGEFTLPNTVAMSSVGQLGFSHAAVDDLNNLSTRIHGQNQFQVY
FT                   QGDLPPLDIPGNLSVTALPGGKIKLHWRAVDKASAYVIYRQGPMDSELVALPQVTATEF
FT                   EDQTLVDGTYLYAVASIRHDNGQEAESSPSQSVSVRSDRVAPAKPDNLTLELNGAGIVA
FT                   RWLAPMVDAEGTNQSQQGLTYNLYRTSLAQGVEVSDPSIYTPIQTRIPALIALDTKPAD
FT                   DQHSYFVTAIDAAGNESVPSATAYLNAGLLPVNQLYITLDNNGYPQLAWQHQGSGVKRY
FT                   RVLRKTGDTEAELLTPDGIVHSSTNTSYTDNTYNNNQASQGAGQEVIYSVIAVDENQVE
FT                   SAPHELRLPALSATLERNKAVLLERGVMNQLWFRIGNKGTRKAESIRLYVTLVENGQVR
FT                   EHISEVFDVDGGASQLVPVVVGGYDKLDAMTNLSLRLEQKPQTNQRIRINQLESVDVGS
FT                   SNLTLDMNTENFTRGGSGKVSFNLTNTSDVETELVMATNNSKADSTDIRLILEDVNGNL
FT                   LTQKAIRQTTGGVINVSSGHTVARVEPKTLFTSQEFTINIPAAAPDQVRLRLVVDKYHY
FT                   QLGKENHVEISAIGISKDIQLNDTPYFAVVTDVQPATVNAKNGAVTISGRAVDRVTNEP
FT                   IANVPVSIITTVRGFERIGTVYSDSSGNFVFSYKPDGTAGKYRISAVHPEMTDRPNQGE
FT                   FIAEGGAVSPLDIDMEAPRNYLQKINLRIRADQETNLTNVRLVQLPNGQQQVAELPAGV
FT                   SVTYQPLVSVSANTAKDLVLTFTGNNEAADIGLITYRVEADNHLGANALGTVNIAYKLS
FT                   PAAPAVSTKPAFIDTGVGLDQTVYEDVIVTNSGLDTLRNAQVELIANNGTPVPDWVRVS
FT                   TANTLGDIPVGESRQVQIVAEPKVGISDGIYEFKLKIQGANLTAYTLPVFIKVTQSGKG
FT                   NAFFKISDIYTATLDNNNQIIEGVNKARIQLQNENVPSEVYNLNTDAKGEVLFEQIPAG
FT                   RYAYRASANDHNSVSGRIWVKPDITSSEKVFLMNNLVNVEWSVREITVEDRYEIKLEAT
FT                   FKTNVPAPVVILSPMSVNLPVMKKGQVFQGEFTLTNHGLIRAYNLKEGLPITNDLVRFE
FT                   FLKEMPSALEPGQVFTLPYRVQALRDFNPESEATATGGGCGSYSGSYTVTYQGKCVNET
FT                   VVTSQASGHFNSNWGSCGINSGNNNAQKIVSTYKNSRRDGILGGWGWGPRGSAPYDALW
FT                   CIADTECDDCNKGNGSGK"
FT   repeat_region   22029..22404
FT                   /note="RPT30A"
FT   gene            32831..37036
FT                   /locus_tag="CJA_0017"
FT   CDS_pept        32831..37036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0017"
FT                   /product="Rhsfamily protein"
FT                   /note="identified by match to protein family HMM PF05593;
FT                   match to protein family HMM PF07661; match to protein
FT                   family HMM TIGR01643"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACE86285"
FT                   /db_xref="InterPro:IPR001826"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:B3PEN8"
FT                   /protein_id="ACE86285.1"
FT                   /translation="MKLVKLFSNLMVICILLLSQQAYAARGISSDNAGPHFSGLHNQET
FT                   IEDIRLKVLGGDVRINRVWRGEHWEWNERWGQLQPMLHSMTDASGETTTSVLAVYRAGQ
FT                   LYRKTSETAEQVVYENQLNQFITKTATEYVWHDRKGNGITYDLDGRVINYFDKNKVYVY
FT                   LERDANGDILSIKDHHQNTVLSLTYETYSNPEDESQQLQRIKTLTDYAGRTVIYGWNNN
FT                   HQLETVTDVRGQVWTYVYSDNGLLTQLKDPDGRVTRYEIEKTGKFISRFNTDGVGERYQ
FT                   YNYDKENQIYYMSKIDGTGRVEETWNNAMGLAVRESNDGEDKRNVEYILSDGSKGVESI
FT                   IKNYSYRVEYWYRGSEFVGKTRYCGNDDQSNNPDSPCLRNDPNLINKPVYVKYKKVIDT
FT                   NGDVTTYENDQWKNEIGVTYPDGTSSSRKLHSQWSLPISETNEKGITTTYEYDTSGNLI
FT                   TLVEAKGTPDERTTRYTYDEFGQIKTKITGESVANNTELAVTYYEYDQYGNIIQVMDPE
FT                   GNITHYSDHDALGNAQTIIDARAHLLPVVEQYTWKNTYDAAGNLLTRRDPYNKGETYTY
FT                   TKTGDLETVIAAGGSKVTLTSNANGQPLTITDDNNKVTKLQYDKAGRLTVTTDANGNKS
FT                   QTAYDAQGRVFRSVDGEGNTTQYNYVEDLLRSIQYPTYKELLEYDNRNRVKQTTQQANS
FT                   RNYIRKHGYDPLGNITNSTDAQDNETVYEYDVLSRVKKITDAEGGVTEFSYDARDNLLQ
FT                   VKDPEGRLTIYTYDKNDRLLTETKDGDQNTDRQRRYAYDQNGNLIGSINPEQEMTTYEF
FT                   DQANRLVKTQVFANKDHTHPIKVINYHFNDKNQLTNWSQQVSTSLPDGVTPTADVIPLS
FT                   ETYTYNNLEQLESVAVNFGSFTKTYRYSYYPNGLKKTYTNPEGITYTYFYNKNNQLMAV
FT                   HIPGEGQISWTAFSWMVPQTLLLPGGQKISFKYDDFQQLQERVLKKANNTELAKAVYEY
FT                   DLEQNIKKIERGEGIFNYGYDNLYRLTTADSPEGYAANDETFGYDGVGNRTTHTENGIS
FT                   ANQSYNQKNQLQAIDDANDTTYTYNANGHTKTQTKNSITTEYRYNHEERLIEVKRDDTT
FT                   IAEYAYNPHGQRVKKTVNGVTTWYLYNGNGLAAEYSSTGQLIKEYHFHPQKTWMTDPLF
FT                   QRTAAGEVYYYHNDHLGTPQQMLDDAGNIVWEAQYSAFGKAHITIDTVENNLRFPGQYF
FT                   DSETGLHHNYFRDYDSALGRYIQSDPIGLGGGFNTYVYAYQNPAVLIDPLGLYVPSDLP
FT                   ENCKVITTGSGIRDENDVKMGPPTKVFQVIIPFIKFKKKVRDHNDVDGKILKYELWKQT
FT                   ITYMYKSYKWMTYYVECQEEDECGNHLPPTIIPGGYDEQLVRDDKQEKTNWWSVAELF"
FT   repeat_region   36092..36297
FT                   /note="RPT25A"
FT   gene            37736..39121
FT                   /locus_tag="CJA_0018"
FT   CDS_pept        37736..39121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0018"
FT                   /product="Rhs family protein"
FT                   /note="identified by match to protein family HMM PF05593;
FT                   match to protein family HMM TIGR01643"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85915"
FT                   /db_xref="InterPro:IPR001826"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="UniProtKB/TrEMBL:B3PEN9"
FT                   /protein_id="ACE85915.1"
FT                   /translation="MPGGQKISFKYDAFQQLRERVLKKANNAELAKALYEYDLEQNIKK
FT                   IERGEGIFNYGYDNLYRLTTADSPEGYAANDESFEYDSVGNRISRTENGTSESQNYNQK
FT                   NQLQSIDSSDDTQDTTYTYNANGHTKTQTTNGVTTEYRYNHEERLIEVKRDDTTIAEYA
FT                   YNLHGQRVKKTVNGVTTWYLYNGNGLAAEYSSTGQLIKEYHFHPQKTWMTDPLFQRTAM
FT                   GELYYYHNDHLDTPQQMLDDAGNIVWDAQYSAFGKAHITIDTVENNLRFPGQYFDDETG
FT                   LHHNYFRDYDSALGRYIQSDPIGLRGGINTFSYAEGHPLSLLDPLGLMSIGHKPDMALL
FT                   PGCEKIVLSDKSKNMNKIITGDPYIYKSKLLFAAAFPIPGGKKAAISIFLEHWIQVSYH
FT                   YSINIEDVTYVIKCKEVDECGVEKVVEHSGYHYSEHQTRLPDIVKKWTEYNMKHESTMG
FT                   PKK"
FT   repeat_region   38150..38355
FT                   /note="RPT25B"
FT   gene            39679..44271
FT                   /gene="cbp35A"
FT                   /locus_tag="CJA_0020"
FT   CDS_pept        39679..44271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbp35A"
FT                   /locus_tag="CJA_0020"
FT                   /product="carbohydrate binding protein, putative, cbp35A"
FT                   /note="identified by match to protein family HMM PF02412;
FT                   match to protein family HMM PF03422"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85711"
FT                   /db_xref="GOA:B3PEP0"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR005084"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:B3PEP0"
FT                   /protein_id="ACE85711.1"
FT                   /translation="MRILGIFVGIFLGIVSIASQAEEALCAEVKIEILQELTMERQGFE
FT                   AMMRITNSLDTFSLENVSVKVIFSDSDGNPVVATSNTSASGAAFFIRVDDTQDVTGLQQ
FT                   GADGYVHSGSIAPQKVGEMRWLIIPTANAAGQTKDGKLYFVGAELRYSYGGKEEVVNVA
FT                   EDSIVVKPQPALTLDYFLTEEVVGDNGFTPEIEPPEPYTLGVRINNNGFGAAKSVKIES
FT                   AQPRIVENKLGLAVNFKILGSYLKDQPSSPSLLINFGNIEPKGITTGRWIMESNLAGKF
FT                   IAFNASFTHADELGGELTSLLQATNANFLVRDVIVDLPGRDNLRDFLAYNATRNLRVFE
FT                   SEPTGANEVDCANCKGVTEITSASLSPIDNSRSRIEFEPVGGLAYVTAVDPFNGAKVLA
FT                   RVVREDGSIIHPQNAWLSKKRASDNINFNYFVNVFDNNASGKYTVYWGGNLVDTPQPPV
FT                   IQYVPDQVTYEGGNLGFIVRATDPNNTLPTLSYSPLPAGALFTSSAINDGVFNWSPLPG
FT                   QAGQYSVIFTATDGEFSVERLVNIKVNPAHDTDGDGMDDDWEREHFGNLDKDGTQDTDG
FT                   DGRTDLEEFEQGTNPNLFEAAPAAPEIDAPAYNADTLDGALPPLMPELIVKNGNHPAGI
FT                   ESVAIVFEVYKDEALTELMGMARLDEGTGSVQGDKTHWEIAPVDLDEGMEFEDNRLYYW
FT                   RARSVQNGSASVSSTWIKSRFFINTENDAPTQPQISSPAIEASIAVLSPTLVVTNSTDI
FT                   DRDELRYGFELYEESDLETPVATVSGLLPGNNGQTSWFVATLLEEDKRYLWQASVTDEH
FT                   NVVVKSDWGSFVVNTQNHPPTNPQVDSPLPASTVTALQENNSLSLRVINSIDPERKPVK
FT                   YYFELDTVNTFDSSDKQSSAAITAGETHTEWTASNLVNQVQYFWRVKASDGEADSAWVV
FT                   SDFTVSVQNQAPSIPVLQNPVDGAVIQSLSVFLEANPAVDPEGSILTYVVEVYSDSALT
FT                   HSVYSNQSLTPWWQLDDLLANQSTYYWRVKAFDEDGQESEWSSTGVFTVNIPSVNQPPQ
FT                   FSFVAPAGNVSMDANGVLIQWVDDDPDSDAQITLVAKKPDNSSITIASNISENLDGAGD
FT                   TFILMPGVLPPGSYTLVAIISDEDHSISVPHCCTLTVPEPPQGLLPFSQWLFDEGTGNV
FT                   TQSSVGEFVAPIKLTYIHNSAATPASWVAGRHPAAETALNFDGRGAYVEIPKTSSQPLL
FT                   NDASLSFWIKTSQAGGLYPEISPAIIGSHNSDTGDHIKWGSLGLQGQFGLAVGEIRMLG
FT                   LTRVADNNWHHVVITRRKTPGSDNGIVKIYVDGKLDAVSAPADEKFTGLVNTFAGLATN
FT                   NRFSSNTPNQIDSTSRFIGGALDDIQIFDRSLTATEVADLYMDESGDQPSITGAYDNFV
FT                   NQGIYQAEAASLYLGAVVTEHSGYSSIGFVDYDFVAGGYIEWVVERTHAGPVTLEFVYA
FT                   NYSISNRNMDISVNGQVVSPNLAFPNTNSWTNWTTVSANVNLAQGVNRIRATAKLTVGG
FT                   PNLDYMRIVE"
FT   gene            complement(44250..44432)
FT                   /locus_tag="CJA_0019"
FT   CDS_pept        complement(44250..44432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0019"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83177"
FT                   /db_xref="UniProtKB/TrEMBL:B3PEP1"
FT                   /protein_id="ACE83177.1"
FT                   /translation="MANCLHLLPEQSGRIDTHITARLDHIQFAILVIHLYQISTGIEYR
FT                   IGVAINYDYYSTILM"
FT   gene            complement(44404..45153)
FT                   /locus_tag="CJA_0021"
FT   CDS_pept        complement(44404..45153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0021"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83452"
FT                   /db_xref="InterPro:IPR014914"
FT                   /db_xref="UniProtKB/TrEMBL:B3PEP2"
FT                   /protein_id="ACE83452.1"
FT                   /translation="MIWQDCQGAQHIQTIAGTAWRLVESQEQIATLGYVDNLEEQALLE
FT                   ELLDGVKPPYPAQCDSYHYLLKTPFRYPPLQWGSRFGRVHEPGIFYAGCNTQATLAESA
FT                   YYRFVFWYSINAAPVKPSITSAHSLFCVDYASARGIRLQTLPFDQYQPQLTHPQDYSAT
FT                   QQLGSDMRTSGVDAFEYTSARDPERNRCIGLFTPRALAQKKPREITQWLCELSANDVSF
FT                   KQLGSKDIIRFPLADFLIDGQLPTPAA"
FT   gene            complement(45153..45524)
FT                   /locus_tag="CJA_0022"
FT   CDS_pept        complement(45153..45524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0022"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84265"
FT                   /db_xref="InterPro:IPR024467"
FT                   /db_xref="UniProtKB/TrEMBL:B3PEP3"
FT                   /protein_id="ACE84265.1"
FT                   /translation="MSALTQATPEPATVLAKAVLNAADQLGLKQAELGAVLGMHRTAIS
FT                   RLKQNLNLDPGSKQGELALLLIRIARALFALTGGDKDWIRHFMHNPNQVTGGIPARQIE
FT                   TIQGLIQVLQFVDALRGKV"
FT   gene            complement(45586..46134)
FT                   /locus_tag="CJA_0023"
FT   CDS_pept        complement(45586..46134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0023"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="identified by match to protein family HMM PF01037"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85158"
FT                   /db_xref="GOA:B3PEP4"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B3PEP4"
FT                   /protein_id="ACE85158.1"
FT                   /translation="MFSNDHLNNNIAYYCFLLAIYAHYLGFTAMELDRYDRLILEALQR
FT                   NGRISNQELADSISLSPSPCLRRVRALEESGLIDGYVALLNARKLGLTLVSFIQISMDK
FT                   HTPDRFDAFENTVAAYPEVLECHLITGQSADYLLKVIVKDMDAYQQFLLQKLTRIEGVS
FT                   GVHSSFVLKSPVDKTALPV"
FT   gene            46125..48146
FT                   /gene="leuA"
FT                   /locus_tag="CJA_0024"
FT   CDS_pept        46125..48146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuA"
FT                   /locus_tag="CJA_0024"
FT                   /product="2-isopropylmalate synthase"
FT                   /EC_number="2.3.3.13"
FT                   /note="identified by match to protein family HMM PF00682;
FT                   match to protein family HMM TIGR00970"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85163"
FT                   /db_xref="GOA:B3PEP5"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005668"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="InterPro:IPR039371"
FT                   /db_xref="UniProtKB/TrEMBL:B3PEP5"
FT                   /protein_id="ACE85163.1"
FT                   /translation="MKTILAIICHRHSPILTNMLIKAPALPARVFGVSAGVTAPLEILA
FT                   SYPEASVQTSRISQNRKTHYSSTQELHSSGPLECLPGRRFQRTPNNRTYILERRSKPRC
FT                   QNSNLSQAKTSESIMLANPSTKYQRFVGVSLPDRQWPNHHIEKPPIWMSTDLRDGNQAL
FT                   IDPMSVQTKLRMFKELVAIGFKEIEIGFPSASEIDYNFTRMLIEENLIPDDVTIEVLVQ
FT                   ARYDLIEKTVQSLRGARRAILHMYNPLAPAFRKIVYNTDKEGVKKIALQGTQWCKELTA
FT                   QAPEVDWTFQYSPEVFSSTEIEFVKEVCDAVVEIWNPSPQKKIILNLPATVEMNTPNTY
FT                   ADQIEWIHRNIHRRDSIVISVHPHNDRGTAVAAAELAVMAGADRVEGCLFGNGERTGNV
FT                   DLVTLALNLYSQGVHPGLDFSDIDKVRKLHEECTQLPVHPRHPYAGELVFTAFSGSHQD
FT                   AIKKGFAVQKKDTLWEVPYLPIDPADLNRSYDAVVRVNAQSGKGGVSFLLQQEAGLQLP
FT                   RRLQIEFSSVVQKVSDSTGKEVKASDIARIFNEEYFAVNSPITYQSSKFTEQDDTHQVD
FT                   IVIHAQHQNKTVEISGSGNGPIDAAAHAISQFIDTEVNVIDYHEHSVGEGSDVVAVTYV
FT                   EIKVKNGKPVYGVGQDRNIITSAVKALINGVNRSGAVS"
FT   gene            48661..50883
FT                   /locus_tag="CJA_0025"
FT   CDS_pept        48661..50883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0025"
FT                   /product="catalase/peroxidase HPI"
FT                   /EC_number="1.11.1.6"
FT                   /note="identified by match to protein family HMM PF00141;
FT                   match to protein family HMM TIGR00198"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85973"
FT                   /db_xref="GOA:B3PEP6"
FT                   /db_xref="InterPro:IPR000763"
FT                   /db_xref="InterPro:IPR002016"
FT                   /db_xref="InterPro:IPR010255"
FT                   /db_xref="InterPro:IPR019793"
FT                   /db_xref="InterPro:IPR019794"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PEP6"
FT                   /protein_id="ACE85973.1"
FT                   /translation="MFKKTKPRISILALTISCAIYSGAALAQDAANSNKFWWPEQLNLS
FT                   PLRQHGVESNPMGSTFNYAQAFKKLDLNAVKADIKALMTQSQDWWPADYGHYGPFFIRM
FT                   AWHSAGTYRIYDGRGGAGGGQQRFEPLNSWPDNVNLDRARRLLWPIKQKYGSSISWADL
FT                   MVLTGNVALESMGFKTFGFAGGRQDDWEADTVYWGPEKKWLDDKRYSGDRTLEKPLAAV
FT                   QMGLIYVNPEGPNGVPDPLLAAKDIRDTFGRMAMNDEETVALIAGGHTFGKAHGAHKPE
FT                   TCLGKEPAAAGIEEQGLGWTNKCGKGNAEDTITSGLEGAWSVNPIAWTTQYLDNLFAFE
FT                   WVQVRSPAGAVQWIPKDGQAANLVPDAHDKTKRHAPIMFTTDLALKEDPEYRKISLRFK
FT                   ENPKEFELAFAKAWFKLTHRDMGPRVRYLGNEVPGEILLWQDPVPEVDHPLIDAADITK
FT                   LKSSLLSSGLSSAELVRTAWAAAASFRGTDLRGGANGARIRLAPQNTWAVNNPRELNRA
FT                   LTRLEKVQGDFNKASTGGKKVSLADVIVLGGVAAVEQAAKKAGYAVEVPFIPGRTDASQ
FT                   AQTDVTSFAVLEPTADGFRNYYAKDNTLPPTDMLVERANLLTLTVPEMTVLVGGLRVLG
FT                   ANSDAAKNGIFTDKPGTLSNDFFINLLDMSTQWRKSAKTGGLYEGLDRKTGKLKWTATP
FT                   VDLIFGSHSELRAVAEVYAANDGQEKFVNDFVKAWHKVMMLDRFDW"
FT   gene            complement(51040..51159)
FT                   /locus_tag="CJA_0026"
FT   CDS_pept        complement(51040..51159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0026"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84013"
FT                   /db_xref="UniProtKB/TrEMBL:B3PEP7"
FT                   /protein_id="ACE84013.1"
FT                   /translation="MTILALWVSPKTNALGLPGFGCYQDVDWIQYFDIFISIQ"
FT   gene            51333..52565
FT                   /locus_tag="CJA_0027"
FT   CDS_pept        51333..52565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0027"
FT                   /product="putative ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84670"
FT                   /db_xref="GOA:B3PEP8"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:B3PEP8"
FT                   /protein_id="ACE84670.1"
FT                   /translation="MDSLQEILYTLRCNKLRTILTAFGVFWGILMLVLLLGAGRGFQNG
FT                   VMAGFGNNVMDFIMVYPGTTAVAYQGLGVGRGIQLREDDVAAIQHQIPGIRSMSPAVNM
FT                   GSVQVIHDRKTGEFELMGVADEFFMIKTAIDFNHGRVMSSLDEKEIRKIALIGNTVAER
FT                   LFNDDRPIGKTIQVKGVVLTVVGVFTDKDNNGRASNRVYIPISTYQKVFGGGNQIGEIW
FT                   LRPNAVTDGFELEKRVVELLKQRHQIAPEDRRAINAFNMAEPAKAVAGLFWAINGFIWF
FT                   VGLGTLTAGIVGVSNIMIITVKERSREIGIRKALGATPFNIVGTLLLESILVTMLAGYL
FT                   GLVMGVALLELVALGLRSAGAELPFFKSPEIDFQMAITAIMLLVGVGALAGLFPALKAA
FT                   KIMPIEAMRAN"
FT   gene            52577..53845
FT                   /locus_tag="CJA_0028"
FT   CDS_pept        52577..53845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0028"
FT                   /product="putative ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83479"
FT                   /db_xref="GOA:B3PEP9"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:B3PEP9"
FT                   /protein_id="ACE83479.1"
FT                   /translation="MLIDTQKWQEIFSTLGRHKLRTALTAFGVFWGIFMLTVLLGAGKS
FT                   LEEGVTSSFRMIPNSVWMWPQGKTQVAYRGMPVGRQISLDSDDIQAIRDNIPNVDKIYP
FT                   ENSVGVWNGVPVYTIYKDQNGAFAVKGTHAGMENMHMQKVTQGRYINLIDEKRRRKVAV
FT                   IGQRIKELLFEPGQSPIGETITIAGISFQVVGVYKSSSTENVNVTQEEIVYIPNDTLRQ
FT                   AFNQKGWISSFGVIPKQGVHAVVVENEIRDFLYQRKRISPDDKGILGSFNLQTEFEKVY
FT                   GLFYGIQVFSWIVAIGTIMAGAIGVGNIMLIAVKERTREIGLRKALGATPFSIVAMIVQ
FT                   ESVLITAFAGYLGLVAGVLILEAVNHVIAGAGGRIGMFGYSDIDFATALSALAVLVISG
FT                   LLASLLPAAKAASVNPIVALQDE"
FT   gene            54270..55001
FT                   /locus_tag="CJA_0029"
FT   CDS_pept        54270..55001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0029"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACE86244"
FT                   /db_xref="GOA:B3PEQ0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3PEQ0"
FT                   /protein_id="ACE86244.1"
FT                   /translation="MIKLHNIHKYYHSGEQPLHVLKGIDLHIRQGELVSIMGSSGSGKS
FT                   TLLNILGILDTHDQGDYFLNGVEIKNLKEKKAAQLRNQLLGFVFQSFNLLPFKNATENV
FT                   ALPLYYQGVGRKERNYRAEKYLDMVGLSHRATHMPNELSGGQKQRVAIARALVTQPKVI
FT                   LADEPTGALDSQTTQEIMALMKEVHSLGNTIVIVTHEQDIADQTQRQIVLKDGLIVPAK
FT                   EIHGSHAESLDNNDREEEILG"
FT   gene            55008..56243
FT                   /locus_tag="CJA_0030"
FT   CDS_pept        55008..56243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0030"
FT                   /product="efflux ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83173"
FT                   /db_xref="GOA:B3PEQ1"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:B3PEQ1"
FT                   /protein_id="ACE83173.1"
FT                   /translation="MDSLQEILYTLRQNKLRTALTAFGVFWGIFMLVLLLGAGRGMQNG
FT                   IYADFGSDVLDFVAVWSGTTSVAYQGRGLGRQISLTLDDVEALQRQIKGIRVISPESMR
FT                   GGISVVYDTKSGNFPVYGVPDDYFNVKESIPFEQGRKTNQLDEQQIRKVVTLGRTVSER
FT                   LFGPGVSPVGKTVRINDVAMTVVGVFYDKGNRGRDSERVYIPASTFQKLFGSGHFIGSI
FT                   WLRPQAGVDSFAFEQQVVELLKRRHQVSPDDRRAIRSFNMAEPAARVNGLFIGINGFIW
FT                   FVGLGTLMAGIVGVSNIMIITVKERTREIGIRKALGATPFSIISTLLFESIMVTGIAGY
FT                   AGLVVGVGLIELIAYGLNSVGAQMPFFKNPEIDFQVAFTAVVLLVIVGALAGLMPALRA
FT                   AKIMPIEAMRAD"
FT   gene            56240..57511
FT                   /locus_tag="CJA_0031"
FT   CDS_pept        56240..57511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0031"
FT                   /product="putative ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84233"
FT                   /db_xref="GOA:B3PEQ2"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:B3PEQ2"
FT                   /protein_id="ACE84233.1"
FT                   /translation="MIMIIDTQKWQEIFTTLGQHKLRTALTAFGVFWGIFMLTVLLGAG
FT                   KGLENGIEDGFPRVPNIVWLWVQGTTQVAYKGMPLGRQITLKPEDVTAIEQNVPSVGYI
FT                   RGQNSVGIWSGSPPYTTYKDKNGTFYVQGTHAGMDNIHSLKIVEGRSVNDIDDREKRKV
FT                   AIIGTAVRNQLFNADENPIGKDITISGISFMVIGVFKSLASGDEQQEQEKIYIPNDTLR
FT                   YAFNQVGWIGSFIVIPKPGLHARIAEQDVKRYLSEVKHVSPDDYGVFGSFNLQNEYDKI
FT                   QGLFGGIAAFSWLVAIGTIMAGAIGVGNIMLIVVKERTREIGLRKALGATPSSITGMIV
FT                   QESIFITTVAGYMGLVIGVLLLEGIGKLLDAAGGQAGFFGKPEVDFATALSALVVLVVS
FT                   GLLASLLPAAKAASVNPIVALQDE"
FT   gene            57563..58636
FT                   /locus_tag="CJA_0032"
FT   CDS_pept        57563..58636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0032"
FT                   /product="membrane fusion efflux protein"
FT                   /note="identified by match to protein family HMM TIGR01730"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84231"
FT                   /db_xref="GOA:B3PEQ3"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B3PEQ3"
FT                   /protein_id="ACE84231.1"
FT                   /translation="MKKFIGFAILGLIAVVFIGTAVFLYNKSQAKPVVYESDATFKSTI
FT                   IKKTVAVGKVIPRREVEIKSQVSGVVEQLYVVAGQTVKKGEIIAKITLAPNMIQLNQAE
FT                   SQLEQARINLQNATTEFERQKKLFTQKLVSQSEYNKFLLQYDLQREAVTAAENNVLLLK
FT                   QGATKKSDKVSNLIPATVTGMVLDLPYKEGAFIVETSSFGAGTTIATLADMNDMIFEGM
FT                   VDESEVGKIREGMELVLDVGALEGDPFTAKLEYISPKGVTDQGTIKFQIRAAVTLNDRL
FT                   FLRANYSANADIVLDKRENVLAINEGNLSVEEKGHFVEIETGPQKFEKRAVKTGLSDGI
FT                   NIEIVEGLKEGDKIKRR"
FT   gene            complement(58696..59415)
FT                   /locus_tag="CJA_0033"
FT   CDS_pept        complement(58696..59415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0033"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85793"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFB7"
FT                   /protein_id="ACE85793.1"
FT                   /translation="MKALITTLTTLFILTGCGSDVIVNPDPNTKTLEIDFNQGINDWKS
FT                   GFADYPVGQETFYELSASHTMLPSELGTNRKGFRISGNNHSDDLFMFITKRVHGLEPNT
FT                   RYDFEFELNIGSNAKKGCLGVGGAPGEGVTLKAGASKTEPKAENNGSGWYLMNIDKGNQ
FT                   SIGGSDAIVLGDFANSRDCEVNNDSYLKKTLRNTKGSFSAYSATDGSVWILFGTDSGFE
FT                   ATTTIYYLSAKVVATKR"
FT   gene            complement(59412..59516)
FT                   /locus_tag="CJA_0034"
FT   CDS_pept        complement(59412..59516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0034"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82975"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFB8"
FT                   /protein_id="ACE82975.1"
FT                   /translation="MAFKSLTEGSGNISLASMPPLHPGVDTTDHKEPL"
FT   gene            59663..60580
FT                   /locus_tag="CJA_0035"
FT   CDS_pept        59663..60580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0035"
FT                   /product="MltA-interacting protein MipA superfamily"
FT                   /note="identified by match to protein family HMM PF06629"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83585"
FT                   /db_xref="InterPro:IPR010583"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFB9"
FT                   /protein_id="ACE83585.1"
FT                   /translation="MRFSSSLPALLALVLLQPAMAASDCVPDEEACVEVGRWQLGLGIG
FT                   LGVRTNPLEDGDDIPLVLLPMVSYTGERFFIDNLDFGYTLWESDTQQLNLLLTPSYDQV
FT                   FFERWDPVNFVLESPGLGTALNGGGKNSSDPKEPYPLIDPGVSGSGDFEGPESLQRKLP
FT                   KRHMSGLAGLEYHFRLGGYGLHLHWLKDVTDIHQGEERRLALSRAWQAGNHDLALSAGA
FT                   VWQDATLTNYYYGVPQGDAYWASYEAGNALSTQVRFDWNYRLSKHWDLRALLSYRRLPE
FT                   EITASPLVRSDKVVTAFIGGVYHF"
FT   gene            60672..60992
FT                   /locus_tag="CJA_0036"
FT   CDS_pept        60672..60992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0036"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83789"
FT                   /db_xref="InterPro:IPR021559"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFC0"
FT                   /protein_id="ACE83789.1"
FT                   /translation="MLEFSIKPRLCVLSAGEEVCRDTLEVRWSADRARSLCLYRADDDQ
FT                   PLRCWEQATKGSFNFELSARATTRFQLREQGAGEPLGQQDFRVVHEERKYRHPRRNPWS
FT                   FF"
FT   gene            61017..61715
FT                   /gene="rstA"
FT                   /locus_tag="CJA_0037"
FT   CDS_pept        61017..61715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rstA"
FT                   /locus_tag="CJA_0037"
FT                   /product="response regulator (activator) in two-component
FT                   regulatory system with RstB (OmpR family)"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84615"
FT                   /db_xref="GOA:B3PFC1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFC1"
FT                   /protein_id="ACE84615.1"
FT                   /translation="MLHRNILLVEDDRRLAQLVSDFLTANDFRVDVEENGNRVLRQVQN
FT                   LNPSLVILDLMLPGKDGLTLCKELRPQYKGPILMLTARDSDLDQVLGLEYGADDYVIKP
FT                   AEPRVLLARIRALLRRYYQSDENTLANINFGQLHIQPSLRKVTLATEEVHLSSHEFDLL
FT                   LTLAASAGNILSRDFLFQQIYNREYDGLDRTIDVRISQLRKKLQDDPNNPTRIKTIWGK
FT                   GYLFIADAWN"
FT   gene            61725..63020
FT                   /locus_tag="CJA_0038"
FT   CDS_pept        61725..63020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0038"
FT                   /product="putative two-component regulatory system, sensor
FT                   kinase protein"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACE86322"
FT                   /db_xref="GOA:B3PFC2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFC2"
FT                   /protein_id="ACE86322.1"
FT                   /translation="MNRAFVSLYLFIVASVIGLGWALNQLWEGLVPEASVSAEVKGLFI
FT                   SLEQSLVGGVPLTHVQAAMAQQGVELQLIPLDELANSAALEQLQAGGIISASDSEQFHY
FT                   YKLGADGHQVILLSLPPLAGQGELVYRVLLCVFYAGLALAIFLWVWPLSRDARKLEAQT
FT                   RMLGPDGLPEDLRIAPASTLYPLARAFNQMARRLRDLLASHREMTNAVSHELRTPLARM
FT                   KFALAMLESQPLDEKSQRQCRNIATDVAEMESLISTLLMYAGFERYSQQLQISTGQMSD
FT                   LLEELKQRFAHNNQRQLTLELIYTGMDQYCQCEWKLIETALQNAIGNASRYARSRIRIE
FT                   WQPGTTHNCLAIEDDGPGIPEQERARVFGSFVRLYEGQVAPGENTSGFGLGLAIIQRVL
FT                   EWHGGHAIFTEPGHLGGARLELHWPRPESTSL"
FT   gene            63639..66575
FT                   /locus_tag="CJA_0039"
FT   CDS_pept        63639..66575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0039"
FT                   /product="putative TonB dependent receptor"
FT                   /note="identified by match to protein family HMM PF00593;
FT                   match to protein family HMM TIGR01782; match to protein
FT                   family HMM TIGR03304"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85363"
FT                   /db_xref="GOA:B3PFC3"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010104"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFC3"
FT                   /protein_id="ACE85363.1"
FT                   /translation="MHKKRLLPLCIALAASGHLYAQETDTREVVEEITVTGVRQAELNA
FT                   REAERGKSIFSSVISQDDAGNFADQNVAESLQRLPGITLQKSEGEGRFISVRGLGPGFV
FT                   SVQQNGSELASAGSDDRAFALDAIPADLLGAIEVFKSLTPDMDLNSIGGAVNVKTVSAF
FT                   DRKKDSFRVTVQDYYQDYMEEHSPKVSMQGTHLFLDNTIGLGYSLSWEERKTANYEMLH
FT                   HETTDMRYVQENITGVETPDPTDLDSYMLIPFEFQNRQEIAERERTAASIDLGWKPTDS
FT                   GEYYLRSSYTKFTDNDLAWREYYRFGQAGPGDIAYLDRDTNTFGMVDTDIQQQMFIQYG
FT                   ESETSSASVGGKHEFEFNSGRLIIDGDISWSDSTYDKPDGKRVQFRVRDVPVIGRAGKE
FT                   FIVGQAISADALAELAGTTTTGWTDIGGYSGAGINLAAFSFDNLFLEASSRADELQSYG
FT                   MNFKFEIDEGFVSYWKAGFNYKERTRDRNQDRWSIVPRDESQHCPQTEDFAICQDVARN
FT                   TNLSRVETAEVDHPSFVYPAITLNGANQLIDTVRAIATEGNQSGLESIYRDYNMSEDSF
FT                   AAYFMGEFRLADNQWLIAGARWDETKFSSTGFLAINNDNFSLGNDETVKVDYSIPLDSQ
FT                   ANKYDNVLPSLHYRWEPREDVLVRSSIWTSFTRPSYDQARAFANIESNFELCNPVTNVC
FT                   STTPDANTGIPLSEFTLGPNNTLRLGNPNLVAMTSVNYDASVSWYIDENIFLQAAFFYK
FT                   DIDDYIVEVRGARAALDELPVRLPVDQVDAFIIPSDLELNNVSWTANGDRAKVYGAEFS
FT                   YNHNFDNGLFLHNNLTVMSSAAYAGDSIRAGKTQLPEQADTTFNTTVGWENDVVSVRLI
FT                   GNYVSDILKRIGSCPAGSEGYLIVQAGDDRSPCNKWADVYQDDTFSLDFKATWQVNKNI
FT                   KIYFDAMNITDEYMTQYYEGNQYSGGNVMYKSEVYGRSFQIGLNYKFL"
FT   gene            66626..69418
FT                   /locus_tag="CJA_0040"
FT   CDS_pept        66626..69418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0040"
FT                   /product="pectin methylesterase, putative, ce8"
FT                   /note="identified by match to protein family HMM PF00041"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83168"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFC4"
FT                   /protein_id="ACE83168.1"
FT                   /translation="MKNINLFTIAFLGAGLVACGGGDGGPKKPDICQELNQEKCNEIVI
FT                   PESSSSASSEYVEVTPSNNLLPIIESFNVDNASSFFSESYKSLVTINPEDPNNALFYAT
FT                   SGLSEGRIAVENGKLTIGNARFTIGQTLNTTGTHLNPTNTYSDYKVGTTAAADATFPMT
FT                   DSWGDLDLRNNWKISFCVVEREELAGSTGNQSFYVMLDNNQSTIAPSTSIHGDRSSVFQ
FT                   ARVSSFAVGKRVEINIPGEARSNGVLISSTSRIGLEKSFLQFRVPSAGILTMSQLWIGY
FT                   QSDTSTEPTNATCAAGERVSTYLKPLPPVAPAEVTLQPGAGQLRVTWSDSARATSYDLA
FT                   YGLTENLEEATTVTGLSQTPYTITGLENGTTYYVWVRAANATGASDWSAPFTGIPEVPA
FT                   VAPETPTGLTVYGDNQRAVVFWEATEGTESYSLALNTMNDTGTAEVTTGITDTYKLLTG
FT                   LVNNTPYYVFVKAGNAVGDSEYTSAQVVTPSASPYIYQANLAVSKDFFFGTNGPALQTL
FT                   GVDSEVPMHFVAGGNAGITLEEGGIRLANGGRFTIGQVVVPNDEGVLTQTNTTASDTSV
FT                   NGVLDLSGYYKIVINVVSAPDNAGLFQVYLDNNTTSGGSSIHQTTAASRLINRTASTIA
FT                   DGEEIVYEMSANRRGTSTSFIQLRVDSALGAEGILISGIRIEEIDPPAASSSSEASSSV
FT                   ESSSSSSSVASSESSVASSSETSSSSSSSEASSEASSESSSSSSELNGGTSSESSSSSS
FT                   VAASALLTEAFTAADTATFFSADYKAMPADAGKALYRALAGESRITLSDGQLSLNNARF
FT                   SIGDLSEGVATTGSAQPNGAFDLSQPYRIKFTILAATGTGNFQVYVDNNTTSAGNSIHT
FT                   TTESTTVSRLLQVSPSSITSFPYDVVIESSVGTPNSFFQIRADSNITNLVIDNLVIEYQ
FT                   "
FT   gene            69515..72958
FT                   /gene="pme8A"
FT                   /locus_tag="CJA_0041"
FT   CDS_pept        69515..72958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pme8A"
FT                   /locus_tag="CJA_0041"
FT                   /product="pectin methylesterase, putative, pme8A"
FT                   /EC_number="4.2.2.2"
FT                   /note="identified by match to protein family HMM PF01095;
FT                   match to protein family HMM PF02368"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84962"
FT                   /db_xref="GOA:B3PFC5"
FT                   /db_xref="InterPro:IPR000070"
FT                   /db_xref="InterPro:IPR003343"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR032812"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFC5"
FT                   /protein_id="ACE84962.1"
FT                   /translation="MKLQIAVTGVIAALILAGCGGSSSGSSKTSSSSSSVNSSVVSSSV
FT                   SSTSSSVEQSSSSVSEVSSSSESSSEVSSSEVSESSVSSDSSSEESSSSESSSSSSAAA
FT                   LSGCAATTGLYFCDDFAANNSDNWDALPSTINSLAPNGEFSVEDDNGNYIWRYTAASTG
FT                   GVIALIKPDAFSSVTSADYYVEAKIRPRANSTTSNKQIYLLARYVDGNNWYAGALNVQN
FT                   ATTSTQVEIARMVSGTLSRPVQVKKPIEQGTADEFDGVWYTLRFEVLGDKLTVYLDGET
FT                   IGSTTDANFTQPGLIGFWTANKSFDIDDIKVGNATDKPASLLLSPSAITYAAEAGDAAR
FT                   VITVNAKTDAGTADDFTVESSDPAVVSVVTNGTEVSLTPVGEGSATIVFTSSSGLVRSI
FT                   TATIAPQFVMPTATYSFTNQLVPAAGETDAYEDLTLKLTFDSVPALGSSGSIRIFKASD
FT                   DTQVDKIALVDEKDAIGFGTLRSLNTRPVRISGNTASISLHANKLEPNTTYYVAVSEAV
FT                   FSGATLAGQSFTGIGKNANWSFTTRAAKPAAGLTTIIVDDAGSTADFRSVQGALNYAME
FT                   HVALADAVTIEVKDGIYEEPLYLRNKNNVTIRGESREGTIIQYPNNELLNSGSTGRALF
FT                   LVESADMLSLENLTLKNTTLIGAGGQAETIYFNSTTGRLIAKNANFISEQDTLLLKGWT
FT                   WFYNTLVAGNVDFIWGYSKASLFEKSEIRSLGRSTGNTNGGYVLQARVESATDKGFVFL
FT                   NSSVTAGAGPTGETPVDGSHYLARSPGGTTTYDNIVFVNTRMGSHVNAKGWAGGGVNSQ
FT                   PIANPATGTVTTGWREYNTMDLNGNPLDMSGREFVYQLNAGEVAGYCSRAQVFSAYNSG
FT                   AGWDPMPEDTSDCIDVDGTGGASSSSSAASSEASSESSIASSSSSNSEASSEASSESSS
FT                   SVSSESGGGTSESSSSSSTGLSINWSPTYEDFAAVVAAQPAAGSNANFNANASAFAIGN
FT                   FNFYSSGAGSLRLHLTADSSAYAINYNGSSLRTEPTKFVEGSSGQVNPTQLTGAGGVSR
FT                   YVSYPVVSSSDALTFTVTYTNGSADYDVVNNQNGCLNGQIAIVDQTGKAWKVASSCGNT
FT                   TPSTITATISDPNVTELYVLMSRNGDGGGGIRIWNIQVTR"
FT   gene            73344..76232
FT                   /gene="pel1D"
FT                   /locus_tag="CJA_0042"
FT   CDS_pept        73344..76232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pel1D"
FT                   /locus_tag="CJA_0042"
FT                   /product="pectate lyase, putative, pel1D"
FT                   /EC_number="4.2.2.2"
FT                   /note="identified by match to protein family HMM PF00544"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85280"
FT                   /db_xref="GOA:B3PFC6"
FT                   /db_xref="InterPro:IPR002022"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFC6"
FT                   /protein_id="ACE85280.1"
FT                   /translation="MKIYPLLTAGLVCSLVACGGGSSGSGNQSSSVVSSSVVSVASSQP
FT                   SSVVVSSSSSVIVEPSSSSQSSDVVSSVESSSSESSVAESSESSVAESSESSQGGTESS
FT                   ASSESSSEASSSVAESSVSSSEQSSAESSESSSSETSSEASSSAEALNWNVYSADYHPA
FT                   TNGSVTLAGGEIAEFTAGGNGDYFVDQFDGTVVLDTSSVGTDTTSATFYNVVNAEGVYP
FT                   KYFTLVAGVKGNADSLRVLELEVAMADEAQIGSRLKAILRNDGSNKGVQLETANNGSSV
FT                   NSYNVNDMDKFAIYQIAITLTSSTNGSVNVYRNGVLMPGLSLDNVTMRATSAASDNFVR
FT                   FGEVSGSAAYKSTVDWVIWTNQAAYSPLALDGLLPAGLGCVYGYGSSDQLETCENPPVS
FT                   GGSSSSSGGANSSAASSIDHGTAEIRPAKIEGFAAYANVTGGAGGPVITVTTGTELNAA
FT                   LCGVRNGNRTAPVIIMVDGTINHSNTTSQGCDTQNDVIEIKNTSNISIIGVGTNALFDE
FT                   IGIHVRSASNIIIQNVHIRNVKKSGSPTSNGGDAIGMETNVDRVWIDHNWLEASGGEKD
FT                   GYDSLLDMKAGVTNVTVSYNIFNDSSRAGLIGSSDSDNKNNNITFHHNWYRNIEQRTPL
FT                   IRHSLVHIYNNYWSTENRSAMIHGINSRMNAKALVESNYFYNVNNPLLASNDSKVAGCW
FT                   QTNNDNTLVNHIYSRSVTNGALVIPEIIDGQMQSTCEVTVPYTVDMDPAVNVPAIVMTN
FT                   AGVGIISTEVGSSSSSSSSSSVSSQTSSSGTSSSSPSAGTGVLVNEEFGVDKATLFSAT
FT                   YKAISTDSSAALYFVTGGNSGITVVNDQLSIVGGRFTIGHRPPRTATTASDLSANGDFD
FT                   LTSPYRISFTVVSASGAGKVQVYVDNNTTSQGNSLHSNDSKVYEVVANTLTAGQVVEIT
FT                   PSSIGTSTSFIAIRAESSATIVIDDLKLEYID"
FT   gene            76397..80326
FT                   /locus_tag="CJA_0043"
FT   CDS_pept        76397..80326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0043"
FT                   /product="pectin methylesterase, putative, ce8"
FT                   /note="identified by match to protein family HMM PF00041"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACE86103"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFC7"
FT                   /protein_id="ACE86103.1"
FT                   /translation="MKISIIFALMLSVLMVGCGGSGSSLDPLYPPKVSSSAISSTPVSS
FT                   TPVSSISSSATVSSTSSSTPVEASSSFQSEISSSSESSSSESSVESSAESSSSETSSDA
FT                   SSSESSSSAASSSLGPIQTGVFLDAAVSNLGYRTQSLDGSTNELGEFNYREGETIVFFI
FT                   GELEFPAVPVADIITPLDLANTDNPNNPVVINIARLLQSLDSDGDAENGISLSEAAISA
FT                   ARILDFTLAPEIFEQLPAVQSWLQESGGPNQSLVSTEQALAHLQATLDFIYGPGSSSSS
FT                   SAIASSASSSSSVVESSSSAESSQVQSSNSSVTGGEQSSSSSQETSSSEASSEASSEIA
FT                   VSSESSVTSSETSTSSVESSVANSEASSSEESSATSSEESSSSAESSVASSEVSSSVES
FT                   SAISSEDSSSSVESSVASSEASSSAESSSSSEDDVWQGNAYDLFGTSTSIPQGVINLNT
FT                   DNAVTMTAKGGSINTSNRKFFFAHQPVSGDFVFSARLASVTVANEGAFTVLANNQFRYG
FT                   LLAVENLNAVASYPDLGRFAEIGIYTATAAPTFTGSRAYKLDVGGSTTQSRTNGTWTVG
FT                   NYLRIARTGNSIHLSTSVDGEAYTAVNTSSLTDANSNPIGSDWHIGFYAASGADELTLV
FT                   FDNISLETGSTASSSSSDSSAQSSSSSEVASSSSIASSVESSSSSVESSSSSSVVIIGS
FT                   SSSAGSETSSSAESSVASSEGSSSTESSAVSSEASSSVESSVASSEESSSAESSAVSSE
FT                   VSSSAESSVASSEESSSAESSAVSSEVSSSVESSVASSEESSSAESSVVSSEASSSAES
FT                   SVASSAESSASSSEESSSSEASSSSSSAGIVNTLLPIYEDFDNVVDATSFTTNYKLLAT
FT                   DNQISFYHRLSGAFALAGDVNQALVLSPVRLSLGNTTPAVETTSSDSATTGELDLSEPY
FT                   RISFCVLDRNSAGNLQVQIDNNTTGGGNSIHSGSTSRIYSQSISGLTVGQRVTINSSLG
FT                   TPTSFVTLRVDGGGSVTIDDLWIGYQSDTSTEPAAETCIPPAPVAPAAPQVTAGDAELS
FT                   VTWSAIAGATGYELVYNTIDTIDGATEYANNPVTGTSTTITGLTNDTTYYVFVRAVNTG
FT                   GFSDYSVSASGTPVISSGGGEEEPSNSVLLLEDFNGATSATFFTVDYKALPENSSLPMY
FT                   RAISNGSNAQFSNDQLRIVGNTIITIGAENSTNTTSGDIPAGIFDLSKPYKIVFDVIEN
FT                   GTGSGKIQIQIDNNTSSSGTSIHGAGSRIYDVAAASIVAGTVEINNPTKTGGVPVGTTS
FT                   SHISIRSEGGAKVVVIDNFRVEYIE"
FT   gene            80421..83069
FT                   /gene="pel1C"
FT                   /locus_tag="CJA_0044"
FT   CDS_pept        80421..83069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pel1C"
FT                   /locus_tag="CJA_0044"
FT                   /product="pectate lyase, putative, pel1C"
FT                   /EC_number="4.2.2.2"
FT                   /note="identified by match to protein family HMM PF00544"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82841"
FT                   /db_xref="GOA:B3PFC8"
FT                   /db_xref="InterPro:IPR002022"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFC8"
FT                   /protein_id="ACE82841.1"
FT                   /translation="MHRSLISISLMAAILSACGGGSGSGGDNTPSSQASSFSSITQSVV
FT                   SSSSVQSSVSSAVESSIIASSEQAESSAAEQSSSEEGAASSAEESSVSSVADSSSGGQE
FT                   QSSTSSEDEHSSSSSEESASASSTSSDASESSSSAEESSAFSSEANSSVEGLVNINWLP
FT                   SANAFKVGGSSTAISGSVTTNSADVTSFSITGGKFESSKEAFFYINQTVNGDFVFTANI
FT                   SSWGSGTRSGSDQGSVGILLCDNCENGSSSVPVSAKIGVRDTGIIHTERLSVGGTLVKT
FT                   SMGNNVTPSNQLYLRITRTGNQVELAYSNDGGTSYDLVRTSSFSALSNNLRIGIYAAQG
FT                   TDASNNFGVSNISLLANSQENSSSSVASSASSNQSSSQLSSTGSSNQGGQSSSTSSNQA
FT                   NSSSSAPYIPVDITLSQDCIDLTTNPTVNWRDTALQTDQEIVECLYQSLGRPVGYGENA
FT                   MGGYDPNGNSKLTIITKNSSVTVEQQLLDALTDNVHNWIVFDKVEFANEHEIGMYRSYC
FT                   NNSTVLGMLDASETECNDYWQWCTRKGFSGEANCRTEFFNKAMNNKNIPIRIPAVGSNK
FT                   TLDGRMSKAYFMFSGFAIGKDSDGVPTQTSNSIIFTHLDFRGAGHVEDHYVDPDMIRST
FT                   GFSSDIWIHKNTFDTTGDSAFDVKIGAHNITISFNRLVNVKRAVLHGSSDSREINQFIT
FT                   TTMHHNAFVTTDDSYKLLGNTLRRVPLLRRGTTHMFNNVFVNYRKEVLSLRVGARAFLE
FT                   GNVFIVNVSLKEKSSIAASLAEIQGNLFKDISGGFFRNDRNFLWFGSGTCILDDTTKTH
FT                   LTATNGSVDDLSQDYNAASLSVIDGWRFEAGQDLIDYVILTAGKNGDVPFNTPLSPDRT
FT                   YMEALAPTTCQ"
FT   gene            83436..85286
FT                   /gene="pel1F"
FT                   /locus_tag="CJA_0045"
FT   CDS_pept        83436..85286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pel1F"
FT                   /locus_tag="CJA_0045"
FT                   /product="pectate lyase, putative, pel1F"
FT                   /EC_number="4.2.2.2"
FT                   /note="identified by match to protein family HMM PF00041;
FT                   match to protein family HMM PF00544"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84412"
FT                   /db_xref="GOA:B3PFC9"
FT                   /db_xref="InterPro:IPR002022"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFC9"
FT                   /protein_id="ACE84412.1"
FT                   /translation="MQVTSMKTSLQAAAWLLGTGLFCATGLHAQTLGSNLSLTGPGAGA
FT                   DGSGFSDTKLVRDGSINTYTQASGTVNQRVSVKWSSAQTFNTVILRESGNRITNWQLVN
FT                   NDTGAVLATGTGIGAARTVNLGSVSMKKINLIANGSSPLQMAEIEVYNATSTASSSSAT
FT                   GGTSSAANSSAAAGGVNLTGSAGNGQVALNWTVTPAINAQEIYIDTDSDPAGRTRIASP
FT                   GTSVRTYTATGLNNGTNYWFWVKYRTTDGVWHNSNAFSATPVGGTTSSSSSSSSSATSS
FT                   TPSGGTGLMSCSQANTVRGFAALGGGTTGGEGGTTVTVTTGAQLVAALATKKNNPTPLK
FT                   IYVNGTITPANSGGANQFDVKDMANVSILGVGSNALFDGIGINIVRANNIIVRNVKIRY
FT                   NRIGQKDAVSIQGTSKNVWIDHNEFHNSLDVNKDYYDELVSGKNQIDNITISYNYLHDS
FT                   WKTSLWGSGDSDSYDRRVTFVGNRLENVNSRLPLFRFGQAHVYNNYYLNVLETGINSRM
FT                   GARIRIEGNYFENVKNPILSKDSSQIGYWDLGNSDTNAYVNVNWEPSTCSGESACVVAG
FT                   PGVSSTVNYTPPYSYSVMTATAAKTHVLNNAGVGKLSGCL"
FT   gene            86121..88946
FT                   /locus_tag="CJA_0046"
FT   CDS_pept        86121..88946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0046"
FT                   /product="NADH dehydrogenase subunit 5"
FT                   /note="identified by match to protein family HMM PF00361;
FT                   match to protein family HMM PF04039"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84788"
FT                   /db_xref="GOA:B3PFD0"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR007182"
FT                   /db_xref="InterPro:IPR025383"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFD0"
FT                   /protein_id="ACE84788.1"
FT                   /translation="MTLLLIIALPLLGAILPLLTERYGRSLCAIAAALGPLLALVLLLG
FT                   KVPALFERQVFFFHQPWLPQLGLDLSLRLDGLGMIFALLILGIGLLVILYARYYLAKED
FT                   SLGRLYAFLLLFMMAMLGIVLSDNLLLLIVFWELTSLSSFLLISFWSHRSEARKGARMA
FT                   LAITGAGGLTLLAGALILGQITGSYSLQVILQSAEQIQAHALYPLALCLILIGAFTKSA
FT                   QFPFHFWLPHAMAAPTPVSAYLHSATMVKAGVFLLARLYPALSGSDWWFYLVTFVGLAT
FT                   LVFGAYTALFKHDLKGLLAYSTISHLGLITMLFGFSSQLATVAALFHIINHATFKASLF
FT                   MAAGIIDHETGTRDMRRINGMWRYMPVTATVAMVSASAMAGVPLLNGFLSKEMFFTETL
FT                   QVELMGGFDWMIPLLATFAGIFAVAYSYRFIHDVFFNGEPINLPIYPPHEAPGYMILPM
FT                   AVLGLLCLLVGTLPNVTVAPFLEAASFAVLGSGIPEYHIAIWHGVNLPLLMSVVALLGG
FT                   LWLYSQRKGLFAFYERKYYLDEKMVFEKRIQWIVRQAQRLSDVLDNGSLQRSVALFIGT
FT                   ALLVAAVEFWPLGQLVGQVALSPVDWVSVLLALVLVIAALATVIMHHNRFAALLVMGVV
FT                   GLVVSLVFVRFSAPDLALTQISVEVVTIILMMLALYFLPQLTPNESNKGRVVRDLLLAV
FT                   GAALGVGLFTLAILTRPYDTGLADFFLANSVSGGGGTNVVNVILVDFRGFDTLGEITVL
FT                   AIAGIGVYLMLDGLQLPLPGTDGEGRRWARDPYPPILVVLSRILLPLALMVSAYIFLRG
FT                   HNQPGGGFIAGLITSVALILQYVCSGSDWVSQRLPLEYRRLSVLGVLIAAVTGLASWVF
FT                   GYPFLTSTFTHVHWPLVGEFELASAMAFDTGVYITVVGATLLMLAQLGRLAQTTYNRPG
FT                   SGTDTTTGEVH"
FT   gene            88946..89320
FT                   /locus_tag="CJA_0047"
FT   CDS_pept        88946..89320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0047"
FT                   /product="pH adaptation potassium efflux system C
FT                   transmembrane protein"
FT                   /note="identified by match to protein family HMM PF00420"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85746"
FT                   /db_xref="GOA:B3PFD1"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFD1"
FT                   /protein_id="ACE85746.1"
FT                   /translation="MEAIIALVIAVLVGCGVYLMLRARTFPVILGLTLMSYAVNLFIFV
FT                   MGRLRSGAPAVIGQSDSYTDPLPQALVLTAIVIGFAMTAFLLVLSLRARAELGNDHVDG
FT                   SAAIGEKPVQPERLLAEDEV"
FT   gene            89317..90825
FT                   /locus_tag="CJA_0048"
FT   CDS_pept        89317..90825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0048"
FT                   /product="PhaD protein"
FT                   /EC_number="2.3.1.-"
FT                   /note="identified by match to protein family HMM PF00361"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84849"
FT                   /db_xref="GOA:B3PFD2"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFD2"
FT                   /protein_id="ACE84849.1"
FT                   /translation="MNHLIIAPILLPLATAVLLILLTGRSLVLIRRLSLGSSALLLGLC
FT                   TWLLLLASDGQIHLYDLGNWQPPFGILLVLDRLSALMLLVTAILAFFSLAYAVCGNDQP
FT                   GDNLHGLVHFLLLGVNGAFLTGDLFNLFVFFEVLLIASYALLLHGRGPERARAGLHYVV
FT                   INLAGSALFLIAVSALYGITGSLNMADLASKIANLDPADAPLAAAAGMLLLVVFGLKAA
FT                   IAPLYFWLPRAYAAASAPVAALFAIMTKVGVYTIIRVYTLVFGNDAGALANLAWPWLWP
FT                   LALVTLALGLVGALAARELRTQIAYLVVVSVGTLLAGVSLNSEAALSASLYYLVHSTFV
FT                   CGALFLLADLILRQRGECSDRITRGPRLRQPALLGGLFFVGAVSVIGLPPLSGFIGKLL
FT                   LLSAADTGVAVIPLWVILLVGSLVTLMALSRSGSTFFWRTDASESPTVVAADKGALLAV
FT                   VLLLGFSLLLSVAGAPLLDYTRALAQQQLAPDNYIQAVQAFQTR"
FT   gene            90859..91404
FT                   /locus_tag="CJA_0049"
FT   CDS_pept        90859..91404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0049"
FT                   /product="PhaE protein"
FT                   /note="identified by match to protein family HMM PF01899"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85509"
FT                   /db_xref="GOA:B3PFD3"
FT                   /db_xref="InterPro:IPR002758"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFD3"
FT                   /protein_id="ACE85509.1"
FT                   /translation="MNSPWDISTTAPRVGARRWLPHPALSLFMLVFWLLLVNSITVGQL
FT                   LLGAFLAWLIPWLTQSFWPESLRIRKPFLLVKYVLLVLWDVVIANLVLVVRILGPVNKL
FT                   QPVFMKVPLDIHHQFTITIFASTISLTPGTVSADLSLDGKYLLVHSLHETDPEAAIVAL
FT                   KQRYEAPLKEVFECSPQP"
FT   gene            91386..91655
FT                   /locus_tag="CJA_0050"
FT   CDS_pept        91386..91655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0050"
FT                   /product="PhaF protein"
FT                   /EC_number="2.3.1.-"
FT                   /note="identified by match to protein family HMM PF04066"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84251"
FT                   /db_xref="GOA:B3PFD4"
FT                   /db_xref="InterPro:IPR007208"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFD4"
FT                   /protein_id="ACE84251.1"
FT                   /translation="MLTSAVGIALFMFGLAISLNLWRLIKGPSLPDRILALDTMYINTI
FT                   ALLVLFGIYQGSMLYFEVALLIAAMGFVGTVALSKYLLRGDIIE"
FT   gene            91665..91994
FT                   /locus_tag="CJA_0051"
FT   CDS_pept        91665..91994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0051"
FT                   /product="pH adaptation potassium efflux system protein G"
FT                   /note="identified by match to protein family HMM PF03334;
FT                   match to protein family HMM TIGR01300"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85297"
FT                   /db_xref="GOA:B3PFD5"
FT                   /db_xref="InterPro:IPR005133"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFD5"
FT                   /protein_id="ACE85297.1"
FT                   /translation="MAFWLESVIAFFLLAGASFALIGSIGLARLPDFFMRLHGPAKATT
FT                   LGVGGVIIGSVIFFSTRGDGLSLHELLIALFLFITAPVSAHIVAKAALHLRLPCIGRTK
FT                   GKPWE"
FT   gene            complement(92074..94611)
FT                   /gene="cadA-1"
FT                   /locus_tag="CJA_0052"
FT   CDS_pept        complement(92074..94611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cadA-1"
FT                   /locus_tag="CJA_0052"
FT                   /product="cadmium translocating P-type ATPase"
FT                   /note="identified by match to protein family HMM PF00122;
FT                   match to protein family HMM PF00702; match to protein
FT                   family HMM TIGR01494; match to protein family HMM
FT                   TIGR01512; match to protein family HMM TIGR01525"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85077"
FT                   /db_xref="GOA:B3PFD6"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFD6"
FT                   /protein_id="ACE85077.1"
FT                   /translation="MTSKLRLDLPLLLPDIPHEADACVARLQEELQNRPGIELVHLHPS
FT                   ANHKAAQLCIHYDPDNLPLARIRELVLAAGAAITERFGHKLWHMDGIQHERRARTIALH
FT                   LQTLTGVLEAEANATGQVQVEFDRARITEEQILASLAELGVTPSAAAAPKNHRHGHDHE
FT                   HSHDHEHEHEHEHEHKHQHGADSQHSHDHGGLLGPNSELFFALICGGLLAAGFAIEKLV
FT                   ASAPFWVPLGAYWIAYFFGGFYTLREAIDNLRLKRFEIDTLMLVAAAGAAALGAWAEGA
FT                   LLLFLFSLGHALEHYAMGRAKRAIEALAQLAPKTAHVRRGEQAVELPVAALQLGDVVLV
FT                   RPNERLPADGFVISGNSSVNQAPVTGESIPVDKHPVADIALARARADSLDAASRVFAGT
FT                   INGAAALEVEVTRLSSDSALARVVRMVNEAETRKSPTQRFTDQFERIFVPAVLLLAVAL
FT                   LFAWAVIDEPFRDSFYRAMAVLVAASPCALAIATPSAVLSGIARAARSGVLVKGGAPLE
FT                   ELGSLTAMAFDKTGTLTEGRPRITEVITVAGTSEEELLKVAVAVESLSDHPLAAAIARD
FT                   GRARLGDAVPIATASGLQNLIGRGVSAQLGNDRVWIGKAELFGSNGIAPLGETASRAID
FT                   QLRDSGRTSMAIRLGERDLGAIGLMDTPRAGARDALQQLRALGIKRMIMISGDHRNVAN
FT                   AVAKDVGLDEAWGDLMPEDKVEAIRTLRSQGKVAMVGDGVNDAPAMANATVGIAMGAAG
FT                   SDVALETADVALMADDLRQLPFALDLSRRTRTIIRQNVFVSLGVVALLVPATIFGLGIG
FT                   PAVALHEGSTLLVVFNALRLLAYRQQPLNRPDS"
FT   gene            95000..97042
FT                   /gene="pel1E"
FT                   /locus_tag="CJA_0053"
FT   CDS_pept        95000..97042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pel1E"
FT                   /locus_tag="CJA_0053"
FT                   /product="pectate lyase, putative, pel1E"
FT                   /EC_number="4.2.2.2"
FT                   /note="identified by match to protein family HMM PF00544"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACE86114"
FT                   /db_xref="GOA:B3PFD7"
FT                   /db_xref="InterPro:IPR002022"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFD7"
FT                   /protein_id="ACE86114.1"
FT                   /translation="MSSSQRISAWALGSLLSASALLSLPLHAQTLGANLALTGPSAGAD
FT                   GSGFSNTKLVRDGNTGTASPASGTSNQRVSVKWGSAISFNTVILREQGTRITSWQLVNN
FT                   DNGTLLASGTGIGAERIVSLGNVSSKKINLIVNATAAPSLAEFEVYNATGVISSSSSSQ
FT                   AVSSSSQPVSSSSVRSSSSSSSSSVVVSSPPSSVSSSRSSSSAQSSVGGLSAACISLAT
FT                   NSNVNWRDTSLQSDQEIVECLSRTLGKPVGYGENALGGYNPSGGSKLTIIRKNTGVSVE
FT                   QQILNAITDNNHNWIVFDKVDFAQPSEIGMYRLGCNNATVQSILGATEAECVNYTQWCS
FT                   KNNISSAACVNEFFNKAMNKSNNPIRNPVIGSNKTIDGRGSEAYFLFSGFAIGKDSTGT
FT                   PTQTANNVILTHLRFQGAGHTEDHYVDPDMIRSTGASRDIWIHKNTFDTTGDSAFDVKV
FT                   GAYNITMSFNKIVDVKRATLHSSSDSHTIDSQIRTTMHHNLFVTRDASYSALGNTLRRV
FT                   PLIRRGTSHMFNNAFINYRKDLLSIRVGASVLQEDNMFVVNRIHQEKSSLAAALAELQS
FT                   NLIRDVNGGNYRGEGNFLWFSDGACNLDQTTKTGFTVSSGTVANLSNNYTAASRTTINN
FT                   WRFAAGQDLVDYLSATAGKYGQYAFNSPLSGDRYYVLGLGKVSCL"
FT   gene            complement(97165..97890)
FT                   /gene="uvs118"
FT                   /locus_tag="CJA_0054"
FT   CDS_pept        complement(97165..97890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvs118"
FT                   /locus_tag="CJA_0054"
FT                   /product="Uvs118"
FT                   /note="identified by match to protein family HMM PF01553"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82716"
FT                   /db_xref="GOA:B3PFD8"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFD8"
FT                   /protein_id="ACE82716.1"
FT                   /translation="MLTLRSLIFTLGYNISGAFAGLIAVIIWPILPYSWRWQIVTCWNR
FT                   FVMFWLRLCCGIRIEIIGEKHRDQYPCVVMAKHQSTWETMFLQYYFGPVSTILKKELLR
FT                   IPFFGWGLASLRPIAIDRSNPVQALKDIKRKGIQRLQQGNNLLIFPEGTRIPVGKAGNY
FT                   ARSGADIAISAGVPIIAVAHNAGEYWPHKHLIKYPGTVRIVISEPITTEGKDRKQLTDD
FT                   IKNWIEGEIAKMPPVRRNG"
FT   gene            complement(97906..98589)
FT                   /gene="uvs117"
FT                   /locus_tag="CJA_0055"
FT   CDS_pept        complement(97906..98589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvs117"
FT                   /locus_tag="CJA_0055"
FT                   /product="Uvs117"
FT                   /note="identified by match to protein family HMM TIGR01656;
FT                   match to protein family HMM TIGR01662"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84029"
FT                   /db_xref="GOA:B3PFD9"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFD9"
FT                   /protein_id="ACE84029.1"
FT                   /translation="MRPSPTGMLASSLQGSIHGVSHLLTPIHEPTPNRSKNMKLIILDR
FT                   DGVINHDRDDYVKSADECVPIAGSIEAIARLHKAGFTLVVATNQAGLAKGRFELEDLEA
FT                   MHEKITLLVEEQGGEIGAIFYCPHHPDDHCKCRKPKPGMLDAIEAEFNTSVESCYFVGD
FT                   SLRDLQAGLQKGCKPVLVKTGKGIKTLAQLANPGEQTDNPLVSLDQVLVVDNLAAAADI
FT                   IIANT"
FT   gene            complement(98641..100719)
FT                   /gene="glyS"
FT                   /locus_tag="CJA_0056"
FT   CDS_pept        complement(98641..100719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="CJA_0056"
FT                   /product="glycyl-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="identified by match to protein family HMM PF02092;
FT                   match to protein family HMM PF05746; match to protein
FT                   family HMM TIGR00211"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83324"
FT                   /db_xref="GOA:B3PFE0"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFE0"
FT                   /protein_id="ACE83324.1"
FT                   /translation="MSADFLVELGTEELPPKNLKNLMNAFAESIQADLTALELSFTSVK
FT                   AYAAPRRLALLVENLASESPSKELVVWGPPAAIAFDKEGQPTKAALAFAEKNGIAASAL
FT                   KAESDGKVEKLVARLAQDGQKTVELLEKVVGDALAKLPIAKRMKWGSKREEFVRPVHWL
FT                   VMLFGSDVVSASVLGLTAGRTTRGHRFHYNQPIELANASDYASVLKNTGYVVADFAERS
FT                   AIIKDQVEAEAKNIGGVAVIDPALLDEVTALVEWPVALTGQFEERFLAVPAEALIASMK
FT                   EHQKYFHVVDANGKLKNYFITVANLQSKDPTQIIDGNERVIRPRLSDAAFFFETDKKTT
FT                   LASLRERLKTIVFQAQLGTIYQKTERVAKLAQFIAGKLKADEASAVRAAELCKSDLVTN
FT                   MVGEFDDMQGIAGFYYALNDGENAEVAAAMNEQYMPRFAGDQLPATATGAIIALADRLD
FT                   TISGIFGIGQQPSGSKDPFALRRASIAVLRLLVEKNLALDLRELLTFAKAQHNNLTVGE
FT                   ELVDQVLGYMLDRFRAMFEDAQIPAEVFQAVNAKQLSQPLDINQRVLAVNEFSKLPQAQ
FT                   ALAAANKRVSNILAKQNADVSAAVNPALLQEEAEKNLAQAVGAKAAVVAPLFASREYTQ
FT                   ALAALADLQPVVDAFFDNVMVMADDPALQQNRLALLQQLRGLFLEVADISYLVPAKN"
FT   gene            complement(100719..101690)
FT                   /gene="glyQ"
FT                   /locus_tag="CJA_0057"
FT   CDS_pept        complement(100719..101690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyQ"
FT                   /locus_tag="CJA_0057"
FT                   /product="glycyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="identified by match to protein family HMM PF02091;
FT                   match to protein family HMM TIGR00388"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82761"
FT                   /db_xref="GOA:B3PFE1"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFE1"
FT                   /protein_id="ACE82761.1"
FT                   /translation="MTEKRYDVSTFQGLILALQDYWARQGCVILQPLDLEVGAGTFHPA
FT                   TFLRAIGPETWNTAYVQPCRRPKDGRYGENPNRLQHYYQFQVALKPSPDNIQELYLGSL
FT                   REMGIDTSVHDIRFVEDNWESPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECYPVTG
FT                   EITYGIERIAMYLQGVDSIFDLVWTINPNGDKVTYGDVFHQNEVEMSTFNFEEADTDYL
FT                   FKSFDFYERESTRLMARNLPLPAYEMVMKASHAFNLLDARHAISVTERQRFILRVRTLA
FT                   RAVAQAYFDSRKTLGFPLAPEALRNELLSLSNTADGVTAEEK"
FT   gene            101967..102533
FT                   /gene="uvs112"
FT                   /locus_tag="CJA_0058"
FT   CDS_pept        101967..102533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvs112"
FT                   /locus_tag="CJA_0058"
FT                   /product="Uvs112"
FT                   /note="identified by match to protein family HMM PF00571"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85171"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFE2"
FT                   /protein_id="ACE85171.1"
FT                   /translation="MKNLTVFALAADDHLVQPEEFEDVHGTTSALAILTDFRSHKPHML
FT                   DAQMEASEALELMLAEDVRTKLVIDEKREFIGVIGIDDLSEHHMALKRIELGVRPDELL
FT                   VRDLMHSRRNIRAIDFDEFAKARVSDVVSTLKKHHQDYLLVVDQEAHHIRGIVSARDIA
FT                   RRLHTPVQIEKELTFVDIFTAVKAH"
FT   gene            complement(102734..103408)
FT                   /locus_tag="CJA_0059"
FT   CDS_pept        complement(102734..103408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0059"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82638"
FT                   /db_xref="GOA:B3PFE3"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFE3"
FT                   /protein_id="ACE82638.1"
FT                   /translation="MQPVATAWLVFTIPLVVVHAAWLWSSLVGAIDWCVPYWSGCTSIS
FT                   KAARSSDALFLFRSAMTLNAGLLILFWLHVAAFLRLNRLAGHSCYWIIGLGVTGALFLV
FT                   VYANFLGYSGEVYRFMRHYGVTVYFGFTVLAQMLLLRQWRQLPGHTGKCQVKAIHGLCW
FT                   WMLLLGLASSGCNLLLPDPLKDMWENIIEWHFALSMNIYFALVALLWQSLGYRQQPLQE
FT                   ST"
FT   gene            103538..104446
FT                   /gene="uvs111"
FT                   /locus_tag="CJA_0060"
FT   CDS_pept        103538..104446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvs111"
FT                   /locus_tag="CJA_0060"
FT                   /product="Uvs111"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85726"
FT                   /db_xref="GOA:B3PFE4"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFE4"
FT                   /protein_id="ACE85726.1"
FT                   /translation="MTQCMKDQLAPLLIKALALLPLGLLRGMGDLIGRLLWWGKGRSAR
FT                   VTRINIAHCFPELSPVEQRQLAIHSLQETAKTAMEAGAIWRHSWPWLERRILAREGEDI
FT                   LRNKLAQGQGVLVLAPHHGNWEVVAPYLASLAHLTAMYQPLKTQAMDDLVLSGRSKLNI
FT                   TMAPTNRKGVMMLFKALQGGTIVGVLPDQVPERDAGSEIAPFFGQPAVTMTLIHGLIQR
FT                   TGCAVCSCYAERVSGGFKMVVMEADPAIYSDNQVQSVAGLNASVEACVRRVPAQYQWEY
FT                   KRFGRLPAHLRNPYKSGDNKN"
FT   gene            104630..105430
FT                   /gene="uvs110"
FT                   /locus_tag="CJA_0061"
FT   CDS_pept        104630..105430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvs110"
FT                   /locus_tag="CJA_0061"
FT                   /product="Uvs110"
FT                   /note="identified by match to protein family HMM PF05618"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82780"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFE5"
FT                   /protein_id="ACE82780.1"
FT                   /translation="MDNCSFFRPGRKTLNLVLWIPLLAGGLMACSSSKQLLINQNALQQ
FT                   CLANQDTHLKQQEEQQRELVASLGALQQQLAEQQKVLESEPRVIEKQTTRVVCPSPVSP
FT                   PAPKVPPAETPVVDKQIVGLQEQVLLTGLNIIMPTRINTNVANSVLDARNIQLFERNSD
FT                   EWVRFTVYNPETKEPHVLERKRLRFQNVTTASATTERRPVVEMRFTVGKLTQKGEFVLA
FT                   DRSTSEFPLLIGRNLLRDVMLVDVSGNNLAPVQRIEEPAPKAQP"
FT   gene            105463..107013
FT                   /locus_tag="CJA_0062"
FT   CDS_pept        105463..107013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0062"
FT                   /product="Gonadoliberin III-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83511"
FT                   /db_xref="GOA:B3PFE6"
FT                   /db_xref="InterPro:IPR025838"
FT                   /db_xref="InterPro:IPR025840"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFE6"
FT                   /protein_id="ACE83511.1"
FT                   /translation="MKKPSRAPFYTIICGLILFGLVTAWLRHSQMEIPLLPGVQQPVWL
FT                   IEARIDFEATGEPVTARLGLPDNPPGFRSVTEQAAAPGYGYSVVSENGVRRGEWSKRGA
FT                   IGLQTIYYKSQFTIGHNDQALALLQQPEVRRVDWDGSSQETAAQQVLEVAWARSSTPQS
FT                   LARELIKQLNSEALDQNAALLLSVSSDKSLLLEKLINQAGIPARPALGLYLEDARRHQN
FT                   LTRLVQVFDGHQWVLFNPYTGEQGVPANLLLWHTGSESILDVAGGTRSRVSFSMIYQTV
FT                   PVLDLIKAKNQNSIFTLVSIQHLPIEEQSMFKLLLLLPIGALVVVFMRIIIGLKTSGTF
FT                   MPILIALAFLQTSLVLGLISFILVVAMGLVLRTYLSRLNLLLISRIATLVVLVIFIISA
FT                   LSLVGYQMGLNTGMTITFFPMIIIAWTIERMSILWEEEGPKEVLVQGGGSLLVAVLAYL
FT                   LMQVPLIGHLTFNFPELNLIALALIMLMGQYTGYKLSELRRFRAMVDNAEADKKGDQP"
FT   gene            107010..108023
FT                   /locus_tag="CJA_0063"
FT   CDS_pept        107010..108023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0063"
FT                   /product="alpha-L-glutamate ligase homolog"
FT                   /note="identified by match to protein family HMM TIGR02291"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84429"
FT                   /db_xref="GOA:B3PFE7"
FT                   /db_xref="InterPro:IPR011758"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR039523"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFE7"
FT                   /protein_id="ACE84429.1"
FT                   /translation="MSKAAKPSLLTSAGITRWWGSWVSPWRLKRMGILGMNCRNHEFIS
FT                   AYNPRSLYPLVDNKLKTKLLAEEYEVATPKLFFVVNSQHEISHIEEKLMALEAFAVKPA
FT                   KGSGGKGILVIIGRRGDNFIKSSGAEITIEDIRRHMSNALAGLYSLGGKPDVVIVEDLI
FT                   KFDDYFKDYSYEGVPDIRIIIFKGYPVMAMLRLATHKSDGKANLHQGAVGVGLDIATGR
FT                   ALGAVQHSIPVTHHPDTGRALNEIQIANWRDWLLIASRCYEMTGLGYIGTDLVLDKERG
FT                   AQLLELNARPGLSIQVANGRGLLPRLRHVESLKARMHRTPEQRVDYVMKTFTADGL"
FT   gene            108133..108696
FT                   /locus_tag="CJA_0064"
FT   CDS_pept        108133..108696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0064"
FT                   /product="putative OmpA-like transmembrane domain"
FT                   /note="identified by match to protein family HMM PF01389;
FT                   match to protein family HMM TIGR03304"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85200"
FT                   /db_xref="GOA:B3PFE8"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFE8"
FT                   /protein_id="ACE85200.1"
FT                   /translation="MKKHILAAAVMLSGSLSVFAEGFYTAAEFTRNKIEADVGDYSVSR
FT                   SENGYGLGVGYNLTSRIALELAYRDLLSFTESDTYEDVEYSSTIDVTAIQFSITGSYPL
FT                   NQQFSLYGRLGAGRIQVESSYYENAWGDIARESDDETKTRALVGIGVRYAITEHVGARV
FT                   EYSRFSKISGTTLSSMHLGIDYQF"
FT   gene            108696..108971
FT                   /locus_tag="CJA_0065"
FT   CDS_pept        108696..108971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0065"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACE86011"
FT                   /db_xref="GOA:B3PFE9"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFE9"
FT                   /protein_id="ACE86011.1"
FT                   /translation="MPDHLSPWSKQLCVVCSTSNPAQNCLMHIKPEAPQLAHSDPEAAR
FT                   HNSGEFIMLVSGIVATASLVGILAALFVASLVLVVVDNRFDANRSH"
FT   gene            109049..110407
FT                   /gene="gt4G"
FT                   /locus_tag="CJA_0066"
FT   CDS_pept        109049..110407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gt4G"
FT                   /locus_tag="CJA_0066"
FT                   /product="glycosyl transferase, putative, gt4G"
FT                   /EC_number="2.4.1.-"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83054"
FT                   /db_xref="GOA:B3PFF0"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFF0"
FT                   /protein_id="ACE83054.1"
FT                   /translation="MFVPMSYQPLSYGQHLARLIQAPAASLPSAHAEAGESPLRIALLG
FT                   YRSHPHVGGQGIYLHYLSKALVDAGHQVDVISGPPYPELDGRVRLIQLPSLDLYAHPAP
FT                   VRALRLRHLRSFTDTYEWWSKLSGAFGEPYCFGRRLLKYFKRHQPQYDIIHDNQSLCYG
FT                   LLALQRRGYKVLATLHHPITRDRDLALATATSKGHAWLIRRWYSFLGMQGRVVQQLDHL
FT                   LTVSRQSVKDIEQAFGRSGADIRVIPNGVDTRIFKPLPAITRIPCRLMTTASSDQPLKG
FT                   LSILLRACAQLRTEFPALHLLVIGKLKPGGSTEQELQALGLNDSVQFVSGISTEQMVEE
FT                   YARASIAVVPSLYEGFGLPAAEAMACGIPLVCSDGGALPEVTGEAARLVAAGDVDALVT
FT                   ALRDLLTNPSECTRLGQAGREHILQQLSWDCVARQMENYYRELLRQGAANAHH"
FT   gene            110394..111143
FT                   /locus_tag="CJA_0067"
FT   CDS_pept        110394..111143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0067"
FT                   /product="Cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /EC_number="2.1.1.79"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83839"
FT                   /db_xref="GOA:B3PFF1"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFF1"
FT                   /protein_id="ACE83839.1"
FT                   /translation="MLTINFRDFPLSAGDRVLDLGCGEGRHAINVYLQERVLSIGVDLN
FT                   LRDLRTAQARAQPFLQADRPHQLIFKQADATGLPFADGSFDKIICSEVLEHIADYHAVL
FT                   REVARVLKPGGLLAITVPRAWPEKICWWLSDEYHQVEGGHIRIFNGHHLRDEIKQQGFH
FT                   YYRRHWAHALHSPFWWLKCLFWKTQDTNPLIKTYHRMLVWDLMEKPWLTQTLEKILNPI
FT                   MGKSLVMYFTKGTTTALRKNTQGEDSP"
FT   gene            111140..112210
FT                   /locus_tag="CJA_0068"
FT   CDS_pept        111140..112210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0068"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82988"
FT                   /db_xref="GOA:B3PFF2"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFF2"
FT                   /protein_id="ACE82988.1"
FT                   /translation="MKNLLLTKGFFPQTLLRPTVDYILRTQLPDGCIPWFVGGKADPWD
FT                   HIEAAMGLTIGGELSAARRAYTWLAKQQLPDGSWWANYAGNDALDKNHRETNFIAYIAT
FT                   GIWHYFLVSGDEVFLAEQFPVVKNAIEFVLRYQSPSGEIYWAVAEDGSAKKDALVTASS
FT                   SIYKSLECAILCAQKLGQDAKAWRTAYLRLGNSLRYHPECFDRTWEPKTRFSMDWFYPI
FT                   LTGVISGKAAQQRIDEKWKTFVETNVGCRCVSDEPWVTVAESCELTLALLAAGEHAKAV
FT                   NLFSWLYQFLDSDGGYWTGYNFRDQVIWPREKTTWTAGAILLAADALTRHTAAANLFLQ
FT                   SGLASTPDELPLTTEH"
FT   gene            112213..112938
FT                   /locus_tag="CJA_0070"
FT   CDS_pept        112213..112938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0070"
FT                   /product="conserved hypothetical protein TIGR00046"
FT                   /note="identified by match to protein family HMM PF04452;
FT                   match to protein family HMM TIGR00046"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84262"
FT                   /db_xref="GOA:B3PFF3"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFF3"
FT                   /protein_id="ACE84262.1"
FT                   /translation="MRIPRIYTNQTLLTGNKVQLEESASHHLSKVLRMQPGRELVLFNG
FT                   AGGEFAATIDEISKRHVTASIAAHNPHNRESPLQLELAIGISRGERFEWVLQKATELGV
FT                   TKITPLMTERTEVKVSGERQEKIMERWQHILISACEQCQRNLLPQLSAPVPITDWLKTV
FT                   DAELRFVLHHRDSQTLPADKKPHSAALLIGPEGGLSDDEIALAKQQEFAALTLGPRVLR
FT                   TETAPIAAISVVQYLWGDF"
FT   gene            complement(112935..113285)
FT                   /locus_tag="CJA_0069"
FT   CDS_pept        complement(112935..113285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0069"
FT                   /product="peptidyl-prolyl cis-trans isomerase, FKBP-type"
FT                   /EC_number="5.2.1.8"
FT                   /note="identified by match to protein family HMM PF00254"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83556"
FT                   /db_xref="GOA:B3PFF4"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFF4"
FT                   /protein_id="ACE83556.1"
FT                   /translation="MTGSLTELIIEDLQPGSGKAVVKGALITTHYTGWLEDGTEFDASH
FT                   KKGKPFQCVIGTGRVIKGWDQGLLGMQVGGKRKLRVPAHLAYGERQVGPLIKPHSNLVF
FT                   EIELLEVLTRDD"
FT   gene            complement(113367..113981)
FT                   /locus_tag="CJA_0071"
FT   CDS_pept        complement(113367..113981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0071"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85545"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFF5"
FT                   /protein_id="ACE85545.1"
FT                   /translation="MLTTRPGFNLLSAAALAAFFLLQGCGAERDTPFNPGTGSSSASSS
FT                   LGPSISGSERIAEGTTPSTTPTDLNKKLIAIRTAAELDDLWTDYVGSTGWDTDIVDFEE
FT                   GQVLLIDRGQIGNCERLITFDSIRVYDHSANTVKVVVRYNDSGKSSSSSNSSSSSSSSS
FT                   SSSSSAYSEPDCDAGLGTPNQPFRFYYIPSRKVMIFQEDIL"
FT   gene            complement(114019..114498)
FT                   /locus_tag="CJA_0072"
FT   CDS_pept        complement(114019..114498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0072"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84715"
FT                   /db_xref="GOA:B3PFF6"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFF6"
FT                   /protein_id="ACE84715.1"
FT                   /translation="MKANQRIEKKVQEVASLLIPLHERLLLVPNVTVAEIVPVTQVTAI
FT                   QDAPEWYLGNCVWREQTIPLLSLEALNGDARPSFNNRSRFAVFNTTGLHESLPFIALLT
FT                   QGIPRLARVNEEEISEREDMDNKPFELMHVSWAGEEAIIPDVAALERHFLDYLHL"
FT   gene            complement(114520..115419)
FT                   /gene="cheB"
FT                   /locus_tag="CJA_0073"
FT   CDS_pept        complement(114520..115419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheB"
FT                   /locus_tag="CJA_0073"
FT                   /product="protein-glutamate methylesterase CheB"
FT                   /EC_number="3.1.1.61"
FT                   /note="identified by match to protein family HMM PF01339"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83975"
FT                   /db_xref="GOA:B3PFF7"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFF7"
FT                   /protein_id="ACE83975.1"
FT                   /translation="MGIVVDSAAKQQALAQLVAQSGHQLCCQLLIKTDTEALPHPLLDA
FT                   WLVDVAQDYPDDHHLFEQLFNDSRIPVIVSDSDEYPINSEEYRACLRRTAQRLRRLSSD
FT                   INLQQATPARDLWILGASTGGPAAVKRFLSRLPDNLGVAFLYVQHIDHQQTAPLNRMMN
FT                   SAGGYPAMVASPGMVLEPNRLILVTALDRVEILDNRTLAVSHGEGWKGNYAPSIDQMCA
FT                   NAARVYRQHCGLIIFTGMGDDGAASCRLIKQLGGQVWVQTPTECTSDSMPLSALATGCV
FT                   GYIGSPEALAHTLTQQYR"
FT   gene            complement(115439..122449)
FT                   /gene="pilL"
FT                   /locus_tag="CJA_0074"
FT   CDS_pept        complement(115439..122449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilL"
FT                   /locus_tag="CJA_0074"
FT                   /product="type IV pili sensor histidine kinase/response
FT                   regulator PilL"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF01584; match to protein
FT                   family HMM PF01627; match to protein family HMM PF02518;
FT                   match to protein family HMM PF02895"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACE86054"
FT                   /db_xref="GOA:B3PFF8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFF8"
FT                   /protein_id="ACE86054.1"
FT                   /translation="MRPMADNRNFAALDWLIHEIGETLKEARQSLENYVENPNDAARIR
FT                   FCLTHIHQVHGSLQMVEFYGAAMLASEMEQLTQAMIAGKVANSTEAQEVLMRAILQFPL
FT                   YLDQVKATRKDNPLVVLPLLNDLRAVRGESLLTDTKLFVPNLAPARKVSGARLPVTNDN
FT                   VQFQAMVLKLRQMYQYAASGFIRDINPEENLAYLHKAFARLQKLTHGTARFALWDICLA
FT                   LVEALEIDALEISVAVKNLLRQLDKEIKILAVHGIKALNSFTNDELIKNLLYYVARAGK
FT                   HAPGFAPDSNLQRIYDTYNLEQALLEGKEAGDDAQNMISAPDADAMRSVVGALKDELGI
FT                   IKEALDVCLNGGDAQQALGSALPIVKRVADTLAVLGLGDLRKHILEQGAALELVADARS
FT                   ELSQDQLMAVAGQILALENALDNLLEKGGQAPQETILDADITLARAKDSVLRESRNGLE
FT                   HAKDAIIEYIASQWNREHLQQVPDILREIRGGLDIVPLPRPARILGACARYIEEKLLQE
FT                   EATPQWSTLDTLADAITSVEYYLERLSSGARKEENDLLLSVAEESVATLGYAVAKTSRP
FT                   QAAASTPVDIPEVPAADTVPETPGVGLAPEHSLEMDPATELSSYDEPAVIDDDQATTSL
FT                   EQDSEQLSALYAQSAVTADHDDNQAASLASAYAQATAPSAGTEPATDGDTWDIATSHDT
FT                   SLETEEQINEAPVDLADTTGDLADTAGGDAPEESHHQEDEPEEEPTLIRTSNAPVIERD
FT                   NEDIDDEIIEIFIEEAGEVTETIGEYFPRWAQNFDDKYSLTEFRRAFHTLKGSGRMVGA
FT                   NEIGELAWSIENMLNRVIDHTIEPGQIHVNLIRGVVALLPDMIDAFRLDQPNPHAAQAE
FT                   SYRQQAHQLAQGLAPTPPAANATVDEPEPIADILLEEVPADEIQPESTADAFAVTDHLE
FT                   LGHLELDDTDTLAPTSDDELDDLSQALAELAEAQAIGEDEELHELAPAETSEDTLLDME
FT                   LVDGDSLDEPSSAEDIVLENLPGLEVIEETAIDTDSQEQQLRASYANLELDSEDDIDDP
FT                   DAQLWDIFGTEALYHLQVVQQFIAHMEAEAPIYEPPSEAMQRALHTLKGSAHMAEITQV
FT                   AELATPLERFVKELRSYQVNINDDILQLLRDAVSYTQVALDQIKAGEEVNIPRLQQFVA
FT                   RVNELREIHVAPLVRQQELDEHGKRPIDPELLAIFMAEEMNLLLDADQIIAHWRTAPED
FT                   TRQLVPVMEELRKLTQAAAHAYLPVMAELGEKLQSVYEAILAQQLSCDHSLCNALNHAH
FT                   TALLDMVDAIAAGQNLQAIPEAVNAELDELLSNEVVTLAALTQDAFHIEELVDEPYSGD
FT                   ETIAALESPDLPDDGFPAQEASISAAGDGDDFSAIPELESEFILDEDIEPVALDFFVDD
FT                   DLASSPEASETRFDDILLEDIAPIDEVALPVTSLDQPWVEEAPEAAVPETIAPEVSIPE
FT                   AVVEEVIEPATVEAEPENIAAYSAVAELDEDFDPEIVEIFIDEAGELLEDIDRALQDWQ
FT                   DDWNNSDSVEELKRCLHTFKGGARLAGLVDLGDQSHDFETMLIDMDRNTELDQAFFRRV
FT                   NGYQDQLHAGVEQVRARLNGEAIPSQAPAVTPVSSYPVSEQPMGDQDLTLEDIPTLSAD
FT                   DVEELEDEPTTFERPGYSKPTIVVDNTREQPSDDAQELSSDKPNVLTFAPKAKPAPTNL
FT                   PKVPGSEFGGLRGTGAQSQHLAARRSGPQEVVKVSAELLEELVNLAGETSISRGRMEQQ
FT                   VSDLSHAIDEMDSTIERLQEQLRRLDIETEAQILFRQEQMAQHEEFDPLEMDRYSQLQQ
FT                   LSRSLIESASDLMDLKYTLADKTRDTETLLLQQSRINTDLQEGLMRSRMVPFSRLVPRL
FT                   RRIVRQAATELNKEVDFDLDNVEGELDRTVLERMVAPLEHMLRNAVDHGIELPDERTAA
FT                   GKSANGRILLSLGREGGDVIIRLIDDGRGINLKRVREKAIERGLMSPDAQLSDQDVIQF
FT                   ILHAGFSTAEKVTQISGRGVGMDVVHSEIKQLGGAMFIDSEWGQGTEFTIRLPFTVSVN
FT                   RALMIQIGDDLYAIPLNTIEGIVRVSPFELEHYYQEPDARFEYASEEYLVRYLGTMLDS
FT                   SAQPKLDGQSLPLPVVLVRSAENTVALQVDRLLGSREIVVKTLGAQFSAVRGVSGATVM
FT                   GDGSVVVILDLHALIREQLALGSHQAVLLEAPSILSLPEEDTSEKTVMVVDDSVTVRKV
FT                   TGRFLEREGFRVLTAKDGAEAIQLLQDHMPDVMLLDIEMPRMDGFEVAKTIRGSSRLKH
FT                   LPIIMITSRTGEKHREHAFSLGVNKYMGKPYQEDLLLENIRELLKHAVK"
FT   gene            complement(122459..123382)
FT                   /gene="pilK"
FT                   /locus_tag="CJA_0075"
FT   CDS_pept        complement(122459..123382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilK"
FT                   /locus_tag="CJA_0075"
FT                   /product="type IV pili chemotactic methyltransferase PilK"
FT                   /note="identified by match to protein family HMM PF01739"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85130"
FT                   /db_xref="GOA:B3PFF9"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036804"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFF9"
FT                   /protein_id="ACE85130.1"
FT                   /translation="MSLPDYRYPDKAPGPRSLISICMAWSLRTLPTLSEDQFSQWGKLL
FT                   EERTGIQLVFQQKAWLESQMSSRMRELGFEDYDHYYLYVTHGLEGKLEWTRLIDRIAVK
FT                   ETSFFRHRDSIEYVRQYLQNKINNQTLHNSFDVWSLGCATGEEPYSLAMVINDCFELAM
FT                   LDPYYGITAMDISSSALAAGRKARYSKRRIEQIKPEEIKRYMHQCADGSFEVVGKLRDR
FT                   VCFTQANIIHARQLPHVKVDVIFCQNLLVYFRRWLRRDVLNALIDRLKPGGLLVVGLGE
FT                   TVDWEHPLMQRTTDDQVQAYIRAEQE"
FT   gene            complement(123436..125601)
FT                   /gene="pilJ"
FT                   /locus_tag="CJA_0076"
FT   CDS_pept        complement(123436..125601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilJ"
FT                   /locus_tag="CJA_0076"
FT                   /product="twitching motility protein PilJ"
FT                   /note="identified by match to protein family HMM PF00015"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85963"
FT                   /db_xref="GOA:B3PFG0"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFG0"
FT                   /protein_id="ACE85963.1"
FT                   /translation="MKTDSKITAFRAKPAMVVAVAVLVLSIILMVIAFIIVQRDAANDQ
FT                   RYVQQVADLRAQAYQLTSLSRDATSGDDKAFDELNSVVTGMGRTWDTLRASDERTRRVL
FT                   SPEFSNYEGIWGRVKTNAQAIATNKDLIVSLNNVGKTLNENLPTLQTEHNNIVDILLES
FT                   NAPAEQAIQAQLLSWRAERIGRNVDKMLRGDADASEAADQFNRDANFYSRVLTAMKSGD
FT                   VMLGISRVTDNNARASLDQITNLFEGVNKSIQEMFEGSTTLFRARQAAEALLTDTPQLL
FT                   QALASIQDKISVQANSRFPNNYHILACAGLALIALFFIGFNLYRGARLRADETAETNER
FT                   NQTAILRLLDELADLADGDLTTTATVTEDFTGAIADSINFTIDQLRILVARINETAVNV
FT                   SAAAQETQQTALHLAEASEHQAQEIAGASAAVNEMAVTIDQVSANAAESAAVAERAVSI
FT                   ASNGAKVVQNTIHGMDTIREQIQDTSKRIKRLGESSQEIGDIVSLINDIADQTNILALN
FT                   AAIQASMAGDAGRGFAVVADEVQRLAERSAAATKQIEALVKTIQNDTNEAVISMEQTTS
FT                   EVVRGARLAQDAGVALEEIENVSTSLAELIQNISNAARQQASSAGHISNTMNVIQEITT
FT                   QTSAGTSATAQSIGHLAEMALDLRESVAGFKLPEEDMSEARAQAAQAAMAKAPAMDFEQ
FT                   PEELEEIIDLDDELLPEDDVYPQTSRA"
FT   gene            complement(125707..126282)
FT                   /gene="pilI"
FT                   /locus_tag="CJA_0077"
FT   CDS_pept        complement(125707..126282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilI"
FT                   /locus_tag="CJA_0077"
FT                   /product="Protein pilI"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85137"
FT                   /db_xref="GOA:B3PFG1"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFG1"
FT                   /protein_id="ACE85137.1"
FT                   /translation="MPGGTVRIQLLMSEPQAAFQALLHLAQTSRAAARGLPAQADIRPQ
FT                   WSGIGFSLMGSLFVAPIGEVSEMLEVPSYTHLPGVQPWVRGVANVRGRLLPIFDLAHFF
FT                   GDRLGGSRKQRRVLILETETLYSGLMVDQVFGMQHFPMDEYSEEAGTVADSILPFVTGS
FT                   YPQGEQRWSLFRPALLAEESRFTNAAKS"
FT   gene            complement(126372..126734)
FT                   /gene="pilH"
FT                   /locus_tag="CJA_0078"
FT   CDS_pept        complement(126372..126734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilH"
FT                   /locus_tag="CJA_0078"
FT                   /product="twitching motility protein PilH"
FT                   /note="identified by match to protein family HMM PF00072"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84490"
FT                   /db_xref="GOA:B3PFG2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFG2"
FT                   /protein_id="ACE84490.1"
FT                   /translation="MARVLIIDDSPTETYKLTSMLEKNGHVVLTADNGEAGIALAQKEL
FT                   PDVVLMDVVMPGLNGFQATRQLSKMPETAHIPVIIVTTKDQQTDRVWGMRQGAKAYLAK
FT                   PITQEVLMSAMAEVMR"
FT   gene            complement(126719..126856)
FT                   /locus_tag="CJA_0079"
FT   CDS_pept        complement(126719..126856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0079"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85196"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFG3"
FT                   /protein_id="ACE85196.1"
FT                   /translation="MPVAMTRFTLLTASNSLDRTPKDCLMSTALCAAIILFLEHLWPEY
FT                   "
FT   gene            complement(126864..127259)
FT                   /gene="pilG"
FT                   /locus_tag="CJA_0080"
FT   CDS_pept        complement(126864..127259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilG"
FT                   /locus_tag="CJA_0080"
FT                   /product="twitching motility protein PilG-Pseudomonas
FT                   aeruginosa"
FT                   /note="identified by match to protein family HMM PF00072"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82944"
FT                   /db_xref="GOA:B3PFG4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFG4"
FT                   /protein_id="ACE82944.1"
FT                   /translation="MEVTYESLKVMVIDDSKTIRRTAETLLKKAGCMVITATDGFDALA
FT                   KIADTRPDIIFVDIMMPRLDGYQTCALIKNNSEFKTTPVIMLSSKDGLFDKAKGRIVGS
FT                   DQYLTKPFSKSELLGAIEAHVKHLKAS"
FT   gene            127605..128558
FT                   /gene="gshB"
FT                   /locus_tag="CJA_0081"
FT   CDS_pept        127605..128558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gshB"
FT                   /locus_tag="CJA_0081"
FT                   /product="glutathione synthase"
FT                   /EC_number="6.3.2.3"
FT                   /note="identified by match to protein family HMM PF02951;
FT                   match to protein family HMM PF02955; match to protein
FT                   family HMM TIGR01380"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85842"
FT                   /db_xref="GOA:B3PFG5"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFG5"
FT                   /protein_id="ACE85842.1"
FT                   /translation="MAISLGVVMDPIADITFYKDTTLALLLAAQARGWSLHYMEQGDLY
FT                   IQQGEARAGMRSLSVADNADGWFELGARADCKLGDLDVILMRKDPPFDNEYIYSTYILE
FT                   AAQQQGALVVNDPRSLRDCNEKLFATQFPQCCPPLLVSRDMVRLREFHQSQGDVIFKPL
FT                   DGMGGSRIFRCRADDPNVGVILETLTDFGRQLTMAQRYIPAISQGDKRILVVDGEAVPY
FT                   CLARIPAQGETRGNLAAGGRGVAQPLSERDQWIVSQVAPSLKARGLMFVGLDVIGDYLT
FT                   EINVTSPTCAREIDKAYGTGIGARLMDAIEPKLAAR"
FT   gene            128581..129480
FT                   /locus_tag="CJA_0082"
FT   CDS_pept        128581..129480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0082"
FT                   /product="TonB family C-terminal domain protein"
FT                   /note="identified by match to protein family HMM TIGR01352"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84532"
FT                   /db_xref="GOA:B3PFG6"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFG6"
FT                   /protein_id="ACE84532.1"
FT                   /translation="MEDVDLKPVVETGDRLSFTLFMALVIHGLILLGIDFKLPEHSNHS
FT                   QTIEITLATHNALRAPDDADFLAQHNQEASGTIDEAKQLTTVKQAEFADTQVRDVNPIP
FT                   QQQAAAIQQRDQQLVTTRGQSQFQAQIKPYPDEQEEREQIDGLVENQPMISAEIASLQA
FT                   KLDQQRQEYARRPRIRTLTSVSTKASFDAKYLHDWSTRIEQVGTRHYPGEALRRHITGQ
FT                   LRLSVVINPDGSIYEVNILQSSGQRLLDDAARQIVRLASPFAAFPPEIRQHTDRLQIIR
FT                   TWNFEISGGSSTITTSAN"
FT   gene            129498..130142
FT                   /locus_tag="CJA_0083"
FT   CDS_pept        129498..130142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0083"
FT                   /product="Uncharacterized ACR"
FT                   /note="COG1678; identified by match to protein family HMM
FT                   PF02622"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83681"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFG7"
FT                   /protein_id="ACE83681.1"
FT                   /translation="MQIPTCFDHIRPHTFCMNDKILSNATYDELTPGSLRDHFLIAMPG
FT                   LNDSSFAHTVTYICEHSDKGAMGLVINTATPMQLREIFAQMELEDLADVGDQIVMAGGP
FT                   VQTERGFVLHPGDSKWQSTLEVSPDISLTASRDIIVALAEGRGPREYLITLGYAGWGEG
FT                   QLEAEIAANSWLTVPANRNIIFNTPFEQRWTAAAQALGIDVNLITSTAGHA"
FT   gene            130146..130577
FT                   /locus_tag="CJA_0084"
FT   CDS_pept        130146..130577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0084"
FT                   /product="conserved hypothetical protein TIGR00250"
FT                   /note="identified by match to protein family HMM PF03652;
FT                   match to protein family HMM TIGR00250"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83326"
FT                   /db_xref="GOA:B3PFG8"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFG8"
FT                   /protein_id="ACE83326.1"
FT                   /translation="MVKTLLAFDYGTKNIGVATGQTIIRSASSLPGLRARDGVPDWNEI
FT                   EALLKTWQPDLVLVGLPLNMDGSESELSARARKFANRTQGRFGVKVEMVDERLSSFEAK
FT                   GEVMERGGSRDYRHNPVDSIAARLILEAWLERQLRLPPV"
FT   gene            complement(130589..130915)
FT                   /locus_tag="CJA_0085"
FT   CDS_pept        complement(130589..130915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0085"
FT                   /product="Domain of unknown function (DUF1508) family"
FT                   /note="identified by match to protein family HMM PF07411"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACE86308"
FT                   /db_xref="InterPro:IPR010879"
FT                   /db_xref="InterPro:IPR036913"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFG9"
FT                   /protein_id="ACE86308.1"
FT                   /translation="MAGWYELTKNDKEQYHFVLKAGNGEVILRSETYESKAAAQNGIAS
FT                   VQKNSPLDERYERKISSNDKPYFNLKAANHQIIGTSQLYSSAAARDNGIESVKTNGPAT
FT                   TIKE"
FT   gene            complement(130948..132093)
FT                   /gene="pilU"
FT                   /locus_tag="CJA_0086"
FT   CDS_pept        complement(130948..132093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilU"
FT                   /locus_tag="CJA_0086"
FT                   /product="twitching motility protein PilU"
FT                   /note="identified by match to protein family HMM PF00437;
FT                   match to protein family HMM TIGR01420"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85164"
FT                   /db_xref="GOA:B3PFH0"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFH0"
FT                   /protein_id="ACE85164.1"
FT                   /translation="MDFDRLLSLMVEKGASDLFITAGVPPSIKLHGKVVPVTATPLAPE
FT                   KARELVLSVMNEKQRAEFLDKKELNFAVSARGIGRFRASAFYQRNLAGMVLRRIETKIP
FT                   QIDELGLPEIIKELAMTKRGLIIFVGATGTGKSTSLAAMIGHRNQNSKGHIISIEDPIE
FT                   FIHQHQGCIITQREVGIDTESFEVALKNTLRQAPDVILIGEVRSRETMDHAIAFAETGH
FT                   LCLCTLHANNANQALDRIIHFFPADRHRQLWMDLSLNLKAIVAQQLIPTPDGNGRRACL
FT                   EIMINTPLMQDLIRKGEVSELKELMKKSTELGMQTFDQALYDLYDTGDITYEDALLHAD
FT                   SPNDLRLMIKLASETDANYLSHAADSLSIQGDEHSNRGRMF"
FT   gene            complement(132115..133149)
FT                   /gene="pilT"
FT                   /locus_tag="CJA_0087"
FT   CDS_pept        complement(132115..133149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilT"
FT                   /locus_tag="CJA_0087"
FT                   /product="twitching motility protein"
FT                   /note="identified by match to protein family HMM PF00437;
FT                   match to protein family HMM TIGR01420"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85955"
FT                   /db_xref="GOA:B3PFH1"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFH1"
FT                   /protein_id="ACE85955.1"
FT                   /translation="MDITELLAFSAKQGASDLHLSAGLPPMIRVDGDVRRINLPPMDHK
FT                   QVHGLIYDIMNDKQRKDYEEFLETDFSFEVPGVARFRVNAFNQNRGAGAVFRTIPSKVL
FT                   TMEELGMGNVFRDICAVPRGLVLVTGPTGSGKSTTLAAMIDYINDNRYEHVLTIEDPIE
FT                   FVHESKKCLINQREVHRDTHGFNEALRSALREDPDVILVGEMRDLETIRLALTAAETGH
FT                   IVFGTLHTTSAAKTIDRIVDVFPANEKSMVRSMLSESLQAVISQTLLKKNGGGRVAAHE
FT                   IMRGTSAIRNLIREDKVAQMYSAIQTGASLGMQTMDQCLADLVARRVISREAAKTKAKF
FT                   PENF"
FT   gene            133093..133899
FT                   /locus_tag="CJA_0088"
FT   CDS_pept        133093..133899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0088"
FT                   /product="conserved hypothetical protein TIGR00044"
FT                   /note="identified by match to protein family HMM PF01168;
FT                   match to protein family HMM TIGR00044"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85091"
FT                   /db_xref="GOA:B3PFH2"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFH2"
FT                   /protein_id="ACE85091.1"
FT                   /translation="MQVRRALFSAEGQEFGDIHLGNLLLSLGGADLFEESVQLDMHKID
FT                   DKLAKVTERIHQAAILAGRDPQTVQLIAVSKTQPPAAIAEAYAWGQRRFGENYLQEALD
FT                   KQQALHALDDLQWHFIGPIQSNKTRLIAAHFAWVHSVDRLRIAQRLNDQRPEGLPPLEI
FT                   CIQVNIDDEDTKSGVNLAELPALALAIQPLKRLRLRGLMAIPVATSDTQQQRASFSRLR
FT                   LAVAALNRQGLALDTLSMGMSGDLEAAIAEGATFVRVGTDIFGARQ"
FT   gene            133949..134770
FT                   /gene="proC"
FT                   /locus_tag="CJA_0089"
FT   CDS_pept        133949..134770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="CJA_0089"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="identified by match to protein family HMM PF01089;
FT                   match to protein family HMM TIGR00112"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84381"
FT                   /db_xref="GOA:B3PFH3"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFH3"
FT                   /protein_id="ACE84381.1"
FT                   /translation="MHTPKIAFIGAGNMARAIIGGLLAEGFDRTQISASGPRQETLDKV
FT                   AAEFSIPVSIDNLATAAAADVVILGVKPQVLKEVALALKPALGHKPLLISIAAGITTQS
FT                   LAQWLGEDQAIVRCMPNTPSQLRAGASGLFANARVSDGQKSIANSILGAVGIVQWVKDE
FT                   AQLNPVTAVSGSGPAYFFLVMEAMIEAGVKLGLERECATELTLQTAMGAAMLAKSSDLE
FT                   VAELRRRVTSPKGTTEQAILSFERDDIRGIVERAMGACSQRAQELSELLGQ"
FT   gene            134794..135375
FT                   /locus_tag="CJA_0090"
FT   CDS_pept        134794..135375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0090"
FT                   /product="YGGT family protein"
FT                   /note="identified by match to protein family HMM PF02325"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83098"
FT                   /db_xref="GOA:B3PFH4"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFH4"
FT                   /protein_id="ACE83098.1"
FT                   /translation="MQTLAEIAIYLVRTIGSIYLMIVLLRFLLQLVRADYYNPISRFIV
FT                   KATNPLLVPLRKIVPGFWGIDFACLMLALLVQIIILQAIILIAGAGWQNPLLLLPWSVV
FT                   GILGLLASVYFWALLIMVIASWIAPYSDNPGLSLLRQLIEPSLAPIRKILPNMGGLDFS
FT                   PMVALMLLHIFNQYIMPSLANAMGVPGGLL"
FT   gene            135376..135681
FT                   /locus_tag="CJA_0091"
FT   CDS_pept        135376..135681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0091"
FT                   /product="conserved hypothetical protein TIGR00251"
FT                   /note="identified by match to protein family HMM PF02594;
FT                   match to protein family HMM TIGR00251"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85887"
FT                   /db_xref="InterPro:IPR003746"
FT                   /db_xref="InterPro:IPR005228"
FT                   /db_xref="InterPro:IPR036591"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PFH5"
FT                   /protein_id="ACE85887.1"
FT                   /translation="MVGQAGHYRWQGEDLILHCQLQPKASGDDIVGVHGDRLKIRITAP
FT                   PVDGKANEYLIKWLSKQFRVPKGNIKILQGELGRHKTLGIHAPRHLPEEAHICFPK"
FT   gene            135849..137870
FT                   /locus_tag="CJA_0092"
FT   CDS_pept        135849..137870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0092"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84824"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFH6"
FT                   /protein_id="ACE84824.1"
FT                   /translation="MDVKTLHRQMNHYNRWRRQLDERLQRFEAWNQAQGTAAPGALKTL
FT                   QRARQLLRSETFTIACVGEFSRGKTELINALLYIGGGRRLLPSQPGRTTMCPTEIYWDP
FT                   RQPANCVRLLPIETRRTNTSLQNFKRIPQNWITIHFDAADPEQTRAAINQVSASKQVTA
FT                   AEAVKLGFAANELGERDADGLVTIPAWRHALISLDHPLLRQGLRIVDTPGLNALGNEPE
FT                   LTLKTLPDAQAILFLLSADAGVTASDMAIWREHIQSLRDDNCTAVIALLNKIDSLWDDL
FT                   TPPAEVDTNILRLRQLTAQQLDLAAEHVVAISAKQGLLGKVGRKREQLVRSNFPQLERM
FT                   LSEAVLRHQQQVIGHRLIGDSYSLVASTRNSLSRRLQAAEAELDELRNTAPREAAEKLN
FT                   ELRDTIRRAHHDYHKQALSLRTSQRLLESQETALLAPVSQVLLERQIDEAHRKLAQSWT
FT                   TLGLSRAIGEFFDDVDNNIRHLEREMERSNKVLTSIFERPEHGYSADQLVMRHLLKIQK
FT                   QRRQLNQLHHRADEFRKSLTSVLMHKGALITRFINTLVQEVRNVYADLNQHVRSWIAEA
FT                   LTPLFHHNQYQKQLLEHHMLRLTQLQTQRNSFSEQLESLQTNIYQLQASLAALEPLYRD
FT                   LLTNPLLPESMADGVMQEDNVGAQVVSINQGRQLLRGS"
FT   gene            complement(137928..138107)
FT                   /locus_tag="CJA_0093"
FT   CDS_pept        complement(137928..138107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0093"
FT                   /product="Tetraacyldisaccharide-1-P 4-kinase"
FT                   /note="identified by match to protein family HMM PF03966"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83738"
FT                   /db_xref="GOA:B3PFH7"
FT                   /db_xref="InterPro:IPR005651"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFH7"
FT                   /protein_id="ACE83738.1"
FT                   /translation="MLSPKLLAILVCPVSKAPLDYRPEQQELVCKTSGLAYPIRDGIPV
FT                   MLEYEARRLAPEER"
FT   gene            complement(138199..138639)
FT                   /locus_tag="CJA_0094"
FT   CDS_pept        complement(138199..138639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0094"
FT                   /product="Excinuclease ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82735"
FT                   /db_xref="InterPro:IPR035439"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFH8"
FT                   /protein_id="ACE82735.1"
FT                   /translation="MNFITRSIAFIALATCAATTLARDDIQEYSIAEALSTEQAKNILG
FT                   TSVKFYFGNQPHGAIVKKYGEFGTNKKTNGVGKSDKQACEWAFLSAMKSLRERAEREGA
FT                   NAVVNIRSNYRNATTSSTDTFKCGSGAIMSGVALLGDVVELK"
FT   gene            complement(138686..139108)
FT                   /locus_tag="CJA_0095"
FT   CDS_pept        complement(138686..139108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0095"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83630"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFH9"
FT                   /protein_id="ACE83630.1"
FT                   /translation="MNRQQIAQLIPHGDAMCMLDEVVAWNSEHIHCRSYLVNMTANPLC
FT                   EHGQLDTVLLIEYGAQAAAVHAALVQSHLGEMRPAYIGAVKDIELLGAISDNSTPLELH
FT                   AQCLLNNRQGAIYELLATQADIPLLRGRLLLNQPQI"
FT   gene            complement(139105..139923)
FT                   /locus_tag="CJA_0096"
FT   CDS_pept        complement(139105..139923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0096"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82828"
FT                   /db_xref="GOA:B3PFI0"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFI0"
FT                   /protein_id="ACE82828.1"
FT                   /translation="MLTCYLHCIGLAAPGLPDWRTSTAVLQGTEPYRPTPLEKYKPALL
FT                   PANERRRATELVRMAFRVCEDLAAASHIPMDTCASVFASSGGDYPIIDQICRSLCEPER
FT                   LVSPTQFHNSVHNSAAGYWSIATASRQPSTSLSGYDDSFIAGLQEAMGLCQEEQLPTLL
FT                   AVYDIQPPYPLSSKRYIPVEFGVALLLTPHARGQNLARLQLRLDNSGNNTGSPATQAGL
FT                   ESLRLANPAARSLPLLELVAQNRAGHLVFTSDQQQSLLLDVEPLNAIERP"
FT   gene            complement(139923..141107)
FT                   /locus_tag="CJA_0097"
FT   CDS_pept        complement(139923..141107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0097"
FT                   /product="Beta-ketoacyl synthase"
FT                   /note="identified by match to protein family HMM PF00109;
FT                   match to protein family HMM PF02801"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83380"
FT                   /db_xref="GOA:B3PFI1"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFI1"
FT                   /protein_id="ACE83380.1"
FT                   /translation="MIFGKMTPLRITSYTYTTCLGAGLNANWDAIQAGRSGLQPCTFFR
FT                   INDLDTWVGEVAGLDQALPPSLAEFDCRNNRLSWLALQQDGFITRAQSAIARYGAARVG
FT                   IFIGTSTSGIHQTELAYFANQDPLPAWYQYRTTHNVSSVATFVRAALGASGPAIAISTA
FT                   CSSSAKVFASAQRALNTGLCDAAIVGGVDSLCLTTLYGFHALQLISPRKCQPFDSQRSG
FT                   ISIGEAGGFALLEKTGDSNLCLLGYGESGDAYHMSSPHPEGAGAQLAMGAALRKAGLDT
FT                   SAIDYINLHGTGTQTNDSAEARAVQQLFGNTTPASSTKGWTGHTLGAAGIVEACIALEA
FT                   INYHYLPQSLHLQDVDEGMDIALLKHPETRPVARVLSNSFGFGGSNCSLILGSH"
FT   gene            complement(141070..141999)
FT                   /locus_tag="CJA_0098"
FT   CDS_pept        complement(141070..141999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0098"
FT                   /product="acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACE86303"
FT                   /db_xref="GOA:B3PFI2"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="InterPro:IPR014548"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFI2"
FT                   /protein_id="ACE86303.1"
FT                   /translation="MTDTPGARQWQAQRERGTPFLLNLLTWVALHLGRRMVFIWLKVIV
FT                   FYYFLFAREARRASRHYLQRVFGRQARWWEVYRHLLTFAQVAIDRIFFLAGHEHQFDVH
FT                   IHGNSLFKHYQNRGCFLVTAHIGSFDAMRVMGMGKRKDALPIRILLDIQHNANIMQLLH
FT                   KLDPQLAAGVIDARTPAAELALILNEAINQGQLIGIMADRCARGERHTSLDFLGSQARF
FT                   PAGVWQLASLLKAPIISCFGIYSGANRYDLYFQLISEQLGTHRHERAAAIDAGMATYVA
FT                   QLQHLVRQYPYNWFNFYDFWQDDSSAHH"
FT   gene            complement(142293..143675)
FT                   /gene="pigH"
FT                   /locus_tag="CJA_0099"
FT   CDS_pept        complement(142293..143675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pigH"
FT                   /locus_tag="CJA_0099"
FT                   /product="AMP-ligase"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82981"
FT                   /db_xref="GOA:B3PFI3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFI3"
FT                   /protein_id="ACE82981.1"
FT                   /translation="MPVTHPLTMLPALALNHPVALIEPYIPDQVLAIHKGRQITQAGFL
FT                   QELQQVAAHLPDAGFVFNLCEDRYHFLLGFCAILLRGAVNLLPPNRQPVTLAELAQDYP
FT                   GCYCLVDQAQDLHSQLPSTNIVAILAGITPAAAGPVPTIPAQQLAAVAFTSGSTGKSRP
FT                   NAKCFGTLAATARLLGARFSHNLPTPRLVGTVPPQHMYGLETTLFMVLQAGCAMYSGKP
FT                   FYPADVQQLLLHIAEPVILITTPIHLRALVSAGLDMPGLAGIISATAPLDPVLATAAEH
FT                   CFQAPLWEIYGCTEAGSMATRRPTQTTHWQLLDGFHLEVDDEGALARAPHLPDAAPIQD
FT                   QLSLVANDTFLLCGRNADMINVAGKRASLAHLTLQLLQVEGVTDGVIFLPPHTGHTELR
FT                   PVALVVSDLPEKQILAALALRLDAALLPRPLRKVAALPRNETGKLTAAALHHLWEQTHA
FT                   RP"
FT   gene            complement(143687..144295)
FT                   /locus_tag="CJA_0100"
FT   CDS_pept        complement(143687..144295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0100"
FT                   /product="ketosynthase"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83119"
FT                   /db_xref="GOA:B3PFI4"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFI4"
FT                   /protein_id="ACE83119.1"
FT                   /translation="MLKRVITLALIAAYPLLVHLSLVLAMPPLLFIAPILFLTGAFLPG
FT                   LSSGNKSAWLWFSSLSGLIVLLEYLDMTLYLLFLPPILIPLLLLVIFGRTLRRGSEPLI
FT                   TAIGEAARGPLSPTMRRYTRRLTQLWCLVFIAMILSSSLLPLLEQPEVWSWFTNIINYL
FT                   VVGVLFVGEFILRKKIFPAHDHPGFIEYLRIIASAKPRI"
FT   gene            complement(144288..144566)
FT                   /gene="acpC"
FT                   /locus_tag="CJA_0101"
FT   CDS_pept        complement(144288..144566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpC"
FT                   /locus_tag="CJA_0101"
FT                   /product="acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84181"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFI5"
FT                   /protein_id="ACE84181.1"
FT                   /translation="MSLQTPQEQELATLLVSALDLEDLEPGDINPEAPLFDASHSDSLG
FT                   LDSIDALEISLAVAKHYKVQLKADDENNKAIFYSLRSLSHYINEQRA"
FT   gene            complement(144645..145406)
FT                   /locus_tag="CJA_0102"
FT   CDS_pept        complement(144645..145406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0102"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methlytransferase UbiE"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF01209"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85318"
FT                   /db_xref="GOA:B3PFI6"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFI6"
FT                   /protein_id="ACE85318.1"
FT                   /translation="MANNKPNSLAPHPVLPDYYGKAEDRRSRVDAMFDSSAEHYDWITD
FT                   VMSFGSGRRYRHQALVRAGVKAGDKVLDVGAGTGVVSWLAQQIVGQDGLVVALDPSKGM
FT                   LTQAVKLGVEHTSMGLGEALPFPDNTFDYVTMGFALRHVADLGAAFTEYQRVLKPGGKI
FT                   LLLEITRPESKLATALLKFYLKGVIPNIARIFRRSADSKVLMRYYWDTIEQCVPPATIV
FT                   SALKATGLEQSQRAVVLGIFSEYTGIKPANP"
FT   gene            145488..145616
FT                   /locus_tag="CJA_0103"
FT   CDS_pept        145488..145616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0103"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACE86047"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFI7"
FT                   /protein_id="ACE86047.1"
FT                   /translation="MRVFESNNQESPWNSGDVYTYNSRQLTHRQPFLPIACVLKNE"
FT   gene            145623..146621
FT                   /gene="fkbO"
FT                   /locus_tag="CJA_0104"
FT   CDS_pept        145623..146621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fkbO"
FT                   /locus_tag="CJA_0104"
FT                   /product="FkbO protein"
FT                   /note="identified by similarity to GB:AAF86394.1"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82656"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFI8"
FT                   /protein_id="ACE82656.1"
FT                   /translation="MVVTPPGLICRYSDTPHAGVIPDLALAQFRFDAHCENPPGTPVLS
FT                   TGLQPLVEGIAGELLAVAGGPVTRGFGEQCYWAESDDYLFLALWADETDAAGLAAISQH
FT                   LYQRLLGHTRARGYPHLVRMWNYFADINGETQGLERYRQFCLGRFDAFTAHGLAENQYP
FT                   SACALGHGGGDLLVYALASKTTPWHFENPRQASAYHYPAEYGPRSPSFARASLLSLPGQ
FT                   TATLFVSGTASVVGYLTLHPYQLGGQIDVTLENLELLLAHVAQQYRHARGGNPQLKAEV
FT                   LKVYIRNPADLAAIKARVGQAYPQAAIAYVVADICRADLLLEIDGIWNLLP"
FT   gene            146603..147406
FT                   /locus_tag="CJA_0105"
FT   CDS_pept        146603..147406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0105"
FT                   /product="acyltransferase family protein"
FT                   /EC_number="2.3.1.-"
FT                   /note="identified by match to protein family HMM PF01553"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84349"
FT                   /db_xref="GOA:B3PFI9"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFI9"
FT                   /protein_id="ACE84349.1"
FT                   /translation="MESVAVNRMAALWQRLRFSRGWRVPATGLGFALFGMGGVVLSLSV
FT                   FPLLLLVPIGQVRRERYTRQVIARVFRSYIWILRLLGLLSYEFHQVGQLQRPGQLIIAN
FT                   HPSLLDVVFLLGLTHASCVVKGSLWRNPFTAMPVRAANYISNNDPALFHRCLDTLKAGR
FT                   SLIIFPEGTRTRPGTPLSFHRGPSNIALSAGVAITPVLIRCEPATLLKDQQWYEISAQP
FT                   PHYTLRVMPEFPTAHYMAQGELQSVASRQLTRDLEAYFTRLLQSC"
FT   gene            complement(147441..147983)
FT                   /locus_tag="CJA_0106"
FT   CDS_pept        complement(147441..147983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0106"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAL24529.1"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82813"
FT                   /db_xref="GOA:B3PFJ0"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFJ0"
FT                   /protein_id="ACE82813.1"
FT                   /translation="MKTWLESAAESLPLVIFLAYIQVADMAVRADWLVPYGLASAMGLA
FT                   TSLYLYRRKLIFNRLLLGINLYFFSGLLGLASNWDWLNQLYGQLGAVAMLGWILLTGIA
FT                   SGLASPHGFLGTLTPGYLSLPQNSLLLLVATGLATVTAACFMGNKWLGEWLPFIFLFSC
FT                   RNLLWQLNNRTGKVLGD"
FT   gene            148048..148890
FT                   /locus_tag="CJA_0107"
FT   CDS_pept        148048..148890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0107"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83627"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFJ1"
FT                   /protein_id="ACE83627.1"
FT                   /translation="MPARNTYPKQGVLGPGSLLSSPALMSSNKSPLSHPSTQVSGKPKA
FT                   LWVRETRFGRWFLGTHTWYRYVLAQAVQDFNRLLAGRLPARPRVLDAGCGQGLAFGLLE
FT                   TCFQPAAITGIDIDREQINKASTVAAGMATPTTATHGNACAPVFPAESFDLILCHQLLH
FT                   HTNQQVEALQEFYRLLSPGGILLVGESCRTFINSIPVRLLFRHPSMAQQDAQGYIDLVR
FT                   SAGFAFSAADVQTSRPWWSRRCLGIAQKLGLGLGNTEPTEILIVARKPFAVGGENPGE"
FT   gene            148992..149363
FT                   /locus_tag="CJA_0108"
FT   CDS_pept        148992..149363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0108"
FT                   /product="acyl carrier protein"
FT                   /note="identified by match to protein family HMM PF00550"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83358"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFJ2"
FT                   /protein_id="ACE83358.1"
FT                   /translation="MEGEQTWRVCRLCLYQQRVKRKIPMEIPMYTKEKIYGFLQETLVS
FT                   LFEIDASAITPEANLYEDLDIDSIDAVDLTVKLKEFTGRRIQPSDFKQVRTVQDVVDAV
FT                   YDLLNRPEEIDGLASAGQD"
FT   gene            149390..149788
FT                   /locus_tag="CJA_0109"
FT   CDS_pept        149390..149788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0109"
FT                   /product="AMP-binding enzyme family protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACE86309"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFJ3"
FT                   /protein_id="ACE86309.1"
FT                   /translation="MRWPALSDIKTSPGQVDAQLLVAADLAGFAGHFPDLPILPGVMQI
FT                   DWAVHIARQLLLLDTPVVNVERLKFTCPICPGVELRLSLRHDAEAATVDFRFYRLAPAG
FT                   AATGSRSELLFSQGRLVYQQPSLSVPRQ"
FT   gene            149799..150551
FT                   /gene="gt2J"
FT                   /locus_tag="CJA_0110"
FT   CDS_pept        149799..150551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gt2J"
FT                   /locus_tag="CJA_0110"
FT                   /product="glycosyl transferase, putative, gt2J"
FT                   /EC_number="2.4.1.-"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83568"
FT                   /db_xref="GOA:B3PFJ4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFJ4"
FT                   /protein_id="ACE83568.1"
FT                   /translation="MPAVNPCSVIPVFNHPHKIAGLVDRLIAYGLPCILVDDGSGEDCA
FT                   RVLDEIAAAKPQVILLRLPQNSGKGVAVCRGLTLAHERGFTHALQVDADGQHDLDDVPR
FT                   FLARAQQQPLAVVSGWRSYEAMPPSRRSGRKLTDFWVCVNTLSRSIHDSMCGYRLYPLA
FT                   PTMHLLARKKIGARMDFDTDILVRLYWQGLAVENIPTQILYQDDIPSHFDIVKDNVRIS
FT                   WMHTRLFFGMLVRIPVLLQRHSSRRQRL"
FT   gene            150572..150994
FT                   /locus_tag="CJA_0111"
FT   CDS_pept        150572..150994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0111"
FT                   /product="4-hydroxybenzoyl-CoA thioesterase domain protein"
FT                   /note="identified by match to protein family HMM PF03061"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82785"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFJ5"
FT                   /protein_id="ACE82785.1"
FT                   /translation="MYTTYTDILVPFHDVDSMQVAWHGHYVKYLEVARCEFLESFNYSY
FT                   QAMLESGYAWPVVDMRIKYIKPLRFGQRVRVQCALREWEYRLKIDYVISDAATGERLTK
FT                   AYTIQVAVDLATQAMCFESPLVLRESLTRKLGHLPG"
FT   gene            150996..151694
FT                   /locus_tag="CJA_0112"
FT   CDS_pept        150996..151694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0112"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83222"
FT                   /db_xref="GOA:B3PFJ6"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFJ6"
FT                   /protein_id="ACE83222.1"
FT                   /translation="MPMNSLLLVSKSVCFFSKALCLWLVLAAVHGRAAEPTQERIDQVV
FT                   QRLGEIVFIRGDFVQEKTLKGLPYALRAQGTFIFWQNQGLYQATEKPFFNAFTITRDAL
FT                   INWQADGTGSLSREQPAIMQREVNKTLLAFFSADIALIQQRFNTEWQFTDNQWHLTLTP
FT                   RLELIAKNMRSVELAGDHLLQSIRVLAANGDETRIQFSNQQPATEPTAGDCRWFFLPPD
FT                   TRCTELANQP"
FT   gene            151711..154167
FT                   /locus_tag="CJA_0113"
FT   CDS_pept        151711..154167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0113"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84807"
FT                   /db_xref="GOA:B3PFJ7"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFJ7"
FT                   /protein_id="ACE84807.1"
FT                   /translation="MPFVTVPVNTVQRWLGVITAIVTLAVLALLGQVLNQGVRVEADLQ
FT                   KLFPKDQLHPLAARATEQLYREFGNKALLAVQAPQRDEARQAAEVLARAIAHNPLLHIE
FT                   QVAGHSPQLIAQQALIARHHFQLLTPQQREHLRTDPTPLLGQAQAALFGFNGNGLSPLD
FT                   DPLNLVPGYLHQLQPALNGELLNDRLLVADEQGQLILFALSVQGEAFSLSVQEQVDTWL
FT                   TQVRQQLQDNPHTANSQILVSGAIFHAAQAAQQAQREVRVIGIGSLVGLLLLFMLAFRR
FT                   LQPLFLSVLSVAYGCGCAFVVTHWLFAEIHLMTLVFGASLIGVAVDYSLHYLCKYHATL
FT                   ASGGDRDKPVLDGLLASLVLSLITSVLAYSCLFQASLPGLQQIACFSIIGLACSWLFVM
FT                   GLYPLLLRQRAQVDSSLPAPVPLVDRCAFSIWQFWQATSRQARIWLAVVLLGVFSLGAF
FT                   SFSISNDVRTFYTPSPELMASERRLQQVLQGVSPNQYFLLSAASPEQLLQLEEQFRYGH
FT                   LDPLVARGAVHGYTATSVAVPSQRQQALDYQLQRDRVYSNQGLASEFMQSAGFGAEAIA
FT                   DTREKFHLAAGNDLLPDTWLLPDAWLQVARPDQRLLWLGEREQSWVSIIGLRGVADVDA
FT                   LAGLASRAATGQNTILWVDRVADMSVLLQHLLQVSALLLLLAYGVIIVLLWCAYRQWRA
FT                   LVQVVVPMLTTLTTLSVLAILGVDITLFHVFGCYLILGLGMDYSIFSYVGGMHDRVSQR
FT                   AIWLSVVTSLLSFGLLSLSSTPMVQAFGMTLLLGCLFNWLYAPLVATLKPPMQRLHRHK
FT                   GKQDDE"
FT   gene            154160..154753
FT                   /locus_tag="CJA_0114"
FT   CDS_pept        154160..154753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0114"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACE86208"
FT                   /db_xref="InterPro:IPR021675"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFJ8"
FT                   /protein_id="ACE86208.1"
FT                   /translation="MNNAPLTRFLLMFLALAILSGCSFVGTRDFPLQVTTSDQHTYVVQ
FT                   QQWQVYAQGRDYALEVIVERRAARWRLIMLNQLGQRLVTVESDGQRLHVERHLSHPATR
FT                   QLPDLLQAWQFGFWPLADLQGVDPRWVFSEGNGRREVYFSGILRATIERLAVNENKAGD
FT                   SGPQAASGLLNPWQGSLSYNTADLRLLIHSQPLN"
FT   gene            154761..155249
FT                   /locus_tag="CJA_0115"
FT   CDS_pept        154761..155249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0115"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85428"
FT                   /db_xref="InterPro:IPR016776"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFJ9"
FT                   /protein_id="ACE85428.1"
FT                   /translation="MSQPPLFESVQDLLLHRPPMLLLKEVVRWGPGELEALVDPRDSHV
FT                   FIDADGRLPVWVGIEYMAQAIGALAGIAARQEGEPIRLGFLLGTRRYQADVSHFDLAQE
FT                   LRVCVTERLRDETNLVLFNGELYAGTQRLAQAEIKAIQPRDIDAVMGQFMQMNALAGE"
FT   gene            155252..155980
FT                   /locus_tag="CJA_0116"
FT   CDS_pept        155252..155980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0116"
FT                   /product="putative 3-oxoacyl-(acyl-carrier-protein)
FT                   reductase"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM TIGR01831"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83596"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011285"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFK0"
FT                   /protein_id="ACE83596.1"
FT                   /translation="MNNKRVLVTGSSRGIGRAIALQLARDGYELVIHCRQQRDQAEAVQ
FT                   QLISAGGGRASILQFDVAERDLTRQLLEADMEANGAYYAVVCNAGIARDNAFPAMSGDD
FT                   WDAVIHTNLDAFYNVLNPIIMPMVRRRAPGRIVTLASVSGVMGNRGQVNYSAAKAGIIG
FT                   ATKALAIELAKREITVNCVAPGLINTDMLDEAPVEEALKMIPMRRAGEPEEVASLVSYL
FT                   LSPPAGYLTRQVISVNGGMF"
FT   gene            155980..157212
FT                   /gene="fabF-2"
FT                   /locus_tag="CJA_0117"
FT   CDS_pept        155980..157212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabF-2"
FT                   /locus_tag="CJA_0117"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase II"
FT                   /EC_number="2.3.1.41"
FT                   /note="identified by match to protein family HMM PF00109;
FT                   match to protein family HMM PF02801"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82799"
FT                   /db_xref="GOA:B3PFK1"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFK1"
FT                   /protein_id="ACE82799.1"
FT                   /translation="MKRVVVTGMGVVTALGNSWPEFAAKLKTGTSAIRRLDDWATYKDL
FT                   NTNLAGPIEGFVVPEHYPRKKIRSMGRVSLLSTRATEFALADAGLLDDPVVQSGAMGIA
FT                   YGSSTGSTDATRDFAVMLDKRDIGGATATTYIRMMGHTAPVNIGVFFGMKGRIITTSSA
FT                   CTSGSQGIGYAYEAIKYGQQTLMVAGGAEELCPSEAAVFDTLYATSTKNDTPDITPSPF
FT                   DIHRDGLVIGEGAGTLILEELEHAQARGAKIYAELVGFGTNSDGGHVTQPDPVTMNIAM
FT                   QKALDDAGLMPADIGYINAHGTATDRGDIAESVATEKLFGKKTVPISTLKGNIGHTLGA
FT                   CGAIEAWASIQMMNDGWFAPTLNLKAPDPQCGDLDYIVGEGRRLDCTYIMSNNFAFGGI
FT                   NTSLIFKRWPA"
FT   gene            157248..157991
FT                   /locus_tag="CJA_0118"
FT   CDS_pept        157248..157991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0118"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85095"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFK2"
FT                   /protein_id="ACE85095.1"
FT                   /translation="MLFRALLLVVTLGFSWTVCAEPETPEDYVKIFQSTNLPDQEKAAQ
FT                   SLEWAGISSPRLYDLVEAKALEYLPRATDRTNVNYVAHLTNALAYSGNEKYRPTIEKII
FT                   QDAPHKRLKKYATQALGQLSLYSQLNPLIAPKPWPEYTHPSLEQRLVNMLNSGNDELVR
FT                   MAAKRIHFTNNYQPELLALLSAGIQQRYQQPMGGLALDTTAWMCRALAGSRDEQYKALI
FT                   EQVAKGAKEKKLAKYAKKYLSYFGQ"
FT   gene            158133..159275
FT                   /gene="metX"
FT                   /locus_tag="CJA_0119"
FT   CDS_pept        158133..159275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metX"
FT                   /locus_tag="CJA_0119"
FT                   /product="homoserine O-acetyltransferase"
FT                   /EC_number="2.3.1.31"
FT                   /note="identified by match to protein family HMM PF00561;
FT                   match to protein family HMM TIGR01392"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85938"
FT                   /db_xref="GOA:B3PFK3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PFK3"
FT                   /protein_id="ACE85938.1"
FT                   /translation="MPNQLPADSVGLVTPQTLHFSEPLELACGISLNEYDLVYETYGQL
FT                   NAAKSNAVLICHALSGHHHAAGYHRLEDKRPGWWDAYIGPGKPIDTNKFFVVALNNLGG
FT                   CHGSTGPRSINPATGNVWGADFPMLRVRDWVASQARLADALGIDTWAAIIGGSLGGMQV
FT                   MRWSIQYPQRVRYAVVIASAMKLSAQNIAFNEAARKAIISDPNFHNGDYLAHNTLPKNG
FT                   LAVARMIGHITYLSDYAMGEKFGRDLRSGSFELGIAEPVEFQIESYLRYQGDSFAVSFD
FT                   ANSYIRITKALDYFDLAREYSDDPVLAFQGAQAKFLVVSFSTDWRFAPQRSREIVDALV
FT                   GANKAVTYAEIESKHGHDAFLLPDARYEQVFKRYLASVEV"
FT   gene            159280..159867
FT                   /gene="metW"
FT                   /locus_tag="CJA_0120"
FT   CDS_pept        159280..159867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metW"
FT                   /locus_tag="CJA_0120"
FT                   /product="methionine biosynthesis protein MetW"
FT                   /note="identified by match to protein family HMM PF07021;
FT                   match to protein family HMM TIGR02081"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82917"
FT                   /db_xref="InterPro:IPR010743"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFK4"
FT                   /protein_id="ACE82917.1"
FT                   /translation="MRIDLNEIQHWIAQGSRVLDLGCGDGTLLKFLIDNKVVQGYGLEI
FT                   DADQINTCIDKGLNVIEQNLDRGLGNFADKSFDTVIMTQALQTLHFPHLVLDEMLRVGK
FT                   ECIVTFPNFGHWKARLYLALRGRMPVSDLLPYEWYNTPNIHFCTFKDFEVLCRERHIKV
FT                   IRRQVVNEQSGQVLKDLMPNLFGETAIYHLSK"
FT   gene            159881..160336
FT                   /locus_tag="CJA_0121"
FT   CDS_pept        159881..160336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0121"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83651"
FT                   /db_xref="InterPro:IPR025218"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFK5"
FT                   /protein_id="ACE83651.1"
FT                   /translation="MKYLWASLLLLLSTSVLAQIDQPKEITTSKQFGAYTLHYNVFNST
FT                   DIPAKVAQAYKLVRGKDRALVNISLTKTDHGATSLGLPAKVSGKTRNLMQQSQTLKFIE
FT                   VNEGTAVYYLAPFVFNNEEVLHFDIQVQYGDERPFAVTFSRTLYTDR"
FT   gene            160339..160941
FT                   /gene="rdgB"
FT                   /locus_tag="CJA_0122"
FT   CDS_pept        160339..160941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rdgB"
FT                   /locus_tag="CJA_0122"
FT                   /product="non-canonical purine NTP pyrophosphatase,
FT                   rdgB/HAM1 family"
FT                   /note="identified by match to protein family HMM PF01725;
FT                   match to protein family HMM TIGR00042"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85559"
FT                   /db_xref="GOA:B3PFK6"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFK6"
FT                   /protein_id="ACE85559.1"
FT                   /translation="MNKIVLASGNAGKLREFRQLLAGCGYDVVPQSDFFSESAEETGLT
FT                   FVENAILKARFACLNTGLPALADDSGIEVDALNGRPGIYSARYAGEPGSDAANNAKLLQ
FT                   ELAGVPEQERGARYHAVLAFMRHAQDPTPILCHGVWEGRILTEPRGEGGFGYDPLFFVP
FT                   SHHCASAELSKDEKNRISHRGKAMQELLRALSALASR"
FT   gene            160941..162122
FT                   /locus_tag="CJA_0123"
FT   CDS_pept        160941..162122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0123"
FT                   /product="putative oxygen-independent coproporphyrinogen
FT                   III oxidase"
FT                   /EC_number="1.3.99.22"
FT                   /note="identified by match to protein family HMM PF04055;
FT                   match to protein family HMM PF06969; match to protein
FT                   family HMM TIGR00539"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACE86184"
FT                   /db_xref="GOA:B3PFK7"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFK7"
FT                   /protein_id="ACE86184.1"
FT                   /translation="MPLQLPPLALYIHVPWCIRKCPYCDFNSHQANNDIPEADYIAALR
FT                   QDLACDQSLAQGRKITSIFFGGGTPSLLSAQAIGQILVDAEQLIGFEPHIEITLEANPG
FT                   TFEQEKFSGFRAAGVNRLSIGIQSFNDQQLHLLGRVHGRDEALRAVNVARKAGFDNINL
FT                   DLMHGLPGQSVGDAQADLQQAIELEPEHLSWYQLTIEQNTAFYSAPPVLPEEEILADIQ
FT                   DAGQLLLAAAGYEHYEISAYARAKQFSRHNLNYWEFGDYLGIGAGAHGKVTLPEQQNIL
FT                   RLWKTRLPKHYLDAATSARISTNLQGHQNPFGGGSDLLGEESLPLEFMMNALRLHRGVP
FT                   EQYFAQRTGLDFSAIASCWDELARKKLVELADGALRPTPLGRRFLNRVLQAFM"
FT   gene            162194..164035
FT                   /locus_tag="CJA_0124"
FT   CDS_pept        162194..164035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0124"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83221"
FT                   /db_xref="GOA:B3PFK8"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFK8"
FT                   /protein_id="ACE83221.1"
FT                   /translation="MLINVVASYLVAMVFILYCLVLGTGLLNRIGIRINSFTDSYNAYL
FT                   FAFFAIAGGMVAVILALMLLGLTGLLKPTIILIAALLLMLPAIFKLGYLRKYLLLSNSQ
FT                   YLLWPAILMLLAVAFAWKAPGHWDDTSFHLPLVRFYVEQQGIELQEYLRFPLFPQHMNM
FT                   LMVLGYLSTDAIGAGGAVGAQVFATLPWFVIALGFMGISKWHMGSAIPGVVVAILLAKN
FT                   IEAFRVGFGFAYVDTGLAMFCWAALLAMVIGIANDSGQKTQSLTWIILAGLLAGGAAGT
FT                   KLFGGVFALILCITVLLATRKLLYSVVFGICVLATGAWWYVRSYLISGDPFHPIAANFF
FT                   GYFLWNEQDLLAQVAEQKTHGVAPSLLNLWAALKDAGIELWAIALAGLVFFKKLPSSIR
FT                   LMQLVFVVYFGFWFFVTQVERYLAPIMAVGTYLAFYMLYRLVNINIGSFNPGTYIARYS
FT                   RALTVITVLLCCSLIFGEFRRNIANWDHRLSRVSGYELFTQANGWRASHGDRLVQLGFE
FT                   NAAYFFSGIAIGDVFGVARYSQMLDCRAEGCKPVGTDALVELLNKFNSKMVIVSTQQYP
FT                   LLNEQQYINHFDIAFKNEQGVLMLLKQEEAKKQDVND"
FT   gene            164022..165848
FT                   /gene="recQ"
FT                   /locus_tag="CJA_0125"
FT   CDS_pept        164022..165848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recQ"
FT                   /locus_tag="CJA_0125"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271; match to protein
FT                   family HMM PF00570; match to protein family HMM TIGR00614;
FT                   match to protein family HMM TIGR01389"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84059"
FT                   /db_xref="GOA:B3PFK9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFK9"
FT                   /protein_id="ACE84059.1"
FT                   /translation="MSTINTVQTSPQAVLHQVFGYHEFRGPQEAVIHALVAGEDALVLM
FT                   PTGGGKSLCYQIPALVREGVAVVVSPLIALMQDQVNALREVGVRAGFLNSTLSSQEWWQ
FT                   TESALQRGELDLLYIAPERLIQPRTLELLHGLTIALFAIDEAHCVSQWGHDFRADYLKL
FT                   DLLPREFPRVPRIALTATADLRTRDEIVERLQLHNARQFISGFDRPNIQYRIAQKNNPK
FT                   IQLMRFLREEQAGNSGIVYCLSRNKVEQIAEWLCSEGFNALPYHAGLSASIRQQHQEKF
FT                   LREDNIIMVATIAFGMGIDKPDVRFVAHLDLPKSIEAYYQETGRAGRDGETATTLLLYG
FT                   LEDVIKLRQMMSQSEGSEEFKRNEQQRLNAMLGLCEITSCRRQSLLRYFGDHLVQPCGN
FT                   CDNCLIPPQTWDGSEAVQMALSCVYRTGQRFGAGHVIDVLRGSNNEKVLQFDHHRLSTY
FT                   GIGKHLSVDEWKSIFRQLVARGLLDVNSDGFGGLLLNEGCRPYLRGEERLLLRREAKSI
FT                   ANSPRRANLSQDIANEDQSLWQALRACRKRLAEEQGVPPYVIFHDSTLREMLEFRPLTL
FT                   DQLRGITGVGESKLKRFGEEFLTVLREAEYQG"
FT   gene            166129..166605
FT                   /locus_tag="CJA_0126"
FT   CDS_pept        166129..166605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0126"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACE86018"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFL0"
FT                   /protein_id="ACE86018.1"
FT                   /translation="MCFLPVSGIPELSLRTLLVLGALLAFSHIGYADENQLDSPGQSIT
FT                   LESQQSYEGTCSKLVIAGDDYTSACGTSLVVLTMSNGSVSITLQRGDQFLGLYGAQAHR
FT                   HYYNIHGAMVSETDALPLQGYCEMIIAMNGSSALICQMTDETAAPWEIRFAERR"
FT   gene            166720..177969
FT                   /locus_tag="CJA_0127"
FT   CDS_pept        166720..177969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0127"
FT                   /product="RHS Repeat family"
FT                   /note="identified by match to protein family HMM PF00041;
FT                   match to protein family HMM PF01839; match to protein
FT                   family HMM PF05593; match to protein family HMM TIGR01643;
FT                   match to protein family HMM TIGR01965"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83068"
FT                   /db_xref="GOA:B3PFL1"
FT                   /db_xref="InterPro:IPR003284"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR006644"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFL1"
FT                   /protein_id="ACE83068.1"
FT                   /translation="MIVMPVSIFSIRNNVAFMLGYFFRKYLFLLPFLIAIQSANAATFD
FT                   ISTPTQEGTFTLTWSGARTYVEIYELVGTTRMRVGHNYGINGSLSIAKSPGTYTYILVD
FT                   VYMMGAYGMNQPIPLRTEYQKTVVVTPPTVPPAVLSSLMVTPNPFSETISVSWDGLANA
FT                   IHYELQRNGSLVYSGAATSTTPSGSQANTSYTFRVRACNTYGCSDWKTANAVTLPETFG
FT                   VPATSTTGQYSIYAQTPPTATYTRIEERVGTSGSWITLTTLAGSQSYSVTRANGTYYYR
FT                   LFYCVANGQSLDCTPRHQEKSTIVSQPVPVVSASFNAATINEGGTATLNWSSTHATACS
FT                   ATGISGVSGTSGSVTFQAPTVMSGNQTVSIPVTCTGGGGSKTATASLTINWINDLPTLS
FT                   AIGNRTINEDASTGAIAFTLGDEETPAANLTVTATSSNATLIPNANIQLGGSGTNRTIN
FT                   VTPAANAFGSATITVRVTDAHGGQAQQSFTVTVNAVDDVPVISAINNVSVNELAETTVN
FT                   FTVTDIDSPVSGITVTSSANGTVTPVLSGSGNNYSVKLTAGRITSTNSSAQATMTVRAP
FT                   FGSSAVTRTFTVTVNNLTPQLWIEETGTTGIYDLKWEYGTQGVRLFENGVDITASSSGS
FT                   ASAVGSRRITKTANGTFTYYLQDCVGVTQAGLVCQGTHSQKSITVAFPKPVVNASFNRT
FT                   AVNEANAGAANTTANLSWSSTHANSCTATGISGVSSTSGTVTYTAPATLVSSQTHTVTV
FT                   ICTGNGGSISANASITLTALNDVPTFSTIGNRIINEDTNTGAIAFTVGDEETPVANLTV
FT                   SATSSNTALIPNGNLVFGGSGANRTLTVTPTANAFGSATITVRVIDAQGGQAQQLFAVT
FT                   INPVNDAPTLSAIANITINEDTSTGARAFTVGDVDTPVANLVVTAISSNTALVPNGNIA
FT                   LGGSGANRTVNVTPIANVHGTATITVTVSDGQLTASRSFVVTVNPVNDAPTISAIANIT
FT                   IDEDASTGVRAFTIGDIDTPVANLIVSATSSNTTLVPNTNIVLGGSSTSRTINITPVAN
FT                   GYGTATITVTVSDGQLNTSRSFVVTVNSVNDAPTISTMANITIDEDTSTGARAFTISDI
FT                   DTSVSSLTVTATSSNTTLVPNTNIALGGSGANRTVNITPVANGYGTATITVTVSDGQLS
FT                   TSRSFVVTVSPINDAPTISTIANITIDEDTSTGVRAFTIGDIDTPIANLTISASSSNTA
FT                   LVPNTNIVLGGSSTSRTINITPVANSYGSATITVTVSDGQLNTSRSFVVTVNSINDAPT
FT                   ISTIANITINEDTSTGARAFTIADIDTPVANLTVTFTSSNTTLVPHANIILGGNGANRT
FT                   VNVMPVANGNGAATITVTVSDGQLTASRSFVVTVNPVNDAPTISAIANITIDEDTSTGA
FT                   RPFTIADIDTPVANLTVTATSSNTALVPHANITLGGSGASRTINVTPVASGHGTTTMTV
FT                   TVSDGQLSASRSFVVTVNSVNDVPVISTFSNRTIDEDTSTGVVLFTVDDEETAAASLIV
FT                   SATSSNTALVPNNRLVLGGSGTNRTLTVAPLGNAFGVTTITVTVTDAGGASAQRSFVLT
FT                   VNAVNDLPTITPIPEQRITAGTSAPTLNFTIGDIETPAASLSVTTSSDKPGLIATSGIV
FT                   LGGSGATRTLKITPVVGQSGLAMVTIKVTDADGGESTLSVKVSVSADTSITFDMANAPA
FT                   SFIHNLTDGVTNLGSGDFVAITQGALNVDGGAASYKVAIDLPPAIRDLAPTLGLNYNSH
FT                   GSDGVMGVGWFLSGLSSIHRCRATFASEGAEAQKSNPQYTQGDRLCLDGQKLVIAGSST
FT                   PANNSAYWAANAIYQTEIDSFTRIQAHGSHEGGPQYFTLTTKDGRTLTFGEEATNQKSR
FT                   IYAPGQPNGPISNWMLDKVEDRYGNRYQVYYLRDTVIGEHYPSHITWAPESAVVFSYID
FT                   RTGNTPWGYDGGHQYVRTKLLDKVTTYIGITDSSTPTAGTRVREYDIDYQLSATTNRHL
FT                   VKEIRECGFTSTGVRQCAKPLQFEWQMGELGFEQAGQPLAYEGVLYEDINNDGFVDVIG
FT                   EKSILAWGSATGFVAANDSADEFLRTIQTRFGKYMARGVLRGDYVDIKIIRMSPSGMET
FT                   SSTVVSLTKANLPQVHAVDLNNDGLTDLYIGGHLWIQQSDASFVESLATVTYPYEAPSS
FT                   YSGIQPHFVDINNDGLLDRTGVSFHGLVDSGLFNNVLYGALNEVDKFGAFSSSMRVSSV
FT                   SPATKVSGVGHIDAPLHYRYTSNIGFWHSWIDINGDGHADVLYADKHSGAPQWRIRLST
FT                   GDGQSYSLQPLITSGASVVPMNNVALGQYSFVMDYNKDGVDDFIVFFSSGPGERVMRVF
FT                   YGSYVNGTLSFVNGGVDPLMGKLGYLVGLDIVPGEQTINPFRGDINNDGIPDLVIGGAA
FT                   YFGKQQQPDLLSKVTDGFGAIQELGYSPLVDDDNNGKPLYTPDAVAPAFPQAPASRGMQ
FT                   VVKQLSVSNGLGGQVHTWFHYTGGKQDLQGRGFLGFAKIETTSTSSGVETATHYLQGFP
FT                   YTGRISEVLIKDSVSGNLISRTQNHYTTHSHNGRFPYLDYSIQQDYQLLTTSLNTPLAV
FT                   NKVENSFDVCGNLIGRTTTTGTGLSGITVTGILGTATLTNTLINTSDSDCSDDFVSETT
FT                   VTYTEAGDINPRTVTTTFEPNAQFDVYQQTVFEGTALEVVTTTNRNEQGTITDTGAIAA
FT                   DLNSTNTAARITSFSDLDKGIYPEAVTNAAGHIVTLSYDYRFGKVNQEADPNSLISSRD
FT                   FDVLGRNVRETAADGAITELLSWYCASAPVTCPSHAVYLTATRVTHPSEPGKLGAPLAI
FT                   TYYDSLQRVVRNETHSLNQAVVKSDTQYTAAGYVHRVSEPFTGFASHWTTYSDYDALGR
FT                   ANTIIGPDGGSLGVTYSLDANRLKTSETVTVVTPNSTDIQTTRRYTNALGQVVRVEDAR
FT                   GTPVDYTYDAQGNLKTTIVNNNALTTITVVHDLASNKTRITDPDAGVIDFAYNGFGELR
FT                   KQTWQPDLTGHTKSITYTYDDLGRKTHRIDQPASGNATSYSWVWDAPGQLGLLSSQSGN
FT                   GYSENYTYDPLSRVQTQTTSITGLAGGKVFTYGYDSFSRPATTTYPNGLTITRDYQASG
FT                   MHVRTRDVTGSTDNTLWVLGKQQNNRGQLTHALYGNGVVTAHTYTDSNGRLASITSGRL
FT                   TASNTLNSLNGDIQALSYEFDSLGNLRSRTTKRSDNNGLAFENTTERFAYDKLNRVTAS
FT                   TTSGLGLFNRSLDYQYDDLGNLTYRSDTGALAYNRTGNAGVHAVTSSGTSGTPDYKTYA
FT                   YDRYGNMTSRGGETISYDVFNKPLTINGSNGTSSFSYGPNHERFKQITGGKTTYVINGG
FT                   AYEEIVDNNTGTVTQKSYVDGFMVQTKTGTTTDITYLHKDHLGSTEAMTDANGNLTGRM
FT                   SFGVWGQRQQASWQTGTPPTTELNSFKTQQGYTGHEQLDNHDLIHMGGRVYDPTIGRFL
FT                   SADLYIQSPYNTQSFNRYSYVFNNPLSRIDPTGYFSDMMQWAMESSYQHASGWFWNASY
FT                   QAAQAQINYSQAKKAAERAANQGTPTVWMEELPRDEKEELQSTSKQKNGNGLSLDGAQE
FT                   GLKPTEAEYKLISEGKLAEMWQGRCAAGDPIGCVGFATWGDPADVLAMHGKVDGAYWVG
FT                   VGATVRFNARNGLLTGNPELLLNPDALNTAVLSFGKAIATAHLDATAADLSGRHYFLRA
FT                   DEITQYHHVVFDRFNVSRRWYGGSYGTGRHEPLLEPFYCRPSCDSN"
FT   repeat_region   175603..176871
FT                   /note="RPT2M"
FT   gene            complement(178821..179771)
FT                   /locus_tag="CJA_0128"
FT   CDS_pept        complement(178821..179771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0128"
FT                   /product="Integrase core domain protein"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83906"
FT                   /db_xref="GOA:B3PFL2"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFL2"
FT                   /protein_id="ACE83906.1"
FT                   /translation="MTVVSIRIFIEAAWLIWIQQKTVFLKHLRLLGLLIKRQKPLFRAK
FT                   QKIKSTEKQSIIIVKRQRKPAWVKQEIIRLKAFMVHDGCRKVADAFNRLYREKQDMSVS
FT                   KTYTATIIQKHAKEILLLRKTLRNRTPRPLPKNLVWSMDLTYVNDDEHIPQTILGIVDS
FT                   GTRLCLQLEPIPGKASATLLRYLLDTVEKYGKPNLVNTDNEPVFTSKLFRFGLWLLQIK
FT                   HQRSEVCCPWMNGKIERFFGTLKQKLKHYTPGFTENLSTDLDTFRFWYNHIRTHQNLNG
FT                   LTPFEVWKNTTPHTGKPLMFSAWDGALTGIYFSPP"
FT   gene            179794..181146
FT                   /locus_tag="CJA_0129"
FT   CDS_pept        179794..181146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0129"
FT                   /product="cytoplasmic membrane protein"
FT                   /note="identified by match to protein family HMM PF05593;
FT                   match to protein family HMM TIGR01643"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84727"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFL3"
FT                   /protein_id="ACE84727.1"
FT                   /translation="MCGSYTYDAQGHLKTTLVNNNTLTTITVVHDLASNKTRITDPDAG
FT                   VIDFAYNGFGELRKQTWQPDLTGHTKSITYTYDDLGRKTHRIDQPASGNATSYSWVWDA
FT                   PGQLGLLSSQSGNGYSENYTYDPLSRVQTQTTSITGLAGGKVFTYGYDSFSRPATTTYP
FT                   NGLTITRDYQASGMHVRTRDVTGSTDNTLWVLGKQQNNRGQLTHALYGNGVVTAHTYTD
FT                   SNGRLASITSGRLTASNTLNSLNGDIQALSYEFDSLGNLRSRTTKRSDNNGLAFENTTE
FT                   RFAYDKLNRVTASTTSGLGLFNRSLDYQYDDLGNLTYRSDTGALAYNRTGNAGVHAVTS
FT                   SGTSGTPDYKTYAYDRYGNMTSRGGETISYDVFNKPLTINGSNGTSSFSYGPNHERFKQ
FT                   ITGGKTTYVINGGAYEEIVDNNTGTVTQKSYVDGFMVQTKTGTTTDITVSA"
FT   repeat_region   179866..183487
FT                   /note="RPT2D"
FT   gene            181215..181529
FT                   /locus_tag="CJA_0130"
FT   CDS_pept        181215..181529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0130"
FT                   /product="IS66 family element, Orf1 protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84649"
FT                   /db_xref="UniProtKB/TrEMBL:B3PC41"
FT                   /protein_id="ACE84649.1"
FT                   /translation="MKKRNEEQWRALFAQHDASGVSAAVFCKQNELCPKYFSLRRKQLA
FT                   KMASKEEAGFVRVKVKPKIPHEASGVKAASLTIRHHVGQLEFGTLPPPQWLAQLLRALA
FT                   "
FT   gene            181526..181876
FT                   /locus_tag="CJA_0131"
FT   CDS_pept        181526..181876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0131"
FT                   /product="IS66 family element, Orf2 protein"
FT                   /note="identified by match to protein family HMM PF05717"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85482"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFL5"
FT                   /protein_id="ACE85482.1"
FT                   /translation="MIQWDDVPVYVHRQPVDFRKSINGLSVLVQESMALEVFSRSVFVF
FT                   GNRTRNKIKILYWDKTGFCLWYKRLEKDKFKWPRRGDAVLSLTHEQFDWLLRGLDIEKL
FT                   QPHTEKYFFSAN"
FT   gene            181909..183477
FT                   /locus_tag="CJA_0132"
FT   CDS_pept        181909..183477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0132"
FT                   /product="IS66 family element, transposase"
FT                   /note="identified by match to protein family HMM PF03050"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84472"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:B3PC42"
FT                   /protein_id="ACE84472.1"
FT                   /translation="MWMENKPDLLQENIDLQKIVADKDDIISAQEKSLQSKEKRIRILE
FT                   EYILSLQQKQFGSSSEKQEVLQAELVFTEAEDTAEAEAPEQVDAFADDTVVVAEHKRKK
FT                   KRASIPKELHRIEITHDLPEDQKCCPHDGSLLKPIGFESHEQLDIIPASVRVLHHKRLK
FT                   YACPCCENYLVTAKKPAQPIEKSIASPGLLAHIATQKYVDAMPLYRQTDIFKRIGVEMD
FT                   RTTLANWMIRCGNLVQPLINLLHERMLEQTILHADETRVQVLNETGRAAETQSFMWVLR
FT                   STQPTCAAVLYRYEPTRSGKVITELLRDFNGALMTDGYAAYNAPCEKKGITHLACWAHA
FT                   RRKFIEAQKIQAKGKTGKADQAIAFIQQLYGIEKAIKDKTPEEKYQLRQTQSLPVLQKI
FT                   KVWLDKGLAHSPPQSLIGKALHYLHEQWPKLVRYVESGDYPIDNNAAENAIRPFVIGRK
FT                   NWLFSTSPKGATASANLYSVIETAKANGLEPYGYLKTIFTELPNATSLEQIEALLPWNY
FT                   KDGVS"
FT   gene            183532..184044
FT                   /locus_tag="CJA_0133"
FT   CDS_pept        183532..184044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0133"
FT                   /product="Rhs family protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85313"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFL7"
FT                   /protein_id="ACE85313.1"
FT                   /translation="MTSRGGETITYDVFNKPLTINGSNGTSSFSYGPNHERFKQVSSGK
FT                   TTYVINGGAYEEIVDNNTGTVTQKSYVDGFMVQTKTGSIIEVTYLHKDHLGSTEAMTDA
FT                   NGNLTGRMSFGVWGQRQQASWQTGTPSTGELNAFKTQQGYTGHEQLDAHHLVHMGGESM
FT                   TPASEDS"
FT   gene            184053..184817
FT                   /locus_tag="CJA_0134"
FT   CDS_pept        184053..184817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0134"
FT                   /product="Rhs family protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83227"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFL8"
FT                   /protein_id="ACE83227.1"
FT                   /translation="MYIQSPYNTQSFNRYSYVFNNPLSLVDPTGYFSDMMQWAMESSYQ
FT                   HTSGWFWNASHQAAQMQINYSQAKKVAERAANQGTPTVWMEELPRDEKEELQSTSKQKN
FT                   GNGLGFDNAQEGSCWGSYGPLRTAICNTAMEGCTPQSVYSNGLKILPGPGGDGTPFENG
FT                   AISELFVGPTQHFFNDDTLTVHNVALEGHVLSGVVTRQVVTDSRGWVYIETSKVGPATP
FT                   LNVAARLVDGALWRDVDLRIRRMVYHHAVQQQ"
FT   gene            complement(185163..185630)
FT                   /locus_tag="CJA_0135"
FT   CDS_pept        complement(185163..185630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0135"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAB04571.1; match to
FT                   protein family HMM PF04134"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83833"
FT                   /db_xref="InterPro:IPR007263"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFL9"
FT                   /protein_id="ACE83833.1"
FT                   /translation="MVYSFTGHLPHTSGTSLMNQKFEPHNSIIVFDGTCKLCNSSVNFI
FT                   IERDHKNIFKFAHMQTNIGQQILVTYNISNDNIDTFLLVKNGEAFIKSDAALAITKELK
FT                   SPWNHLIILRIIPRPIRNYLYSLIARNRYKWFGKQEYCMTPTPELQDKFLT"
FT   gene            complement(186606..188567)
FT                   /locus_tag="CJA_0136"
FT   CDS_pept        complement(186606..188567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0136"
FT                   /product="phospholipase/carboxylesterase"
FT                   /EC_number="3.1.-.-"
FT                   /note="identified by match to protein family HMM PF00326"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84625"
FT                   /db_xref="GOA:B3PFM0"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFM0"
FT                   /protein_id="ACE84625.1"
FT                   /translation="MRLFRLIFSSLVLLMALTAVTHAAKPAKHTPQPLSSFYRDEVLDR
FT                   LELSPDGTHLLALKNIDGITAVMVYELATGNVFFPTKTDNKEFKFNWVRWANNDRLLMS
FT                   LRFASRRGMNTSLQFTETRLLAVDAKKPSKIITLVKPNEDAVYQGWVSQFQDNIISMLP
FT                   DDPEHILLSVDRDLPGHQTVYKANVYTGKLSRVKKYHSSVRSWLADRQGNVRAGVGYND
FT                   RDRRISIRVLDPNTNKWTEAWSYINFDEPDISPVGFGNDPNELFLFANHEGRQALFKAD
FT                   LSKPGYPKELVLSHPEYDVSGSLIYSPAHKQVVGIYYNDGQSKSIFWNQEFKAFQAGLD
FT                   KALPDSNNYIISLSEDARKYVLYSSGNLNPGAILYGNRDTKELVHVADLLPELTEDVLV
FT                   KKEFRTYKARDGLALEGYLSLPKTFANKPVATIILPHGGPMSEDGSGFDRFSAFMVDRG
FT                   YAVFQPNFRGSSGRGHDFMMQAIGGYGLEMQDDLEDAVHYLVREKIADPKKVCIVGASY
FT                   GGYAALMGATKTPDLFQCAISFAGMSDLVKMRDTFRYYMAANSYREQFGNDRSQLKETS
FT                   PARMVDKVKIPILLIHGDKDASVPVAQSRLMAKALAKTKKTYEYIELEDGTHHLDYLPH
FT                   RQQTFEAMDKFLNQYLPL"
FT   gene            188809..189141
FT                   /locus_tag="CJA_0137"
FT   CDS_pept        188809..189141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0137"
FT                   /product="Peptidase propeptide and YPEB domain protein"
FT                   /note="identified by match to protein family HMM PF03413"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85638"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFM1"
FT                   /protein_id="ACE85638.1"
FT                   /translation="MNTTLKISRTLVAGLSLASVLAIASTAVQADDIGPDKALALRDQG
FT                   AILAFDKLNNLALAQHPGGRIGDTELEEAWGRYVYQVEVLDAQGQEWDLELNAATGELL
FT                   RNERDD"
FT   gene            189162..189479
FT                   /locus_tag="CJA_0138"
FT   CDS_pept        189162..189479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0138"
FT                   /product="Peptidase propeptide and YPEB domain protein"
FT                   /note="identified by match to protein family HMM PF03413"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83285"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFM2"
FT                   /protein_id="ACE83285.1"
FT                   /translation="MSLIPRFTAVGLMLVCLALNSGAGADDLDQDLARALREQGHILPL
FT                   EQILTSLYQRYPGASLLEVDLEREDGIYVYEVELLTREGRVRELELDASSGQILSDEED
FT                   D"
FT   gene            189479..190144
FT                   /locus_tag="CJA_0139"
FT   CDS_pept        189479..190144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0139"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84943"
FT                   /db_xref="GOA:B3PFM3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B3PFM3"
FT                   /protein_id="ACE84943.1"
FT                   /translation="MRLLLVEDNVALADELNRDLKRLGYALDWLADGRDALHQGLIEPY
FT                   DLVLLDLGLPGTSGLDVLRHWRAQGLHTPVLILTARDKWSERIDGLKAGADDYLTKPFH
FT                   PEELQLRIQALLRRAHGFANQPQLQAAGLVLDEARQMAQYRGETVTLTAAEFSLLRYLM
FT                   LHPERILSKSQLYDHLYNGEAERDSNVIEVHINHLRRKLGKDIIETRRGQGYRLGGEA"
FT   gene            190141..191481
FT                   /locus_tag="CJA_0140"
FT   CDS_pept        190141..191481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0140"
FT                   /product="sensor histidine kinase"
FT                   /note="identified by match to protein family HMM PF00672;
FT                   match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83652"
FT                   /db_xref="GOA:B3PG85"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B3PG85"
FT                   /protein_id="ACE83652.1"
FT                   /translation="MSSIRRRLSLGLVTSLVIAGVLLAQISIWLFEQGLRRYLENHLRI
FT                   ETETLLRALVRQEGEIRLDPRRLAPAYDRPFSGQYYVVHLEPADQAPAQRWRSRSFWDT
FT                   DTALPDKAGLQEELVPGPQGQQLILLRADYHRLGRDAVLVVGRDYRPMLESLRRIQLWV
FT                   LGGGALALLLILWVQRQLVTRALAPLETARLQLAQLQQGQRSSLDTRVPDELQPLVEQI
FT                   NRLLIHTEDTLRRSRDALGNLGHALKTPLAVLFSLSNRQELDAHPALRDSLRQQLDAIQ
FT                   QRLARELGRARLAGEALPGAYFDCARELADLCDTLRQIHGRDLKLHWDAPPGLQLPWDR
FT                   EDLLELFGNLLDNACKWAGAEVSLSVQQQGHTYLIAVDDDGPGIEPEQWAAVLKRGSRG
FT                   DEQVEGHGLGLAIVRDILSHIGGELSLQDSPLGGLRVVISLPVPRLA"
FT   gene            191519..193327
FT                   /locus_tag="CJA_0141"
FT   CDS_pept        191519..193327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0141"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82807"
FT                   /db_xref="GOA:B3PG86"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B3PG86"
FT                   /protein_id="ACE82807.1"
FT                   /translation="MRGMHSSGLSAHPNQEPRSPTPVHLRQTLGYLLPYLWDFKGRLIL
FT                   AILALLAAKGATLAMPWALKHIIDGVDRSLSPALVLPIAFVVFYGLLRFGSVFFGELRD
FT                   ALFSRITEHAMRHIGLRVFKHLHSLELAFHLDRATGGVSRDIERGTNGISFLMRFLMFN
FT                   IVPTLFEILMVAIIFAAAFSIWYAVITLLAVVIYVIFTILTTEWRNRFVREANQADSST
FT                   STRAIDSLLNYETVKYFNNEHYEAETYDKFLEKWESAKLKNRMSLLALNSGQALIIAIA
FT                   MTAMMWMAAQSVIDQQMTLGDLAMINAYMIQLFIPLNFLGFVYREIRRALTDLENMLAL
FT                   LRRQPAIVDTPDAKPRQAGAGEIYFERVDFGYTPERPILRNFSARVAPGSKLAIVGASG
FT                   AGKSTIARLLYRFYDIQGGNIYIDGQDIRQLTLESLRRSIAVVPQDTVLFNASIRDNIA
FT                   YGNPAASEEEIDRAIKAAHLEIFIRSLPQGDQTLVGERGLKVSGGEKQRIAIARVLLKK
FT                   APILIFDEATSALDSHAEAAILDALRELAAGHTTLVIAHRLSTVVDADQILVMEQGQVV
FT                   EQGSHAQLLAKQGAYAQLWNRQQEEH"
FT   gene            complement(193338..194165)
FT                   /locus_tag="CJA_0142"
FT   CDS_pept        complement(193338..194165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0142"
FT                   /product="metallo-beta-lactamase superfamily domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00753"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACE86263"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B3PG87"
FT                   /protein_id="ACE86263.1"
FT                   /translation="MNHPFFQQDKAHFLFNQPGHQCIQFSDLVVGEGIQANQFLIISNG
FT                   RAALIDPGGDLTYTPLNIELGKRVKTQQLDYIFASHQDPDIIASLPRWMMHTQCKVVTS
FT                   KLWSRFLPHLASQFMTQQYCQAFEERIIALPDHGGATRLGNTEIIALPAHFLHSVGNFH
FT                   FYDPVSKILFSGDMGASLVETHAEKPIENFDAHVPHMLGFHQRYMASNKACRLWANMVR
FT                   EMDVDMMVPQHGSPFVGKAIIHQFLDWISNLPCGIDLLNQSRFDARKAGYRGE"
FT   gene            complement(194224..195420)
FT                   /locus_tag="CJA_0143"
FT   CDS_pept        complement(194224..195420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0143"
FT                   /product="drug resistance transporter, Bcr/CflA subfamily"
FT                   /note="identified by match to protein family HMM PF07690;
FT                   match to protein family HMM TIGR00710"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85433"
FT                   /db_xref="GOA:B3PG88"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B3PG88"
FT                   /protein_id="ACE85433.1"
FT                   /translation="MTKESHPWLIVLLAAIIATTPLAVDMYLPAMPVIAGDLNAHIGSV
FT                   QQSLSIFLAAYAAGMLLFGPLADMIGRRPLALFGLGGFTLSSVALAFSSQIDQFLLLRV
FT                   IQAFCGAAATVVAPGVVRYLYQEHTAKGMSYISMMMMLAPLLAPGVGSLVLWVSDWRSI
FT                   FWLLAVYGLLIWVLIWRYLPEIPRAENQPKPNLLSGYRTVFGHSGARPLIVSMMFGSFA
FT                   FFCFITAVPFVYIQYFGASEQQFSLLFGFNVVMLMLANWVNSRWVIRVGSLTMLRAGLV
FT                   LATVSALVLAGVNLAELNLWFTVFSVAPLMMGLTLIGTNTDALVLMQFPHNTGTATAVN
FT                   GTLRFGSGAFAGPLLAWFYNGTALPFALLMLTGVLGVMLCQIYYGYLHRKPRHIVEPL"
FT   gene            195719..196510
FT                   /locus_tag="CJA_0144"
FT   CDS_pept        195719..196510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0144"
FT                   /product="probable partition-related protein"
FT                   /note="identified by match to protein family HMM PF01656"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84139"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3PG89"
FT                   /protein_id="ACE84139.1"
FT                   /translation="MDITPLHKRHSEPLISIQALNACRILVINGKGGSGKTTLSTNLAA
FT                   WLAKRGESTSLLDADPQGSSSHWIKQRPLELPFIYGFKIESSSRTTLSFQLRAPKSTRW
FT                   LVTDAPPGLSGLALDDLVRDHDLILVPVMPSEIDIRASARFIGELLLTQNMRRKRRPIA
FT                   VVANRIRQQASAWVRLQKFLQSLQIPYPANLRDTQNYVRAYTEGRGIIDYPQQAYARDR
FT                   EDWESLMNWIDAQNREHQWLKDEAAHELTPSEISREGTAQG"
FT   gene            complement(196552..196758)
FT                   /locus_tag="CJA_0145"
FT   CDS_pept        complement(196552..196758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0145"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83305"
FT                   /db_xref="UniProtKB/TrEMBL:B3PG90"
FT                   /protein_id="ACE83305.1"
FT                   /translation="MLKNFEMNDDVFNTIKVQFLALRLMAKSTKRKTRSVNDKSAYWML
FT                   TPAGEAAMVTLRAIRKLQLTQES"
FT   gene            complement(196789..197502)
FT                   /locus_tag="CJA_0146"
FT   CDS_pept        complement(196789..197502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0146"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84069"
FT                   /db_xref="InterPro:IPR025139"
FT                   /db_xref="UniProtKB/TrEMBL:B3PG91"
FT                   /protein_id="ACE84069.1"
FT                   /translation="MELFPATNEDQWTLIRKVIEDCDYYIVVIGGRYGSVGPLGISYTQ
FT                   MEYEYAVAQNKPVIAFLHKDPGTLPAKRVEKSEQGKEKLDEFRALAQQKMCKFWTTPAD
FT                   LGSAVSRSLIKLIKANPAVGWVKADLLPEKSATEEILRLRQQIEDLQNQLADSQQASTI
FT                   GIEHLAQGDDIVEISYAFGAFKTSEWRPDVTYKASFQTTWNHIFSAISPLLIDEAPDNT
FT                   LKKGLNSFIEAEQLN"
FT   gene            complement(197722..198336)
FT                   /locus_tag="CJA_0147"
FT   CDS_pept        complement(197722..198336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0147"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83150"
FT                   /db_xref="UniProtKB/TrEMBL:B3PG92"
FT                   /protein_id="ACE83150.1"
FT                   /translation="MSLLLLAAIPWASSWLESIKVGNFEAKFRELQEAVDATQKELDQL
FT                   KSTYREMEQDFMKTCNEFDPDAPATELNKLASKLKAKAKGLTSIDFLFSNLANSSNQAE
FT                   VFGAACALHVRPQFHAIDGVINLLDALSKTATLRDFRLKTIYRLLMAVDEIVKLDTRND
FT                   ESLLTDEQRKGIARVLAQLQSHPRCLADDTSQYAAKIIAKL"
FT   gene            complement(199015..201783)
FT                   /locus_tag="CJA_0148"
FT   CDS_pept        complement(199015..201783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0148"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83110"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:B3PG93"
FT                   /protein_id="ACE83110.1"
FT                   /translation="MKGNIQDVCKTLIFVITILNITACGGSSSSSSSSSSSSSSSSSSS
FT                   SSSSSVQNTAPIANAGPDKTTNEREEVVLDGNTSSDIDNDPLAYSWTQISGPSVSLTDA
FT                   NTATAKFIAPTVAVDTPAVFRLTVDDGLLNHTDDILITIKPVTDSISIAILGLGNEILV
FT                   TNEPTISVAGIASADAPINKISFNNPSSAISGDAAGIENWSVSVPLAIGDNPLTFTAQA
FT                   ADGKTAEINTTITYYPNLAFNTPLILSQDIAYKNETVNLSVTIGLSTGTEPTVTLFTAS
FT                   EDGTPGSELEPMLDDGKLPDEIEKDGIYSTQFAITPTSTGYQCYRAKIEINDSTPYFSE
FT                   LRCMWVTSHYTAEEVATATSVADDLESAYLTLLANGKTEIEAANTVVSSLSTNIDIGEA
FT                   GATGDGGIWWVTKAGILGAYHPVLENQRAAAAKQRNATPRKQNPISTKKPVVPTVAYPA
FT                   TYLAHRNYYVPSAPAQPTSKYNLRTKTAGENNPILSNKALIISPYLNNPIDPQNSFGSS
FT                   DDYFGVWNSIKNGNQCLLYAEKEAVNNGSLNVSLSDFYNLSSFGYIHIVTHGDNFYNGL
FT                   LSLWQNNWGPNNFLTGSLSQVVIYSGLYLPSDGNGGYDITGYEDDLQAKRLVIAPGGAI
FT                   AILPSYFQRYVGALPNSLVILGACRSTYNNSLANVFLSKGAGAVVGYTDYVNSSYAQNT
FT                   LKMLVEEMYTGKDVGEAINATTAIYGTNDADNDPAYITLSGASNLSFGSGNFSNLGFED
FT                   GTLTTWERSGDGRVISQLGSTRPTEGVWAGIISTGLGYTTTAGQIEQTGCLANNVTKLN
FT                   FDWNFFSEEFLEYCESIYQDEFKVDICEKDNSVTTNCQTLFQTNIDQLCNSVSASDVSF
FT                   DQGGVYNTGWSRKSLNIDSYAGKNVLLRFYATDIGDSIYDSAILLDNIEIE"
FT   gene            complement(202110..203390)
FT                   /locus_tag="CJA_0149"
FT   CDS_pept        complement(202110..203390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0149"
FT                   /product="phosphate regulon sensor protein PhoR"
FT                   /EC_number="2.7.13.3"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF02518; match to protein
FT                   family HMM TIGR02966"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84230"
FT                   /db_xref="GOA:B3PG94"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR014310"
FT                   /db_xref="InterPro:IPR021766"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B3PG94"
FT                   /protein_id="ACE84230.1"
FT                   /translation="MLKGFTAELRRIGLILCIALIVGVAVDHITLALLLGSTIYIINHF
FT                   LQLHKLHSWTTRSDQPPPESTGLWGELFDSLYQLQRHQKLEKEQLQAVIKRIQEITSAL
FT                   KDGIIILDWRGHLDFWNPAAHRMLALNTKDQGQSVINFIRHPKFVSYFEERNYSEPLEI
FT                   PSPRFPSKYLQFQITPFGNNERLIVVRDTTQLHNLEKMRQDFVANVSHELRTPLTVING
FT                   YVETLADNNTTPAWDKPLQQMLQQAKRMSLLINDLLVLSKLETTEAGHNHKAINVEQLL
FT                   QVVKSEADVLSSEKSQTLTLICNNTTKPLTLQGNEKELHSAFSNLVTNAIKYTQAEGKI
FT                   SILLWQDKNHFYVSVSDNGPGIEAKHLPRLTERFYRVDASRNSGTGGTGLGLAIVKHVL
FT                   MRHDAELKITSEVGKGSVFMCVFPLPQ"
FT   gene            complement(203427..204125)
FT                   /gene="phoB"
FT                   /locus_tag="CJA_0150"
FT   CDS_pept        complement(203427..204125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoB"
FT                   /locus_tag="CJA_0150"
FT                   /product="phosphate regulon transcriptional regulatory
FT                   protein PhoB"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486; match to protein
FT                   family HMM TIGR02154"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85236"
FT                   /db_xref="GOA:B3PG95"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011879"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B3PG95"
FT                   /protein_id="ACE85236.1"
FT                   /translation="MTGRKILIVDDESAIRDMLRVALEMADYQCIEAGNAQDAHSLIID
FT                   EKPDLILLDWMMPGTSGIELARRLKRDEVTANLPIIMLTAKGEEDNKIQGLEVGADDYI
FT                   TKPFSPRELVARLKAVLRRADPHVNSAPIIVQGLCLDPASHRVTINNQSVDMGPTEYRL
FT                   LEFFLTHQERAYTRSQLLDHVWGGNVYVEERTVDVHIRRLRKALAIDGHEDLVQTVRGT
FT                   GYRFSTKIEA"
FT   gene            complement(204211..205140)
FT                   /gene="ubiA"
FT                   /locus_tag="CJA_0151"
FT   CDS_pept        complement(204211..205140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiA"
FT                   /locus_tag="CJA_0151"
FT                   /product="4-hydroxybenzoate polyprenyl transferase"
FT                   /EC_number="2.5.1.-"
FT                   /note="identified by match to protein family HMM PF01040;
FT                   match to protein family HMM TIGR01474"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACE86292"
FT                   /db_xref="GOA:B3PG96"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:B3PG96"
FT                   /protein_id="ACE86292.1"
FT                   /translation="MPGKSPKPTKNRSPRHKAPITNRWLTKATHYVQLMRLHRPIGILL
FT                   LLWPTWWSLWLAAKGAPSLKNLVIFTLGVILMRSAGCVINDFADRRIDGHVERTRERPL
FT                   ATGAVSSREAIALFVVLCLAAFGLVLNTNLLTIQLSVGGLLLAFCYPFMKRYTHLPQVI
FT                   LGAAFAWGIPMAYAAEAGEIPAQAWLVYLVVVVWTVVYDTFYAMVDRPDDLKLGVKSTA
FT                   ILFGEQDRLITGILQAITLYTLLLVGKRFDLGSYYQLSLVAVAGLFIYQQWLIRYRARQ
FT                   ACFKAFLNNNWVGFAIFTGIALDLALKT"
FT   gene            complement(205161..205772)
FT                   /gene="ubiC"
FT                   /locus_tag="CJA_0152"
FT   CDS_pept        complement(205161..205772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiC"
FT                   /locus_tag="CJA_0152"
FT                   /product="chorismate--pyruvate lyase"
FT                   /EC_number="4.1.3.-"
FT                   /note="identified by match to protein family HMM PF04345"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82704"
FT                   /db_xref="GOA:B3PG97"
FT                   /db_xref="InterPro:IPR007440"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/TrEMBL:B3PG97"
FT                   /protein_id="ACE82704.1"
FT                   /translation="MPALPTTCDATMLPHPASVPLRWRPVQHWPRANRPNLALRDWLSH
FT                   EGSLTARLQQRSQGYFQVHILRQHLALPHLDERQLLGQYRRPSLALIREVILQGRGEDW
FT                   VFARSVLPLQSLTGRLRHLRHQGSKPLGAFLFSRPDLARSPIELACISPQQGYVPISLY
FT                   QQAQHLWGRRSVFYLDRKPLLVSEVFLPSFCQGLAHSQPR"
FT   gene            205964..206239
FT                   /gene="hup"
FT                   /locus_tag="CJA_0153"
FT   CDS_pept        205964..206239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hup"
FT                   /locus_tag="CJA_0153"
FT                   /product="DNA-binding protein HU"
FT                   /note="identified by match to protein family HMM PF00216"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83772"
FT                   /db_xref="GOA:B3PG98"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:B3PG98"
FT                   /protein_id="ACE83772.1"
FT                   /translation="MNKTDIVVAVANTVELSAHKADLVVSAFVEQITNALARGESVALL
FT                   GFGSFQVSERAARTGRNPQTGEAIQIAASKSVSFKAGKALKDAVNE"
FT   gene            206285..207652
FT                   /locus_tag="CJA_0154"
FT   CDS_pept        206285..207652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0154"
FT                   /product="proton/glutamate symporter"
FT                   /note="identified by match to protein family HMM PF00375"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82666"
FT                   /db_xref="GOA:B3PG99"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:B3PG99"
FT                   /protein_id="ACE82666.1"
FT                   /translation="MSLTTKILIGMLLGFLLGAGFNLLAGVEKGPDGQLLPLTGVALWL
FT                   QTYLIEGLFDALGQIFIASLKLLVVPMVFVSLVCGAAALGGHSRMGIMAGKTVIYYTLT
FT                   SVIALTLAVGFALLIQPGAGVQMDMAVNFTPPESPSIKSMLIDIFPSNPVAAMVEANML
FT                   QIIVFAILFGIAISRTTGESGKVISSFFNSLNDVVISLVMLLMQFAPYGVFCLLVKLFS
FT                   QLGFGAILDLAKYFFTVLFVLLLHGVVIYGLLIRSLTGLSPVTFFKKQWKVMLFAFSTA
FT                   TSSATMPFNMRVCRDEMGVDNKIASFAIPLGATINMDGTSIMQGVAAIFIAQAFGIDLG
FT                   IGGYLMIILTATLASIGTAGVPSVGLVTLAMVLQSVGLPVEGIALIIGVDRLLDMTRTA
FT                   VNITGDSVGAIVVAKSEGMLDEERYRDMNASMEGEPIENAGTQTPDPVEKPDFQEK"
FT   gene            complement(207682..208380)
FT                   /locus_tag="CJA_0155"
FT   CDS_pept        complement(207682..208380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0155"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83730"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGA0"
FT                   /protein_id="ACE83730.1"
FT                   /translation="MIRHTHPMRQTLTNDLNPIRVLIRQAQEEDSASGRLVDFLEHRQA
FT                   HLHNAIKLPTEKAAICLADFVMRYIRHVPDFIEAISTMAKEAGIYSEVSPLLKIASDYF
FT                   LSPPSLVGEHSQLQALLDEAYLAHRLLEEVNDRFMAQSGIPLAPMDMTLANIIAHELIG
FT                   EPFANELDQAVLFSAELLLNEHRLEGENVRRYVYQHQHQGWEEELKRWPCLTEDLAIEI
FT                   DFGKPPGVWH"
FT   gene            208615..209208
FT                   /gene="hisB"
FT                   /locus_tag="CJA_0156"
FT   CDS_pept        208615..209208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisB"
FT                   /locus_tag="CJA_0156"
FT                   /product="imidazoleglycerol-phosphate dehydratase"
FT                   /EC_number="4.2.1.19"
FT                   /note="identified by match to protein family HMM PF00475"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84708"
FT                   /db_xref="GOA:B3PGA1"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PGA1"
FT                   /protein_id="ACE84708.1"
FT                   /translation="MSDRIAQVTRNTLETKISVSLNLDGAGKGVFNTGVPFLEHMMDQI
FT                   ARHGMIDLDVTCDGDTHIDDHHSVEDIGITIGQAIAKAVGDKKGIRRYGHAYVPLDEAL
FT                   SRVVIDFSGRPGLVMDIPFTQKRIGQFDTELFWEFFQGFVNHAGVTLHVDNLRGHNAHH
FT                   QIETVFKAFGRALRMALEKDPRMEGIMPSTKGSL"
FT   gene            209230..209880
FT                   /gene="hisH"
FT                   /locus_tag="CJA_0157"
FT   CDS_pept        209230..209880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisH"
FT                   /locus_tag="CJA_0157"
FT                   /product="imidazole glycerol phosphate synthase, glutamine
FT                   amidotransferase subunit"
FT                   /EC_number="2.4.2.-"
FT                   /note="identified by match to protein family HMM PF00117;
FT                   match to protein family HMM PF07685; match to protein
FT                   family HMM TIGR01855"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85505"
FT                   /db_xref="GOA:B3PGA2"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGA2"
FT                   /protein_id="ACE85505.1"
FT                   /translation="MAQQTVAVIDYGMGNLHSVASALAQVAPEQNVIVTADPAAVAAAD
FT                   RVVFPGVGAIRDCMAEIKRLGFDTLLREQIATGKPVLGICVGMQALMDHSEENGGVDCI
FT                   GMLPGQVKFFGEQHKDAQGNPLKVPHMGWNQVHHNHHPLWADIAQDSRFYFVHSFYIHA
FT                   DEPSLVAATCDYGLEFHAALARDNLFAVQFHPEKSHTVGLQLLKNFLHWDGRA"
FT   gene            209938..210669
FT                   /gene="hisA"
FT                   /locus_tag="CJA_0158"
FT   CDS_pept        209938..210669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisA"
FT                   /locus_tag="CJA_0158"
FT                   /product="phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase"
FT                   /EC_number="5.3.1.16"
FT                   /note="identified by match to protein family HMM PF00977;
FT                   match to protein family HMM TIGR00007"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83542"
FT                   /db_xref="GOA:B3PGA3"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PGA3"
FT                   /protein_id="ACE83542.1"
FT                   /translation="MLIIPAIDLKDGQCVRLRQGLMDDSTVFSDDPVAMARQWVDQGCR
FT                   RLHLVDLNGAFEGKPVNGGVVTAIAKAYPGLPIQIGGGIRSAATIEYYLQAGVQSVIIG
FT                   TKAVKEPQFVTDMCKAFPGHIIVGLDAKDGWVATDGWAEVSNVQATELAKRFEQDGVSS
FT                   IVYTDIARDGMMQGVNVQATVTMAQASSIPVIASGGITNMDDIRALKAEAHKGICGAIT
FT                   GRAIYEGTLNMAEAQAYCDAN"
FT   gene            210683..211456
FT                   /gene="hisF"
FT                   /locus_tag="CJA_0159"
FT   CDS_pept        210683..211456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisF"
FT                   /locus_tag="CJA_0159"
FT                   /product="imidazoleglycerol phosphate synthase, cyclase
FT                   subunit"
FT                   /note="identified by match to protein family HMM PF00977;
FT                   match to protein family HMM TIGR00735"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84351"
FT                   /db_xref="GOA:B3PGA4"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PGA4"
FT                   /protein_id="ACE84351.1"
FT                   /translation="MPLAKRIIPCLDVDNGRVVKGVKFLDIRDAGDPVEIAKRYNQEGA
FT                   DEITFLDITATHEGRDTTVHTVEKIASEVFIPLTVGGGIRTVDDIRTMLNAGADKVSIN
FT                   SAAVFNPDFVKAASDRFGAQCIVVAIDAKKVSAEGEMPRWEIFTHGGRKPTGIDAVEWA
FT                   VKMAGYGAGEILLTSMDGDGTKKGYDLGVTRAISDAVPIPVIASGGVGNLQHLVDGVTL
FT                   GRADAVLAASIFHFREYTLPQAKEFMRAQGIEVRL"
FT   gene            complement(211551..212267)
FT                   /locus_tag="CJA_0160"
FT   CDS_pept        complement(211551..212267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0160"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83689"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGA5"
FT                   /protein_id="ACE83689.1"
FT                   /translation="MAATKSAVNAIAELEHQIAKVTAAVEKARAQELASAQKALVAAKK
FT                   AAANATKKVKDLKAKGAKNAAARARLKLLQQEVDNSGKALAGAQERVAQLAAAQKEAAE
FT                   ISKAVSRELGAKAVKPKAAIKPAKKVAKVTASKVEKTITAKAAPKARPEKNTAKKVAVK
FT                   KTGAVTPNTEQKPAAKTQKPAAKKVVQGSVIATPPVAPVETTPEPVIPAVNAAPVIAPV
FT                   VATASEPRGDTPSVEN"
FT   gene            212719..213450
FT                   /locus_tag="CJA_0161"
FT   CDS_pept        212719..213450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0161"
FT                   /product="macrophage infectivity potentiator"
FT                   /EC_number="5.2.1.8"
FT                   /note="identified by match to protein family HMM PF00254;
FT                   match to protein family HMM PF01346"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84616"
FT                   /db_xref="GOA:B3PGA6"
FT                   /db_xref="InterPro:IPR000774"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR008104"
FT                   /db_xref="InterPro:IPR036944"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGA6"
FT                   /protein_id="ACE84616.1"
FT                   /translation="MFNKRLLVLGLMAASTTLIVGCKEEAKQDDSAKLTTLEQKANYII
FT                   GQNIGRNLKNGGLAIEPESLALALADIRDGKDSRISEEEMQKIMQEVQEKAIAKQEEEQ
FT                   KKLSEENQTKGKAFLDENKAKEGVVATESGLQYKVITEGKGAKPKATDTVTVHYTGKLI
FT                   DGTEFDSSAKHGQPATFPLDGVIPGWTEALQLMPQGSKWEIYIPSELAYGAGGQGPIPP
FT                   SSTLIFEVELLEIKAPEAAAN"
FT   gene            complement(213613..214080)
FT                   /gene="algQ"
FT                   /locus_tag="CJA_0162"
FT   CDS_pept        complement(213613..214080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="algQ"
FT                   /locus_tag="CJA_0162"
FT                   /product="transcriptional regulator AlgQ"
FT                   /note="identified by match to protein family HMM PF04353"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85996"
FT                   /db_xref="GOA:B3PGA7"
FT                   /db_xref="InterPro:IPR007448"
FT                   /db_xref="InterPro:IPR038309"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGA7"
FT                   /protein_id="ACE85996.1"
FT                   /translation="MLENCKSAKERWGGVSEIIDRWLEERQQMLVQYCDLSALEATDAN
FT                   EALRGHKLRELCQILVDYVSAGHFEIYDQLIKEGREFEDEEALQEAGKLYAVVDETTET
FT                   LLDFNDKYLETDDLGSLSDDLSRLGESLETRFSAEDRMISVLHTSHKDLVN"
FT   gene            complement(214176..214658)
FT                   /gene="dsbH"
FT                   /locus_tag="CJA_0163"
FT   CDS_pept        complement(214176..214658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbH"
FT                   /locus_tag="CJA_0163"
FT                   /product="protein-disulfide reductase"
FT                   /EC_number="1.8.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82923"
FT                   /db_xref="GOA:B3PGA8"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR022920"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGA8"
FT                   /protein_id="ACE82923.1"
FT                   /translation="MLSIRQTNLLIFLGCTALILAAAYMEHVMKMVPCSLCITQRAFVI
FT                   LTGLIALAALIHHPATTGRRAYAVFGIISALLGAAFASRQLWLQSLPADQVPACGPGLA
FT                   YIFEEFPLMEAFKLLLQGDGNCAHVDKIFGMSLAFWTLAAFIGLALVNLYQAIRKA"
FT   gene            214932..215399
FT                   /locus_tag="CJA_0165"
FT   CDS_pept        214932..215399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0165"
FT                   /product="Flagellar basal body-associated protein FliL"
FT                   /note="identified by match to protein family HMM PF03748"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84267"
FT                   /db_xref="GOA:B3PGA9"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGA9"
FT                   /protein_id="ACE84267.1"
FT                   /translation="MFMNLYVLRICMAIGLLLSSIMVPVWAAGGGDKIPEGINYIPVAP
FT                   ALIVNYGGPDSKTRYIKVELSIRAENAADTKTLMHHLPLIRDRLISIFSAQTEEALGSV
FT                   EGKEKLRLEALAEINRVVHEIEYGADAATQHSIPANKPASDLLFNNFVVQR"
FT   gene            complement(215396..217006)
FT                   /gene="gshA"
FT                   /locus_tag="CJA_0164"
FT   CDS_pept        complement(215396..217006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gshA"
FT                   /locus_tag="CJA_0164"
FT                   /product="glutamate--cysteine ligase"
FT                   /EC_number="6.3.2.2"
FT                   /note="identified by match to protein family HMM PF04262;
FT                   match to protein family HMM TIGR01434"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85329"
FT                   /db_xref="GOA:B3PGB0"
FT                   /db_xref="InterPro:IPR006334"
FT                   /db_xref="InterPro:IPR007370"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGB0"
FT                   /protein_id="ACE85329.1"
FT                   /translation="MSQISPIATALLQLLAKPSVNTSLGGIMRGLEKESLRVTPEASLA
FT                   QTDHPAGLGSALTHPHITTDYSEALLEFITQPFTKVEPLLDQLEQIHRFTYQQLPVGER
FT                   LWPTSMPCHLGPDDNIPVARYGTSNSGLMKTIYRIGLGHRYGRSMQTIAGIHYNFSLPD
FT                   SFWQQLQAHVGDQQSLQDFKTERYFALIRNFRRHFWLLIYLFGASPAVGACFVKRRDHQ
FT                   LQPFPGHQDTLYTPYATSLRMGDLGYQSDAQKSLVVNYNNLSDYLKTLCGAITQSHPAY
FT                   ERIGVKDTEGNYQQLNTSLLQIENEFYSSIRPKRTSKRGETALQALRLRGVEYVEVRCV
FT                   DLNPYEPLGITAEQIRVMDSFLLFCLLSESPAMDEQEFYQGQENQKRVVNQGRDPALTL
FT                   LSGDTQRPLRLWAGEVLAQMQGCAELLDQAQSSTAHQQALEQQLQKLENPSLTPSAQLL
FT                   ADMQEADQGFIRFTLAQAERQRAHFARNPLKGSELARFRQMSEESQAEQVQLETSQLLS
FT                   FDEYLANYYAQYQGCSCGC"
FT   gene            complement(217091..217408)
FT                   /locus_tag="CJA_0166"
FT   CDS_pept        complement(217091..217408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0166"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACE86329"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGB1"
FT                   /protein_id="ACE86329.1"
FT                   /translation="MSEWFILQNQQKLFLGKQNQWVDGRDPAALFKTPHKDEAINQKVE
FT                   ASARDFTQRIQLLSCGLNEKGLPLLDPAILPEPLPKPAKDLFEDPAEPAPVIETGTQTA
FT                   P"
FT   gene            complement(217441..218718)
FT                   /locus_tag="CJA_0167"
FT   CDS_pept        complement(217441..218718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0167"
FT                   /product="transporter, small conductance mechanosensitive
FT                   ion channel (MscS) family"
FT                   /note="identified by match to protein family HMM PF00924;
FT                   match to protein family HMM PF07244"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85490"
FT                   /db_xref="GOA:B3PGB2"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR030192"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGB2"
FT                   /protein_id="ACE85490.1"
FT                   /translation="MKALIQGWLEPYQLAHADLIYVAIVLGLIVLTSLVLHVILHSVVL
FT                   RAISYSTRNSEQLWRQALYKNRLFNRIALVFQGVILYVQANIWLAPDSDALAFIQILTE
FT                   LWILLFALLSLFALLNALEEIFMPTSIGRRMPLRGISQSIKLIAALVAIIFGISLVIDK
FT                   SPLILFSGLGAMTAVLLLVFKDAILGFVAGIQLAANNMLSLGDWLEMPKYGADGDVIDI
FT                   SLTTVKVRNWDNTITTVPAYALISDSFKNWRGMSESGGRRIKRAVYIDATSVKFLQQED
FT                   IQRLRRAALLSDYIEEKIRDIEADNQQSGIDLEYPVNGRRLTNLGTFRAYLSAYLRNHK
FT                   NIHKGMTQMVRQLEPKAEGIPLEVYAFSNDTSWANYERIQADIFDHIFAVIPEFGLRVY
FT                   QSPSGYDMQHMAHQVGPLNSSDQAPT"
FT   gene            complement(218879..219673)
FT                   /locus_tag="CJA_0168"
FT   CDS_pept        complement(218879..219673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0168"
FT                   /product="Short-chain alcohol dehydrogenase family protein"
FT                   /EC_number="1.1.1.69"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85499"
FT                   /db_xref="GOA:B3PGB3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGB3"
FT                   /protein_id="ACE85499.1"
FT                   /translation="MTHPLFDLRGKVALITGATHGLGMAMASGLASAGAKLIINGNSSQ
FT                   EKIDKAVEYYRAQGFQAFGYRFNVTDEDQVTAAVEQIEKDHGAIDILINNAGIIKRTPL
FT                   LEMSLEDFEEVIKIDLTGVFTMTRPVARKMVERRQGKIINVCSMMSELGRNSVGAYAAA
FT                   KGGLKMLTKNMATEWAKHNVQVNGIGPGYFATSQTEPIRVDGHPFNEFIINRTPAAKWG
FT                   DPDDLQGATIFLASKASDFVTGQIVYVDGGILATIGKPSNEA"
FT   gene            complement(219686..220525)
FT                   /locus_tag="CJA_0169"
FT   CDS_pept        complement(219686..220525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0169"
FT                   /product="4-deoxy-L-threo-5-hexosulose-uronate
FT                   ketol-isomerase"
FT                   /EC_number="5.3.1.17"
FT                   /note="identified by match to protein family HMM PF04962"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84692"
FT                   /db_xref="GOA:B3PGB4"
FT                   /db_xref="InterPro:IPR007045"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR021120"
FT                   /db_xref="InterPro:IPR027449"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGB4"
FT                   /protein_id="ACE84692.1"
FT                   /translation="MKVLEERFAVHIDDYKHYDTQKLRKHFLVENIFAADEVLFTYTHY
FT                   ERLMVGGAMPVNKAVVLETYDQLKSEYFLQRRELGTINIGGNGKVSVDGEVFAINTKEA
FT                   LYIGRGAKEVIFSSDDASNPAKFYLNSTPAHHSYPTKKVDKENGKVLHMGAGDTCNERD
FT                   IYQLMINTVLDTCQLQMGMTELKPGSIWNTMPMHTHSRRMEAYFYFNIPQDHAVCHFMG
FT                   PAEETRHIWVANEQAVVSPPWSMHSGVGTANYTFIWGMAGENHDYTDMDFHKPSELK"
FT   gene            complement(220653..223214)
FT                   /gene="urh105A"
FT                   /locus_tag="CJA_0170"
FT   CDS_pept        complement(220653..223214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="urh105A"
FT                   /locus_tag="CJA_0170"
FT                   /product="unsaturated rhamnogalacturonyl hydrolase,
FT                   putative, urh105A"
FT                   /EC_number="3.2.1.-"
FT                   /note="identified by match to protein family HMM PF03991;
FT                   match to protein family HMM PF07470"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84385"
FT                   /db_xref="GOA:B3PGB5"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR010905"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR032342"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGB5"
FT                   /protein_id="ACE84385.1"
FT                   /translation="MQDDFNQRFERVITLISMRHDKTLGAIFSISLMVAALAGCSPDQS
FT                   KQATNTETTSTPSAAVNHQLAQLEVSNANAFALDREPVFIPLYDLGLDANNPKAQQLAI
FT                   KSDEQILPSQLVDTDGDETLDALLFNADFASAQTRRFTVSADPSISKPVVKKQTQAEIS
FT                   IKEGGEWQGKEYVGGTFKNVDRVTPPPQYTDHSYWIRYEGPGIESDKVGYRIYLDWRNG
FT                   FDIFGKKVHEMVLQNVGQDGYDSYHHNADWGVDVLKVGKSLGMGGFGFWNGKSVELVSQ
FT                   VDTRDAIITNNGDLYSGFIINYKGWQINDTKLDLKAHFTMTAGSRLVKVDLNASKEIPN
FT                   FAIGMVKHPGTTLLQGNTEKSGYAWTYVGSWGKQSLSGPDDHLGMAIIFRRGDRQEQTE
FT                   DESSYVSVMNDNGGNLEYYFLAAWEHELDGIKTEADFKAYLEREVDRLTKAPRIRFEST
FT                   LSAEAKQNLLTPESALSWAKKLADSELDRKTLKYHYGGWDEYRRRPAKFEYDVAGLQIQ
FT                   ALQDLNGVSPDQRYVDAAEIVTGSFVTEEGNIHTFPPELFSIDLTNPGRVLILLEQRTG
FT                   KEKYRKAVDYLRNHLKIHPRTSEGAFWHRATYPNQLWLDGVYMGIPFLIQYASIYETGA
FT                   VQHASFKEGIHEFDITRNRLRADNGLYIHAWDESKEAFWADKETGLASQYWSRGMGWLA
FT                   MAMVDVLDYLPESETDLRKTMLDMVNEFAADIIRYQDPETGTWWQITDKPGELANYRES
FT                   TGTAMFTYFLAKALNNGYLPAEYKEPALKAYQGLIKEFVTVHADGKISMTNQCLVAGLG
FT                   FGRDGSYDYYMTERIVSNDPKGNGPFIMAGIEIYKLLKQAQ"
FT   gene            complement(223310..226021)
FT                   /locus_tag="CJA_0171"
FT   CDS_pept        complement(223310..226021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0171"
FT                   /product="TonB-dependent receptor"
FT                   /note="identified by match to protein family HMM PF00593;
FT                   match to protein family HMM TIGR01782; match to protein
FT                   family HMM TIGR03304"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83111"
FT                   /db_xref="GOA:B3PGB6"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010104"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGB6"
FT                   /protein_id="ACE83111.1"
FT                   /translation="MRKFQINPLVLAMAVTALPLGAMAQSQSSNGDVVEEVLVTGSYRA
FT                   SLASALDTKRNSANAVDSIKAEDIADFPDNNLAESLQRIPGVAITRSGGEGRAISVRGL
FT                   GPDYTRVRINGVEAISTTGGTDATGGTNRTRGFDFNTFSSDLFSSLTVNKTAMASIEEG
FT                   SLGATVDLKTAQPFDYNDFVFTASAQAGYNELSEETDPAASFLISNVFADGKLGALFSL
FT                   SYSERTVRDEGSSTVRWSNAANQRFGSFSDGTPILATDNITTAFHPRIPRYDSFNHEIS
FT                   RLGASLSLQARPTDTTEVSLDVLYAKHEANRQEVFWEASMNGTQNNSVVVNDYEIQGNS
FT                   LVYADLSNVRLLAENRYDEMTTDFHQITLNVKQDFTDQLKGNLVIGSVKSDFDNPLQNT
FT                   AIMRADGMDFSYDFRDGKKGNFVFGDTAYNASSWTLTEMRQRPQASVNEYQNVLADIAY
FT                   EINDVLTLKAGVNYKKFEFSTTERRLASEAAPAGINLNDYLLTYDSGLGSGGAWLIPDR
FT                   GAIATDFDIFSRGYNIQASNTYETKEETTGGFIQLDFNSSIGETPVRGNIGLRQFSTEQ
FT                   STSGVLAGSQVWVDHKYDDVLPAANLSIEPIEDVIIRLAYSEGIARAGLGSIKADTSVS
FT                   VAGTNMSVTGSNPFLEPTKAKSYDVGVEMYFDNESALAMTLFRKDLESQVQSYRATRNF
FT                   QDIIAGFSPEQQASLSQQATTQCAASSLSTADCNTNAVWNYTVPVNSPGGDIYGFELSY
FT                   QTPFTFLPGFWQDFGFIGSFTYVKGQIAYLDPNTGNVEFVSDLENMSVNTSSATLYYEK
FT                   DAFQARISLASRSGYLTNARGRDGNSAEGTHSTHNVDASASYQLNDNWRFTFEALNLTN
FT                   EADDQWVDSNDYRLSYYHETGRQYYLGVQYKY"
FT   gene            complement(226264..227733)
FT                   /gene="pga28A"
FT                   /locus_tag="CJA_0172"
FT   CDS_pept        complement(226264..227733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pga28A"
FT                   /locus_tag="CJA_0172"
FT                   /product="polygalacturonase, putative, pga28A"
FT                   /EC_number="3.2.1.15"
FT                   /note="identified by match to protein family HMM PF00295;
FT                   match to protein family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACE86080"
FT                   /db_xref="GOA:B3PGB7"
FT                   /db_xref="InterPro:IPR000743"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGB7"
FT                   /protein_id="ACE86080.1"
FT                   /translation="MNKTPRQLIDRREFLNRAGSMAGIAFLGATGLTACVNNKPSPNSG
FT                   MSYDEAWRTADDIRNNIARTSFPNKTFDIRAYGARAGGAIDATKAFANAIAACHAAGGG
FT                   KVLVSGGTYLSGPIHLLSNVNLHVEKGARIAFITDPKAYLPAVFTRWEGMELMGYSPLI
FT                   YAYRQENIAITGEGTLDGQANRTTWWPWKGGAWKGGKNWSVPGFPTQDEGREQLQRAME
FT                   AGVAPEQRLFAEGANLRPPFVQPYECERVLIEGVTIVNSPFWLLNPVLCNDVIVRGVTC
FT                   DSMGPNSDGCDPESCDRVLIEDCYFDTGDDCIAIKSGRNHDGRRINRPSQNIVIRNCHM
FT                   RRGHGGVVIGSEMSGGVRNVFVEHCEMNSPDLERGLRIKTNSVRGGVVENFFARDITIV
FT                   EVKNAIVIDFQYEEGDAGEHTPIVRNIDFRGITCAKAERVFQVRGYERSPISNLALRNC
FT                   DFKQVKEIGVLEHMDAMTAENVRINGTPFTI"
FT   gene            complement(227896..228030)
FT                   /locus_tag="CJA_0173"
FT   CDS_pept        complement(227896..228030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0173"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85748"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGB8"
FT                   /protein_id="ACE85748.1"
FT                   /translation="MSFFVNFSLKNGFLAEITYAECLQFTEVTTRMIFTKSEDAHLAY"
FT   gene            228491..230011
FT                   /locus_tag="CJA_0174"
FT   CDS_pept        228491..230011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0174"
FT                   /product="dehydratase"
FT                   /note="identified by match to protein family HMM PF04292;
FT                   match to protein family HMM PF04295"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83193"
FT                   /db_xref="GOA:B3PGB9"
FT                   /db_xref="InterPro:IPR007392"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGB9"
FT                   /protein_id="ACE83193.1"
FT                   /translation="MSSIIVLHESDNVGICKVSLPAGVLYAEKDVTLLRDIPAMHKFAV
FT                   RPIAKGEAITKYGQVIGFANQDIPAGEHVHAHNCVMGDFEKDYGFCEQARPTQFVPVAE
FT                   RATFQGYKRANGKVGTRNYIGIITTVNCSATVAKAIAQQISQSGELAQFPNIDGVVALT
FT                   HDSGCGMRSDGEGYETLRRTFNGYARHPNFGGVMMVGLGCETMQIKRVMEECGLADSKT
FT                   FTAYTIQDVGGTRHAIEKGLDAVRAMLPLVNAHQRETASASELIIGLQCGGSDAFSGIT
FT                   ANPALGIAGDILVRHGGTVILSETPEIFGAEHLLTRRAESPEVAQKLLERIQWWQDYTA
FT                   RNDFELNNNPSPGNKAGGLTTIIEKSLGAQAKSGSTNLRDVFLYAEEITEKGFVFMDSP
FT                   GYDPVSATGQVASGAQILCFTTGRGSAFGCKPAPSIKLATNSGIYERMQDDMDINCGKV
FT                   LDGELTLEQSGQEIFEEILAVASGKRTKSELLGYGDNEFIPWKIGAVV"
FT   gene            230198..231358
FT                   /locus_tag="CJA_0175"
FT   CDS_pept        230198..231358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0175"
FT                   /product="proton-translocating nicotinamide nucleotide
FT                   transhydrogenase subunit PntAA"
FT                   /EC_number="1.6.1.1"
FT                   /EC_number="1.6.1.2"
FT                   /note="identified by match to protein family HMM PF01262;
FT                   match to protein family HMM PF05222"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACE86352"
FT                   /db_xref="GOA:B3PGC0"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGC0"
FT                   /protein_id="ACE86352.1"
FT                   /translation="MRLAIPKERRAHERRVAATPETVKKFIALGFDVTVEAGAGLASRI
FT                   TDEDYRNAGASVVDDPASLLGQADVVLKVQRPLLAGEGELDELSLMKRDALLVAILSPY
FT                   ADAKAVEAYAKAGVTSMALEFVPRITRAQSMDVLSSQSNLAGYRAVLEAINVYDRAMPM
FT                   MMTAAGTVAPARVMVLGAGVAGLQAIATARRLGAIVSATDVRPASKEQVESLGGKFIMV
FT                   ESEETKQAETAGGYAKEMSDDYKRRQAELVAETLKKQDIAICTALIPGRKAPTLINDEM
FT                   VYSMRPGSVIVDLAAEQGGNCTLTKPGEVVEVNGVTIIGLFNIPSRISADASALYAKNL
FT                   LNYLTPLVDTASKQLAINWQDEIVAATTLTRAGEVVHPNFKAPSAT"
FT   gene            231373..231657
FT                   /gene="pntA"
FT                   /locus_tag="CJA_0176"
FT   CDS_pept        231373..231657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pntA"
FT                   /locus_tag="CJA_0176"
FT                   /product="NAD(P) transhydrogenase, alpha subunit"
FT                   /EC_number="1.6.1.1"
FT                   /EC_number="1.6.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85293"
FT                   /db_xref="GOA:B3PGC1"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGC1"
FT                   /protein_id="ACE85293.1"
FT                   /translation="MEGQFVSQLSIFVLAIFVGYYVVWSVTPALHTPLMAVTNAISSVI
FT                   IVGALIAVGPEGVSLSKVLGFVAMVLAAINIFGGFTVTQRMLAMYKKKK"
FT   gene            231673..233076
FT                   /locus_tag="CJA_0177"
FT   CDS_pept        231673..233076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0177"
FT                   /product="proton-translocating nicotinamide nucleotide
FT                   transhydrogenase subunit PntB"
FT                   /EC_number="1.6.1.1"
FT                   /EC_number="1.6.1.2"
FT                   /note="identified by match to protein family HMM PF02233"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83594"
FT                   /db_xref="GOA:B3PGC2"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGC2"
FT                   /protein_id="ACE83594.1"
FT                   /translation="MSSTYESLTSLAYLVAAVLFIMALRGLSSPESSRRGNFFGMLGMA
FT                   IAIVTTILSPAVTSYTWIVVALLIGAVIGIVIARKIAMTAMPQLVAAFHSLVGLAAVLV
FT                   AGAAFSNPEAFGIVNAAGEIYIASRIEMGLGVVIGAITFSGSVIAFTKLQGLVSGKPMV
FT                   FGGQHLLNALIGAVIIGLIGYFCVEQAPWVFWTMTALAFVIGILLIIPIGGADMPVVVS
FT                   MLNSYSGWAAAGIGFTLHNDALIVTGALVGSSGAILSYIMCKGMNRSFFNVILGGFGAD
FT                   ASAAAASGGEDRPVKRGSAEDAAFIMKNAGSVIIVPGYGMAVAQAQHALREMADELKHA
FT                   GVKVSYAIHPVAGRMPGHMNVLLAEANVPYDEVFELEDINNEFQTADVAFVIGANDVTN
FT                   PAAKTNPQSPIFGMPILEVEKARTVLFVKRSMASGYAGVENELFHRDNTMMLFGDAKKM
FT                   VETIVKNLA"
FT   gene            233154..233552
FT                   /locus_tag="CJA_0178"
FT   CDS_pept        233154..233552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0178"
FT                   /product="glyoxylase family protein"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82935"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGC3"
FT                   /protein_id="ACE82935.1"
FT                   /translation="MKIEHFAINVADPVAMADWYVTHMGLRVVRKQEGGANTHFLADDS
FT                   GDVMLEIYNNPPDEVPDYAAMNPLLLHLAFVCENPEQKRAQLEAVGASFAEEVHIKDGS
FT                   HLVMMRDPWGLSIQLCKRGSKMLRCQQS"
FT   gene            complement(233604..234692)
FT                   /gene="kdgK"
FT                   /locus_tag="CJA_0179"
FT   CDS_pept        complement(233604..234692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdgK"
FT                   /locus_tag="CJA_0179"
FT                   /product="ketodeoxygluconokinase"
FT                   /note="identified by match to protein family HMM PF00294"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84021"
FT                   /db_xref="GOA:B3PGC4"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGC4"
FT                   /protein_id="ACE84021.1"
FT                   /translation="MDFHAAHWQRNKTHKFSIFRAAVVLYFAANKQPNNTAVSLVFLTP
FT                   GIITMAHIAAIGEVMVELSPFPTADSNGREIMALSFAGDTYNTSVYMARLGLQTDYVTQ
FT                   LGDDPYSAQILQRMRDDNISTDLIKQLPGRSPGLYIIRNRPDGEREFFYWRKEAPAREL
FT                   FATQEAADNLCQQLANCDCVYLSGITLAIIGAASREFLYNSLHKLRQQGVTIAYDSNYR
FT                   PRLWADKHEAQQAMLSMMKYTDIALLTLDDEQLLWGDDTIEGCKQRYAEFRLRELVLKR
FT                   GADDAVIITHEGELRVPVPPVQGVVDTTGAGDTFNAGYLAGRLTHKSLEDSAKQGIRCA
FT                   SIIIRHRGAIIDKAVFAKELGA"
FT   gene            234806..236284
FT                   /locus_tag="CJA_0180"
FT   CDS_pept        234806..236284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0180"
FT                   /product="D-mannonate oxidoreductase"
FT                   /EC_number="1.1.1.57"
FT                   /note="identified by similarity to SP:P39160; match to
FT                   protein family HMM PF01232"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84138"
FT                   /db_xref="GOA:B3PGC5"
FT                   /db_xref="InterPro:IPR000669"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGC5"
FT                   /protein_id="ACE84138.1"
FT                   /translation="MNRLNQEQLSLLPKDVILPRYDRNSLKAGIVHLGIGAFHRAHQAF
FT                   YTEAVLNEFGGDWGIVGCSLRSPSVRDQLVPQDCLYTLVERSGEGEKLQIIGAVKDTVV
FT                   GPENPQALVAIIAESNIKIVSLTVTEKGYCHDPATGNLNLNHPDIVHDLANLDRPVSAI
FT                   GFLVAALKKRYEAGQKAFTLLSCDNLPNNGEVLEKVIVQFAQQIDASLAQWIKTNATFP
FT                   CTMIDRIVPATTDDDRRDIEARLGVRDEGMVVCEPFTQWVVEDKFADGRPAWEKVGVLM
FT                   VEDVRVFEKIKLRLLNGAHSTMAYTGYLSGFQYISEVMEQPAFVNLVKTYMAREAGETV
FT                   SAPAGFDIEAYKQQLRDRFSNKALKHRTWQIAMDGSQKLPQRLLETLREQLAGNGHIDI
FT                   LCLGVAAWIRYVSGVDEQGNPIEVSDPLAKELRAACDANQGNPAGMVKAIVGIQKVFGS
FT                   DLIDATPFVQTTTQWLERFYAKGVLASVQDAFGH"
FT   gene            236371..237471
FT                   /gene="pme8C"
FT                   /locus_tag="CJA_0181"
FT   CDS_pept        236371..237471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pme8C"
FT                   /locus_tag="CJA_0181"
FT                   /product="pectin methylesterase, putative, pme8C"
FT                   /EC_number="3.1.1.11"
FT                   /note="identified by match to protein family HMM PF01095"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84027"
FT                   /db_xref="GOA:B3PGC6"
FT                   /db_xref="InterPro:IPR000070"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGC6"
FT                   /protein_id="ACE84027.1"
FT                   /translation="MVRAAAVLAICVLVLGCLYRPGTVRDIHYQARVDKTISAANVYPS
FT                   IQAALDAAPAAATEPYRILVASGDYYEKLVINKPNIHIVGAGPASTRLYFDAYAGQSYA
FT                   QGKTWGTSGSATLTVRAPGVLLQQLTIENTFDFLANDALAVDDPARIQHTQAVALLLDT
FT                   GSDRFIGRQLHLLGYQDTLYINAGRSWFDRSLVAGNVDYIFGRGNALFTHSEIRTLGRN
FT                   KTSFPHGYITAPSTQISDHYGLTFIHCKLTRVAGVPDNSVPLGRPWHPTTQFADGRYAD
FT                   PNAIGKSVFINTWMDAHITRDGWYSMSGTAKDGISKVQFTPEDSRFFEYQSAGPGAQVN
FT                   SKRRQLSAREAEDYTPEKILGEWYPQ"
FT   gene            237624..239966
FT                   /locus_tag="CJA_0182"
FT   CDS_pept        237624..239966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0182"
FT                   /product="putative methyl-accepting chemotaxis protein"
FT                   /note="identified by match to protein family HMM PF00015;
FT                   match to protein family HMM PF00672"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82874"
FT                   /db_xref="GOA:B3PGC7"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGC7"
FT                   /protein_id="ACE82874.1"
FT                   /translation="MNISSRLMLGAMVLTGIAVILAAGTTGWLALQQTNRALSQNLEQR
FT                   FQALAEGRAQAVATQFSSYAELLLSLSHGRMTQEAVYGFIRPFASYRYEVSATPEAELR
FT                   TQLADWYQQTYAPYHRQLTRGQPADARTWVEGFSLETLLIQQRYLQANPSPINALDTME
FT                   DAADATIYGQQHRRYHSSFRDLTRRFGFSDLLIVDSRSLAVIYSVNKSSLLGDSLATAS
FT                   LASSPLAQLARSLQRAHADQVLVSRFHSNPRRFEQQLVYVGVPVFHDVQSPHKAIGLLI
FT                   AEIPVTRLTQIMSAQQHWQSLGLGETGDIYLVDSSQRLLTELREVQQAPMTAVADLQQT
FT                   VTGNLNAMIRLQQAAGNIQIATYPVREALAGRAGTGMEQDYLGRTMFTSWQPLVIGDQA
FT                   LALVAQQRPEEVFAAVAELRGTLWRSVVIASIVLTGLAAVLAFFFSRSIGKPLVLLAHK
FT                   IKRAAEDKNLASEFPAQRRDELGEMGRSLNFLFAELNRVLVQVNQSSEQSLQGALDNVT
FT                   TTRQCRDETARQRHEMNHVGAETEAVVKSMSDISQHLDTVTRQVSLAQEAAGQGQVRAR
FT                   AVVNEMQSLAQQVADSCATLTELRTATGNIGSVLDTIQGVAEQTNLLALNAAIEAARAG
FT                   EQGRGFAVVAEEVRRLSFDTQKATGEIKDMIDQLRASVGQISIGLAAEQETAQRCMDET
FT                   LATQTALDRIQQSVADANQLTQRINLSAQDESNRAQAMRNRLVNLVSGINETDQAIARL
FT                   AQGAEQQNQLANQAMRAAKVLTFSRAR"
FT   gene            complement(239974..240945)
FT                   /gene="fbp"
FT                   /locus_tag="CJA_0183"
FT   CDS_pept        complement(239974..240945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fbp"
FT                   /locus_tag="CJA_0183"
FT                   /product="fructose-1,6-bisphosphatase"
FT                   /EC_number="3.1.3.11"
FT                   /note="identified by match to protein family HMM PF00316"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85656"
FT                   /db_xref="GOA:B3PGC8"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR020548"
FT                   /db_xref="InterPro:IPR028343"
FT                   /db_xref="InterPro:IPR033391"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PGC8"
FT                   /protein_id="ACE85656.1"
FT                   /translation="MQRLVPTLRRDGVNPELIPVIRTLLAATKEIAFRVRQGALSGVLG
FT                   STLDENIQGETQKQLDVIANQLIKDLLLEEPQVRAIASEEEDTVVAGNPKGAYTVAFDP
FT                   LDGSSNIDINGQIGTIFTIYPARDDVPADSEAQFQQPGHQQVCAGYVLYGPSTILVMTT
FT                   GGPTRGYTLDATHGSYLLTQAQLSVPLNTQEFALNMANQRFWSAPFQRYVQDLLLGETG
FT                   PRAKRFNMRWNAAMVGDVHRVLTRGGIFMYPSDNRNPRQPAKLRLLYEANPMAMLTENA
FT                   GGKAWSENQRILNIQPDSLHQRVAVILGSANEVDVCMSYLLE"
FT   gene            complement(240961..242040)
FT                   /gene="fbaA"
FT                   /locus_tag="CJA_0184"
FT   CDS_pept        complement(240961..242040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fbaA"
FT                   /locus_tag="CJA_0184"
FT                   /product="fructose-bisphosphate aldolase, class II"
FT                   /EC_number="4.1.2.13"
FT                   /note="identified by match to protein family HMM PF01116;
FT                   match to protein family HMM TIGR00167; match to protein
FT                   family HMM TIGR01520"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83714"
FT                   /db_xref="GOA:B3PGC9"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006411"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGC9"
FT                   /protein_id="ACE83714.1"
FT                   /translation="MNSLANLVAPGVATGDDVQTLLNAAKAGGFAYPAVNAANTNTINA
FT                   TLEAARKVNSPVIVQLSQGGSAFFCGKSLKLEGLGSSILGAIAAAHYVHNVAQAYGIPV
FT                   ILHTDHAAKKLLPWIDGLLDASETFFAQTGKSLFSSHMIDLSEESLQENIEISAHYLER
FT                   MKKLGITLEIELGCTGGEEDGVDNTGLDNSALYTQPEDVAYAYEKLSAISDKFTIAASF
FT                   GNVHGVYKPGNVQLTPVILKNSQQFVSEKFSLGHNPLNFVFHGGSGSLPEEIAESLQYG
FT                   VVKMNIDTDTQWAFWEGTLNFYQANSGYLHGQIGNPDGDDKPNKKYYDPRVWLRHSEES
FT                   MVKRLEQSFADLNCINRYV"
FT   gene            complement(242146..242916)
FT                   /locus_tag="CJA_0185"
FT   CDS_pept        complement(242146..242916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0185"
FT                   /product="triosephosphate isomerase"
FT                   /EC_number="5.3.1.1"
FT                   /note="identified by match to protein family HMM PF00121;
FT                   match to protein family HMM TIGR00419"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82668"
FT                   /db_xref="GOA:B3PGD0"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGD0"
FT                   /protein_id="ACE82668.1"
FT                   /translation="MKPRKPIVIANWKLNGGLDLICTSVASFIGKHVDAQIAICPPYLY
FT                   MRDMMTFLQFSELQIGSQNVSRYESGAYTGETSAQMLKQAGCSLCLIGHSERRAMFAEN
FT                   NEGCQIKVRTALNHGLLPVLCVGENQAEREANITEEVLYKQLSEGLANIELNGRDLCIA
FT                   YEPVWAIGTGLAATPAIAQSVHQYIRAELARIFDADSAARVRILYGGSVNKTNARDLLL
FT                   QEDIDGLLVGGASLDPGHFLAICEQASELAEHTA"
FT   gene            complement(242903..243145)
FT                   /locus_tag="CJA_0186"
FT   CDS_pept        complement(242903..243145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0186"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACE86005"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGD1"
FT                   /protein_id="ACE86005.1"
FT                   /translation="MITFGQEGRCTLNATVFHAPSGDGHGHSPLPCLHQTATQFPFTYT
FT                   YYGFGATEITENDPYQRPGQHYKSDRVQETFDETT"
FT   gene            complement(243444..245024)
FT                   /locus_tag="CJA_0187"
FT   CDS_pept        complement(243444..245024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0187"
FT                   /product="putative GGDEF domain protein"
FT                   /note="identified by match to protein family HMM PF00672;
FT                   match to protein family HMM PF00990; match to protein
FT                   family HMM TIGR00229; match to protein family HMM
FT                   TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83267"
FT                   /db_xref="GOA:B3PGD2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGD2"
FT                   /protein_id="ACE83267.1"
FT                   /translation="MNSLHIRVSLAVAASALLVVLVSSYLFYESSYKNSLASSQRSVQQ
FT                   LMETVRAPAAIAAYVGNRELAQQVVTGLAQNDMVVGAKILANREIIGQDGKRPEDNGKD
FT                   TMTLSLVSPFDEKEEVGTLLVAPNIAQIALRARDAAMATTASLAALAVVVALLVLIMVY
FT                   WMMSRPLVRLSTNLHKITPGDGNRLKDGQRSDEIGLLISDINSLLNTVEKMLDEERQLR
FT                   HRVEQLENRFRGIFEDSSAGIFLITEQGQLVTANPSFFKLTRFEEDAHTLSQNLIERVF
FT                   HEPSQAQSLIRLAQISKRPCSADLRLATEDPQDERWIHCIFSPAGNDQRSHIVEGVMYD
FT                   VTQRKKAEERTRELAETDSLTGLTNRPAAEAILDQWLIQAAATSRGLAVMMIDLDRFKQ
FT                   INDSYGHDAGDQVLRVVANRLRKLVRDSDLVARLGGDEFLIVLKQTDNPDVDKRIAQQI
FT                   LDAQAAPIEIQPQVLETVGISIGIAHYPAHGDNPQSLRRHADQALYSVKRRGKNNYAIY
FT                   DPEDVDPPA"
FT   gene            complement(245027..245419)
FT                   /locus_tag="CJA_0188"
FT   CDS_pept        complement(245027..245419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0188"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84123"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGD3"
FT                   /protein_id="ACE84123.1"
FT                   /translation="MFAGLVQAEILVIVNAQNPHLQLERKQVVDIFMGRVSTFPGGAPA
FT                   QAFDLKAGSPGRATFYKILTGKSEAQVDAYWATLVFAGRMSPPRQVDSDQALIKAVAAN
FT                   PAAIAYIPRQPLPAGVKVVMELNNTP"
FT   gene            complement(245455..246714)
FT                   /locus_tag="CJA_0189"
FT   CDS_pept        complement(245455..246714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0189"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85821"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGD4"
FT                   /protein_id="ACE85821.1"
FT                   /translation="MRLPIPITRLLTTSLLAIALPVLGDSQVQHRFSGFATLGITSNDN
FT                   PNLVYRRDVIQDQGSYDGKLEWRTDTLVGAQWQGLWTHAWETSVQVVAKDRFEGSLDDA
FT                   VEWAYVRYRPEDGLDLRLGRLGVDIFMLSDYRLVGYAYPWVRPPHETYGLLSMYHIDGA
FT                   DITKRFDIGDSSLSLKAFYGRFKDDYPTSYRSNDSVGLQFEPYGFSTVLEKGAWKWRAT
FT                   YVNANLRDDYAGSLIDALNAAGPYWPEAMEWSQKLRTHNKNAGYFELGMDYDSNNWWVQ
FT                   SELVRINSDTSLIGNSDHGYLSIGRRFGNLSVFAMAGFAEPRDRRVVIIPPAGYPPPLA
FT                   GQLEQLAQATQGLLNGVRIDQRSVSLGTRWDFRPRMALKFQVDDIDIATHGTNLWFTAD
FT                   ETVTSDQSATVISLTLDVLF"
FT   gene            complement(246845..247678)
FT                   /locus_tag="CJA_0190"
FT   CDS_pept        complement(246845..247678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0190"
FT                   /product="response regulator"
FT                   /note="identified by match to protein family HMM PF00072"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83685"
FT                   /db_xref="GOA:B3PGD5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGD5"
FT                   /protein_id="ACE83685.1"
FT                   /translation="MGVRILVVDDASFIRDMVKKQLRDKVPGAEVLDAVDGNRALAILK
FT                   NTPIDLILSDWEMPNMTGAELLGAVRAMPEYSKTPFMMISSRGDRSHIIKAIELGVSDY
FT                   LTKPFSAEELIKKVYKQLKAVGKLPTHHRQMASTQGIAHASVDVLTGGRTLTPPASSEP
FT                   PPPPARTVEPVRHKGRAQLRFNHNRTFGCIIREMSLQMMHCLMPRADNLPGLFEQVVVD
FT                   IELGEGGELARVNGYVHSLQAVEPGPDAKTIKLLIRFVDNDAEKFEVLSKYIAQL"
FT   gene            complement(247757..248533)
FT                   /locus_tag="CJA_0191"
FT   CDS_pept        complement(247757..248533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0191"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03883"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85453"
FT                   /db_xref="InterPro:IPR005583"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PGD6"
FT                   /protein_id="ACE85453.1"
FT                   /translation="MLHVISPAKTLDFETPPITRHFTQPQFLDHAQQLIDELRPLNPQQ
FT                   VSELMDISEKLGVLNAQRFLDWQLPFTTENAKQAVLAFKGDVYTGMQADRFSSQDLAWA
FT                   QQRLRILSGLYGLLRPLDLIQPYRLEMGTHFANSRGKNLYEFWGNRLTEQLNRELAQAP
FT                   QPLLVNLASNEYWGAVQARHLSGEVITPTFKDRKNGQYKIISFFAKKARGMMSAWIIQQ
FT                   RLDQAEGLKDFNSAGYRYNPAMSSAREWVFTREEPV"
FT   gene            complement(248585..248959)
FT                   /locus_tag="CJA_0192"
FT   CDS_pept        complement(248585..248959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0192"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACE86278"
FT                   /db_xref="InterPro:IPR025361"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGD7"
FT                   /protein_id="ACE86278.1"
FT                   /translation="MQSPAFAKGLASGDRVRMLPETREFELVKRSGNLSIRVFSRTDIE
FT                   HLSDRITPELEKLGGELERETPRMLGYAIHVSCGFEAIEAILNRHVGQDGQSQWMYGNV
FT                   YDPQDGTTPLNWWQDILKPE"
FT   gene            248963..249109
FT                   /locus_tag="CJA_0193"
FT   CDS_pept        248963..249109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0193"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83372"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGD8"
FT                   /protein_id="ACE83372.1"
FT                   /translation="MQGAIFQLAYLKLFYNGLAICAQAGKEFDNLKGLRHGVHLGFKKA
FT                   VAL"
FT   gene            249136..250404
FT                   /locus_tag="CJA_0194"
FT   CDS_pept        249136..250404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0194"
FT                   /product="Peptidase family M48 family"
FT                   /EC_number="3.4.-.-"
FT                   /note="identified by match to protein family HMM PF00515;
FT                   match to protein family HMM PF01435"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83057"
FT                   /db_xref="GOA:B3PGD9"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGD9"
FT                   /protein_id="ACE83057.1"
FT                   /translation="MKNLARLIAVGLALAALSGCVVNPVTGKSQISLMSPEQEIATGAQ
FT                   NYEPSQQSQGGQYTVDPALTTYVQSVGRKLAAVSDRPSLPYEFVVLNNDVPNAWAMPGG
FT                   KLAINRGLLMYLEDEAQLAAVLGHEIVHAAARHGAQQQTQNVLLGAGVLLTGVAISQKK
FT                   PEYGALAIGALGVGATAWQAKYGRNHELESDRVGIKYMAEAGYDAQAAVELQQIFVKLS
FT                   EGRNAGFIDGLFASHPPSQERVDANRKTAAQYPGGVRNKTQYQRAIAQLVKDKPAYEKY
FT                   QKAQQLAANKQYIDALAYADQAARAQPKENLFWELKGQLLLQQNKRDEAVVALDKAIQA
FT                   NPAYFKPYVFRGIAYNQLGKRDLAEKDLLTSQRYLPTQIATYYLGEIALAKGNRSQATE
FT                   YFQQAAQGGGEIGEAAQAQLGKM"
FT   gene            250575..251123
FT                   /locus_tag="CJA_0195"
FT   CDS_pept        250575..251123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0195"
FT                   /product="TRAP transporter, DctQ-like membrane protein
FT                   family"
FT                   /note="identified by match to protein family HMM PF04290"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83899"
FT                   /db_xref="GOA:B3PGE0"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGE0"
FT                   /protein_id="ACE83899.1"
FT                   /translation="MSQLISRSAKDSPSAIRWLDAITDITGSTTAWLTLAMVLISSLVV
FT                   ILRHGFNIGSIALQDSVTYMHGMVFMMGAAYTLKQGGHVRVDILYNRFSPRSRAWVDAL
FT                   GSLVFTLPVVVFIGWGSWDYVMRAWEIRESSNDSGGLGGVYLFKTLLPLMALSLGLQAF
FT                   AELLRNLWYLMQPAESTAC"
FT   gene            251117..252499
FT                   /locus_tag="CJA_0196"
FT   CDS_pept        251117..252499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0196"
FT                   /product="TRAP transporter, DctM subunit"
FT                   /note="identified by match to protein family HMM PF06808;
FT                   match to protein family HMM TIGR00786"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85675"
FT                   /db_xref="GOA:B3PGE1"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGE1"
FT                   /protein_id="ACE85675.1"
FT                   /translation="MLIELIPLWMFIAICLFMLLGYPVAFTLAGVALGFAGFGIVAGVF
FT                   DANLLKSFPTRLYGIMNNYTLVAVPLFVFMGTVLEKSRLAEDLLANMTKACGRLPGGLG
FT                   LSVVMVGSLLAASTGIVGATVVTMGLMSLPLMLKRGYAPDFACGTICATGTLGQIIPPS
FT                   IALVLLGDVLSSAYQQAQLKMGVFNPKTLSVGDLFIAAIVPGLALVVIYMLFVVFTAWF
FT                   RPHIIPRVPVDTDERVPVFKLVLSLLPVLLLIGLVLGSILIGAATPTEAAGVGALGACL
FT                   LALFKKQLTWQRLREVSRSTIQITAMIFMILIGASLFSLVFRGFGGEELVHHFFNQLPG
FT                   GVFTAVLLVMVAMFILGFILDFIEIIFVVVPIVGPVLLAMGVDPIWLGIMIAVNLQTSF
FT                   LTPPFGFALFYLRGVAPAAIPTAAIYRGVIPFVMLQLLLLMLMALWPGLVTWLPEQIGM
FT                   SK"
FT   gene            252577..252972
FT                   /locus_tag="CJA_0197"
FT   CDS_pept        252577..252972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0197"
FT                   /product="acyl-CoA hydrolase"
FT                   /note="identified by match to protein family HMM PF03061"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84604"
FT                   /db_xref="GOA:B3PGE2"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGE2"
FT                   /protein_id="ACE84604.1"
FT                   /translation="MPAHTESPTGTLTLQTISMPADTNPFGDIFGGWVMAQMDIAGAIH
FT                   ANEVAKGRVTTVAVGSMSFIRPVPVGAIISCYTSTRRIGNTSIRVWVEVWIKDFLTQKI
FT                   SLVTEGEYIYVALDEQGHKRPVRLGNG"
FT   gene            253164..253823
FT                   /locus_tag="CJA_0198"
FT   CDS_pept        253164..253823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0198"
FT                   /product="Cytochrome b561 homolog 2"
FT                   /note="identified by match to protein family HMM PF01292"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83208"
FT                   /db_xref="GOA:B3PGE3"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGE3"
FT                   /protein_id="ACE83208.1"
FT                   /translation="MPVPTITVIFTPIRHWGRDRWDLPPYYRALKPLGFIMLKDTRRDY
FT                   GWISISIHWISALLIFFLFGLGIYMTGLSYYDEWYHKGPSLHISLGLVLLLVMVVRLVW
FT                   RGANPTPEDLSPHRLNNALAKLVKLGFYLLIFAVIISGYLITTAEGKPAEIFGLLKIPS
FT                   IMELSASQVDLAGEIHEFLAWGIVLLAVLHALGALMHHFVWRDRTLVRMLKPGKQK"
FT   gene            253895..254479
FT                   /gene="ycel3"
FT                   /locus_tag="CJA_0199"
FT   CDS_pept        253895..254479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycel3"
FT                   /locus_tag="CJA_0199"
FT                   /product="yceI-like protein, ycel3"
FT                   /note="identified by match to protein family HMM PF04264"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84371"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGE4"
FT                   /protein_id="ACE84371.1"
FT                   /translation="MLKKSLLALAVSSIGLMSLPALADSYVIDTKGAHASINFAVKHLG
FT                   YSWLTGRFDNFSGEFTYDPAKPEASTISVTIDTTSVNSNHAERDKHLRGSDFLNVEKFP
FT                   KATFVSKQIKVDPDDKDEFDIIGDLTLNGVTKTIVIEVDKVGEGKDPWGGYRVGFEGET
FT                   HINMRDFNIKMDLGPASQMVKLELHVEGIKK"
FT   gene            254812..255102
FT                   /locus_tag="CJA_0200"
FT   CDS_pept        254812..255102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0200"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85206"
FT                   /db_xref="GOA:B3PGE5"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGE5"
FT                   /protein_id="ACE85206.1"
FT                   /translation="MYRVLFPREHQILARFGEDLLLAVKRRGLTKQMICDRTGFDNKTI
FT                   NKVFAGDPGVAIGTYLKVMAVLGMEENFAELAAHDEVGIKLQNIKLLRGSK"
FT   gene            255099..256349
FT                   /locus_tag="CJA_0201"
FT   CDS_pept        255099..256349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0201"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82697"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGE6"
FT                   /protein_id="ACE82697.1"
FT                   /translation="MSRTAVAVYASWMPIDAPLLIGQLMFADTSRGGVFSFTYDKHFLT
FT                   SDYCLQIDPRLTLHTGELYNDSPDRNFRTFLDSCPDRWGRILMQRRAAIECRKGLRPSA
FT                   RLTELDYLLGVHDSYRMGGIRFKTTESTDFLDNDTEFAAPPMTSLRELEHAAIQIEKDD
FT                   NIDSDEYYHWLKMLISPGSSLGGARPKACVTDEQNQLWIAKFPNKNDTVDVGAWEMVCY
FT                   ELAQTAGVDMFPSEIHKFSSAHHTFLTKRFDRIGSKRIHFSSAMTQLQYYDGEHSEGAS
FT                   YLEIAEFLTNHGAQTKADLAQLWRRIVFNIAVSNTDDHLRNHGFLLTKRGWKLSPAYDL
FT                   NPIVGKQGLHLNINDTSNELNYSLAFDVIDFFRLTHEEATRIYDDVLSAVKEWQAVANR
FT                   LGISRSEQLIKQQAFNL"
FT   gene            complement(256425..257294)
FT                   /locus_tag="CJA_0202"
FT   CDS_pept        complement(256425..257294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0202"
FT                   /product="conserved hypothetical protein TIGR00255"
FT                   /note="identified by match to protein family HMM PF03755;
FT                   match to protein family HMM TIGR00255"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83540"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGE7"
FT                   /protein_id="ACE83540.1"
FT                   /translation="MPRSMTGFARREAKLPWGTAVWEIRSVNHRYLEPSFRLPEDFREI
FT                   EPALREAMRKALQRGKVEASLSIQWEQAGETELGINLDKVAQLTKAAQQINGLLGEVAA
FT                   PVNALEILRWPGVIQKQELDREALQADVLQLFESALGGLIEHRSREGAELEQLILARLD
FT                   AVSAQVANVRTRMPEILAAQREKLHTKLAALQIELDPERLEQEIVLLAQKADVDEELDR
FT                   LDTHVIEVKRSLKQTDSLGRRLDFLMQELNREANTLSSKSVVSETTQAAVELKVLIEQM
FT                   REQVQNIE"
FT   gene            257434..258153
FT                   /gene="rph"
FT                   /locus_tag="CJA_0203"
FT   CDS_pept        257434..258153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rph"
FT                   /locus_tag="CJA_0203"
FT                   /product="ribonuclease PH"
FT                   /EC_number="2.7.7.56"
FT                   /note="identified by match to protein family HMM PF01138;
FT                   match to protein family HMM PF03725; match to protein
FT                   family HMM TIGR01966"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85909"
FT                   /db_xref="GOA:B3PGE8"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PGE8"
FT                   /protein_id="ACE85909.1"
FT                   /translation="MQRPSGRNPQALRPIRITRRYTKHAEGSVLIEFGDTKVICTASVV
FT                   AGVPSFLRGQGQGWLTAEYGMLPRSTGTRMDREAARGKQQGRTVEIQRLIGRSLRAAID
FT                   LNALGENTIHLDCDVIQADGGTRTASITGAWVALADAVAWLKAEGRVTDEPLKRAIASV
FT                   SVGIYQGVPVLDLDYPEDSAADTDMNVVMGDDGGIIEIQGTAEAEPFTEAEFAAMLSLA
FT                   KQGIGQLHQLQQQALSH"
FT   gene            258427..261036
FT                   /gene="cel3A"
FT                   /locus_tag="CJA_0204"
FT   CDS_pept        258427..261036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cel3A"
FT                   /locus_tag="CJA_0204"
FT                   /product="glucan 1,4-beta-glucosidase cel3A"
FT                   /EC_number="3.2.1.74"
FT                   /note="identified by match to protein family HMM PF00933;
FT                   match to protein family HMM PF01915"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84847"
FT                   /db_xref="GOA:B3PGE9"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="InterPro:IPR041443"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGE9"
FT                   /protein_id="ACE84847.1"
FT                   /translation="MKDDFPQRLLRVSAASLLVLAALAGCDSRAPSTTDSTTTVSADTV
FT                   TTQATEKVEWPVLNSAIKKDPAVEARVDDLLARMTLEEKIGQLVQPEIRHVTPEDIKQY
FT                   HVGSVLNGGGSTPGANKYASLEDWVKLADSFYYASVDKSDGRIGIPVIWGTDAVHGLGN
FT                   VIGATLFPHNIGLGATNNPELLKQIGWATAREIAATGLDWDFSPTVAVARDDRWGRTYE
FT                   SWSEDPQIVHAFAGKMVEGLQGTGGSDRLFTHEHVIATAKHFIGDGGTLNGVDRGETQG
FT                   DEKVLRDIHGAGYFSAIESGVQVVMASFTSWEGTRMHGHKYLLTDVLKDRMGFDGLVVG
FT                   DWSGHSFIPGCTALNCPQSLMAGLDIYMVPEPDWKELYKNLLAQAKTGELPMARVDDAV
FT                   RRILRVKIRAGLFEKGAPSTRPLAGKKDVLGAPEHREVARQAVRESLVLLKNKNNLLPL
FT                   ARQQTVLVTGDGADNIGKQSGGWSVSWQGTGNTNADFPGATSIYAGINAVVEQAGGKTL
FT                   LSDDGSFSEKPDVAIVVFGEDPYAEMQGDVGNMAYKPRDTSDWELLKKLRSQGIPVVSL
FT                   FISGRPLWVNREINASDAFVAVWLPGTEGQGIADVIFRNAQGEINYDVKGRLSFSWPKR
FT                   PEQTPLNRGDANYDPLFPYGYGLSYGDKDTLGDNLSEEGIQLAEALDVLDLFNRRPIEP
FT                   WQLEIIGYQNDRVPMASSTVTASSLKIQAVDRNEQEDARRVQWNGSGPGQVALSVGDRQ
FT                   DFIGYVKSDSALVFDIKVNAAPTVTTYLRLGCGSYCASDIDLTEKLKGFAGQDWQTVTV
FT                   PLHCYPNSGANFGVTQPPEEFWTQVLQPFSLLTSGTLDVTFAQVRVVKGAGKDVACP"
FT   gene            complement(261130..261978)
FT                   /gene="metF"
FT                   /locus_tag="CJA_0205"
FT   CDS_pept        complement(261130..261978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metF"
FT                   /locus_tag="CJA_0205"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /note="identified by match to protein family HMM PF02219;
FT                   match to protein family HMM TIGR00676"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83770"
FT                   /db_xref="GOA:B3PGF0"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGF0"
FT                   /protein_id="ACE83770.1"
FT                   /translation="MIDSQPRLSFEFFPPKTAEGKEKLLRVRDQLAQFAPDFFSVTYGA
FT                   GGSTRDNTKGLVTQCKADGISVAPHLSFGGDDEATIKALLQDYQTTGVDRIVALRGDMP
FT                   SGVGGAYQLVYANELVAFIRQHFGDHFHLEVAAYPEIHPQAKSYSDDIRYLKGKFDAGA
FT                   NSAITQYFFNPDAYFYFIEQCIKIGITQPIYPGIMPIINYKNLTRFSDTCGAEIPRWLR
FT                   KALENYGDDEESLRAFGVDLVTELCEVLLENEAPGLHFYTMNQTEPTAQIVRNLGLIPT
FT                   E"
FT   gene            complement(262059..263447)
FT                   /gene="ahcY"
FT                   /locus_tag="CJA_0206"
FT   CDS_pept        complement(262059..263447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahcY"
FT                   /locus_tag="CJA_0206"
FT                   /product="adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /note="identified by match to protein family HMM PF00670;
FT                   match to protein family HMM PF05221; match to protein
FT                   family HMM TIGR00936"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84161"
FT                   /db_xref="GOA:B3PGF1"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGF1"
FT                   /protein_id="ACE84161.1"
FT                   /translation="MSFTDYKVAAKTAEEFARDANWGRKEIDIAEGEMPALMALRRKYR
FT                   DSKPLAGAKIIGCIHMTIQTAVLIETLVELGAEVRWSSCNIFSTQDHAAAAIAAAGIPV
FT                   FAWKGETEEEFWWCIEQTILKDGKEWDANMILDDGGDVTLVLHEKYPQMLDNIHGISEE
FT                   TTTGVHRLLEMLKKGTLKVPAINVNDAVTKSKNDNKYGCRHSLNDAIKRGTDHLLAGKK
FT                   ALVIGYGDVGKGSAASLRQEGMIVKVTEIDPICAMQACMDGFEVVSAYSNGITTGHYDD
FT                   INHIVLGTTDLVVTTTGNVNVCDSAMLRALKNGAVVCNIGHFDSEIDTAYMRKYWEWEE
FT                   VKPQVHKVYRDKTTNNHLIVLSEGRLVNLGNATGHPSRIMDGSFANQVLAQIYLYERKF
FT                   ADLPAEQKAEHIYVRVLPKKLDEEVARDMVEGFGGVITKLTAQQAEYIGVEVEGPFKPD
FT                   SYKY"
FT   gene            complement(263558..264712)
FT                   /gene="metK"
FT                   /locus_tag="CJA_0207"
FT   CDS_pept        complement(263558..264712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metK"
FT                   /locus_tag="CJA_0207"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /note="identified by match to protein family HMM PF00438;
FT                   match to protein family HMM PF02772; match to protein
FT                   family HMM PF02773; match to protein family HMM TIGR01034"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82640"
FT                   /db_xref="GOA:B3PGF2"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PGF2"
FT                   /protein_id="ACE82640.1"
FT                   /translation="MSEYSVFTSESVSEGHPDKMADQISDAVLDAILTDDPNARVAVET
FT                   LVKTGMAIVAGEVRTSTYVDLEDLIRQVILDIGYNSSDVGFDGASCAVLNAIGKQSADI
FT                   AMGVDEGDQKDLGAGDQGLMFGYATNETAVLMPAPIFYAHRLVEKQAQLRKSGELPWLR
FT                   PDAKSQVTLRYENGKPVAVDAVVLSTQHSPSVQQAEIHEAVRELIIKNVLPAEWLHKDT
FT                   QYHINPTGQFIIGGPVGDCGLTGRKIIVDSYGGMARHGGGAFSGKDPSKVDRSAAYAGR
FT                   YVAKNIVAAGLADKCEIQVSYAIGVAEPTSISINTFGTGKLPDAEIIKLVREHFDLRPR
FT                   GLIEMLNLKRPIYRQTAAYGHFGRELPDFTWEKTDKADALKKAL"
FT   gene            complement(264784..265821)
FT                   /locus_tag="CJA_0208"
FT   CDS_pept        complement(264784..265821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0208"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="identified by match to protein family HMM PF01022"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85930"
FT                   /db_xref="GOA:B3PGF3"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGF3"
FT                   /protein_id="ACE85930.1"
FT                   /translation="MAALLDWRPMSSQILTSIPEPASGSLDADNALTHLLKAAGDPLRL
FT                   DILRVLARDSFGVLELCRIFSIKQSGMSHHLKVLTTAGLLSSRREANSIFYRRAYLPPD
FT                   SPLAALQQQLFATVDTQPLSPALREQIALLQQERSQVAQGFFSENADKFRAQQDLIASY
FT                   PVYAEPMAQLLNNTPLRAKNLALEVGPGEGEFLALLSPQFDQVIALDNAANMLDKARRF
FT                   AAGKQLRNIEFIHGDTASLPSHKVLADCILVNMVLHHTPSPADIFQDLSRALVPGGALL
FT                   ICDLCRHEQAWVRDACGDLWQGFEPDDFSRWAASAGLEEGQSVYFALRNGFQIQLRQFF
FT                   KLANV"
FT   gene            complement(265919..266101)
FT                   /locus_tag="CJA_0209"
FT   CDS_pept        complement(265919..266101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0209"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82682"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGF4"
FT                   /protein_id="ACE82682.1"
FT                   /translation="MTGIRKALWAFAACNRLWMGFVCRWVPAAVAGWHLPEGVGPGEVP
FT                   KGRLFSPSHGTDVKE"
FT   gene            266158..268161
FT                   /gene="tkt"
FT                   /locus_tag="CJA_0210"
FT   CDS_pept        266158..268161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tkt"
FT                   /locus_tag="CJA_0210"
FT                   /product="transketolase"
FT                   /EC_number="2.2.1.1"
FT                   /note="identified by match to protein family HMM PF00456;
FT                   match to protein family HMM PF02779; match to protein
FT                   family HMM PF02780; match to protein family HMM TIGR00232"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85556"
FT                   /db_xref="GOA:B3PGF5"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGF5"
FT                   /protein_id="ACE85556.1"
FT                   /translation="MPTRQHLANAIRVLSMDAVQKANSGHPGAPMGMADIAEVLWNDFF
FT                   KHNPQNPQWADRDRFVLSNGHGSMLIYSLLHLSGYDVSIDDLQQFRQLHSKTPGHPELG
FT                   YTPGVETTTGPLGQGIANAVGMALAEKVLAAQFNRAGHDLVDHYTYCFLGDGCMMEGVS
FT                   HEACSLAGTLGLGKLIAFYDDNGISIDGHVEGWFTDDTPKRFEAYGWHVIRAVDGHNPA
FT                   AIKAAIDAARAETAKPTLIVTKTIIGFGSPNKQGSHDCHGSPLGLEEVALVRKTLNWEY
FT                   EPFVVPADVYEGWDAKAKGAAAEKAWGEKFAAYKTAHPELAAEFERRVIKGELPADFAA
FT                   KAEAFIAETQAKGEKIASRKASQNTIAAFVEWLPEILGGSADLAGSNLTLVKRSKGVEA
FT                   GDASGNYVYYGVREFGMSAIMNGVSAHGGFIPYGATFLMFQQYAANAVRMSALMKLRNV
FT                   FVYTHDSIGQGEDGPTHQPIEVLGSLRLTPNLETWRPADSTESAVAWKSAVERKDGPAA
FT                   LVFSRQNLEFFARTPEQVANIAKGAYVLVDSVGEPDAILIATGSEVGVTVKAAEALKAK
FT                   GKNVRVVSMPSTSVFDQQDAAYKESVLPSHVSARVAVETAHVDYWYKYVGFDGRVVGMT
FT                   GFGESAPGGKLLEYFGFTVDNIVSTVEELLED"
FT   gene            268299..269471
FT                   /gene="pgk"
FT                   /locus_tag="CJA_0211"
FT   CDS_pept        268299..269471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgk"
FT                   /locus_tag="CJA_0211"
FT                   /product="phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="identified by match to protein family HMM PF00162"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84703"
FT                   /db_xref="GOA:B3PGF6"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PGF6"
FT                   /protein_id="ACE84703.1"
FT                   /translation="MTVKLMKDQDLAGKRVLIREDLNVPLDGGRITSTVRIDAAIPTLK
FT                   AALEAGAKVAVMSHLGRPDEGVYDAAASLAPVAKYLSEKLGREVPLVQDWIDGYSADAD
FT                   LVLLENVRFNKGEGKNDDALAQKMAALCDVFVMDAFGTAHRAQASTHGVAKFAPIACAG
FT                   PLLAAELDALGKVLDKPARPLVAIVGGSKVSTKLSVLDAVSKIADVLVVGGGISNTFVA
FT                   SAGNEVGNSLYEKDLIPEAQRLRAQTEVVFATDVRVTKEGFKEWSHNSVAVAKKASEIQ
FT                   ADEEIVDYGPETAARVAEIIKNAKTVLWNGPCGVFEFDAFAQGTEVVARAIAESEAFSI
FT                   AGGGDTLAAIDKWNLADKISYVSTGGGAFLEFVEGKKLPAVAILEERAKA"
FT   gene            269907..271052
FT                   /gene="pel3A"
FT                   /locus_tag="CJA_0212"
FT   CDS_pept        269907..271052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pel3A"
FT                   /locus_tag="CJA_0212"
FT                   /product="pectate lyase, putative, pel3A"
FT                   /EC_number="4.2.2.2"
FT                   /note="identified by match to protein family HMM PF03211"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85330"
FT                   /db_xref="GOA:B3PGF7"
FT                   /db_xref="InterPro:IPR004898"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGF7"
FT                   /protein_id="ACE85330.1"
FT                   /translation="MRIFSFMAGVALVACAGSVFAANRPSGFVTICTENKTCSVAPNTT
FT                   VAFGRADQFRYQVLSGSFVCSEAVFGPRIPGGVNECSIPRAGNSSAQSSSVASSVASSL
FT                   SSSSRSSSSSSVRSSSSLASSASSVPVSQYFPGCEKPEPSETVQLSATRVVAAGEIFDG
FT                   LNKRYNLSGGSQSEGQPPVFRVENGGVVRNVIIGNLAADGIHCLGNCTLERVWWEDIGE
FT                   DAATAMGPVGTIMNVTCGAAFNGSDKTFQFNGRGELHISKFYVEKSGKLARTCGDCTNN
FT                   GGPRKLVINEVITRDVSTIVGINSNFGDVAVIRNLTLNNSSNAKTKICQVYKGVVKGQG
FT                   STSALGVEFDTANCHVSQSDVTLLGISRMNTEACTGSCPIP"
FT   gene            complement(271358..271501)
FT                   /locus_tag="CJA_0213"
FT   CDS_pept        complement(271358..271501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0213"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84493"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGF8"
FT                   /protein_id="ACE84493.1"
FT                   /translation="MLLVIHEGPHAHLANEWVQPGYTDAGLNRNRTSSTLRFIVLIPRD
FT                   KA"
FT   gene            271521..275018
FT                   /gene="glu81A"
FT                   /locus_tag="CJA_0214"
FT   CDS_pept        271521..275018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glu81A"
FT                   /locus_tag="CJA_0214"
FT                   /product="glucan endo-1,3-beta-glucanase, putative, glu81A"
FT                   /EC_number="3.2.1.39"
FT                   /note="identified by match to protein family HMM PF03422"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83197"
FT                   /db_xref="GOA:B3PGF9"
FT                   /db_xref="InterPro:IPR001064"
FT                   /db_xref="InterPro:IPR005084"
FT                   /db_xref="InterPro:IPR005200"
FT                   /db_xref="InterPro:IPR006584"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011024"
FT                   /db_xref="InterPro:IPR040720"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGF9"
FT                   /protein_id="ACE83197.1"
FT                   /translation="MKKFNKLLLLLGVLGLAQAGQAAIINYGAGNISDTVNTAGWKCVV
FT                   DYGNWIYNAGVVKPGVSSCNPIGAPTPIYPQKVAPATTKPTMTHRWWGSVSFMGEMRIG
FT                   ATTDSAYITPDPITARITERGVRLLGIPGGLRVNGNEYTYPIPDPFSEVFDGIAVGNSS
FT                   YNNLDAFLKDYSDGSVTVQWRSGSTAVMEATFVHGSPYVYFTALQGNLVVRTKAGDGGE
FT                   KGVFYQSGNHLGVWTDVAGNRNAFLITGHDATTFTGVNTNSIGVNNGTKRMTVTWLPQL
FT                   TGTPSTAMINAFAQYATQQVDRVNINYSVNRTTNMVTVSHQYQFNGANVTTMTGLLPMH
FT                   WKNSNQAVTSYKVRSARGVTKFATTSNFSYTIPYVGVLPYFPEAIGDYNNTQLRALVTE
FT                   FVNQGTANWNGATDTYWAGKNYGKVAELAAIARSIGMTAEANQMIAWLKAELQDWFRAN
FT                   TTGALDTSKYFVYDNNWNTLLGFDESFGAQQQLNDHHFHYGYFVRAAAEICRVDANWCS
FT                   SSQYGPMVELLIRDYAAGRDDAMFPYLRNFDPAYGFSWASGHANFVLGNNNESTSEAAN
FT                   AYGAMVLYGMITGNNAITERGMYLHASSTEAYWEYWNNIDRYRGLGGDYDNFPAAYTRP
FT                   TTSIIWGNGHVFSTWFSGAYAHILGIQGLPLSPLVLHIGQHADYLNNYVALGLSESSNG
FT                   KPSGLVNDQWRDVWWNIWAMTNGQAAVDDLLSYGFNYVPEAGETKAHTYHWVYTLKQLG
FT                   HLATGTGALTANHPAAVAFNKNGILTYIAYNFGCSAINVAYSDGTSMSVPAKGYAYKRT
FT                   GQSTVSSGAGCGGSSSSSSTSSSLPGNAVTLFNHIDYGGWSASFPVGSYNYNALIAAGA
FT                   VNDQTTSVRVPAGYKVTLYEHGDFTGTSVTLTADSNYLGSFNDKTSSLVVSLNTSSSSS
FT                   SSSSSVASAPYGHSITGGSSVRFHANNAAWADIHYTVNNGAQQNIRMTHNADNSNTFDL
FT                   TGIPAGATVRYFFTIAQGAGAYDTDWLQFNCCSGGGSSTPASSSSSSAPAFSLLVQAEA
FT                   FTAMSGVQTEATTDTGGGQNVSYIDTGDWMAYADITIPATGSYRIEYRVASPAGAALSA
FT                   DLNAGAIQLGNVAVPATGGWQTWTTVNHTVTLNAGTYAFGIFAQQSGWNINWFRITRL"
FT   gene            275369..278323
FT                   /locus_tag="CJA_0215"
FT   CDS_pept        275369..278323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0215"
FT                   /product="TonB-dependent receptor"
FT                   /note="identified by match to protein family HMM PF00593;
FT                   match to protein family HMM TIGR01782; match to protein
FT                   family HMM TIGR03304"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85721"
FT                   /db_xref="GOA:B3PGG0"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010104"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGG0"
FT                   /protein_id="ACE85721.1"
FT                   /translation="MNQTQNNNQVGFKKTLLATAVASYAVLGFAAPAMAQQQEVVEEVI
FT                   VTGIKASLQRSMDVKRDAKGVVDAISAEDIGKFPDTNLAESLQRISGVSIDRQNNEGSK
FT                   ITVRGFGPDFNLVTLNGRQMPTNGSSRSFEFSDLASESVSGVEVYKTFGATRASGGIGA
FT                   LVNIKTARPLDNPGFKASLGAKAVMDSTNEVGDDVTPEISGIFSNTFADDTIGIAISGS
FT                   YQERDNRAVNADIANWRNNIDFETAVADAGASVNVTDNRSDPNGNVYYPRNFGYGIEDF
FT                   HRERTNAQAVLQYTPTETIKATLDYTYAKVDLTAQNTGVGIWYNDSGSDAREVVIDENG
FT                   TITKLTACCDDYASNIRLNTSETESKSVGFNLEWQANDNLTLAFDAHNSVNENGGVGRG
FT                   HNAFLILAAPFIETKTYDATAGKDIPFMHITFNPSGTGIVDGMPTAASYDSLFGEANLN
FT                   LNKSEVTQFQLSGSFETDADSGITSVNFGLGNADIVNRWRTFSTGQIAAGWYGGNQDLF
FT                   PDEIFTEHKLNGLMPSFSGGGSNVPVYHAWDFEKAVAIAEAEWAIPGGSTRPWGWGTGV
FT                   MRPDLNGNPISDHKVTEETTNAYLEFNSRGDLAGMPLNITTGMRYETTDIEANSFQQDP
FT                   AELVWINQTEWSLNLAQESSYTSVGGSYDVWLPSLDLSLEVTEDVVARLSYSKSITRPT
FT                   LNKMIGTTSVTSRPKPGERTGTAGNPDLKPFMADNFDLSAEWYYDDASYVSAGFFLKQV
FT                   DDFIVDVISKRTVGNLRDPSKGPRAQQAIADLEALGINPTDANVIAQIKANEGLSTSDN
FT                   IVQNDDDPLAEFDMTQPANQEQAKFYGWEFAVQHMLGETGFGVQANATFVTSDIDVDNS
FT                   STDFQFALPGLSDSANLVVFYDKDGLQARVAYNWRDTFLNGFGEGNTPYYTEEYGQVDI
FT                   SLSYDLPWVDGMTVFVEGININDASQRVYARYENQFKSAYQYGARYNLGVRYNF"
FT   gene            278418..279140
FT                   /locus_tag="CJA_0216"
FT   CDS_pept        278418..279140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0216"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85576"
FT                   /db_xref="InterPro:IPR010836"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGG1"
FT                   /protein_id="ACE85576.1"
FT                   /translation="MARYVLLDNLNHKTIKVINQRGKTWGDNIGYSAIIPREFRQVASC
FT                   YPIFFRKIQANNQFEPVAMFGLAPDENLFLSDAGWGSHYIPLSQVRTPFAIGYTGELSA
FT                   SQRQPVIHIDIDHPRVSYTEGNALFLEDGSHSPYLEQVNSILAELINGVGICKRFTDIL
FT                   QAEGLLEPFTLKYELDNGTQAELNGFYTINEMVLRDLNSEQLVRLHRQNFLELIYMVIA
FT                   SLSNVKKLIARKNQSLSV"
FT   gene            279153..280166
FT                   /locus_tag="CJA_0217"
FT   CDS_pept        279153..280166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0217"
FT                   /product="Pass1-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84638"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR041667"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGG2"
FT                   /protein_id="ACE84638.1"
FT                   /translation="MVDKFAPVEVVAGLTAGAIPDWVVNSASPLVLKGLVREWPIVKAA
FT                   MQSPEAAYNYLCQFYNGELLNTVIGDETNNGAIFYNQDFTGFAYERLRSSLTRVYRNIN
FT                   NLHASGSQRAYYIDSAPVDGCVPGFREHNDINLHPFQPRVSLWMGNRTIVAAHHDVPDN
FT                   IACVVIGKRRFVLFPPEQLRNLYIGPLDFNPAGPAISLVDLHNPDFDKYPRYREALAHA
FT                   QIAELEPGDAIYIPSMWWHHVEGLMPFNLMVNYWWTAFPDYVGSPQDAFTHALMNIRSL
FT                   PADERQHWKNVFDYYIFDDSPDNTAHIPSEKLGVLGEMDEAKARQIRSQLSSRLKR"
FT   gene            280203..281681
FT                   /locus_tag="CJA_0218"
FT   CDS_pept        280203..281681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0218"
FT                   /product="tryptophan halogenase"
FT                   /note="identified by match to protein family HMM PF04820"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84281"
FT                   /db_xref="GOA:B3PGG3"
FT                   /db_xref="InterPro:IPR006905"
FT                   /db_xref="InterPro:IPR033856"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGG3"
FT                   /protein_id="ACE84281.1"
FT                   /translation="MKNNQHIVIVGGGSAGWMAAAALSNAFGASKKITLIESDAIGTVG
FT                   VGEATIPAVKSFNKLLGIDEAEFLRATQGTFKLGIQFENWGEQGETYMHPFGLVGKDSW
FT                   MANFQHFWLKARRMGIAGDYFDYSLNIRAAKSNKFFIDPQSGLDYAYHFDAGLYAALLR
FT                   QYSEARGVVRREGLIDSVHTNDMGFIASLRLASGEMISGDLFIDCSGFRALLIEQTLHT
FT                   GFEDWSHWLPCDRAVAVQTESVGEPIPYTRSIAHSVGWQWRIPLQHRVGNGLVYCSRYI
FT                   SDEAAKALLLENLAGDVRTEPRLIKFRTGRAIQQWHKNCVAIGLSSGFLEPLESTSLHL
FT                   IQTGIVRLIRLFPGDDGINQAQIDEYNRQSRYEYERIRDFIILHYHVTRRSDSDFWNYC
FT                   RTMSIPDTLAHKIHLYKNTTSVFREQDELFLEGSWQQVMLGQGLTPGNYHPVVDKMSDD
FT                   ELTRLMTSIEREHNQRLAQFPGHQQFIDHYCKAI"
FT   gene            complement(281757..282215)
FT                   /locus_tag="CJA_0219"
FT   CDS_pept        complement(281757..282215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0219"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85144"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGG4"
FT                   /protein_id="ACE85144.1"
FT                   /translation="MKISTLILGIGFSLIGSMATHSFAQSSVDSGCSWTVIAVNNFSYG
FT                   ATVASACQLNGTTLAYRSQTWSQYSPPSCSITWVAPNHTSSGACASAKIMKTVAPVCYT
FT                   GSSMIVQTGPNGYMNPVFNANHFCGQGCPYSVQPLDQHSYPRLKYTCL"
FT   gene            281932..282036
FT                   /locus_tag="CJA_0220"
FT   CDS_pept        281932..282036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0220"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83811"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGG5"
FT                   /protein_id="ACE83811.1"
FT                   /translation="MIFALAQAPLLVWFGATQVMLHDGGEYWLQVCER"
FT   gene            complement(282357..283049)
FT                   /locus_tag="CJA_0221"
FT   CDS_pept        complement(282357..283049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0221"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83436"
FT                   /db_xref="GOA:B3PGG6"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGG6"
FT                   /protein_id="ACE83436.1"
FT                   /translation="MKHNYKIFLACSISITIGIYIGAAYAPSQDGHGLTILSGPGLANE
FT                   KRDVQSRDTDNPDTANPAIQPPPATATEPHMFPAQASVREQMLEQQLVQLKNQYHQQKS
FT                   LNFTQWLGRATEKDKNFSLRETMQNRFNSESIDQAWAEPQEQQYISLFSQDQQLADYAL
FT                   TSTQCRTTQCELSFHITNLDQANQLVEALAKSLQAKGQYPLIIATPDQQQGITRLYIAN
FT                   DENSFEFD"
FT   gene            283112..283273
FT                   /locus_tag="CJA_0222"
FT   CDS_pept        283112..283273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0222"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82835"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGG7"
FT                   /protein_id="ACE82835.1"
FT                   /translation="MLTGYTPLCRPMFFITQNWAAIIPSMQCPTFVNLFKVGRRLFLAM
FT                   QLWVAESG"
FT   gene            283555..286101
FT                   /gene="cel3C"
FT                   /locus_tag="CJA_0223"
FT   CDS_pept        283555..286101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cel3C"
FT                   /locus_tag="CJA_0223"
FT                   /product="glucan 1,4-beta-glucosidase, putative, cel3C"
FT                   /EC_number="3.2.1.74"
FT                   /note="identified by match to protein family HMM PF00933;
FT                   match to protein family HMM PF01915"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85841"
FT                   /db_xref="GOA:B3PGG8"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="InterPro:IPR041443"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGG8"
FT                   /protein_id="ACE85841.1"
FT                   /translation="MHLSCKTLMCSLAVLVALGGCSKSSDEAPTPTAGEPVTETSGISL
FT                   WPEVQSRIAKDPAIEAKVAELLAQMSPEQKVGQLIQPELRQITPEEVTRYSVGSILNGG
FT                   GSFPAENKYAKVEDWLALADSFYQASMSTEGGRVAIPVIWGTDAVHGHNNVIGATLFPH
FT                   NIALGAMRNPELIRQIGAATAAEVAVTGIDWTFAPTLAVARDDRWGRTYESYAEDPEIV
FT                   KAYGGMMVEGLQGIPGTAELFDGTRVVATAKHFLADGGTEGGIDRGDAVISEADLVAIH
FT                   NPGYLTALASGAQTVMASFSSWQGVKMHGHTYLLTDALKKRMGFDGFVVGDWNGHAFVP
FT                   GCTTTSCPQAINAGLDMFMAPDPNWKELYENTLAQVKSGAISQARLDDAVGRILRVKLR
FT                   AGLFEAGLPSTRPLAGQQALLGSAEHRAVARQAVRESLVLLKNNGSVLPANPAGKILVT
FT                   GDGADNIGKQSGGWTITWQGTGNVNSDFPGATSIYQGIATAVNAAGGHVELSSDGSYQQ
FT                   KPDLAFVVFGENPYAEMQGDVNSLLYQNEQDLALLKKLRAEGIKVVALFITGRPLWANS
FT                   FINASDAFVVVWQPGTEANGIADVVLANADGSVNHDFKGQLSFSWPADPGQSPLNVGQA
FT                   DYQPQFAYGYGLRYRAHKELANLSETIKAPAATTSERLAIFNQRPQAPWQLVLRDHLNN
FT                   SRTVTTSKDEVSTLSVSAVDNKVQEDARRAVWNGTGKGTLSFASIQRSDLSAYAANKAA
FT                   LVVDFKLNQAPASAVTIGMSCGTDCETDIDVTAALKAATPDAWQTLAIPLSCYSNARIK
FT                   MDMVVAPFVIGTDGALDITLYNLRIEQADQTITCPE"
FT   gene            286172..287194
FT                   /gene="glu16B"
FT                   /locus_tag="CJA_0224"
FT   CDS_pept        286172..287194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glu16B"
FT                   /locus_tag="CJA_0224"
FT                   /product="beta glucanase, putative, glu16B"
FT                   /EC_number="3.2.1.6"
FT                   /note="identified by match to protein family HMM PF00722"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84798"
FT                   /db_xref="GOA:B3PGG9"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGG9"
FT                   /protein_id="ACE84798.1"
FT                   /translation="MKSWARLSLLGCVATILGACHFSGKPSPAPDSTPEAHGWQLVWQD
FT                   EFEGNQLDTRKWGHEKNCWGGGNNELQCYTDKQDNAFVRDGLLTIVARRETFRGPALND
FT                   DMAGYRADDTANERHYTSARLRTKHKGDWRYGRFEIRAKMPQGQGIWPAIWMLPSEWHY
FT                   GSWPLSGEIDIFEAVNSNTEKFGNEVHGTLHYGELPPRNRYSGTGYTPPQPIWEQFHTY
FT                   AIEWEEGEIRWYVDDVHFATQTSAGWYTYYQPDSNKPFVPGENAAPFDQKFHLMINLAV
FT                   GGNWPGSPNAETTFPQQLQVDYVRVYQCTRHSQTGKGCASHVNPAITPLKGFPGSSIKD
FT                   "
FT   gene            287247..290024
FT                   /gene="glu16A"
FT                   /locus_tag="CJA_0225"
FT   CDS_pept        287247..290024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glu16A"
FT                   /locus_tag="CJA_0225"
FT                   /product="beta glucanase, putative, glu16A"
FT                   /EC_number="3.2.1.-"
FT                   /note="identified by match to protein family HMM PF00722"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84208"
FT                   /db_xref="GOA:B3PGH0"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGH0"
FT                   /protein_id="ACE84208.1"
FT                   /translation="MKLLVYSSNAGGASRALGFCLTLTLLGLIGCGGSSGGSSKSSSSA
FT                   ALSSSLASESSVSLSSESSSVELSSSSSAETESSSSVDDSSSSESDSSSSVDASESSSS
FT                   ATGTGSSSSTGWTLVWSDEFEGDAIDPAKWGHEQNCWGGGNNEQQCYTDRAENSFIEEG
FT                   VLHIVARRESFTGPNTPDGTGDGNTTLPYTSARLRTKGLEEWTFGRFEIRAKMPQGQGT
FT                   WPAVWMLPTDSPYGIWASSGEIDIVEAVNLKTQTLVNGELQAPEARVHGTLHYGRVWPG
FT                   NVNSGAAYTLPEGANPADDFHVYALEWEEGEIRWYVDGVHYATQRSSGWYSQYLLDGVL
FT                   TDAPEGAPYDAQSRYHLLLNLAVGGNWAANTNNLGIDESVFPQTLQIDYVRVYECSVSP
FT                   QTGKGCATLGDEAELVRGYQRPGIGPVELPGPPQLVMYEDNLIDGLAFDSYDPDNHVSY
FT                   SEVDEGSRGNVIHLVKAGDSGNLYFRVNGDPYDLRHWSLDSELVFDVKLNSKAEGAVLR
FT                   VKLDSGWPNVSDTIVPLGAEGEWTEFRISLGDLVNSGNSIEPGKANLASIANIFVMEPS
FT                   AEMDVSFDNIRIEGEANQSVFADVPLYTIYADAVPAELQIQSFNPDNNSIVSTQVAEEG
FT                   RGNVFNVVKSRSGGNVFFNITAGAADLNHWADAGELVFDVKVNSRAEGAGLLVKIDSGW
FT                   PNVSDANVTLAPDGEWTEFRIAVADLINNGNSITAGIANLNAISNIFVIEPTGVMDVSF
FT                   DNIRLVVPSSYSIYDDAPHAELQILTYNDDGLITTSGVEESGRGNVFRVVKSAAGQGNA
FT                   YFNNTAGPRDITAWLDAELVFDYKISSHAEGAYLLIKMDSGWPNASDVLIEPAAENTDW
FT                   AEYRIRIADLINDGNHYTSQADKANPLQILNLFVIEPQAGAMDVSFDNIRVVIE"
FT   gene            complement(290265..291440)
FT                   /locus_tag="CJA_0226"
FT   CDS_pept        complement(290265..291440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0226"
FT                   /product="FAD binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82958"
FT                   /db_xref="InterPro:IPR006905"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGH1"
FT                   /protein_id="ACE82958.1"
FT                   /translation="MRAHINMQQHPLTPFGTAPVRVAIVGAGPAGSATAIALCNALAEQ
FT                   KRDDIEVCIFHRTTAKRWPLGETIPPAASAVLRELQLPGLLHSGRHLPCPGSLSVWGGE
FT                   KAQANDFLLDLSGSGYHLDREDFDSGLLHEAQKRGTKVHSDYSLRHLLSKPLSDEGGFT
FT                   LMFATPEGEQQLDADFVVDASGQGAAVMRRLDIARNQLDEVISLYTRIALADHNTLPQH
FT                   TLLEATADGWWYLSAVPGGDCVLSLTTDAQQLKAKNLDKPDQWQHAYTQAKWLNQFLSA
FT                   QQLNHYPLRQAPARSAILSNCVGSHWLAVGDAACSFDSISSAGITNALIQGLWAGQALA
FT                   AYFIDVNRTALAAYQDKVFARFNQYVGVRSYLYAQETRFPTEGFWQRRRLG"
FT   gene            complement(291425..293479)
FT                   /locus_tag="CJA_0227"
FT   CDS_pept        complement(291425..293479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0227"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85898"
FT                   /db_xref="GOA:B3PGH2"
FT                   /db_xref="InterPro:IPR033797"
FT                   /db_xref="InterPro:IPR041168"
FT                   /db_xref="InterPro:IPR041173"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGH2"
FT                   /protein_id="ACE85898.1"
FT                   /translation="MNNTYFRVHPSINFARVGVSEDYYLAPETAAGKLVDSNSGLFGGL
FT                   PIKKGTESTPIEESDLRDAQQNPLRQAARFRIYAYDTPQTTYPSTDPGREVKIGDQVNG
FT                   KTIKDIVWQVHLANKKANNYEITSANGDEDGIAAYENGQTPPLRNPQFPGTASDPKRIT
FT                   QLVIDAGPRALNASSNGSQVLNFDATTPCSYMSTDGQINNLPSYPVSFPDDHFDMFNPR
FT                   GAINSLGEMTIEAGTGRLIVSGGYGKASAILTDGKPPALNDAIDNNGWFDDTSDGPVTA
FT                   TLLFTDGSSAPVVQGWVVCTDPGYAPQTRNVVSTWDDSYTIWVEQLNLVPQLFSQGQYN
FT                   SNYSASFADDVLPVFHGALLQRWNTNLPKQAVNGHNYVASIKPSDNPKDKIPDFKSLIR
FT                   DPNIAAESDQGVKMPLALGDAKKSFLSLTTTQYFLLSQWYDGKSVADAVPIGRGEELDR
FT                   IALENCLGGRYSPGIDLTFIVRDVNLYAQDWQGATGPFRLNMQPLDYSTAVSNQPFLQE
FT                   GYIPLRTAPVEPGDLCKFMSLPWHTDYNSCATHTPDPNPADNNTLYWSWPAQRPVTVYP
FT                   ASQCTFDGSKWNLGGQVFSVRGSEGQGTETDYPQQEGRYQCYFDFVANWQKVGFVIQGT
FT                   QIPAAQNGNYGADKFLEVASLFDTDGQAVQPWPTASIPGYTPPTNCGPT"
FT   gene            complement(293497..294819)
FT                   /locus_tag="CJA_0228"
FT   CDS_pept        complement(293497..294819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0228"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84584"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGH3"
FT                   /protein_id="ACE84584.1"
FT                   /translation="MKTPLSSRLPQKLKLLAAVVGMLSLPAMAASSSCISDPSWFPHAQ
FT                   TPEPDNQGFASSSNCEFQQWSWQMFLWLTQSVNGQPRFLSFASPFSLLGMADFGMVPKT
FT                   RTNTDAQSFDEYLQAGTDGVLVDQQGKAVYYSQYLDNTFTQFIVSNKLTDPAVVRKFNA
FT                   TTSFPIGSLELKAAWKQVQPGDNTDDMFTMDGKINKLANKNGQIVIDPTQTQTVKLALV
FT                   GFHIGGVVNGHPEMIWATFEHQRNAPNVPARVTPTTIISNENWTFYKANTPYKDCNLNW
FT                   VATNKLVLNEKTQTLSPITQVCRQYPFGNDPTSPNPSIVINDKNIASLNQDVLSKLDPN
FT                   DVWHNYTLIGAIWFAAIDGLKPNMALDTDVILTGSVKLSNSTVETYTQVQSTMNNCFRC
FT                   HNTLSAFPSSTDLYPLPPLNLNISHAFQNIYFWSQQQPAKK"
FT   gene            complement(295153..296313)
FT                   /locus_tag="CJA_0229"
FT   CDS_pept        complement(295153..296313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0229"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83626"
FT                   /db_xref="GOA:B3PGH4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGH4"
FT                   /protein_id="ACE83626.1"
FT                   /translation="MQKHIFNIHDVVLFMTMAECLLLVIFQAMLPVKNKLANRLLSAFM
FT                   LSIAVGSACVLVLWNDDVKITPVFDDWLLPYCLSAAQLLKGPILLLYVASLTEDSFRLR
FT                   RDHLLHLIPLALTWAWLAILSIDSSDLRFRTLGQTPEERELANAVWHFIKLLPLAYGIA
FT                   AVLRVHSYRRSLKNQYSHFSPLEPSWLNILSLGFLVTWSFSILVHLIANTIAANYPNIS
FT                   DAFGITENYLILILINALFINSLVHTHELLTTKPEPPKEKTEEKLSDSAIAKVQQGMEE
FT                   QKLFLKQNLNIEEFAKRISLSVKDVSAVINKHYGTNFFEFMNSYRVEEAKRLLGDQAYA
FT                   DMTVMDVLLQAGFNSKSAFHRFFNRLVGISPTEYRKQHLGKEEKVA"
FT   gene            296489..297469
FT                   /locus_tag="CJA_0230"
FT   CDS_pept        296489..297469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0230"
FT                   /product="hydrolase, alpha/beta fold family"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82899"
FT                   /db_xref="GOA:B3PGH5"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGH5"
FT                   /protein_id="ACE82899.1"
FT                   /translation="MFSSAPVTDNPAWLSLLGDLPPLRVEVTADNLNTQDARVQAYLAY
FT                   YGIHFARNPGLVHGFGGLEIAGYRIATHYWLPAGAKGTLVVVHGYYDHAGIFGHAIRFG
FT                   LEQQLAVVAFDLPGHGLSSGDRVAIDRFDTYADILAGVLERLQPVLPQPLYALGQSTGG
FT                   AVLLNHLWRYPRQAAHWHRIALAAPLLLPRGWILGRISYALLRPFCRRLRRSRSRSSHD
FT                   ETFLEFLDQRDPLQDKTLSVQWVGAMKDWNAQFRAFPAKETPLLVVQGTADGTVAWRYN
FT                   LRQIRRKLPHARVALIEGAGHQLVNERDDYRQQAFMQIHRFFFDN"
FT   gene            297542..298501
FT                   /locus_tag="CJA_0231"
FT   CDS_pept        297542..298501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0231"
FT                   /product="Predicted membrane protein"
FT                   /note="identified by match to protein family HMM PF04018"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACE86247"
FT                   /db_xref="GOA:B3PGH6"
FT                   /db_xref="InterPro:IPR007163"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGH6"
FT                   /protein_id="ACE86247.1"
FT                   /translation="MNQPDRTLKDYLLVLLKGLCMGAADVVPGVSGGTIAFITGIYDEW
FT                   LTSLKRCTPAVLLMLKREGIAKTWRYINGNFLVALFGGILISLKTFAAIVLMAMDAYPI
FT                   LVWAFFSGLVAASIYHLAREQRGWGLTEVFGLLLGIAFILAISFMAPAQLPGHGWILFL
FT                   GGFVAICAMILPGISGSFILLLVGLYPVFLQAIHNLEIVKLLWFGAGCITGLIVFSRFL
FT                   LWLLKSYHNQTLSVLVGFLVGSLYVTWPWKHALLTTTDSHGRTVVLQQENINPFNYAAV
FT                   TGTEPTLGLAVLWAFIGVALVLGVEVVAGWIKRRSQGA"
FT   gene            complement(298589..299818)
FT                   /locus_tag="CJA_0232"
FT   CDS_pept        complement(298589..299818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0232"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /EC_number="1.1.1.95"
FT                   /note="identified by match to protein family HMM PF00389;
FT                   match to protein family HMM PF01842; match to protein
FT                   family HMM PF02826"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84557"
FT                   /db_xref="GOA:B3PGH7"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGH7"
FT                   /protein_id="ACE84557.1"
FT                   /translation="MSKTSLDKSKIKFLLLEGVHQSAVDTLHAAGYTNIEYLKTALGED
FT                   ALVERIQDAHFVGLRSRTQLTRRVFENAPKLIAAGCFCIGTNQVDLKAAQEHGVAVFNA
FT                   PYSNTRSVAELVIAEAILLLRNIPQKNVVCHRGGWDKSAIGSYEIRGKTLGLIGYGSIG
FT                   SQTSVLAESLGMKVRFYDVVTKLPLGNAAQVRDLDELLATSDIISLHVPETAATQDMIG
FT                   AREIGLMKKGAILINASRGTVVDIDALANAIKAGHIAGAAIDVFPEEPKANGDEFISPL
FT                   RGLDNVILTPHIGGSTMEAQENIGIEVAEKLIKYSDNGTTTSSVNFPEVALPGHPDAHR
FT                   LLHVHANVPGVLSAINKIFSDNKINISSQYLQTNDKVGYVVVDINSPYSEAALEQLKKI
FT                   DGTIRCRVLF"
FT   gene            300067..301308
FT                   /locus_tag="CJA_0233"
FT   CDS_pept        300067..301308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0233"
FT                   /product="putative transmembrane efflux protein"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84057"
FT                   /db_xref="GOA:B3PGH8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGH8"
FT                   /protein_id="ACE84057.1"
FT                   /translation="MLLIDCYCLEVLGLSSSVVSAEAASPTFFIALLAMGLGSFAIGVG
FT                   EFISMGLLPEISTSLVITIPQAGHAISAYALGVVIGAPLLAIASTGRSRTRMLVVMMGL
FT                   YALANIASALAPGYWSFMVLRLLSGFPHGTYFGIASLVAASLAPAHMRARAVAYVMLGL
FT                   SLATLVGVPVATGLGQWLGWRSAFVLVGLIALASVICIIKFVPAEPARAGARIAHELSM
FT                   FTNRQVWITLGIGAIGFGGLFAIFSYVKPTLMSLAGLTEVGVPLVLALFGAGMVVGNIV
FT                   GSHMADKDLLGTIKRCLIWSMLACAFFALTASHLLLACLAVFCVGTVVVIGPAVQIRLM
FT                   DVAGKAQTMAAAMNHSAFNFANAAGAFLGGVAIDAGFGYASTGWVGLFLSAAGLAMFYW
FT                   MLVDARRQARCVAG"
FT   gene            complement(301360..302082)
FT                   /locus_tag="CJA_0234"
FT   CDS_pept        complement(301360..302082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0234"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83461"
FT                   /db_xref="InterPro:IPR025245"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGH9"
FT                   /protein_id="ACE83461.1"
FT                   /translation="MKLARTCFLLLPLSLVACNATLPQIAETGAAVASATGYNNQAQLI
FT                   RAIKETLELGSSRATASLSASGGYANSSLYRIGLPANLQPIASNLRQLGLGAQIDKVEA
FT                   LMNQGAEKAAGEAATVFIDAVRNMSVTDALGIIRGSDTAATDYFRAQTEASLRQRYQPI
FT                   IQQNLEQIGFYSQYKQLLNTYNLLPIANKPSLDLEQHALNMALDGLFKQVAVEEKLIRK
FT                   DPVQRGSQIIGAVFGQKQ"
FT   gene            complement(302102..302821)
FT                   /locus_tag="CJA_0235"
FT   CDS_pept        complement(302102..302821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0235"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01980;
FT                   match to protein family HMM TIGR00104"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82875"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="InterPro:IPR041369"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGI0"
FT                   /protein_id="ACE82875.1"
FT                   /translation="MNFTFPAIGIVHSCFKEKFGIPRQPGLAPLARGEIELLPPYDDPD
FT                   ALAGLEGTSHLWVEFVFHANRREDWKARVKPPRLGGNKTLGVFATRSPTRPSPIGLSVV
FT                   RLHDWEQREGKLFIRISGLDLLDGTPVLDIKPYIPYADCVLAAENHVAPEPPAAIPVTI
FT                   PAEWMAFCVAYWKTRDIDLAGLITQVLQQDPRPQYQEPEPGRVYGMKLLDLDVRWQYRV
FT                   DPGNTYSIQLTQLLPLA"
FT   gene            302983..304242
FT                   /gene="man26C"
FT                   /locus_tag="CJA_0236"
FT   CDS_pept        302983..304242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="man26C"
FT                   /locus_tag="CJA_0236"
FT                   /product="endo-1, 4-beta mannanase, putative, man26C"
FT                   /EC_number="3.2.1.78"
FT                   /note="identified by match to protein family HMM PF02156"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84009"
FT                   /db_xref="GOA:B3PGI1"
FT                   /db_xref="InterPro:IPR000805"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022790"
FT                   /db_xref="PDB:4CD4"
FT                   /db_xref="PDB:4CD5"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGI1"
FT                   /protein_id="ACE84009.1"
FT                   /translation="MSTSSISLSLMAALMLSAGLLLGCSEKPAESAAAVADSATTTAPQ
FT                   SGKPETALPALIDTQATAETRALYRNLAKLRYKHLLFGHEDSLAYGVHWEGDMDRSDVR
FT                   DVTGANPAVYGWELGGLELGHTANLDAVNFEKMQHWIKAGYSRGGVITISWHVFNPVSG
FT                   GNSWDKTPAVHELIPGGARHATLKAYLDTFVAFNEGLADVDAQGNKHYPPIIFRPWHEH
FT                   NGDWFWWGKGHASEQDYIALWRFTVHYLRDEKKLRNLIYAYSPDRSRIDMANFEAGYLY
FT                   GYPGDAYVDIIGLDNYWDVGHEANTASADEQKAALTASLKQLVQIARSKGKIAALTETG
FT                   NNRLTIDNFWTERLLGPISADADASEIAYVMVWRNANLAREKSEQFFAPFPGQATADDF
FT                   KRFYQSEVVLFEDELPPLYR"
FT   gene            304522..305430
FT                   /locus_tag="CJA_0237"
FT   CDS_pept        304522..305430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0237"
FT                   /product="PEP-CTERM putative exosortase interaction domain
FT                   protein"
FT                   /note="identified by match to protein family HMM TIGR02595"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84420"
FT                   /db_xref="InterPro:IPR013424"
FT                   /db_xref="InterPro:IPR026588"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGI2"
FT                   /protein_id="ACE84420.1"
FT                   /translation="MGFYKNALISAGLLSCSLWASAGPLTDYSLIVFEDLSPSGSLHVH
FT                   GRTFIGGDLNGSSPEFANALDKSLTLDTVEVAGDLNASGWLKVNAGALAYGGANNLSGV
FT                   NCNGNAYGGSASCLHQVSGLDDKAASLYDTLKGESIYYAGLAATGNVGGGLFSYAGVDD
FT                   LAVFEISGADLFNSNWALDLGAASYGIINVSGVNLSNSGATNLNSGFGNYTNILWNFYE
FT                   ADTLNVGNQWKGSVLAVDAVVSTWNDFEGSLAAKSYVGYGQVHNFPWGYTPPEIELPEP
FT                   SVLLLLLSGLGLLGWRRARSA"
FT   gene            complement(305486..306163)
FT                   /gene="rpiA"
FT                   /locus_tag="CJA_0238"
FT   CDS_pept        complement(305486..306163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpiA"
FT                   /locus_tag="CJA_0238"
FT                   /product="ribose 5-phosphate isomerase A"
FT                   /EC_number="5.3.1.6"
FT                   /note="identified by match to protein family HMM PF06026;
FT                   match to protein family HMM TIGR00021"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85658"
FT                   /db_xref="GOA:B3PGI3"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR020672"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGI3"
FT                   /protein_id="ACE85658.1"
FT                   /translation="MSPQDQLKHAVARAAIEYIKPKLTPDAVLGIGTGSTANFFIDMLG
FT                   ELKYDFAAAVASSDASAQRLQTLGIEVLDCNAVSELLVYVDGADESNPNLHLIKGGGAA
FT                   LTREKIVCAVAREFVCIADESKWVDILGRFPLPVEVIPMARSFVARELVKLGGAPVYRE
FT                   GVITDNGNVILDVHNLQILNPVELETKINQITGVVANGLFAIKPADVLLLGTKEGVKVI
FT                   RPQ"
FT   gene            306162..307805
FT                   /gene="ilvA"
FT                   /locus_tag="CJA_0239"
FT   CDS_pept        306162..307805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvA"
FT                   /locus_tag="CJA_0239"
FT                   /product="threonine ammonia-lyase, biosynthetic"
FT                   /EC_number="4.3.1.19"
FT                   /note="identified by match to protein family HMM PF00291;
FT                   match to protein family HMM PF00585; match to protein
FT                   family HMM TIGR01124"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85441"
FT                   /db_xref="GOA:B3PGI4"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005787"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGI4"
FT                   /protein_id="ACE85441.1"
FT                   /translation="MVVSVVPIKLAPLYGFSSCQPPPNWVHCGLFLSLCRDCHTRPPMP
FT                   ETYIKRILNARIYDLAIETPLDEARLLSQRTGNTVLLKREDLQPVFSFKLRGAYNKLQQ
FT                   LSEEERSRGVICASAGNHAQGVALGSQHLGIKATIVMPRTTPAIKVDAVKARGAKVVLH
FT                   GDSYDEASAHAKKLVEEKGLTYIHPFDDPDVIAGQGTTAMEALRQYPGHIDAVFVQVGG
FT                   GGLAAGVAAYVKYLRPQTRVIAVESDESACLQAAMEKKKRVVLPQVGIFADGIAVAQIG
FT                   EEPFRVLRKTVDECIAVNADEICAAIKDVFEDTRSIAEPAGATAIAGMKKYAAQHNLKG
FT                   QTFLAIVSGANINFDRLRYISERTEIGEQREVILAVTLPERPGAYKAFCKSIGKRNITE
FT                   FNYRYADSQKAHIFVGVQVSAGGQDRIDLVAELVEQGYDVVDMTDNELAKLHIRHLVGG
FT                   HAAGVTDEVLYRFEFPERPGALYTFLNKLAGRWNISLFHYRNHGAASARVLVGMQVPKS
FT                   DYAALKAFLTDLNYPYWDETHNEAYQFFLA"
FT   gene            complement(307862..308860)
FT                   /locus_tag="CJA_0240"
FT   CDS_pept        complement(307862..308860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0240"
FT                   /product="Transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00356;
FT                   match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84104"
FT                   /db_xref="GOA:B3PGI5"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGI5"
FT                   /protein_id="ACE84104.1"
FT                   /translation="MSNIRDVARLAGVSVATVSRALSNPEKVSPESLEKVHTAIAEVGY
FT                   RPNMLARNFRSARAYAVVVLVPDIANPFYSLFIRALEDRAHQKGYAVLLGDTRGTPERE
FT                   LEYIRRVETRLADGIVQLRPSSEKSQNNIPPDVPCVNACGCEYTTGPAIRIDNRAAARS
FT                   MVEYLISLGHRRIGVISGLKDNPHAIDRLEGYKEALASAGIAFEKDLIAEGDFTMWSGL
FT                   NAAFQFCNMKNRPTAIFSMNDEMAIGAMQTLKNQGIRIPEDMSVTGFDDIAYAKYSDPS
FT                   LTTISQPAEEMGKMAMDMLLKVIEGEPLSQRECVLPTEFIIRKSTGPVPKH"
FT   gene            309066..310931
FT                   /locus_tag="CJA_0241"
FT   CDS_pept        309066..310931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0241"
FT                   /product="Na+/glucose symporter"
FT                   /note="identified by match to protein family HMM PF00474"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83591"
FT                   /db_xref="GOA:B3PGI6"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGI6"
FT                   /protein_id="ACE83591.1"
FT                   /translation="MQLSFIDIAIVLAYILGTLAVGFWVSKKASKNMRSYFLGGNSLSW
FT                   RMLGLSNASGMFDISGTMWLVYLLFIYGLSSVYIPWLWPVFNQIFMMVFLSAWLRRSGV
FT                   LTGAEFITFRFGNSLGARLSHLVVVVFALINVVAFIAYGFIGIGKFAAVFLPWQFSADP
FT                   YWNDVAYALIITAITTLYVVKGGMMSVVFTEVFQFVVMTLASIAVGIIAMQQVSPELLA
FT                   TILPDGWSSVAVHWQLNIDWAERLPAANEKILQDGYNLFTIFFMLVLLKGVLVSLAGPA
FT                   PNYDMQRVLSTKSPSDASKMSWFVNVVLFIPRYMMIAGLTVLALVFFTDDLRAMGSAVD
FT                   FEQILPMALKEFIPVGLKGLLIAGLLAAFMGTFAATVNAAPAYVVNDIYKRYINPNADA
FT                   KKYVHLSYLFSVIFVILGVIVGLFIPSLNNAIQWIVAALYGGYTASNMLKWLWWRFNGM
FT                   GYFWGMVVGIVAAITLAFTSYNPLYSFPFLFLLCLVTCVIASLVTRADDMEVLKAFYIK
FT                   VRPWGFWTPVREQVQQDYPAVQKNPHFVRDMFNVLVGIIWQTSMVALPIFLVIQHWSEL
FT                   LVSLVVLLVTSGLLWKFWWKNLEDYPADTPRHYLPGTAGEVETRG"
FT   gene            311104..312285
FT                   /gene="unk1"
FT                   /locus_tag="CJA_0242"
FT   CDS_pept        311104..312285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="unk1"
FT                   /locus_tag="CJA_0242"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACE86269"
FT                   /db_xref="GOA:B3PGI7"
FT                   /db_xref="InterPro:IPR007184"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="InterPro:IPR028583"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGI7"
FT                   /protein_id="ACE86269.1"
FT                   /translation="MSSFNHQVKALLAQHDALVTRKNSPRALGNGIYTGYENPILTAEH
FT                   APIFWRYDLNEKTNPYLMERQGVNATFNSGAIYWQGKYILAVRVEGVDRKSFFAIAESP
FT                   NGIDNFRFWDYPITMPETERPDTNVYDMRLTAHEDGWVYGLFCTERKDESRPNDTSAAE
FT                   AQCGIARTKDLVTWERLPDLITYSGQQRNVVLHPEFVEGKYALYTRPQDGFISVGAGGG
FT                   IGWGLTETMTNAEVKAEVIVDHKIYHTIKEVKNGQGPAPIKTAQGWLHLAHGVRNTAAG
FT                   LRYVLYMFMTELERPWVISHRPAGHFIAPQGEERVGDVSNVAFANGWIVNDKQEVFIYY
FT                   ASSDTRMHVATSTVEKLIDYCKNTPEDGLRSAASVATRNQLISANLNILKDLV"
FT   gene            312288..313535
FT                   /gene="unk2"
FT                   /locus_tag="CJA_0243"
FT   CDS_pept        312288..313535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="unk2"
FT                   /locus_tag="CJA_0243"
FT                   /product="Unk2"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84985"
FT                   /db_xref="GOA:B3PGI8"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR028584"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGI8"
FT                   /protein_id="ACE84985.1"
FT                   /translation="MSALSLPIQSLTLQQEFRAELIAIADWWATYTIDETHGGFHGEIT
FT                   ADNQPVANASKGIILNARILWFFSEAAQVVDNPLYRRCAERAYDYLRNYFFDRDHGGVY
FT                   WELDVTGKPINTKKQVYAQAFTIYALCAYFQLTGDAAAVEQALACFKLLETHAIDREHE
FT                   GYLEAFTREWGTIADVRLSEKDLNYPKSQNTHLHVLEAYTTLYQAHPGNEVREALRYNI
FT                   ELFDKYMIDRNTYHLRMFMDLDWKDHSPGFTYGHDIEASWLIAKALESLQDAEYSARLT
FT                   PTLIRIAEVTAAEAIGEHGHVLDAYDFASKTISPDIVWWVQAEAVVGFLYAYATTGDEK
FT                   FYRVAETIWRFIQQYQIDHEHGEWLWLSTLDAARAEPYYKVGFWKCPYHNGRAMIEAVR
FT                   YLEASAARTEKHHNNQ"
FT   gene            313546..314949
FT                   /gene="man5D"
FT                   /locus_tag="CJA_0244"
FT   CDS_pept        313546..314949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="man5D"
FT                   /locus_tag="CJA_0244"
FT                   /product="putative 1,4-beta mannosidase man5D"
FT                   /EC_number="3.2.1.25"
FT                   /note="identified by similarity to GB:AAS19695.1"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83583"
FT                   /db_xref="GOA:B3PGI9"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGI9"
FT                   /protein_id="ACE83583.1"
FT                   /translation="MIAFALRAFGACLLLLGLAACAPEPAATAPEKMPSPDTSTAKSDT
FT                   QGAEFVRVQGRQFVLDGKAYYPVGVNFWFGAYLGAEGEQGDRTRLLKELDLLHSLGVNN
FT                   LRVLAVSEDSELVRAVRPAIVNAKGEFNESLLQGLDFLLAEMAKRNMTAVLYLNNFWQW
FT                   SGGMSQYVAWHKGTPVLDPDVTGEWNAFMQNSAEFYRIADAQVRYHQVIKTLTGRVNSI
FT                   TGIAYHQDPTIMSWQLANEPRPGSDADGRPNVEVYIQWIKTTARLLHQLAPQQLVSTGS
FT                   EGVMGSIGDPAVYVAAHELPEVDYLTFHMWAKNWGWFDAKNPAATFTGSLEKAAAYIDT
FT                   HIDIANRLGKPTVLEEFGLDRDGGAFAADSGTQYRDIYYQTVFNQLHERAVAGDAIAGY
FT                   NIWAWGGYGRSQRADFIWQPGDDFMGDPPQEPQGLNSVLASDASTLAIIKQSTADFASL
FT                   AVTEKTALP"
FT   gene            complement(315023..315127)
FT                   /locus_tag="CJA_0245"
FT   CDS_pept        complement(315023..315127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0245"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83270"
FT                   /db_xref="GOA:B3PGJ0"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGJ0"
FT                   /protein_id="ACE83270.1"
FT                   /translation="MGKIIAVIQYFPVLSLCFFKVMLGTPQYIFIVYY"
FT   gene            315172..316386
FT                   /gene="aga27A"
FT                   /locus_tag="CJA_0246"
FT   CDS_pept        315172..316386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aga27A"
FT                   /locus_tag="CJA_0246"
FT                   /product="putative alpha-galactosidase, aga27A"
FT                   /EC_number="3.2.1.22"
FT                   /note="identified by match to protein family HMM PF02065"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85287"
FT                   /db_xref="GOA:B3PGJ1"
FT                   /db_xref="InterPro:IPR000111"
FT                   /db_xref="InterPro:IPR002241"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR041233"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PGJ1"
FT                   /protein_id="ACE85287.1"
FT                   /translation="MRKQLLLGLGLVSALLVSVQASAQKFEQLAKTPQMGWNSWNTFGC
FT                   NVDEKMIRAMADAMVTSGMKAAGYEYINIDDCWHGERDKNGFIQADKKHFPSGMKALAD
FT                   YVHAKGLKLGIYSDAGNTTCAGRPGSRGHEYQDALTYASWGIDYVKYDWCDTQDINPKS
FT                   AYATMRDAIHKAGRPMLFSICEWGDNQPWEWAQDVGHSWRTTGDIYPCWNCEHNHGSWS
FT                   SFGVLPILDKQAGLRKYAGPGHWNDMDMMEVGNGMTEEEDRAHFSLWAFMASPLIAGND
FT                   LRNMSDTTRAILTHKETIAINQDKLGIQAMKWIDEGDLEIYIKPLEKGHYAVLFLNRAD
FT                   DAMDYRFDWSFHYMKDDISKHEIFFDKQAFNWRNIWNGETGSTKEVLNIKVPAHGVVVL
FT                   RLSPR"
FT   gene            complement(316462..317766)
FT                   /gene="plt103B"
FT                   /locus_tag="CJA_0247"
FT   CDS_pept        complement(316462..317766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plt103B"
FT                   /locus_tag="CJA_0247"
FT                   /product="peptidoglycan lytic transglycosylase, putative,
FT                   plt103B"
FT                   /EC_number="3.2.1.-"
FT                   /note="identified by match to protein family HMM PF01471;
FT                   match to protein family HMM TIGR02283"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85822"
FT                   /db_xref="GOA:B3PGJ2"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR011970"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031304"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:B3PGJ2"
FT                   /protein_id="ACE85822.1"
FT                   /translation="MSYLPKFTLFACCVGLLSCAQTPGTGQSAAASTAHTAANNAGSAP
FT                   LTTGTATQQAPLSDADFAACIDRFSRDAINAGISEQVIRTSLQRATLNRRVLELDRQQP
FT                   EFTTTFADYFNRRVTAQRVAQGRALWAAHRPLLDRIEQAYGVPAPYLLAFWGLETNFGS
FT                   YFGNIPVMDSLATLACDTRRSGFFTIELMNALRIVEQGDIAPKKMVGSWAGAMGNFQFM
FT                   PSAYLKNAVDFDGDNKRDLWHSKPDAMASAAHFLRNLGWVSAERWGREVKLPRNFPFLE
FT                   AGLKNHKSIAEWRNLGVTRADNTPLPPVDIQASLLVPAGHEGPAFLVYENFNVIMRWNR
FT                   SEFYALAVGQLADQIAGGAPLVQAPPTDAPRLHRQQVIQLQEALGQKGFYHEKADGIFG
FT                   PATRRALSEFQHQQGLIADGFPSRTLLTMLGVLSD"
FT   gene            complement(319437..319682)
FT                   /locus_tag="CJA_0248"
FT   CDS_pept        complement(319437..319682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0248"
FT                   /product="Modulator of Rho-dependent transcription
FT                   termination (ROF) superfamily"
FT                   /note="identified by match to protein family HMM PF07073"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83502"
FT                   /db_xref="InterPro:IPR009778"
FT                   /db_xref="InterPro:IPR023534"
FT                   /db_xref="InterPro:IPR038626"
FT                   /db_xref="UniProtKB/TrEMBL:B3PH51"
FT                   /protein_id="ACE83502.1"
FT                   /translation="MIHCDQHDYIEIVCLYHYPIRLTLTSGATIEGIAQDTQHNDQREE
FT                   CIKLSTDTGEQLVVLSELKQLDVLVENPHVERVVFG"
FT   gene            complement(319702..320442)
FT                   /gene="algR"
FT                   /locus_tag="CJA_0249"
FT   CDS_pept        complement(319702..320442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="algR"
FT                   /locus_tag="CJA_0249"
FT                   /product="alginate biosynthesis regulatory protein AlgR"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00806; match to protein
FT                   family HMM PF04397"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84386"
FT                   /db_xref="GOA:B3PH52"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B3PH52"
FT                   /protein_id="ACE84386.1"
FT                   /translation="MDVLIVDDETLARQRLVRMVEKLEGFCVVAEADNAESALHAVINQ
FT                   DPDIVLLDIRMPGKDGLDLAQDISKLDDPPAIIFCTAFDNYALDAFGTNAIGYLLKPVK
FT                   AEQLLQVLDKASNLNKLQRQAAEQKRGTSASDSRTHISTRTRRGVELIPLDEVRYFIAD
FT                   QKYVTVFHLGGEHLLDETLKELEEEFGNHFLRIHRNALVSVKHIEAIERNAQGQYQVRL
FT                   NGCAQKPLISRRHVSGVKDFMRTI"
FT   gene            complement(320449..321468)
FT                   /gene="algZ"
FT                   /locus_tag="CJA_0250"
FT   CDS_pept        complement(320449..321468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="algZ"
FT                   /locus_tag="CJA_0250"
FT                   /product="AlgZ"
FT                   /note="identified by match to protein family HMM PF06580"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACE86281"
FT                   /db_xref="GOA:B3PH53"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B3PH53"
FT                   /protein_id="ACE86281.1"
FT                   /translation="MVLVAELLALLLTIADYGFRDFNWDHLAMASVQVQWIMILSALCL
FT                   CRMRHWLGSLPQAKAGLISYGLVLGITLTLSLISQWLLYAMSGLIYLSDHHFQVNGWIV
FT                   LEHLALAAISAGIALRYLYLQQQLANQREAEMQARIQALQSRIRPHFLFNSMNSIASLI
FT                   ATAPDTAERVVEDLSDLFRASLAEPGLIPLERELELCRRYLDIEQLRLGKRLVVDWQLG
FT                   KLDPQLKIPSLMLQPLLENAIFHGIEPLPQGGTIGIRVLHKDKQLRIVITNPYPLAKAT
FT                   TKKSPVGEDTPESNGRHNRMALDNIRRRLTAHFGTRARLSSSAENGLFTTYIFCPLKG"
FT   gene            321659..323110
FT                   /gene="argH"
FT                   /locus_tag="CJA_0251"
FT   CDS_pept        321659..323110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argH"
FT                   /locus_tag="CJA_0251"
FT                   /product="argininosuccinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /note="identified by match to protein family HMM PF00206;
FT                   match to protein family HMM TIGR00838"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85302"
FT                   /db_xref="GOA:B3PH54"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/TrEMBL:B3PH54"
FT                   /protein_id="ACE85302.1"
FT                   /translation="MAGLTAAPVRFFFGGPFFMSQNDQPIKPWGGRFSEATDAFVERFT
FT                   ASIGFDYRLYHHDINGSIAHATMLARVGVLTEAERDQIINGLEEIRAEIVAGTFTWSVS
FT                   LEDVHMNIEALLTQRIGITGKKLHTGRSRNDQVATDIRLYIRDEIDAIAKELTRLQQGM
FT                   LQVAEANADTIMPGFTHLQTAQPVTFGHHLLAWFEMLQRDYGRLIDCRKRVNQSPLGAA
FT                   ALAGTTYPIDRAYTAQLLGFDAPTENSLDSVSDRDFAIEFCAFASILLTHMSRMSEELV
FT                   LWTSSQFKFIDLPDRFCTGSSIMPQKKNPDVPELVRGKTGRVNGHLIALLTLMKSQPLA
FT                   YNKDNQEDKEPVFDAIDTVKDCLRAFADMVPAIQPRTAEMYEAAKRGFSTATDLADYLV
FT                   RRGVPFRDAHEIVGKSVAYGVQTGKDLSEMSLVELQQFSTVIEQDVFAVLTLEGSVAAR
FT                   NHIGGTAPVQVKAAIERAKASLASR"
FT   gene            323323..323433
FT                   /locus_tag="CJA_0252"
FT   CDS_pept        323323..323433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0252"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83679"
FT                   /db_xref="UniProtKB/TrEMBL:B3PH55"
FT                   /protein_id="ACE83679.1"
FT                   /translation="MGFYSLFFRRFGIWLNGKAGVRRINIMGKHNITGKY"
FT   gene            323562..325541
FT                   /locus_tag="CJA_0253"
FT   CDS_pept        323562..325541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0253"
FT                   /product="Response regulator receiver domain protein"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00512; match to protein
FT                   family HMM PF00785; match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82714"
FT                   /db_xref="GOA:B3PH56"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B3PH56"
FT                   /protein_id="ACE82714.1"
FT                   /translation="MEATNDGLWDWDLITDKIYFSNSYLRMLGYDYEELPGNLQTLKDY
FT                   FIHPEDVDNLLQEYRVAVHNCRDSLQLQYRMLHRNGHSIWVHSKAKFFEPDADGRPTRC
FT                   VGINTDISRFIKTQEELLHAKTQADMASKTKSEFLARISHEIRTPMNAIIGIGYLMQDT
FT                   PLDEQQQSYLTSINSAADSLLQIINQLLDFSKIEAGRVILEHAHFDLEQVFEKITRLFE
FT                   ISALHRNVSIAYDIAPDVPRFLRGDASRLSQILNHLISNAFQYSRRDQVVVRVKRLPGE
FT                   QLVLEFCVEDTGLGMTAEKLSHVKERLLKGSQETGGSTCGLGICNHLIQLMQGDMRIES
FT                   APNRGCKVSFSANFEPSRLGEKTLVNQPRELSNIRVLIVDDNTIARTIIASTARSLRLQ
FT                   VDEADKPLEAMDKIRQADNLGQPYHLVLLDYRMPTINGLQLTGMIKKDRSLRCKPQVFL
FT                   ISAYHRDEISSTDPNAILVDEFLSKPVSESRLFEAISQAVNREQRLQEISPLLVGDEDR
FT                   AALLASARVLVVEDNLVNQQVICGILKKKQVVTVLAANGLEAVNAVTEASEPFDAILMD
FT                   LEMPIMDGIEATCQIRRQWPAQLLPIIAVTAQAMRGDRERCLEAGMNGYLSKPVNPEQL
FT                   YNTLVEVLRARRDQRAASPQNPTD"
FT   gene            325559..327514
FT                   /locus_tag="CJA_0254"
FT   CDS_pept        325559..327514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0254"
FT                   /product="adenylate cyclase, class I"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85852"
FT                   /db_xref="GOA:B3PH57"
FT                   /db_xref="InterPro:IPR000274"
FT                   /db_xref="InterPro:IPR024685"
FT                   /db_xref="UniProtKB/TrEMBL:B3PH57"
FT                   /protein_id="ACE85852.1"
FT                   /translation="MSATSIDTHGIDEGLDRKQLTLLRRRFLSLNEQRVARTLTNLSER
FT                   QQQFMQLLPLLFHVNHPMLPGYISGATPAGVYAYQPDKDSLRLARILARSFTYTRDLVE
FT                   TTPGIDALFLMGSVGSIAHTAGSDMDIWVCHNPTLDLPALQELERKCQVITHWAASQIH
FT                   LEVHFFLMTGEHFQTGKCSSMSSEASGSAQHYLLLDEFYRTALWLAGKVPLWWFVPVTR
FT                   EADYRRYSETLLHKRFIKAAEVIDFGGLPFIPANEFIGAGIWQLYKAIASPYKSVLKLL
FT                   LLEVYASGDTAQDTATEPLALSLKRALYEREPDVDRLDPYVMIYERIERYLCARHQDAR
FT                   LELVRRCLYFKINKPLSRKNARTKKSWQRVLLEDLTHAWGWNSHQLHMLDNRAYWKSPH
FT                   VIAERALLVNELNHSYRLLAELNKQLGLNAAISTDELQVLGRKLHAAFERKAGKVEYIN
FT                   PGISRNLSEPALCFVQDKSVAGESWQLVRGSQQDLTLRSVAVEPVRRARSLVELLVWSQ
FT                   VNGLLVPGTRVDLISKDYQITALQKQQLLQAILQWLPEPHQPEHQAFTSAARVEKVLML
FT                   FNLGVEPQAELHKRGMQMLSAQSDPLGFSGFRANLVLSVDIVQLNSWGELVARHYPQDA
FT                   LVNALLHYHCCPIVCR"
FT   repeat_region   327485..328763
FT                   /note="RPT4H"
FT   mobile_element  327488..328761
FT                   /mobile_element_type="insertion sequence:ISCja2"
FT   gene            327588..328739
FT                   /locus_tag="CJA_0255"
FT   CDS_pept        327588..328739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0255"
FT                   /product="ISCja2, transposase"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84945"
FT                   /db_xref="GOA:B3PC11"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025399"
FT                   /db_xref="UniProtKB/TrEMBL:B3PC11"
FT                   /protein_id="ACE84945.1"
FT                   /translation="MSHSNTAFHQLLKPLSRHEFEAEAKKHHVGQKLRSATRWDQFVGM
FT                   AMSQLSGRQSLRDIQSNLEAQQHKLYHLGAKPIARSTLARINEVQPAELYKHVFARLLH
FT                   RCKSMQGKHKFQFKNPLYSLDASAIDLSLSVFPWAAHRDDTANVKLSVGLNHGTQVPEF
FT                   VALSDGQENDMIEGRKFDFPKGSIVAFDKGYVDYRWFKLLTDKGVFFVTRLRAKAVYRV
FT                   EERRYADSSKGIISDQVIQLSSAHAIKRGAPKLRRIGYRDATTGKFYEFLTNNFQLAAA
FT                   TIAAIYKDRWQVELFFKAIKQNLKIKAFVGTSRNAVLTQIWIAMITYLLLAFSRHSTKA
FT                   GWTVQRIMRVIQLNLFERRSLKSILIPDPPNHKKSEPQMRLAL"
FT   gene            328748..329761
FT                   /locus_tag="CJA_0256"
FT   CDS_pept        328748..329761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0256"
FT                   /product="putative adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACE86066"
FT                   /db_xref="UniProtKB/TrEMBL:B3PH59"
FT                   /protein_id="ACE86066.1"
FT                   /translation="MGQQCLHYLRLLPPGRRPALPELTIRCFSLGQGTNIAQRLTDLWR
FT                   DLIHCFYSGLRPSGSRYLLETGDEFLLLQFLQQQPQVYRYKDYDRLLEKLSQPQADYSP
FT                   LVVDRYALRDKPLAAISQTIKVPGIYLFYQVDVETAHDSRHWARIMLVDEKGSLFTARA
FT                   HYYNQQTFLRPLLIFIRNALQHQQWSGDLHSALMLDNIQVYELEPARHYLSSGRSGPLL
FT                   VQARQFPAQWMRIPLMNIKAIADMNADGQLLFSLYCDEQEFSPLAYGDELMPAVARYIL
FT                   GHRRTGEHYPGYITDLDLSLCRETIVQQTGLQLSHYLQIKTDLEMQLNQAMRQLLA"
FT   gene            complement(329795..331606)
FT                   /gene="glc13A"
FT                   /locus_tag="CJA_0257"
FT   CDS_pept        complement(329795..331606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glc13A"
FT                   /locus_tag="CJA_0257"
FT                   /product="alpha glucosidase, putative, glc13A"
FT                   /EC_number="3.2.1.20"
FT                   /note="identified by match to protein family HMM PF00128"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84958"
FT                   /db_xref="GOA:B3PH60"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B3PH60"
FT                   /protein_id="ACE84958.1"
FT                   /translation="MDFYCTNSISFFENDSNSETEKLFFLQSPPFFRASYNDGNLTIKL
FT                   TLVTLGNFLIERINLLYVYLGDETRKELSLIQGSDVKKWVITLNIPNYYHNNFSFRFSI
FT                   STKKGELFFDPNGLHKYSVDNLSNFKVYLNQDWHWIQESIIYHIFVDRFYGREFNVKSA
FT                   SDDQFDFMMGDLYGIQDKIRYLIDLGINTLCLTPVFSSTTNHRYDVENYFEIDEKLGGN
FT                   LAFYQFMDECKNNGIRVILDGVFNHISRNSKLFLDGFINGKEPCANYFCTTDNLHGYEC
FT                   FWGVALLPKLNYRSSELRNYIFSNDNSVVKSWLGPPFDVDGIRIDACTMVGRYADVDLQ
FT                   KEILSGIYFSAKSKKRDCYILGENPFDPTDLTPFEHYDGITNYSGFYTPLLKWVCTGEL
FT                   ETFEFVMHLNRFKALLGLGFLLRSQNFIGNHDKKRFFSILNKNRKLYHVSLAILFFYPG
FT                   VPTLYYGEEYGLMDSSVENDSRMCMKWFDFTDCELEINEFIRRLIYIRNSHKFLSCGDV
FT                   IFNYYDKDTLIFTRAYNDQYICALVSKSSSPELNTRFDFSFIAKFYGSDFFTEKFGQLV
FT                   DICIENEICIVHGHLEKGVLLFSNHPL"
FT   gene            complement(332030..333727)
FT                   /locus_tag="CJA_0258"
FT   CDS_pept        complement(332030..333727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0258"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83692"
FT                   /db_xref="UniProtKB/TrEMBL:B3PH61"
FT                   /protein_id="ACE83692.1"
FT                   /translation="MQVNSETHENYMHVPFQVVNIVSSKVLWISNEFESDYGLRGFDIF
FT                   KEKFSLISPDYRLRDGMTLDLSTASTLFAERYGGNGVGTNGGGARTGNLENFQLKGVGK
FT                   NILAANTTDDWHSYGGLNLVDAVIETISYLLLKNILPIGCVKIYGIIITGDETAYLPGG
FT                   KIGPGAILVREKVTRPGHFLPCPAYNVKEIQDIPQDSYRLRYINKILYKKFRDPRELAV
FT                   ALAKMASMIADQFGFSKIARIFHGSISASNLSIDGRWLDLTNCTFINDVHNYVGSTPFH
FT                   AEGIHIVSILEEWIYTIRKYNNLRFNERIILDYYASQLKSSCYKHIGYLFAIQEKELLP
FT                   FHQQSLLLDFFNEVYSHLFTGNKNLVYGRPTQIEKDDLVVNFVTSVLVKYSNNRSDSTY
FT                   FTSKFIKEFIVRKSQYLNIKEKNVHVAHAICSLKRLYLCEFYFIGRLEPIIYKLVDNKC
FT                   YDQLEALIGFSTEYASWVFEDVMLCNTSRTVTVLNVDGHRLIYDALKDIFYLHHKDNDL
FT                   ISEFFSFNEYLSFVLNPDFIAPIFGFDFGKYFKALASVLDCINGLYEQ"
FT   gene            complement(333768..336080)
FT                   /locus_tag="CJA_0259"
FT   CDS_pept        complement(333768..336080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0259"
FT                   /product="efflux ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82664"
FT                   /db_xref="GOA:B3PH62"
FT                   /db_xref="UniProtKB/TrEMBL:B3PH62"
FT                   /protein_id="ACE82664.1"
FT                   /translation="MFKSVPIKIPNLIFSSIVVLLVFIFLSFQSELSKDSKSDLINKKY
FT                   NINGDIYSIYLKNKENYQHIPKNKADEISSLLKSDVSSIYVTQVSTESGAFDIGLISNN
FT                   FFSLLGIKDFFGEDIQLNAYNQIILNYNQLNKLNNKYEIGSSISIAGNTYTVVGFSDTE
FT                   FDGIGDSGELGWILFDGNESIYKDYPTVKKKYRDALFKAAPINYVFTRADKNQHFRWNQ
FT                   EIQSLGNTNISYFQYTASAFVKFPIDGFTFTLEPGLILDPQKYNAETVKRIGYTIISIL
FT                   ILLFVTISYSLMQLVVVTESFRDFKIMEILGIHPQKLKTTLIVLSSVPIVASYMIYCLS
FT                   MPLISLMVNDFSFSLLNVTLFSIVLILVSYSVVIKFYTSEKDNVFFSRSTISQRNRIFR
FT                   NSALILQCVIIQICMFLFASSFFETKEFEDSMLGFRDDHYYFGAVQEMPSGGTIGKIQI
FT                   LRDASKAENNNKQYLSIHGSHPFGDPWLAQISLPSGELINSVITIVSPNYIEFTKNKLI
FT                   SGRNFESNNYPGIIINKVLLDLLGESTSKIVDSNIDFLIMGLPISKQVIGVVDDLRIKQ
FT                   PIIYINSFDTKNFYVDSDFFLIKSNENLSIIESRLIDDLKKIGWKLSEIKPLSEKIKQY
FT                   TPAVNDLTSSGLYISLISLVIIIFTIFAILGFEVKQKKDELSIKRNIGAHPFYLIRENI
FT                   ISLFKATLISVLLYQLLYFVFIASFKKIYIEHLIDYKLMMISSSVSVIFFIFSNIAFIA
FT                   ISVTFIRRYVYSKNSHL"
FT   gene            complement(336073..336750)
FT                   /gene="phnL"
FT                   /locus_tag="CJA_0260"
FT   CDS_pept        complement(336073..336750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnL"
FT                   /locus_tag="CJA_0260"
FT                   /product="ABC transporter, ATP-binding subunit"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85889"
FT                   /db_xref="GOA:B3PH63"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3PH63"
FT                   /protein_id="ACE85889.1"
FT                   /translation="MNEKILTAKDISKVFYTKKIKTTAVKNANFSVGKGEFISITGESG
FT                   SGKSTLLNVVSTIEKPTTGGIFIDGENISSFNEIQLSYIRNRKIGFVFQMFNLIGHLSV
FT                   IDNVALPYLYATGNKEDALKKAAEILDEIDMGHRIDHYPHQLSGGQQQRVAIARALINN
FT                   PKIIFADEPTGNLDVENSLIIMRILERQVDTGCSLILVTHDKMIAQRAERILKIEGGEL
FT                   LNV"
FT   gene            complement(336751..337935)
FT                   /locus_tag="CJA_0261"
FT   CDS_pept        complement(336751..337935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0261"
FT                   /product="putative ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84780"
FT                   /db_xref="GOA:B3PH64"
FT                   /db_xref="UniProtKB/TrEMBL:B3PH64"
FT                   /protein_id="ACE84780.1"
FT                   /translation="MDEPIEVNNKFFSHRKIYLISTLIVVVAITLYLFKSEDSALYKVE
FT                   PLTSSLVIRTSGVLRPLIYRDLYSPQDGEIKYITDNKAGEKTNKGDLIFSVFNSEIESL
FT                   FSQKRKEYSDEEYEFQQKLISLKQDILKTELEKLSIEAKYEGAKSELLAYSKHPDVIPT
FT                   LELNIKKREIELLKKQITQLMKISEDQHLNVKQFENNWQNKKEYMNVELGILSATIEAL
FT                   NIKSPIDGNIEYIDESLQIGKVVSKGQVLGRVSDFSFWAAYLDVPVASIDRIKIGDRVI
FT                   LDVNGHSVAGSIYQIDQKVENQTIKIIAKIKDDNLTILRSELRVNASIETNENRPLSII
FT                   RFSNNIPLNSKTLNVIAHYKDGKKNKIEIKVQEISNEKIIFESLGSQVEAIGFY"
FT   gene            complement(337937..339979)
FT                   /locus_tag="CJA_0262"
FT   CDS_pept        complement(337937..339979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0262"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664; match to protein
FT                   family HMM PF03412"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85142"
FT                   /db_xref="GOA:B3PH65"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B3PH65"
FT                   /protein_id="ACE85142.1"
FT                   /translation="MISPVYQSESSDCGFAAIAMILNFYGLNIKLSDLRNHLRDRPYGI
FT                   SAREIIYLSNKYDINSRALRIDLADLTKIKLPAILHWNMNHYVVLERIQSGEATIYDPA
FT                   YGKRVVKQKELNESFTGICFEFSPSPNIKPIQQGKNRIIPDYLHLIIKNIASFKKIAIP
FT                   IILISIATQLLVAYFPTIVQRSIDDPNPGNTMLWAAIIFGMWLLPGISEYVRSNLLSHF
FT                   SVRVNLQLGKLFVRKLILLNADYFKRRSTGSILTRIDSIAEVRKLISNEFLSIFIDSIF
FT                   LCTSIFFLVKYNYQFALITVSGCLLILLIYLVNKKEIRECLYRQLDYQSKSNSNLLETI
FT                   QSIESIRATGSEELRYHQWLNLTYESAKAEIKSSQLYARIDFFRQLSTAIELSLLTFLI
FT                   ITFSKSGLITIGAIAAIYSLRMTFNSRFVSLIDNITGLNLIAIHLSRLDDILDSLSNGD
FT                   DNADIKHGALTIKNVSFSYGIKNILSNANLRIYPGEHIVITGESGIGKSTFIKIVSGNL
FT                   LPENGQVFIDDNEVNADNYRSIQKHMGIVSQGETHIFEGTFEDNITMFDPSPDESYFDQ
FT                   IIKTCLLDDVLSNLPSGKKSMMVNGTVLSGGQLQRLVLARALYKKPKILILDEATSNLD
FT                   AGTEEKLMQNIIGLKMTTISITHRSSILGFSDRCFELKNSTLREI"
FT   gene            complement(340186..340353)
FT                   /locus_tag="CJA_0263"
FT   CDS_pept        complement(340186..340353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0263"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83991"
FT                   /db_xref="UniProtKB/TrEMBL:B3PH66"
FT                   /protein_id="ACE83991.1"
FT                   /translation="MEINERKVSGEKSEAMIASEIVGRLLAEQELDAIQGAGCSFLQGR
FT                   GFSNTASTFC"
FT   gene            complement(340403..341323)
FT                   /locus_tag="CJA_0264"
FT   CDS_pept        complement(340403..341323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0264"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83402"
FT                   /db_xref="GOA:B3PH67"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:B3PH67"
FT                   /protein_id="ACE83402.1"
FT                   /translation="MKFFVIADNGIGDSIMMLPALRALAMEVSSEIKILSNPRYFDNVL
FT                   YEFTKKSILLNDYNNDNQHILTCIEETDIVVIYSTWDIVNQLGIKPFLKDKIVFGYFSE
FT                   YCTNLIEYDHRNMIDQYFSVVMFFNKAIDVNRYSYPLVLPDSSKVNASALYSAFSPGTL
FT                   LIGIHTHTREEKMVSADYFVEVIKIVKEIYPQSILIVVDPVDTELSVMLDNNTFVNLQG
FT                   LDISIVMQFFQYISLLICIDSCILHAADLIKLPIISFFPATSVNNWGPKYSRSLVIDGR
FT                   NLSIKEIRSRGCEITSFLKSSLADK"
FT   repeat_region   341492..342741
FT                   /note="RPT2Q"
FT   mobile_element  341494..342739
FT                   /mobile_element_type="insertion sequence:ISCja1"
FT   gene            341553..341852
FT                   /locus_tag="CJA_0265"
FT   CDS_pept        341553..341852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0265"
FT                   /product="ISCja1, transposase orfA"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACE86089"
FT                   /db_xref="GOA:B3PCD8"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B3PCD8"
FT                   /protein_id="ACE86089.1"
FT                   /translation="MARTATPMKQNRTRHSQAFKNEALALAERIGVSKAAEQLGLHASQ
FT                   LYGWRSKQQQTLSSSEREQSLADENARLKRLLAEQAEELAIVKKAAAYFAKSLK"
FT   gene            341849..342709
FT                   /locus_tag="CJA_0266"
FT   CDS_pept        341849..342709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0266"
FT                   /product="ISCja1, transposase orfB"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84086"
FT                   /db_xref="GOA:B3PCD9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B3PCD9"
FT                   /protein_id="ACE84086.1"
FT                   /translation="MKYAFMRTHAPAFSVKAMCRVLGVARSGFYAWCSREPSTRHQQRA
FT                   ELDQRVAQAYNARKGRSGAPRLCHDLWEAGLRCNRKTVAASMQRQGLRAKAAKKFKATT
FT                   NSRHSLPVAENLLKQDFTASAPNQKWVGDITYLHTDEGWLYLAVIIDLYSRMVVGWAMS
FT                   ERMTADLACDALHMALWRRKQPKGVIVHSDRGSQYCSTAYQGLIRAHQLRCSMSAKGNC
FT                   YDNACAESFFHSLKVECIHGERFMSRAQMRETVFEYIETDYNRQRRHSTLGHISPQAYE
FT                   ARMSA"
FT   gene            complement(343335..344576)
FT                   /locus_tag="CJA_0267"
FT   CDS_pept        complement(343335..344576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0267"
FT                   /product="radical SAM domain protein protein"
FT                   /note="identified by match to protein family HMM PF04055"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85299"
FT                   /db_xref="GOA:B3PH70"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B3PH70"
FT                   /protein_id="ACE85299.1"
FT                   /translation="MHGIIARDLKIQSLNKVQFVLKLISTCNLRCTYCYWFFKEDNTWK
FT                   ESSVSVKAETIEWIIIAIQDAIDELDLKEVDIIFHGGEPLMLKKHVFEQHCNLFREKIQ
FT                   KKCILNFKIQTNAVLVDEEWIDIFSRQNIAVGVSLDGDKDANDEYRIDIHGNGSYEKTV
FT                   DGIKLLMDASSSNKIIKPALISVINPKFNYEKLLNHFYQLGFETINFLMPNYCHDDIPN
FT                   DFNMEGITKALKDIFNVWITQDNPLQKPIIFIEKDINFFQRVNFKNYRYSENTRYNAII
FT                   AVTTDGLMSVNDNLMCTDWRKMQPSPSIKDTSLKAYLNSLTYITLDEEEGIIPRECSEC
FT                   EYKNICKGGELPHRYSRKKGFDNRSIYCVPLKIYYQYLSRFLVANGYPTNELNHLLAQN
FT                   PTAKLKNYERIIEI"
FT   gene            complement(344590..345012)
FT                   /locus_tag="CJA_0268"
FT   CDS_pept        complement(344590..345012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0268"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82810"
FT                   /db_xref="UniProtKB/TrEMBL:B3PH71"
FT                   /protein_id="ACE82810.1"
FT                   /translation="MLALYSFVLKKSKIAISMENNMKKANKALGSVALIFFSSFVQAEI
FT                   FVKAQVEDEPANLQVSKQKGENEKINVIFENGYSLTIETYTEEADQVYQFKTVDQPMVE
FT                   VRNDIGKNGTYIFIDVNATEYKVTAGVDSVELMSSN"
FT   gene            345471..345701
FT                   /locus_tag="CJA_0269"
FT   CDS_pept        345471..345701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0269"
FT                   /product="adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83633"
FT                   /db_xref="UniProtKB/TrEMBL:B3PH72"
FT                   /protein_id="ACE83633.1"
FT                   /translation="MVWRPAFRLVARYILDHRRTGEHYPGYITDIDLSFCRETIAQQTG
FT                   LQLSHYLQIKTDLEMQLNQAMRQIDWLSSGM"
FT   gene            complement(346205..347812)
FT                   /locus_tag="CJA_0270"
FT   CDS_pept        complement(346205..347812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0270"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85105"
FT                   /db_xref="UniProtKB/TrEMBL:B3PH73"
FT                   /protein_id="ACE85105.1"
FT                   /translation="MSNDLFLDNYSWVTKNNFFTDESRIHPGITQTMFAERYGGFGIGT
FT                   NGGGARVVNINGMQIKGGGANALAGDGALRSHSYGGLDIQGAVKEIIYSRLLSKISPVG
FT                   TQTIKGLILLDDTSALHNGNKAPSVLMVRETVVRPGHFLPCVNFRLKPEHRSLMRSDYS
FT                   RVLGIYKSIGKQSLLSEFYTLIQHFLDKCADQLSFFRMARLSHNALTPSNICLDGRVLD
FT                   TALCSFVVSGSNYGQVTSYFEEASTPVLVAKEWFYLIHKFLTDTSVEEHFLKLYEEKFY
FT                   QYACINMGFLFGLDREMSTKLSCTLEWRKVASRLFSLFSMGSPIKTSILPTTDAIDFVN
FT                   DILTASLYSILHNLDTTKTSKFLAEFTQDLNALMTIMARSLGWHGQDEQSFYKTFVIQT
FT                   IKRAILSSYFFITYIGRTVDDYCAAGRVNDTAKIIKENDRVTNWIYENLLSEQSTIYSG
FT                   NRLSIGYSSMADEYIYRDGDGIERRINDICSLRTIIDTNKSGYIIQDYDFYPYLKRLFS
FT                   LLDRDAMNSFNGVKNVFC"
FT   gene            347112..347231
FT                   /locus_tag="CJA_0271"
FT   CDS_pept        347112..347231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0271"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82887"
FT                   /db_xref="UniProtKB/TrEMBL:B3PH74"
FT                   /protein_id="ACE82887.1"
FT                   /translation="MLPETTKLHSAVSNTRPSKQIFEGVKALWDNRAILKKDN"
FT   gene            complement(347932..349173)
FT                   /gene="gt1B"
FT                   /locus_tag="CJA_0272"
FT   CDS_pept        complement(347932..349173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gt1B"
FT                   /locus_tag="CJA_0272"
FT                   /product="rhamnosyltransferase, putative, gt1B"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83978"
FT                   /db_xref="GOA:B3PH75"
FT                   /db_xref="UniProtKB/TrEMBL:B3PH75"
FT                   /protein_id="ACE83978.1"
FT                   /translation="MDYLLYSLGTTGDALPFIKLASSLNACGVKAAFIGSEKFIPLADT
FT                   MGVECLPVSTKTDYENTYNSPLTWSRYHSQNHYNEFHFPAIKPTFKAIQRVVQQRHNPL
FT                   IIYQDILSGARMAAEEFGLKSCQVVLAPYGVSSILSPAYPMRRQVEERLWSEILPQIQE
FT                   KAKRDTLERLVKPLINPARKELGLSEWTIQDLPSMQSSPSILALFPEWFKPNPGDWPTQ
FT                   LVNTGFILGNTPDNHSNKQLDEFITQYGKPLAFTFGTGIPVTSQLIDKIRHLCRVVRKP
FT                   GVFVAHSQTARFIDNGDNPVLTLPSAPFSYLFACSALVIHHGGIGTCAQALACGIPQVI
FT                   SPYTFDQPDNAFLLWQLGISNSVDFLNDSVDQIASIVNDVMSSESVAKKVKEYQALTTD
FT                   ETAASVKFLLSLQG"
FT   gene            complement(349273..350430)
FT                   /locus_tag="CJA_0273"
FT   CDS_pept        complement(349273..350430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0273"
FT                   /product="peptidase, rhomboid family"
FT                   /note="identified by match to protein family HMM PF01694"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84521"
FT                   /db_xref="GOA:B3PH76"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:B3PH76"
FT                   /protein_id="ACE84521.1"
FT                   /translation="MSPVDTLFSVFYEYSYMKFLIKNKNPIRSLLAILACGNIIIFYVI
FT                   SHGFWPTNTQEIFIFYNLICSLILFGLSRRQLSVEIMSDYMLVTRLLSTKKIRNSDIKS
FT                   IEVQSYGAKKNGNMCRLGVNGSFPVIFTEDMFEDDRDYNALVKCLGWVEKKYSHHNEPS
FT                   WKGIASACSKQLVTYSVVFIMIILNSILFFINKDDFLWIMDNFAFSKSTIEFREYYRFI
FT                   TAFFLHLNPVHLLINLISLGVLGGMLEQYFGRAKYFNILILSTFSGWIFSLAFSPFNLV
FT                   VGASGGIFGLFGSYIALKILSKEALQPSVDPMPFWWAIIILIFQVISDLYIHNSDFYAH
FT                   IGGVIGGSLYFIVSRFTIIKSIKTDKLISLVIFLLCIFSFFKFMH"
FT   gene            complement(351365..353122)
FT                   /locus_tag="CJA_0274"
FT   CDS_pept        complement(351365..353122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0274"
FT                   /product="putative toxin secretion ABC transporter,
FT                   ATP-binding subunit/permease protein"
FT                   /note="identified by match to protein family HMM PF00664;
FT                   match to protein family HMM PF03412"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84953"
FT                   /db_xref="GOA:B3PH77"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033838"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B3PH77"
FT                   /protein_id="ACE84953.1"
FT                   /translation="MNMSPEQSVKQTATSPDQLLNFSGAHSLPMIHQTEAAECGLACLA
FT                   MIASFHGYETDLAYLRQRIQVSSHGTNLKNLMEMAGRLHLAGRALKLNSDSLGGLQLPC
FT                   VLHWDLNHFVVLKAVKSRKAIIHDPASGEKTLTKEEFDKHFTGIALELTPTSKFEVADT
FT                   RKHLKLHHFWSRISGLKRSLLQILVLSLLLQVFAIISPYYMQTVVDDVILRNDDNLLLV
FT                   LALGFGLLLLIETGTHVLRQWVMLYLSSRLNIQMAANLFRHLIRLPMSYFSTRHMGDVV
FT                   SRFGSLQNVRELLTTSLVAAVVDGIMAVITLTVMFFYSIKLTLLVLIVVLLYAALRFAL
FT                   YKPLRLLTEEQIIAQARHDTHFMESVRAVQTIKLFQRENDRQGQWQNRLADTINQGIRI
FT                   TRWNIGYDTINRLLFGIENLLVIYFAATAVMGNIFSVGMLYAFLSYKSRFVSSMDTLIA
FT                   TWIELKMLGLHLDRLSDIVFTETEEQDDLLPSQSSTRPLAGKIEVRNLSFQYGETEGPT
FT                   FQNLNFIIEPGETVAITGPSGCGKTTLLKCLMGLLQPTEGEILIDDRPLKQVLDYRRHI
FT                   AGVMQRNLP"
FT   gene            complement(353122..354438)
FT                   /locus_tag="CJA_0275"
FT   CDS_pept        complement(353122..354438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0275"
FT                   /product="putative toxin secretion, membrane fusion
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00529"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85731"
FT                   /db_xref="GOA:B3PH78"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:B3PH78"
FT                   /protein_id="ACE85731.1"
FT                   /translation="MLMAIQGIDKFSMNNECSPTQKAPLFREQVIKQKSDRLHGDVLLL
FT                   PQVSHSVLIALLLVWLLALAVWLTTSTYARKETVVGWLEPPTGVVRLYPEASGQVKKIL
FT                   VKEGDKVQAGQPLIIINGDRILADGGNLESRLLEEYESQRRLLTEQIERADRTQQDREN
FT                   SLRRQIESIKHNLSLMDEQLATLDARHILIKNQIERYRPKIEKGHISRLEYDQVLSQEL
FT                   SVRSDKQGLLREISNQKDLLSQRHTDLRLLAQEAANSLDQLQARMSELAQQIAQLQGQR
FT                   AHIITATRAGIVNNLQAREGQFVSSTNPVPLLTLADSASPLVAHLLVPVRAAGFIASGQ
FT                   RLDIRYDAFPYQKFGLYQGEIESVAKTPLLPGELLNTPVTLQEPVYRVEARLYEQGVNA
FT                   YGQSIPLRSGMTLTADVELAERRLWQWLLEPIYSLKGRL"
FT   gene            355028..356386
FT                   /gene="cbp6B"
FT                   /locus_tag="CJA_0276"
FT   CDS_pept        355028..356386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbp6B"
FT                   /locus_tag="CJA_0276"
FT                   /product="carbohydrate binding protein, putative, cbp6B"
FT                   /note="identified by match to protein family HMM PF03422"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85527"
FT                   /db_xref="GOA:B3PH79"
FT                   /db_xref="InterPro:IPR001064"
FT                   /db_xref="InterPro:IPR005084"
FT                   /db_xref="InterPro:IPR006584"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011024"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:B3PH79"
FT                   /protein_id="ACE85527.1"
FT                   /translation="MFTVATVSALAAGNVQAATVDLLVLYDTYSKNYFGGDPQTAMNNW
FT                   VNQMNAAYRDSQIDVQLRLVGVRENNLAGADMGAVLGNLRVNANAIALRDQLGADFVSQ
FT                   LHERGACGVGYVAVDRNWAWNVTGPGCGPMVMAHELGHNMGLNHSRKQGDTSGARFRYG
FT                   VGYGVQNVFVDIMAYEGVFNTTRVNRFSNPNLTCRGLPCGLPVGHAEEAYAALAIHNVR
FT                   DEIAAFRPTAGSSGPVQVSQHCNYEGYTVGLPVGQYTLSQLQARGILNDDVSSVRVQSG
FT                   YSVTLYQHDNFTGNSLVRTSNDSCLVSAGFNDAASSIIVSTTGSSFNLLIQAENYFSSN
FT                   GVQLENTTDTGGGQNVGWIDTNDWMAYSGITIPTSGTYTVEYRVASQSGGGRLSLDLNG
FT                   GSIVLGELAVPSTGGWQNWTTISHTVNINAGTYNLGVFAKAGGWNLNWIRIRR"
FT   gene            356387..357217
FT                   /locus_tag="CJA_0277"
FT   CDS_pept        356387..357217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0277"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82773"
FT                   /db_xref="GOA:B3PH80"
FT                   /db_xref="UniProtKB/TrEMBL:B3PH80"
FT                   /protein_id="ACE82773.1"
FT                   /translation="MIFVAIPPSVPEVKPACTDVPLFTSFAENTMNNKYLFALAIAVTG
FT                   VAAAWYFSKPPAMAPLPVPATSSAVKTVAPAGVDPAPENTAMATAVSSVAAQQVIPETL
FT                   QERLDAIAIRRPELQLDVETVQTKIAQPIAWTPSEKIPQHLPLTAEELNDGRQFIALDD
FT                   LKIETLMPGDSVDIQMPDTKNTFEVVIDKVEKHDYNSISWYGHIEGADGQDYSVSFTRG
FT                   ASLTVAGFDTPDGHYVLQGHGKDGWIASSGLLYKQDTSVTDAIYPEDVLDAHEH"
FT   gene            complement(357239..358696)
FT                   /locus_tag="CJA_0278"
FT   CDS_pept        complement(357239..358696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0278"
FT                   /product="putative sensory box histidine kinase"
FT                   /note="identified by match to protein family HMM PF02518;
FT                   match to protein family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85640"
FT                   /db_xref="GOA:B3PH81"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B3PH81"
FT                   /protein_id="ACE85640.1"
FT                   /translation="MARLSARSLLQRLAAKPHLSSTREFPMKQLMALLALLSIHTHAQA
FT                   DMFAVFRNEDGSTRWQYVANTSAGILIITLAIVLGFLVRAHLRALRYNRALKDMKATLE
FT                   ERVVERTAQLQQSNENLHQREAYITGIVDSMPVMLIGLNKQLEITQWNRVAESITGRPI
FT                   ADVLGQNLWKAYSAITLTPEQVQQVLATKQTLQLKHHQRGQYSFDITVYALGEDNETGI
FT                   VILVSDVTKQVNAETKLAERDKVSAMGELASAMAYDISLPINNIFSRVSSARQEIEAAD
FT                   LGEVKEFLLQEVETVRQSAHQATAIAHNLLDLARAHRDSKQPAAIAPIMDHAIELAGNL
FT                   FTDSNGLSFKDINIHRQYADKLPLIPCFPAELQQVFVRVMRSAFYALNAYAQRDTFEPV
FT                   IDLEISEFYETLWIKIHHNGKCLSAEEQLDIFQPYFSLTNHSSHTYPAEQRLSYSYFII
FT                   TEHHRGQMAVTSTEENGTSFHIQLPMA"
FT   gene            complement(358811..359329)
FT                   /locus_tag="CJA_0279"
FT   CDS_pept        complement(358811..359329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0279"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84439"
FT                   /db_xref="GOA:B3PH82"
FT                   /db_xref="InterPro:IPR009959"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:B3PH82"
FT                   /protein_id="ACE84439.1"
FT                   /translation="MSLSSVFLPFCRSPRSPSRPTPLTPAPESARVSALLKAALCGSAQ
FT                   DFQEQIHPHIRCVGFPEFTPHNREELFGFFNYLLEVFAEPQLTIEELPGTAQQATVEFC
FT                   VRGRHREEFMGLPATGGQLQLCAQLMVRTEAEVITDMWICDKRISLTTTTGSVYRLHLP
FT                   REQQEHPLR"
FT   gene            complement(359433..360473)
FT                   /gene="cebR"
FT                   /locus_tag="CJA_0280"
FT   CDS_pept        complement(359433..360473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cebR"
FT                   /locus_tag="CJA_0280"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="identified by match to protein family HMM PF00356;
FT                   match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83355"
FT                   /db_xref="GOA:B3PH83"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B3PH83"
FT                   /protein_id="ACE83355.1"
FT                   /translation="MTIMVFLDVPMPSKSLPPVSIADIARRAGVAESTVSRALNNNPMI
FT                   NAQTREKIQALAREMNYKLNTGARNLRLQRSHAISIVINAEVRDGQGFSDPFMMDMIGA
FT                   IADELHRHHYSLLFSSPAITSDDWHAHLLGSKRSDGLIVIGAGRDDQPLRQLHEQGDAI
FT                   VVWGAPRGDSNYCVVGSDNYQGGQLAATHLLSRDCKRLVFLGDITHPEIEQRFQGYVDR
FT                   LTQAGHSTQERHRQSAFSIESGYAQVKSLLQQGLDFDGIFAASDNIAMGAIKALQAHGL
FT                   DVPRDVSVVGFDDIPMAPYFTPPLTTIRQDIHRGGQLLVEKILARVNGDTVTSEQLKTE
FT                   LVVRSS"
FT   gene            complement(360498..361751)
FT                   /locus_tag="CJA_0281"
FT   CDS_pept        complement(360498..361751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0281"
FT                   /product="major facilitator family transporter"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACE86111"
FT                   /db_xref="GOA:B3PH84"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B3PH84"
FT                   /protein_id="ACE86111.1"
FT                   /translation="MPLAPHQRLIALVLMLNYFLFGLLLNSVGIVILQSINSFGISKES
FT                   AAVLEGFKDIPIAIVSFFVAALLPRLGYRRAMMIALAVVVAACLAMPLLREFWASKLFF
FT                   LCVGAAFALVKVSVYASIGLLTRDKQDHASLMNTIEGIFMLGVLSGYWLFGAFIDAQNP
FT                   ASLGWLDTYWLLATICGINLLVMMAVRFDDRPARDDGARPLDDFIAMLRLAARPLVYTF
FT                   VFSLFLYVLIEQGIGSWLPTFNNQVLKLPASISVQITSLFALSLALGRLGAGQLLKHIP
FT                   WHWLLSGCVLAMATLMLLTLPLSHQVEADPRAHWFNLPLVAYLFPLIGLFMAPIYPVLN
FT                   SVVLSALPRQQQSSMAGLIILFSALGGTTGSMITGMMFSRFSGQTAFYLALVPMAIILL
FT                   LLFQLRRRTREPVPAPVV"
FT   gene            complement(361918..362049)
FT                   /locus_tag="CJA_0282"
FT   CDS_pept        complement(361918..362049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0282"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84993"
FT                   /db_xref="UniProtKB/TrEMBL:B3PH85"
FT                   /protein_id="ACE84993.1"
FT                   /translation="MLVNAEPGEDSNRRALPHRLFMLGDKILFSNRLQFFLQSIADM"
FT   gene            362079..364415
FT                   /locus_tag="CJA_0283"
FT   CDS_pept        362079..364415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0283"
FT                   /product="TonB-dependent receptor"
FT                   /note="identified by match to protein family HMM PF00593;
FT                   match to protein family HMM TIGR03304"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83981"
FT                   /db_xref="GOA:B3PH86"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:B3PH86"
FT                   /protein_id="ACE83981.1"
FT                   /translation="MNKHPLAHALATVNHQRYFPQVISSLALALLSLPALAQPGAAGPV
FT                   EELIVTGTPGGASVRRFDASFAISTVSDEEIQQVAPASTADLLKTIPGVWVESSGGVSG
FT                   ANIFVRGLPSGGDADFVTVAINGLALYPAPTLSFMENSTLFRVDETIARLEGLRGGPNP
FT                   VYSNGQVGLTTNFILKEGGEETEGTVRYTTSDYELQRIDAVISGKLDQDLYYMIGGYVS
FT                   SSPGVRDAGFNAEEGHQITINITKILDNGKANIFHRSTDDHGTWYLPVALDVDGIKTGL
FT                   DASYTQVGQANRLVLVPISGADGEGGSETRWESFDMGEGRGWNGSVTGGAVELNLNNDW
FT                   TFTDRFSLTKGAANTLGFVPQGAAVSLGSLNGGAAGETVSGAAVAADDLVQQFGPWVVM
FT                   KDIKAFNNDLSLAKRWENYKLTLGYYTSSWEVDEWWSIGNQKWYRLGHNGEMISPASIS
FT                   DACQGPEVATCSWKYDVDALGDARENAFYIAGETYIGDVTLDAGVRVVNRKTHYAVDHT
FT                   TDDDGPRDGITDFVASADEDKVSYTAAVNWNFRDDMGVFVRINDGHKYPDFDAYRDFRG
FT                   DYNNGSDLVIDVSQFELGYKLARDNYSLYATAFSNNTKGQPFCDVGGASCDRLETKAVG
FT                   VELDGKLFLGDFVLDLNATFQEPEIDNGELAGNQVLRQPTHQVRLTPSYQFAFNNGVEA
FT                   SVYGTLSLISDRYGDNANTNKLDSYTKFDFGVQVSVDNFNVQLAVDNATDELALTESDP
FT                   RAVGTSANGRYILPRNVKFSVGYNF"
FT   gene            364569..366167
FT                   /gene="tre37A"
FT                   /locus_tag="CJA_0284"
FT   CDS_pept        364569..366167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tre37A"
FT                   /locus_tag="CJA_0284"
FT                   /product="trehalase, putative, tre37A"
FT                   /EC_number="3.2.1.28"
FT                   /note="identified by match to protein family HMM PF00515;
FT                   match to protein family HMM PF01204"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82971"
FT                   /db_xref="GOA:B3PH87"
FT                   /db_xref="InterPro:IPR001661"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR018232"
FT                   /db_xref="UniProtKB/TrEMBL:B3PH87"
FT                   /protein_id="ACE82971.1"
FT                   /translation="MQRILWLSLVLGLLVSCSIPTDRAGGGTAVRIDYASGLTDRENSM
FT                   FKEIQLSGVFADSKTFVDSHPKLPLAEIAELYHVRQQQAGFDLAAFVHRYFELPPSIAS
FT                   GFVSDTSRPVEKHIDILWDVLTRQPDRQEAGTLLPLPYPYVVPGGRFREIYYWDSYFTM
FT                   LGLQASKRWDLMEGMVNNFSHLIDTIGFIPNGNRTYYEGRSQPPFYALMVELLANKQGE
FT                   SVLLAHLPHLRREYEFWMEGAAKLSPAAPAHRRVVLLPDGSILNRYWDDIAAPRPESFR
FT                   EDYELAEAIGGNKRELYRHIRAAAESGWDFSSRWFKDGNGMASIHTTDIIPVDLNALVF
FT                   NLERMLAHIYGLQGDQDQATHYYQLAEQRKQALLRYCWNAQQGFFHDYDYVAAQQTPVM
FT                   SLAAVYPLYFSMVDQRTGDRVAEQIEAHFIQAGGVTTTLATTGQQWDAPNGWAPLQWLT
FT                   IQGLRNYHHNSAAEQIKQRWIALNQRVYRNTGKLVEKYNVYDLDVAGGGGEYELQDGFG
FT                   WTNGVLLHLLNESTP"
FT   gene            complement(366187..366687)
FT                   /locus_tag="CJA_0285"
FT   CDS_pept        complement(366187..366687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0285"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83871"
FT                   /db_xref="InterPro:IPR018531"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:B3PH88"
FT                   /protein_id="ACE83871.1"
FT                   /translation="MNPIPVFIRYLQQLQHMLRLMEAHTQGDCQLLGQQLHPHMLPLLA
FT                   QVRTAANFAPRALCPLLGRERIGFENSDHSYAGLQQQLAETIQWLTQLPTEDITPACAS
FT                   ISDKAGFQDLDLPAQEYLQQYALPNFFFHLGMAYAIARHAGVPLSKGDFDGYHQYPPGF
FT                   SFV"
FT   gene            complement(366701..367360)
FT                   /gene="cbbY"
FT                   /locus_tag="CJA_0286"
FT   CDS_pept        complement(366701..367360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbbY"
FT                   /locus_tag="CJA_0286"
FT                   /product="CbbY"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01509"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83398"
FT                   /db_xref="GOA:B3PH89"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B3PH89"
FT                   /protein_id="ACE83398.1"
FT                   /translation="MLKAILFDHDGTLVDSEEVHYQLWREIMRAYAVDLSAEEYRDYYS
FT                   GIPTAKNALDLTVRHQLPIDAPSLAAQKHQVTRDYIARTAFPLMPHADATVRRFAATGA
FT                   QLAVVTGSTRNCVDATLAAYQWQPLFSTIVSSEDVSNNKPAPDSYLLALQRLGLSAQEA
FT                   IAIEDTAHGLQAATRAGITCVAVRNAMSQSHDLSNAIQVFNHLQEAADWVVQHYRF"
FT   gene            367619..370216
FT                   /gene="hex20B"
FT                   /locus_tag="CJA_0287"
FT   CDS_pept        367619..370216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hex20B"
FT                   /locus_tag="CJA_0287"
FT                   /product="beta-hexaminidase, putative, hex20B"
FT                   /EC_number="3.2.1.52"
FT                   /note="identified by similarity to SP:Q54468; match to
FT                   protein family HMM PF00728; match to protein family HMM
FT                   PF02838; match to protein family HMM PF03173; match to
FT                   protein family HMM PF03174"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACE86226"
FT                   /db_xref="GOA:B3PH90"
FT                   /db_xref="InterPro:IPR004866"
FT                   /db_xref="InterPro:IPR004867"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR015882"
FT                   /db_xref="InterPro:IPR015883"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025705"
FT                   /db_xref="InterPro:IPR029018"
FT                   /db_xref="UniProtKB/TrEMBL:B3PH90"
FT                   /protein_id="ACE86226.1"
FT                   /translation="MKVAGRISRSGWMALILGAVMGQGLAVGANAGNLTQAQLSQFARD
FT                   AQLAFAPVSNFALGHGQFQAQLTLNNQSAIALPAGKGDWRIYIHSIRKLHENKVAGLQI
FT                   KHVQGDLHALEPSADFTGLAAGASLEVPYSGGNWIVSYSDFMPRAFIAQPGLEAAVFAN
FT                   TDTEDLTRFVSPFVRPEQQLRFNAPTADAFPIVTSAGRYESNRAVNAIKPVEQLGIIPT
FT                   PKSVKYRRGSIQLDGSWQIRYAGSLTSEARYLVAQLKAAGLELNSAADHIPAQGPVIRL
FT                   ALEPGGVSEAYHLSIGKEVIQIRGSDNAGAFYAVQSLLSLLPAQTAAQYTLPVVEVKDQ
FT                   PRFSWRGMHYDMGRNFHGKAVTLRLIEQMARYKLNKLHLHLTEDEGWRIEIPGLPELTE
FT                   VGAFRCFDLTEQSCLLTQLGTGPHKSGSGNGYYSAEDFVEILKFAAARHIEVIPEIDMP
FT                   GHARAAVKAMDARYHKLLKAGKKAEAEQFLLSDPADKSQYLTVQNYTDNSINVCLPSTY
FT                   AFADKVVYELQQMYRKAGLKLNTFHMGGDEVGAGSWVESPACKTLFATQEGVAGPADLK
FT                   PYFVSKLAAITHERGLALVGWEDGLMYDPNNTFNRKAFANERVLANAWDNIWEWGVADR
FT                   AYRLANAGYQVILSAGTHLYFDHPHEAHPEERGYYWAARYTSPGKVFGFMPDNFYANAD
FT                   TTREGTPIDNLEALVGRSLPKLEKPENLLGMQGQVWSETIRTAQQLEQMIYPRLMSLGE
FT                   RAWHKAAWESNAPDTTARTADWAQFAHTLAKRDLPRLVQAGADLYLPPPGAVIESGQLL
FT                   ANTALPGLAIEFSLDKGASWQPWTAPVALTAEQSASVWLRSRLGDKTSRVSTL"
FT   gene            370520..370660
FT                   /locus_tag="CJA_0288"
FT   CDS_pept        370520..370660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0288"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85175"
FT                   /db_xref="UniProtKB/TrEMBL:B3PH91"
FT                   /protein_id="ACE85175.1"
FT                   /translation="MKVDLFTLVLIVFALGVCVTLVDVGTLFSTAEATVTDETEITSAR
FT                   E"
FT   gene            complement(370751..371350)
FT                   /locus_tag="CJA_0289"
FT   CDS_pept        complement(370751..371350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0289"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase family
FT                   protein"
FT                   /EC_number="6.3.3.2"
FT                   /note="identified by match to protein family HMM PF01812"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83671"
FT                   /db_xref="GOA:B3PH92"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B3PH92"
FT                   /protein_id="ACE83671.1"
FT                   /translation="MTDGDLRQPLRARLRARRRSLSPQEQQQAALLLVRQLLKMPQLLR
FT                   AQHIALYSANDGEIDPEPLARQLWKMGKHTYLPVLRPDKPRELWFVAYGPDTPLTPNRF
FT                   GIAEPDFRQAHRLPPHLLDMALMPLVGFDRQGTRLGMGGGFYDRTFAFKQQKPKGKPYL
FT                   VGLAHSCQEEESLATASWDIPLFALATEQELILCAR"
FT   gene            371532..371627
FT                   /locus_tag="CJA_0290"
FT   CDS_pept        371532..371627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0290"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82637"
FT                   /db_xref="UniProtKB/TrEMBL:B3PH93"
FT                   /protein_id="ACE82637.1"
FT                   /translation="MHTKHNEILPGYDYRLKDIVGLRTSQGFAPV"
FT   gene            complement(371836..372159)
FT                   /locus_tag="CJA_0291"
FT   CDS_pept        complement(371836..372159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0291"
FT                   /product="Family of unknown function (DUF710) superfamily"
FT                   /note="identified by match to protein family HMM PF05164"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85813"
FT                   /db_xref="GOA:B3PH94"
FT                   /db_xref="InterPro:IPR007838"
FT                   /db_xref="InterPro:IPR036192"
FT                   /db_xref="UniProtKB/TrEMBL:B3PH94"
FT                   /protein_id="ACE85813.1"
FT                   /translation="MPNKLEAAMSNETVVVKILDKEYQVACPREERQALLESAQLLDER
FT                   MKAIRSTGAVIGLERIAVMAALNLSHELLQARQSGNQGKGANQADLLRLHEKLDRSLAN
FT                   KID"
FT   gene            complement(372149..372391)
FT                   /locus_tag="CJA_0292"
FT   CDS_pept        complement(372149..372391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0292"
FT                   /product="putative conserved hypothetical protein
FT                   TIGR02449"
FT                   /note="identified by match to protein family HMM TIGR02449"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84242"
FT                   /db_xref="InterPro:IPR012662"
FT                   /db_xref="UniProtKB/TrEMBL:B3PH95"
FT                   /protein_id="ACE84242.1"
FT                   /translation="MSDPRSYWSFIIMSDDLLLSLENKLDKLILLCNRLQQENTELKAR
FT                   ESEWQRERQRLIEKNELARSRVEAMITHLRNLDAE"
FT   gene            372587..373195
FT                   /locus_tag="CJA_0293"
FT   CDS_pept        372587..373195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0293"
FT                   /product="yecA family protein"
FT                   /note="identified by match to protein family HMM TIGR02292"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84183"
FT                   /db_xref="InterPro:IPR011978"
FT                   /db_xref="InterPro:IPR036255"
FT                   /db_xref="UniProtKB/TrEMBL:B3PH96"
FT                   /protein_id="ACE84183.1"
FT                   /translation="MTDRQPQTYSPLSFDDLANLLAPLGTLNSPSELHGLLCGKLAGGA
FT                   QLTEINWLLEAVEFLDFVSAPDEKVRIALTHLYHNTLQALQGDFNLKLMLPDDDTLLSD
FT                   RARCLSQWCHGFLTGFGSVELATKRELDEEAQDMLQDFSHIVQIQVDDEEDEPSAEADY
FT                   MEVVEYVRMATNSLYLEFAPAQSDAADKDLSSANHQTVH"
FT   gene            373227..374543
FT                   /gene="pepP"
FT                   /locus_tag="CJA_0294"
FT   CDS_pept        373227..374543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepP"
FT                   /locus_tag="CJA_0294"
FT                   /product="aminopeptidase P II"
FT                   /EC_number="3.4.11.9"
FT                   /note="identified by match to protein family HMM PF00557;
FT                   match to protein family HMM PF05195"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83137"
FT                   /db_xref="GOA:B3PH97"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR007865"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:B3PH97"
FT                   /protein_id="ACE83137.1"
FT                   /translation="MRITKAEFARRRKQLMALMEPNSIAIVPAAPERQRSRDTEYHYRQ
FT                   DSDFLYLSGFEEPQAVLVLIPGREHGEYVLFVRERNREREIWDGYRAGPEGACSEFEAD
FT                   DAFPIDDIDDILPGLLEGRQRVYYAMGKDADFDKHVMDWVNTIRAKVRSGATPPGEFLD
FT                   LSHFLNDMRLFKSAAELRVMREAGDISARAHVRAMQACKPGVMEYQLEAEILHEFHMNG
FT                   ARFPAYNSIVGGGKNGCILHYIENSAPLKNGDLVLIDAGCELDYYAADITRTFPVNGKF
FT                   SPEQKVLYEICLNAQLAAIAVARPGNHWNDPHEETVRVITSGLVEAGLLQGHVDELIQS
FT                   EAYKEFYMHRAGHWLGMDVHDVGDYKVGGQWRVLEPGMVMTIEPGIYVAPDNERVAKKW
FT                   RGIGIRIEDDVVITKDGNEVLTSGVPKTVADIEALMAQA"
FT   gene            374550..377069
FT                   /gene="ubiF"
FT                   /locus_tag="CJA_0295"
FT   CDS_pept        374550..377069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiF"
FT                   /locus_tag="CJA_0295"
FT                   /product="2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol
FT                   hydroxylase"
FT                   /EC_number="1.14.13.-"
FT                   /note="identified by match to protein family HMM PF01360;
FT                   match to protein family HMM TIGR01988"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85901"
FT                   /db_xref="GOA:B3PH98"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR011295"
FT                   /db_xref="InterPro:IPR018168"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B3PH98"
FT                   /protein_id="ACE85901.1"
FT                   /translation="MNNSLAFDIAIIGGGMVGTSLASLLAAACPFLRIALIEAQPLAET
FT                   GEAYQPSFDARSTALAQGSVDVLRELGLWSRLAQHVTAIQQVHVSDRGHFLGGVIEAAE
FT                   HHLDAVGYVVENAWLGRVLLDHVLQTPAITCFAPARVHGLQPQVDGALLALEYQGQAQF
FT                   IHTRLAVIADGGDSPLRQSLGIHTQVRAYGQTAIITNVEFTQAHGGIAYERFTDQGPIA
FT                   LLPLGESPDACRAALVWTLPNELADNILALSDADFLEHLQHRFGFRAGRFTRVATRFAY
FT                   PLQLRLAEEQIRSHLVLLGNAAHFLHPVAGQGFNLALRDCTALVETLRIALDQQRHPGD
FT                   LAVLQTYLERQSLDQQLTVEFSDKLVRLFSSSQLPLVALRHLGLLSLETLFPLKQVFSA
FT                   QTMGAGGRQYRWREMVPAVADDLAGQAISPAAPQPLIDGTHVDLLIAGAGLVGAALACA
FT                   VAQAVPAWQVVVVEPGVDLPDYAGTRFDPRVVALTQASQQLLMDIGCWDAIVAQRLCSY
FT                   TDMHVWDGEGTASIAFDAAEVRQPQLGHIVENSVAVRALRQRMAQLPNIHLVQSAAVLD
FT                   MQQPASTASHIQVLLSSGIKLIAPLVIAADGAHSKVRELAGFKTREWDYGQQAIVTTVR
FT                   CEKSHAFTAWQRFMHTGPLAFLPLQHQGDTHYCSIVWSADSGLADQLMAMDRVSFCAAL
FT                   ARAFEYRLGSVEHCAELLAIPLRQRHATQYIQPGIALVGDAAHNIHPLAGQGVNLGLLD
FT                   VGALAAELIRAHQRGLPLHDYSILRRYQRQRLAANLTMMSAMEGFKRLFGSRDLAVNWL
FT                   RNTGVRWCDQQPALKKIIINAALGISR"
FT   gene            377093..377608
FT                   /locus_tag="CJA_0296"
FT   CDS_pept        377093..377608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0296"
FT                   /product="Uncharacterized membrane protein"
FT                   /note="identified by match to protein family HMM PF02308"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84090"
FT                   /db_xref="GOA:B3PH99"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="UniProtKB/TrEMBL:B3PH99"
FT                   /protein_id="ACE84090.1"
FT                   /translation="MDLDTLFSIYPFDWKAIGTAILCGSIIGMERQLRGKPVGIRTSSL
FT                   ITLGTYIFIAASLAISASLAGPEKVVTDPSRIIGQVITGIGFLGAGVMLARDGVVLGVT
FT                   SAATIWALASIGVCIAIGYNLVAIKLSLVVIAVLVGVDLLEDYSQAFTRGVHKKYQDWR
FT                   GKHKTGSE"
FT   gene            377658..378032
FT                   /locus_tag="CJA_0297"
FT   CDS_pept        377658..378032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0297"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84653"
FT                   /db_xref="GOA:B3PHA0"
FT                   /db_xref="UniProtKB/TrEMBL:B3PHA0"
FT                   /protein_id="ACE84653.1"
FT                   /translation="MSKTRLVAHFLNYVLLLLLLASVVGFLSFANIYGVFLALVTATIA
FT                   WFVCKHNRWGYFAAAAWGLACYQLAKQGYEFQAIKRQVMIVGIFVIPVALFLHEVLAKV
FT                   PTKSAQDEKHDDPSGSNMPD"
FT   gene            378301..378528
FT                   /locus_tag="CJA_0298"
FT   CDS_pept        378301..378528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0298"
FT                   /product="cold-shock domain family protein"
FT                   /note="identified by match to protein family HMM PF00313"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83572"
FT                   /db_xref="GOA:B3PHA1"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:B3PHA1"
FT                   /protein_id="ACE83572.1"
FT                   /translation="MQDEEFMSDIVSGVVKWFNDDKGYGFIEREGGADVFVHFRAINGT
FT                   GRRTLKEGQKVTFEVTQGQKGPQAENVTPL"
FT   gene            378721..379038
FT                   /locus_tag="CJA_0299"
FT   CDS_pept        378721..379038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0299"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83175"
FT                   /db_xref="GOA:B3PHA2"
FT                   /db_xref="InterPro:IPR021732"
FT                   /db_xref="UniProtKB/TrEMBL:B3PHA2"
FT                   /protein_id="ACE83175.1"
FT                   /translation="MLNIEWFFWLIILSLAILYWRHALRVKEWAYMAARKRCEELQVQM
FT                   LDESVYLRRLWVKRNAQGKLVFWRAFYFEFTVSGGERYFGRVLMLGNLIEEVQLEPHRL
FT                   H"
FT   gene            379041..379490
FT                   /locus_tag="CJA_0300"
FT   CDS_pept        379041..379490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0300"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACE86197"
FT                   /db_xref="GOA:B3PHA3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B3PHA3"
FT                   /protein_id="ACE86197.1"
FT                   /translation="MSLYFTYRISKQGCFMAIRYLHDTPLDVGQVIALYQRTSLGKRRP
FT                   VDRPDVFEGMIRNANLVITAWDEDKLVGIARALTDFVYVTYLADLAVDEDYQHQGIGRH
FT                   LLDQVQGHTEPDCMVVLLAAPQANDYYPKLGFTHNPRAWMLKSNY"
FT   gene            379490..380050
FT                   /locus_tag="CJA_0301"
FT   CDS_pept        379490..380050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0301"
FT                   /product="hydrolase, NUDIX family"
FT                   /note="identified by match to protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACE86008"
FT                   /db_xref="GOA:B3PHA4"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:B3PHA4"
FT                   /protein_id="ACE86008.1"
FT                   /translation="MTDPYLAEKIGGWKTKTSKVVYENPWIKVCHEEVVTPKGTDGIYG
FT                   VVHFKNTAIGVLPIDEDGNTWLVKQSRYSLNQYTWEIPEGGCPQGESPLEAAKRELEEE
FT                   VGLKAHHWQEFMRLHLSNSVTDELCIVFIARDLFVGQQQLEASEDIEYQKIPLQDAIAM
FT                   VMRGEITDGISVAALLRAAQGLS"
FT   gene            complement(380066..380989)
FT                   /locus_tag="CJA_0302"
FT   CDS_pept        complement(380066..380989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0302"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85071"
FT                   /db_xref="GOA:B3PHA5"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B3PHA5"
FT                   /protein_id="ACE85071.1"
FT                   /translation="MIVKIIGSLLIGMLLTLEATAKPLQLDAQYAVFDGDPVSLQQVLG
FT                   KQPVYLKFWASWCLDCRRELPHLQQTYERYRDRIAFYAVNLNINEEDTYIQALKDKHQL
FT                   TIPIVMDNNGSIAGNFQFHGTPFHVLINRTGDVVYTTYKDDAQLASNLEQLASLGTLAT
FT                   AKNSAQIARTSTPVTLPEGLALVYFATTWCDWYMADIHPDMARNCTQADQLVNQLHKQH
FT                   PNIPLQSYVSHLWTEEKYLKEYIEKFNIRYPVTVDTEGAIARYYQNSEYPTLLLFDKGK
FT                   ELKRFSRFENPEDVLAQLNTLLGKNK"
FT   gene            complement(381104..381826)
FT                   /locus_tag="CJA_0303"
FT   CDS_pept        complement(381104..381826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0303"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83086"
FT                   /db_xref="GOA:B3PHA6"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:B3PHA6"
FT                   /protein_id="ACE83086.1"
FT                   /translation="MRRSNTPYRIKRLYKAINHWYIKRFIAPQFDSIGTIPEIAHPRSL
FT                   VIFGRNIHLGKYAQIICASDNCVRFTSWPGKQGDAEIVIGDYCLIAPGVRLSAGKSIRI
FT                   GDNCMLAANVTISDSDWHGIYNRIRPFRCTQPVIIGNNVWLGERVIITKGVTIGENTVI
FT                   GAGAVVTRDIPPNTVAAGNPARVIKTINPNRRMLKRELLFSNPEHYFYNQEQLDKLMLG
FT                   NNGWLNWLRSLWKPNHRD"
FT   gene            381876..382484
FT                   /locus_tag="CJA_0304"
FT   CDS_pept        381876..382484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0304"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85588"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B3PHA7"
FT                   /protein_id="ACE85588.1"
FT                   /translation="MLPIDIDAVKGFLDKDEGAALYEYALKASILGPCMEIGSYCGKST
FT                   VYLGSACQRAQTLLFAVDHHRGSEEHQLGEAYHDPALYDIEAQRMDSLREFRRTLARAH
FT                   LEDTVVPIVAPSDLVARHWNTPLGLVFIDGGHSMEAALTDYRCWAPHVQRGGWLAIHDV
FT                   FPNPEDGGRPPYEIWTLAQASGLFEALPLIKTLGLLRRL"
FT   gene            complement(382489..383391)
FT                   /locus_tag="CJA_0305"
FT   CDS_pept        complement(382489..383391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0305"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84446"
FT                   /db_xref="InterPro:IPR010583"
FT                   /db_xref="UniProtKB/TrEMBL:B3PHA8"
FT                   /protein_id="ACE84446.1"
FT                   /translation="MVTIGSWARMAGIQSCHYTRDKMHTCFFSSASRLSRLFLRQFSLL
FT                   MVMVPSTYAQDEHKTWELGVGLGALYGPDYRGADEYRSYVAPIPYIVYRGKFIQSDRDG
FT                   LRGNVVRSDTYEFTLSASANITPDSEKNRAREGMPELGSTAELGPSLNLLLMGENLQEG
FT                   LQLQIPWRFVFALHGDKRGYIGQVLQPQLMWRQRIDDWSLSYRAGITLATEPYHHYYYG
FT                   VDERYATGTRPAYTTDSGYSGWFGQLAVSHSLRIINEQTRLALFMRYDNLAQSTMEDSP
FT                   LLFSKNAWRGGLAFIWVIH"
FT   gene            383354..384763
FT                   /locus_tag="CJA_0306"
FT   CDS_pept        383354..384763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0306"
FT                   /product="DbpA RNA binding domain family"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271; match to protein
FT                   family HMM PF03880"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82977"
FT                   /db_xref="GOA:B3PHA9"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3PHA9"
FT                   /protein_id="ACE82977.1"
FT                   /translation="MPAILAQEPIVTTTCTFSTLPLSRAMLDNLASLEYTSMTPIQAES
FT                   LPWVLAGRDLIAQAKTGSGKTAAFGIGLLEKLQVDSFAVQALVLCPTRELADQVAKELR
FT                   RLARFTHNIKILTLCGGVAIGPQLGSLERGAHIVVGTPGRIVDHLRKGSLHLDRLQQLV
FT                   LDEADRMLDMGFADDINTVIASANSERQTLLFSATYPANIQQMSARYQRDPVRVTVESL
FT                   HTSQQIRQHFYELAEGDSRTSAVINLLAHFQPASTLIFCNTKAECEELADGLQAKKVAA
FT                   LALHGDMEQKERDRVLVRFANKSCAVLIATDVAARGIDIKDLDAVINYELARDSEVHVH
FT                   RIGRTGRAGAEGLALSLVAPREIVRVNRLEDYLRQTISLEAVPDSDTNSLPQPVMATLN
FT                   IDGGKKDKLRPGDIIGALTKDAGLPFEKIGKIDIFDFAAYVAVDRSIARAALRQLQEGK
FT                   LKGRKFRARLC"
FT   gene            complement(384778..385719)
FT                   /gene="hslO"
FT                   /locus_tag="CJA_0307"
FT   CDS_pept        complement(384778..385719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslO"
FT                   /locus_tag="CJA_0307"
FT                   /product="heat shock protein HSP33"
FT                   /note="identified by match to protein family HMM PF01430"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83496"
FT                   /db_xref="GOA:B3PHB0"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="InterPro:IPR023212"
FT                   /db_xref="UniProtKB/TrEMBL:B3PHB0"
FT                   /protein_id="ACE83496.1"
FT                   /translation="MRAIEFIFKGSPMTSNDLLHRFLFDDCDIRGEIITLGDSYREVLS
FT                   HNQQPPAIRQLLGEFLAAVGLLSSTLKFDGKIILQARGDGAISTIMAECNFHQNLRGIV
FT                   RANADIELSDQQANQGSLRDLLGNGVLVITIEPQRRENFEGKLERYQGIVPMEADDLAG
FT                   CLEDYFQQSEQLATRLWLAADDQTVTGLFVQALPQQLNTNPEDNQDRWKTITTLADTVT
FT                   AEELCGLDHPTLLHRLFHEQPLRLFEPNQLRFSCSCSRERSASALLTIGRDEVEELLIE
FT                   KGSIDIDCQFCNQHYHFSAEEVRKLLGGDVLH"
FT   gene            complement(385707..386135)
FT                   /locus_tag="CJA_0308"
FT   CDS_pept        complement(385707..386135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0308"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84375"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:B3PHB1"
FT                   /protein_id="ACE84375.1"
FT                   /translation="MYKPLLWCLLVLCSESVSADVYRWVDKDGKVHYTDKKPAPEAEDI
FT                   TRQVSKQNIDTSSEELRKVEQILRKEKPADQDFYNAPDPEEQAQRTQRCKAARQRQAKI
FT                   SGRVIFIGDDGKVVKVTEQERQHMLAELNGIISENCEP"
FT   gene            complement(386153..386602)
FT                   /gene="hslR"
FT                   /locus_tag="CJA_0309"
FT   CDS_pept        complement(386153..386602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslR"
FT                   /locus_tag="CJA_0309"
FT                   /product="heat shock protein 15"
FT                   /note="identified by match to protein family HMM PF01479"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82910"
FT                   /db_xref="GOA:B3PHB2"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025708"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B3PHB2"
FT                   /protein_id="ACE82910.1"
FT                   /translation="MHRFMSKQKHTLEDDADDDKIRIDKWLWAARFFKTRSLAKQAIDG
FT                   GKIHCDGQRIKASKEVTIGLVLNIRQDWDEKTVVVKALSDQRRGAPEAALLYAETEASV
FT                   ALREKRRLERKAGLGAFIVSDHRPNKKERRQIHRFQRINLLDNED"
FT   gene            complement(386587..387366)
FT                   /locus_tag="CJA_0310"
FT   CDS_pept        complement(386587..387366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0310"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01509"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83211"
FT                   /db_xref="GOA:B3PHB3"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B3PHB3"
FT                   /protein_id="ACE83211.1"
FT                   /translation="MDLIGAEQAAAGNGPAVKNLWLGWHYGFHRRTRFMVNWNQIDTVM
FT                   LDMDGTLLDLHFDNFFWLDHLPQRYATIHGLDPETANRRLTQDIHQYEGTLQWYCLDFW
FT                   SRELQVDIPQLKEEVKHKIQMRPHVGEFLQRLRDHHKKVLLVTNAHPKSLNLKLGITRI
FT                   DRWLDVIVSSHEFNEPKESQRFWQQLQAREDFDPERTLFIDDTARILESARRFGIKHLL
FT                   GIHQPDSQISRRMEQFPAIHHFDEIMPPARQGYCTDL"
FT   gene            387145..387855
FT                   /gene="nudE"
FT                   /locus_tag="CJA_0311"
FT   CDS_pept        387145..387855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nudE"
FT                   /locus_tag="CJA_0311"
FT                   /product="ADP compounds hydrolase"
FT                   /note="identified by match to protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84598"
FT                   /db_xref="GOA:B3PHB4"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:B3PHB4"
FT                   /protein_id="ACE84598.1"
FT                   /translation="MNGGIALGQMVQPKKVVEMEVQQGTIHIQHYCVYLIPVNHKPCSS
FT                   VEAIMPSKPEILNRGTVARSRLFRADEIHLRFSNGEVRTYEKLCTGGPGAVLIVPLLDE
FT                   NTVLLVREYAVGIEDYHLALPKGAMDLGESLLEAANRELKEEVGYGARQLKFLKRIHLS
FT                   PAYMEHGINLVLAWDLYPERLPGDEPEPIEVVPYPLDRLLELVMRPDVCEGRSIAALFM
FT                   AREWLAGNLSLEST"
FT   gene            387890..388765
FT                   /gene="cysQ"
FT                   /locus_tag="CJA_0312"
FT   CDS_pept        387890..388765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysQ"
FT                   /locus_tag="CJA_0312"
FT                   /product="3'(2'),5'-bisphosphate nucleotidase"
FT                   /EC_number="3.1.3.7"
FT                   /note="identified by match to protein family HMM PF00459;
FT                   match to protein family HMM TIGR01331"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83972"
FT                   /db_xref="GOA:B3PHB5"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006240"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="UniProtKB/TrEMBL:B3PHB5"
FT                   /protein_id="ACE83972.1"
FT                   /translation="MSPVIDAALVRHLLAIGRDAGAAIMAIYRDKDSHGVVHKADDSPL
FT                   TAADLAAQAVIASRLAQLLDLPIVSEEAQIPAFAERSRWESYWLVDPLDGTREFVAGNG
FT                   EFTVNIALVHAGRPILGLVHVPVTDITYLGILAEAQPAGAWKYQGDGTPQAIRTSDINQ
FT                   RLSQGLPLRVLLSHRHGTSATLGLVEQLARAWPGGIVRCNAGSSLKFCVIAEGGADFYP
FT                   RLAPTSEWDTAAAQAVLEAAGGAVVEAMGSDAALQPLRYNQRDELLNPYFYGLADGTFA
FT                   WQSLLMEGRL"
FT   gene            388932..389147
FT                   /locus_tag="CJA_0313"
FT   CDS_pept        388932..389147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0313"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84332"
FT                   /db_xref="UniProtKB/TrEMBL:B3PHB6"
FT                   /protein_id="ACE84332.1"
FT                   /translation="MKRQNKNLRPDVNTRRADLLREKLLREISDYERQLAELKLVGNHV
FT                   NFTMIQTYKELIAARQAMLKRLPVHY"
FT   gene            complement(389153..391090)
FT                   /locus_tag="CJA_0314"
FT   CDS_pept        complement(389153..391090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0314"
FT                   /product="sensory box protein"
FT                   /note="identified by match to protein family HMM PF00563;
FT                   match to protein family HMM PF00990; match to protein
FT                   family HMM PF01590; match to protein family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83523"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B3PHB7"
FT                   /protein_id="ACE83523.1"
FT                   /translation="MINPVLLQTAVPSLLAAMDALTLEPDFQQFFRKAAAAVRDLLGAD
FT                   GTALILLDDHQETLEYKLFEGKRKALLDTFTGLRFPANSGISGRALISKTSIFTRNYPQ
FT                   SPDAMAQLVDAGLQANLVIPLISSDQVLGVLASSWFAPNPAPTGIAPQLLALAERIASQ
FT                   IAVACHREKLERQLRELVSIDPLTKLLNRRGILAHLDQNLERLQRYQRSFALFFIDVDG
FT                   LKSANDHWGHEAGDLLLRDLAQRLSDVVRKGDQIGRLGGDEFLIIAECDEGHIELLAKR
FT                   FLQALRAPFGEGRKRGRLSGSIGIAFAPQDGTDETSLLRKADAAMYVAKSQGGDRYHRA
FT                   SVRAAPTTAAKLSIVDVEGALERQELQLWYQPICQLQDLSILGFEALLRWRRSDGDLVT
FT                   AEPIIQALEGSRGDLEYRLGNWVLREAARQFQRWQREGFNLDIHINISARHFVHPVFLL
FT                   ELQRLCESHPAFGRKLIIEITETAMLEDLERAKRIMLGCRQLGVRMAVDDFGTGYGSLT
FT                   YLKTLPLDLLKIDRSFVADLPGNKVDWDITKGIVAIAHALGLAVVAEGAETWEQIGCLR
FT                   ELGCDQVQGYFIQRPMPFDEASRWLDTHFSHKGAQRLSPKRPANDQFNNSLRGYDPRFS
FT                   LERLSRVHSG"
FT   gene            391230..391367
FT                   /locus_tag="CJA_0315"
FT   CDS_pept        391230..391367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0315"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85882"
FT                   /db_xref="UniProtKB/TrEMBL:B3PHB8"
FT                   /protein_id="ACE85882.1"
FT                   /translation="MRLYWIADPNTLGDWLDGVPNGKGIRLLHAQFWCGTYPQRLVFLV
FT                   "
FT   gene            391570..392379
FT                   /gene="modA"
FT                   /locus_tag="CJA_0316"
FT   CDS_pept        391570..392379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modA"
FT                   /locus_tag="CJA_0316"
FT                   /product="molybdate ABC transporter, periplasmic
FT                   molybdate-binding protein"
FT                   /note="identified by match to protein family HMM PF01547;
FT                   match to protein family HMM TIGR01256"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82840"
FT                   /db_xref="GOA:B3PHB9"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:B3PHB9"
FT                   /protein_id="ACE82840.1"
FT                   /translation="MKKYLPVVVACQVQIQSLHRAFLLSLLLCVMLISGAARAGDIHVY
FT                   AAASLTDAIGELGSAYEKTHKGVGIKASYAGSSTLAKQIENGAPAQLFISADQDWANYL
FT                   QERQLLDENSRVNLLLNELVLIVPAGRKVDIRFDKDADLIASFNGKLCTGDPSHVPVGK
FT                   YARQALEYYGWWDSIQPRLVGTPDVRTALAFVERGECALGIVYKTDALLTDKVDVVASF
FT                   PAQSHVPIVYPGGLVRGANADAEAFWQFLQSDKAAQVFQRYGFKRAQ"
FT   gene            392406..393101
FT                   /gene="modB"
FT                   /locus_tag="CJA_0317"
FT   CDS_pept        392406..393101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modB"
FT                   /locus_tag="CJA_0317"
FT                   /product="molybdate ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR02141"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82953"
FT                   /db_xref="GOA:B3PHC0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B3PHC0"
FT                   /protein_id="ACE82953.1"
FT                   /translation="MLSESEWQVLGLSAQVGCWATLVCLLPGVFFGWLLARKDFMAKPV
FT                   LEAVLFMPMVLPPTVPGYLLLVVFGSQGVVGQFFKTHFDIEFAFNWKGAVLASAVIAFP
FT                   LMVQTAKLSVQMIDRRLELAANTLGASPFKVWYSVTLPLMLPGILIGSILVFSRSLGEF
FT                   GATITFVGNIAGETRTLPLAIYSATHQMGGDAIAIRLIVICVAFAFFSLLLSNLLTRRA
FT                   ERWLGVRRA"
FT   gene            393094..393738
FT                   /gene="modC"
FT                   /locus_tag="CJA_0318"
FT   CDS_pept        393094..393738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modC"
FT                   /locus_tag="CJA_0318"
FT                   /product="ModC"
FT                   /EC_number="3.6.3.29"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85644"
FT                   /db_xref="GOA:B3PHC1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3PHC1"
FT                   /protein_id="ACE85644.1"
FT                   /translation="MLEIDVEYQRDQFSLRAQQAISAPITGILGASGSGKSTLLALIAG
FT                   LLKPGRGQLRLNGKTLCDIQQRIWVPPYRRHIGLVFQDGQLLPHLSVRSNLLYGFNNIA
FT                   PGQRRFAFGKVVELLEVGALLERKPATLSGGEKQRVALGRAVLYSPELLLLDEPLSALD
FT                   ERLKQQILPFFLRIYAECKIPMVYVTHALSELEFLTTHRLVVRDGHLLPDA"
FT   gene            complement(393743..394168)
FT                   /gene="modE"
FT                   /locus_tag="CJA_0319"
FT   CDS_pept        complement(393743..394168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modE"
FT                   /locus_tag="CJA_0319"
FT                   /product="MopB-like protein"
FT                   /note="similar to sp:MOPB_RHOCA MopB of Rhodobacter
FT                   capsulatus, molybdenium-pterin binding protein; identified
FT                   by match to protein family HMM PF00126"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84587"
FT                   /db_xref="GOA:B3PHC2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B3PHC2"
FT                   /protein_id="ACE84587.1"
FT                   /translation="MQLCRPTANSIMSEKAKTASGVRLKIQARLLLDEEIAFGPGKADL
FT                   LDAIEASGSISAAGKQMGMSYRRAWLLVDAMNRCFQQPLVETVTGGVHGGGARLTTTGK
FT                   EILQAYRQLQADTRHLAEQHIATFKPLLRKQPLPSPG"
FT   gene            complement(394132..394647)
FT                   /gene="moaB1"
FT                   /locus_tag="CJA_0320"
FT   CDS_pept        complement(394132..394647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moaB1"
FT                   /locus_tag="CJA_0320"
FT                   /product="molybdopterin biosynthetic protein B1"
FT                   /note="identified by match to protein family HMM PF00994;
FT                   match to protein family HMM TIGR00177"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83646"
FT                   /db_xref="GOA:B3PHC3"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR012245"
FT                   /db_xref="InterPro:IPR013484"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:B3PHC3"
FT                   /protein_id="ACE83646.1"
FT                   /translation="MSSQKDFEPLNICVLTVSDTRTLATDTSGQQLQDLLEAAGHRLHG
FT                   RTLVVDDIYQIRAVTSQWIVDPLAQVVLITGGTGFAGRDSTVEAMTPLFDKTVVGFGEL
FT                   FRQVSYEEIGTSTIQSRAIAGLSNRTLIFCLPGSTGACTTAWEKIIREQLDARHRPCNF
FT                   VGQLRIPS"
FT   gene            complement(394719..395717)
FT                   /gene="moaA"
FT                   /locus_tag="CJA_0321"
FT   CDS_pept        complement(394719..395717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moaA"
FT                   /locus_tag="CJA_0321"
FT                   /product="Molybdenum cofactor biosynthesis protein A"
FT                   /note="identified by match to protein family HMM PF04055;
FT                   match to protein family HMM PF06463"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACE86251"
FT                   /db_xref="GOA:B3PHC4"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013483"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B3PHC4"
FT                   /protein_id="ACE86251.1"
FT                   /translation="MALLDGFGRTINYVRLSITDRCDLRCVYCMAEEMTFLPRDQVLSI
FT                   EEFARLGAILVELGVTKLRITGGEPLVRQGAITLMQRLGQIPGLRELCLTTNGTRLSHH
FT                   AQALRDAGVSRINISLDSLNPDRFRQMTRYGDLSQVLSGIRAAQQAGFERIKLNCVVLK
FT                   HYNADEAVDLVRFALDEGLDISFIEEMPLGRINEHGRAAEFVSSEELRRSLGKHWTLHP
FT                   SINPGNTQAGPARYWQVSDYGSRIGFISPHSDNFCSSCNRIRVTATGRLLLCLGQEHSL
FT                   DLRAHLRAREASADAVRNAIVAAMANKPERHRFDLAGDEPQILRFMNMTGG"
FT   gene            396016..396117
FT                   /locus_tag="CJA_0322"
FT   CDS_pept        396016..396117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0322"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85447"
FT                   /db_xref="UniProtKB/TrEMBL:B3PHC5"
FT                   /protein_id="ACE85447.1"
FT                   /translation="MVRTCTNKKHKKEIITGPEFPGFSAAVRDLFLT"
FT   gene            396260..397162
FT                   /locus_tag="CJA_0323"
FT   CDS_pept        396260..397162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0323"
FT                   /product="uroporphyrin-III C-methyltransferase"
FT                   /EC_number="2.1.1.107"
FT                   /note="identified by match to protein family HMM PF00590;
FT                   match to protein family HMM TIGR01469"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84091"
FT                   /db_xref="GOA:B3PHC6"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:B3PHC6"
FT                   /protein_id="ACE84091.1"
FT                   /translation="MKMLFPLSSARGFSVSAIGNAVVEVLKPVAKKAAGKPARARSSRD
FT                   GKVWLVGAGPGDAELLTLKALRAINSADVIFYDYLVSPDIRALFPTHIPAFYVGKAKSQ
FT                   HSIAQGDLNRLLVDQARLGLKVCRVKGGDPFVFGRGSEELLELRRAGIAAEVIPGITSA
FT                   SGCSTYADIPLTHRGIAQGCTFVTAHAEKSLDLNWQALAQLNHTLVFYMGLTRADFIAG
FT                   QLLAGGLDAQTPVAIIENGCRTNQRNLISNLQDFPAVVVREQVQSPALIIVGEVVKVRE
FT                   QLQAPHLQELLAGQQRLLA"
FT   gene            397217..399754
FT                   /gene="nirB"
FT                   /locus_tag="CJA_0324"
FT   CDS_pept        397217..399754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirB"
FT                   /locus_tag="CJA_0324"
FT                   /product="nitrite reductase [NAD(P)H], large subunit"
FT                   /EC_number="1.7.1.4"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF01077; match to protein
FT                   family HMM PF03460; match to protein family HMM PF04324;
FT                   match to protein family HMM TIGR02374"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83313"
FT                   /db_xref="GOA:B3PHC7"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR012744"
FT                   /db_xref="InterPro:IPR017121"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041575"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:B3PHC7"
FT                   /protein_id="ACE83313.1"
FT                   /translation="MKKRIIVVGNGMVGHKFIDNLANHQDAAQYQLITFSEEPRLAYDR
FT                   VQLSKYFSGSSAEDLALTNAEYYREKEVQFILRDKVVDLDFDNREIITASGRREAYDKL
FT                   ILATGSYPFVPPIPGNSGEHCLVYRTIEDLEKITASAQQSKVGVVVGGGLLGLEAAAAL
FT                   KAAGLETHVVEFAPRLMAVQLDEGGGRLLRRKIEALGVRVHTQKATTDIVAGSEARYRM
FT                   NFADGSHLETDMILFSAGIRPQDELARKCGIAVGERGGIVVDNYCQTSVKDVYAIGECA
FT                   LWNNRIYGLVAPGYQMAKVVVSHIVGGDEQFLGADMSTKLKLLGVDVASVGDAHGNTPG
FT                   SLSYTYANDVEQVYKRIIVSADNKKLLGAVLVGDVEVYGTLQQMCVNGMDLPEDPNALI
FT                   LPSVEGGMAIGVDALPESACVCSCYDVSKGAICCAVQNGARTMGDIKAVTKASTGCGGC
FT                   SALAKQVMDAELTKLGVEVSNHICEHFPHSRQELADIVRVKQIKSFDTLLDQHGQGLGC
FT                   DICKPAVGSILASFWNEFVLDKKHIGLQDTNDIFLGNMQKDGTYSIVPRIAGGEITPEK
FT                   LIVLGQIGKEYNLYTKITGGQRIDLFGAQLHQLPEIWKKLVDAGFETGHAYGKSVRTVK
FT                   SCVGSTWCRYGVLDSVGMAIEIENRYKGLRSPHKLKFAVSGCTRECAEAQSKDVGVIAT
FT                   ETGWSLYLCGNGGMRPRHADLFATGLDNATLIQYIDRFLMFYCRTADRLQRTSVWFENL
FT                   DGGLDYLKKVIIDDRLGIAAELEAQMAHNISQYQCEWKTTVENPELQKRFTHFINSDKV
FT                   DDNLAYVQERGQPRPATALERKHSEIQFVELVD"
FT   gene            399776..400108
FT                   /gene="nirD"
FT                   /locus_tag="CJA_0325"
FT   CDS_pept        399776..400108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirD"
FT                   /locus_tag="CJA_0325"
FT                   /product="nitrite reductase [NAD(P)H], small subunit"
FT                   /EC_number="1.7.1.4"
FT                   /note="identified by match to protein family HMM TIGR02378"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83687"
FT                   /db_xref="GOA:B3PHC8"
FT                   /db_xref="InterPro:IPR012748"
FT                   /db_xref="InterPro:IPR017881"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:B3PHC8"
FT                   /protein_id="ACE83687.1"
FT                   /translation="MSEKPWISVCEFEDLIPDTGVCALVNNKQVAIFLSRRLNEIFAVS
FT                   NFDPVGEANVLSRGIIGSIGDEIVVASPLYKEHYSLRTGECLEKPEYQISVFPVRVDDG
FT                   LVQVQA"
FT   gene            complement(400238..402418)
FT                   /locus_tag="CJA_0326"
FT   CDS_pept        complement(400238..402418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0326"
FT                   /product="diguanylate cyclase (GGDEF) domain protein"
FT                   /note="identified by match to protein family HMM PF00990;
FT                   match to protein family HMM PF01590; match to protein
FT                   family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83105"
FT                   /db_xref="GOA:B3PHC9"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B3PHC9"
FT                   /protein_id="ACE83105.1"
FT                   /translation="MNNLFFRRAINYPTGPGCARPVPLPIHQRSRRHAMPVNLFSLALL
FT                   WLWSHPLCADTLRLQLKWTHSFQFAGYYAALEQGYYRELGLDVEFLEASPNTPVADRVM
FT                   AGEAEFGVGTSSLLLERHRGKPLVVLANIFQHSAQVLVARQQSPLQGVHDLAGKTLMLE
FT                   DGADELVAYLTQEGLTPDKYRTITHSANHEDLLNGRVDAMSAYSSYELYHFRQAHQPLQ
FT                   IYTPRSAGIDFYGDNLFTSSKLIRRNPRLVDNFRDASLRGWQYAMANPEDIIALIMLRY
FT                   TSQHSADFLRAEAEHMQALIRPDLIEIGYSNPGRWRHIADTYADLGLLPQGFSLDGFLY
FT                   QQGLGDNRTWFYAALTTLLGALVIFAIALHVYRVNSKLHNLVRLMRRADVQQRNHNHVL
FT                   ALIAADEPLEDILLSLVEGVEHLKPEMKCSVLLFDRKQQKFSVAAAPSLPDFYNQAIAH
FT                   LQAHDTAGSCGAAVATGKRVIVSNIQTHPNWEAYRQLAAQADLMSCWSEPILNRHGEAL
FT                   GTFAIYQHKVAEPTAEDIQLIEESAYLAEIAIERKQALEALRESEERHRMMAQHDNLTG
FT                   LPNRALFADRLQQALSYAKRHHKSLAVMLLDLDDFKPVNDTYGHALGDELLKAVALRLQ
FT                   EAVRASDTVARIGGDEFVILLHQIDSPAQARIVSDKIGQLLAQEFWLGEQSIHIGCSIG
FT                   IAYYPQDSSDARELTHIADQRMYEQKQLHHPS"
FT   gene            complement(402411..402851)
FT                   /locus_tag="CJA_0327"
FT   CDS_pept        complement(402411..402851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0327"
FT                   /product="cytosine deaminase"
FT                   /note="identified by match to protein family HMM PF00383"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83889"
FT                   /db_xref="GOA:B3PHD0"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:B3PHD0"
FT                   /protein_id="ACE83889.1"
FT                   /translation="MKDPFMQAALEEARKGRREGGIPIGSVLVIDGRIVGRGHNQRVQK
FT                   GSCVLHAEMDCLENAGRLKASDYRRATLYSTLSPCDMCSGTVLLYGIPKVVVGENLSFQ
FT                   GPEAYVRSRGVELDIRDDAECKQLMQDFIAQQPALWNEDIGE"
FT   gene            complement(403031..404485)
FT                   /locus_tag="CJA_0328"
FT   CDS_pept        complement(403031..404485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0328"
FT                   /product="Response regulator receiver domain protein"
FT                   /note="identified by match to protein family HMM PF00072"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84698"
FT                   /db_xref="GOA:B3PHD1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B3PHD1"
FT                   /protein_id="ACE84698.1"
FT                   /translation="MPIKTALIVDDSTTAQYRLKKMLRPYNLHIDAVDSGEAALRYLAS
FT                   KVPDVIFMDHLMPGMDGFRALQIIKSHPETAMVPVIMYTAKSGDVYTGQARALGALDVV
FT                   SKDTINATDLSKVMQAIHLYPESSKPAVKGDGIESPELIAAANQVSDMPINDRVTDADY
FT                   PFIERRAPNQAIIDQARNLELRLSHLEHSLEDNRRVITSRVVRELQGLRQNIRKEFNDV
FT                   LANAPAVTHTPPASPPPPPDAGSGPPAARSNKGYGVALILVLLLLAVALYYLISMNRHL
FT                   LDTQAQQQEIRTQLSSLQSPREPDMVSPALQNLARAQQFDAQQYSNRAFLDDLSWAFNQ
FT                   SGAIPFRQNTLDPRSAVRIYEFILRLLDKGFVGAIHLDVFVGDFCLLLDPMGQGELAAP
FT                   DSTLANCLLSNEAYNLDRIRDNYTRELEDALDNLIRNQDGRLSVSINSYLGPETYPERL
FT                   PIVSAGDWNAIAQRNNRIEIRLEPLY"
FT   gene            complement(404574..406337)
FT                   /locus_tag="CJA_0329"
FT   CDS_pept        complement(404574..406337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0329"
FT                   /product="putative dual serine/threonine-protein
FT                   kinase/phosphatase"
FT                   /note="identified by match to protein family HMM PF00069"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84098"
FT                   /db_xref="GOA:B3PHD2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:B3PHD2"
FT                   /protein_id="ACE84098.1"
FT                   /translation="MQHRSARLLIVYYPAMDHLQSPLHISFAQKSDAGHKPENQDTVGA
FT                   RLPDGNLLTTKGIAIAIADGVSSSKAAREASQTAIAGFLNDYYATPDTWSTQQSAMRVI
FT                   QALNSSLWGRSQNSIYGEGYLTTFSALILKGASAFIFHVGDTRVYRLRDQHLELLTRDH
FT                   TQRIDKHTTHLSRAMGADPYLEVDMHSLELHAGDLFILTSDGIHEAMPPQELRQLAINQ
FT                   RNRLEVLVDQALQLALYHQSDDNLSIQAVSIENLGTAGQDDTLQVLSRLPFPPVLSPGQ
FT                   ILDGLRIKKILHESTRSQVYLVEDDQKNLLAMKTPSELFLDDPAYIERFVMEAWIGARI
FT                   HSPGVVRVMAAPESRSCLYYLTEYIPGPTLAQLLKERGILSIVDAVELIESLLRGIRAF
FT                   HRKETLHQDLKPDNIVVGARGPVIVDFGSCWVASVQEAGAPIARDHILGTLDYSAPEYR
FT                   YGATPGTASDQFSLAVLLYEMLTGKLPYGTGYSKAMDLKSFQRLAYIPAMKHNPLVPYW
FT                   LDKALEKALSINPNHRYTALSEWLQDLKRPNPLWLTPRAQPLLERDPLKAWKVIAISGW
FT                   ICALVALLWRG"
FT   gene            complement(406354..407829)
FT                   /locus_tag="CJA_0330"
FT   CDS_pept        complement(406354..407829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0330"
FT                   /product="nitrate permease"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85378"
FT                   /db_xref="GOA:B3PHD3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B3PHD3"
FT                   /protein_id="ACE85378.1"
FT                   /translation="MSAFRLNLLDFSNKSVATLHFTWFAFFLTFVMWFSLPPLKPLITA
FT                   SLDLSAQQWAALLTLNVALTIPARIVVGSLVDKFGPRAIYTLLLAVSGAILIAFALAQT
FT                   FEQLALFRFLLGFVGAGFVIGIRLVSEWFPARQVGLAEGIYGGWGNFGAAAAGFTLPFL
FT                   AIHVYGGEDGWRYAMITAGVIAMLYAVCFYLSVRNTPKGSTYFKPKKSGGLEVTSKKDF
FT                   VFYVLMNVPMYLILAVLAWKMSPTNLGLLSTATTYVLYVVLLGLFAFQFAQIYRVNKEM
FT                   LKQGAAEHDKYEFKQVAILSWAYLATFGSEIAVVSVLPAFFMSTFEGLSVTQAAMLGGS
FT                   FAFMNLIARPSGGWVSDKCGRRISMSVILAGVTLGYLLLSQINAGWPLYLAFAAVFTCS
FT                   LFVQAGCGAVFAVVPLIKRRMTGQIAGLAGAYGNVGALFFLTMNTFIDIHSFFYMLAGA
FT                   AAIGLVFVQFLKEPRGHVVEVNEDGTLHKIEVS"
FT   gene            407820..408005
FT                   /locus_tag="CJA_0331"
FT   CDS_pept        407820..408005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0331"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83032"
FT                   /db_xref="UniProtKB/TrEMBL:B3PHD4"
FT                   /protein_id="ACE83032.1"
FT                   /translation="MRSWKRIQTNHKKSDDYGIAAGKSLFGALAQWNACYRDVCNGYAN
FT                   PQKVHFLMVNWRLNSE"
FT   gene            complement(408343..408711)
FT                   /locus_tag="CJA_0332"
FT   CDS_pept        complement(408343..408711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0332"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83662"
FT                   /db_xref="InterPro:IPR001826"
FT                   /db_xref="UniProtKB/TrEMBL:B3PHD5"
FT                   /protein_id="ACE83662.1"
FT                   /translation="MQIKTPELAISYRHNALGNRVTKLINGQVVEQYLWKDLTRLLVVY
FT                   DGQGNLKQRFEYTLGRTPTSFTQSGQRYFIQTDHLGSPRVITDNSGNIVKTISYDSYGN
FT                   IIEDSNLNSKSRLALQVD"
FT   gene            408981..409427
FT                   /locus_tag="CJA_0333"
FT   CDS_pept        408981..409427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0333"
FT                   /product="IS5 family transposase, orfA"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84721"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:B3PHD6"
FT                   /protein_id="ACE84721.1"
FT                   /translation="MELTQQQWEMVKPYLPQHDVIQQGKGRPRVDSRHILEGILWVLRT
FT                   GAPWKDMPSRYPSYQTCHRRYQEWVENGVLENILRGLLADLESRGKIDLSEVYIDGSFA
FT                   SAKKGALALVKQSAAKGARSWQLRIATVFLSDYSLEVLRRMKSL"
FT   repeat_region   409538..410785
FT                   /note="RPT5A"
FT   gene            409605..409904
FT                   /locus_tag="CJA_0334"
FT   CDS_pept        409605..409904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0334"
FT                   /product="IS3 family transposase, orfA"
FT                   /note="identified by match to protein family HMM PF01527;
FT                   match to protein family HMM TIGR01199"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACE86261"
FT                   /db_xref="GOA:B3PDH0"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B3PDH0"
FT                   /protein_id="ACE86261.1"
FT                   /translation="MTKQTRKKYTPEYKLEAIALVRDQGFSIGEAAAHLDINHNMLRRW
FT                   LKEHEAQPFSDYQGKAGMTPEQKRIRELEKQVRELQLDNDILKKASSYFAKHMR"
FT   gene            409901..410755
FT                   /locus_tag="CJA_0335"
FT   CDS_pept        409901..410755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0335"
FT                   /product="IS3 family transposase, orfB"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83549"
FT                   /db_xref="GOA:B3PDG9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B3PDG9"
FT                   /protein_id="ACE83549.1"
FT                   /translation="MRFAFIREHASRCRVKHLCRMLSVSRSRYYEWLGQQQDKPDPEQQ
FT                   RLETCMRALFVESNSSMGSRRMARRLQAQGFAAGRYRVRRLMKKRGLVVKQKRKFRITT
FT                   NSNHKLPVAENILDRQFNPVTPNQAWAADITYIWTVEGWLYLAVVIDLYSRRVVGWCMD
FT                   KRQTKSLVIRALMMAVNMRKPSAGLIHHSDRGSQYASLKYQASLKQHGIVCSMSRKGNC
FT                   WDNAVVERFFSSLKREWIRDNLYRYREDAIRDVRAYIVTWYNSRRPHSTLGYKSPIEFE
FT                   KCA"
FT   repeat_region   410833..413181
FT                   /note="RPT2L"
FT   gene            complement(410842..412407)
FT                   /locus_tag="CJA_0336"
FT   CDS_pept        complement(410842..412407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0336"
FT                   /product="IS66 family element, transposase"
FT                   /note="identified by match to protein family HMM PF03050"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82725"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:B3PCE3"
FT                   /protein_id="ACE82725.1"
FT                   /translation="MWMENKPDLLQENIDLQKIVADKDDIISAQEKSLQNKEKRIRILE
FT                   EYILSLQQKQFGSSSEKQDVIQSELVFTEAEDTAEAEVPEQADAFADATVVAEHKRKKK
FT                   RASIPKELPRIEIIHDLPEGQKCCPHDGAELKPIGFESHEQLDIIPASVRVLHHKRLKY
FT                   ACPCCENYLVTARKPSQPIEKSIASPGLLAHIATQKYVDALPLYRQTEIFKRIGVEMDR
FT                   TTLANWMVRCGAIVQPLINLIHERMLEQAILHADETRVQVLNETGRAAETQSFMWVLRS
FT                   TQPACAAVLYHYDPTRSGKVITELLHDFDGALMTDGYAAYNAPCEKNSITHLACWAHAR
FT                   RKFIEAQKIQKAGKTGKADQAIAFIQQLYGIEKSIKDKTPEEKYQLRQTQSLPMLQKIK
FT                   AWLDKSIAHALPQSLIGKALHYLHEQWPKLICYVESGDYPIDNNAAENAIRPFVIGRKN
FT                   WLFSASPKGAAASANLYSVIETAKANGLEPYTYLRKVFSELPQATSLEQIEALLPWNVK
FT                   SGVD"
FT   gene            complement(412440..412790)
FT                   /locus_tag="CJA_0337"
FT   CDS_pept        complement(412440..412790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0337"
FT                   /product="IS66 family element, Orf2 protein"
FT                   /note="identified by match to protein family HMM PF05717"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84805"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:B3PCE4"
FT                   /protein_id="ACE84805.1"
FT                   /translation="MIQWEDVPVYVHRLPVDFRKSINGLSVLVQESMGLDAFSPAVFVF
FT                   GSRSRNKIKILYWDKTGFCLWYKRLEKDKFKWPRRGDAVLSLTHEQFDWLLRGLDIEKL
FT                   QPHTEKYFFSAN"
FT   gene            complement(412787..413101)
FT                   /locus_tag="CJA_0338"
FT   CDS_pept        complement(412787..413101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0338"
FT                   /product="IS66 family element, Orf1 protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85690"
FT                   /db_xref="UniProtKB/TrEMBL:B3PCE5"
FT                   /protein_id="ACE85690.1"
FT                   /translation="MKKRTRDQWQELFTQHNTSGVSAAEFCKQHNLCPKYFSLRRKQLV
FT                   RAVGNMETGFVRVNVKPETKPGVSGVMTSALVIHSNAGKLEFGVLPPPQWLAHWLRELA
FT                   "
FT   gene            complement(413272..413619)
FT                   /locus_tag="CJA_0339"
FT   CDS_pept        complement(413272..413619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0339"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83788"
FT                   /db_xref="InterPro:IPR001826"
FT                   /db_xref="UniProtKB/TrEMBL:B3PHE2"
FT                   /protein_id="ACE83788.1"
FT                   /translation="MPEIGRENSRLQKNINTCYCHNALGNRVAKLVNGTVTEQYLWQDL
FT                   TTLLATYDGSGNLKQRFEYTLGHTPTSFTQSDQRYFIQTDHLGSPRVITDSSGNIIKTI
FT                   SYDSYGNIVNA"
FT   repeat_region   413334..413549
FT                   /note="RPT8C"
FT   gene            complement(413574..413897)
FT                   /locus_tag="CJA_0340"
FT   CDS_pept        complement(413574..413897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0340"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85362"
FT                   /db_xref="GOA:B3PHE3"
FT                   /db_xref="UniProtKB/TrEMBL:B3PHE3"
FT                   /protein_id="ACE85362.1"
FT                   /translation="MKLEEKFDKKFYNRQTNYAFLYVIFLIVLTIIFVWTLFFKNLAEL
FT                   KIFLLENLSEESANLIFNLIKNMFSSFILSLLPFFIIPSLWLLVASYRCQKLAEKIADY
FT                   KKT"
FT   gene            complement(413922..415607)
FT                   /locus_tag="CJA_0341"
FT   CDS_pept        complement(413922..415607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0341"
FT                   /product="Rhs family protein"
FT                   /note="identified by match to protein family HMM PF05593;
FT                   match to protein family HMM TIGR01643"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACE86231"
FT                   /db_xref="InterPro:IPR001826"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="UniProtKB/TrEMBL:B3PHE4"
FT                   /protein_id="ACE86231.1"
FT                   /translation="MTFNGVNLIETETRPAPETTQYNYNRDRQLTEIKLPSGETLHYIY
FT                   QEGRLAHLQTPEGDTHYRYQQGDQLHEIQQGSEKVNYSYDGTLLTQQTYQGQLNATINF
FT                   GYNTDFRVNNLSYAGGNTSLSYDKDGLLTGIHGFTIEHHPNNGLPQRLSRGQWNKNWQW
FT                   NAYGETISVNYRWGSQANFGYDLEYNLTGQIVRKTEYLPDGSTATFDYTYDNRYRLTEV
FT                   KRNNEIVEAYGYDANGNRTLHTSVDMGITNQSATYTQGDQLQNHGNTTYLYDANGRLGS
FT                   KLKATDDGLALTTYIYGSQGQLLQVDTPDKSIRYLHNALGNRVAKLVNGTVTEQYLWQD
FT                   LTTLLAIYDGSGNLKQRFEYTLGHTPTSFTQNNQRYFIHTDHLGSPRIITDSNGNIVKT
FT                   VSYDSYGNIIEDSNPEFQIPFGFAGGLKDDDTGLIRFGYRDYDPETGRWTARDPIGFEG
FT                   GDTNLYGYVLGDPINWVDIDGLAPAWVGPVAAVTAVVGGALIAYGGPVAPFGLGLVLIA
FT                   GGLTIWDWATTPEEQIKEIQPKLDSLQEKIDKLQDAIDKANSCH"
FT   repeat_region   414229..414872
FT                   /note="RPT8A"
FT   repeat_region   415243..415538
FT                   /note="RPT26A"
FT   gene            complement(415626..416315)
FT                   /locus_tag="CJA_0342"
FT   CDS_pept        complement(415626..416315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0342"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83307"
FT                   /db_xref="GOA:B3PHE5"
FT                   /db_xref="UniProtKB/TrEMBL:B3PHE5"
FT                   /protein_id="ACE83307.1"
FT                   /translation="MNEKIIFIAAISELFSLYFFIKILNSRDSLLMKVILSILVFIPII
FT                   GTIFYFLAANSPPPQPYSLQNKGDPYSNVPMRGEYTDRWQSKMEIMRWEMSNLKEEMDF
FT                   YNEAWKEDKTETAVGIHIIFPDGKHDHISDKLDLEIIEKEIKKLDWHSNFYQFIVVIKP
FT                   GISMEVGGSLNGVDGLSAMYRNRINRVDAVIRTPPEDVSEMQKILKVFLMPGEEWRKKY
FT                   EFNFTHY"
FT   gene            complement(416340..428336)
FT                   /locus_tag="CJA_0343"
FT   CDS_pept        complement(416340..428336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0343"
FT                   /product="RHS Repeat family"
FT                   /note="identified by match to protein family HMM PF02368;
FT                   match to protein family HMM PF05593; match to protein
FT                   family HMM PF07603; match to protein family HMM TIGR01643"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83291"
FT                   /db_xref="GOA:B3PHE6"
FT                   /db_xref="InterPro:IPR001826"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR011460"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="InterPro:IPR031965"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:B3PHE6"
FT                   /protein_id="ACE83291.1"
FT                   /translation="MSDNFMKPNRLTYNKRDLIVSCFLLISFLFCTTSHAQTWTETYFR
FT                   GTPNNWGATPMMFNITNGLWETQQTFSGTTPRFKISRFTNNWNEAYPAQDYTITGGEGE
FT                   YTITFNDATKAISATKLATIPSANLICYNNPSHHANPTIYFWNPSPAGSVTPLPNWPGQ
FT                   AMSQYGNFYCYNLSPLLNNDTMPASLQVIFSNSGSQQTANLTYTGTGCYENGTWKNLSA
FT                   CGLVNTSSSSSSSSSSSSSSSSSSSSSNTSNSSSSSGASSSSSQITSTSSSSSSSLNIP
FT                   SSLSSSSLYATNDHRICYRTPANHTQPTIYFWAPSPAGSVTPLPSWPGQAMSQSGTLSC
FT                   YDLSPLLNNNLMPSSLKVIFSNNGSQQTADLTYNGTACYDNGIWKSLLACGLSSNSSSS
FT                   SSSTSSHSQSSSSAAISSNASTSSTSSNLPTTDNRICYRNPANHTTPTIYFWNPSPAGS
FT                   VTPIPTWPGRSMVRDGNFYCYDFSENLSNAQMPVSMGVIFSNNGTAQTADLTYQRDAAC
FT                   YDNGIWKSLQQCGLIITSSSSMSVSSSSHSASQSSTSSSSSVSGRPMVANTNVCYDNPD
FT                   NHINPTIFFWQPEPSDRLIALPSWPGYAMTKQGKFYCFDFKPLLKDGYMPDSLSIIFSS
FT                   NGQNQSPDLRFNNRGCFDQGTWKPLLACDFSETGSSSSTSSAAPGQPFITSVPEPFAYI
FT                   DNPYFYTVTATAENSLIFTLLSAPTGMAINYITGAIEWRPTSNQQGEHTVSIAVTNNEL
FT                   TSTQTFTIAVVEPPLTLFPKANAQSVDLTWHDIGAESYNVYISSSSNCDVNHYMLCPDG
FT                   ALISNITSPYRVTDLKNGKNYWFILEAISNGTISRAPMAGARPDQLIANNTNFYPDYTT
FT                   VQALATADDGTLYMGGDFTEIGVRTGHGVGINRKTGFAEAFPYVNGEINAVVSDGTGGW
FT                   YIGGTFSYVDNKPRHNLAHIRADGTLGDWAPQFGYPEGSRISALAVDKGIIYIAGQFSH
FT                   IEGLARNGLAAIAANGSLTDWNPNANPLYSDYNFLALTIADDVIYIGGYFRSISQTERL
FT                   NIAAIGADGIVKNWHPRVGSHSLTPVRTLAVHNDVVYIGGSFSRVNNIDRLDLAAVGTD
FT                   GTLIDWNPGFYFLPGYDSFINALAIENDTVYVGGRFRSINGIDRWYLGAIGTDGSLKDW
FT                   SPVAGGEFLQSEGSWPNIRSLVIADNTIYISGRFTSINGIPRSHIAALGLDGSLKPWSP
FT                   KAGNVINAMAIAGNTVYVAGALTLINGTPRQGLASINTDGTLTDWNPTSEANFNPVAAL
FT                   AILDDTIYVGGRFTRINGTERMHLAAIKTDGTLTDWNPGVEETYWDSITSIAIVNDTIY
FT                   VGGNFSRVGSQERNRLAAIGLDGSLRPWNPSANGRVWALTAEGDTIYAGGDFTHINGLE
FT                   RNHLVAIKTDGTITPWNPAVTGAQSKAISALDINNGLVYAGGNFTAINGINRRGLAAIN
FT                   PDGTISDWGPVVTARYPNPLLINALSVVNDTVFVGGEFESINTLPRINVAAIGIDGTLN
FT                   QWAPHTIADKTTHRTSHRQIYALAISDKAVYAGTLSNRNPTGSTDGFKILDLPKQPPVI
FT                   QSTPVSSTLTGITYHYQVAAEDPQHSQLNYALANAPPGMLIETQTGLIQWLPQPHQVGS
FT                   HAVSVTVTNTFGLTATQQYTLDVEPHLYAVITPPQSPLPAGASITLDGTGSSNSHGNIS
FT                   AYRWTRLPDSAVLSTETTLTLTQLPVGHHQYQLEIEDSSGNTAKTQASFVVGYKPLAVA
FT                   PEYTHGYAGTEIFIDGQSSSIEQGSLSYQWFIDGELISGEARFPLSLPEPGIYTLELVI
FT                   TSELGLSDSRTINVEILADLHNQFACAYQPANDDYSYIDKYPHDNIPWHGGWAESVLEI
FT                   QRAFNHARLRDPSVNQYLIMPEQSIWDAMPLPQKGLYLINAERAARGLKPYSGYDAAMN
FT                   QVAQSYAEYIRSNNQVIGHFNDNRTPMQRMRTNTYIDTHAETFISLPESLASTTALNRP
FT                   DNEVYALVRAIYGWLYQDKDWFIAFGLSEGTPWGHRNQLLQTGLHENHNDAHSEGVIGF
FT                   GLAHGLYRPGSTSPTTHGAVTVFKTIDQSPSWDNTRIHTADISQAQGCLPYRLDIAQDD
FT                   PLVAGLERLTIYPSSLHLAVGQTAALSITGWYQDGSQRDLTTLGQFAADGYAVASVAQG
FT                   QVSALRTGPARIYARVAGIESNRLHLNVGEATDSSPLIGTPAASLRPYIAENATAVNFN
FT                   PLAMAVFTGLVTDRYGTPIPNTKVSLLQAPDYGSMTTDSDGRFILAGPAGEQTIVYEKE
FT                   NHLVLQRTTVAASNSWAAVETVVLLPRDTQKTWIDLSSGTAQVHQSSTITDAFGERKAT
FT                   VVFNGISSAVIRSADGSQRPLEQFLFSATEFETPASMPGELPTETAFTWASDLHIDGTH
FT                   YTDTVQFNGHVVMYVDNFLNFPVGEIVPIGYFNRLSSRWIASSNGVVVRLLDQDGDGLV
FT                   DGVDYNDDGLADDLNNNGSTLDEAIGLANYSAGTTLWWGSFTHMTPYDYNWAAADAEAP
FT                   EPVDTELEAEEEKDTECEATGSFFKPYRQSFHEDIRIAGTDIRLHYTSQRTSGYHHKLR
FT                   VAVSGNDIPASLEKMIARLEIAGRVFEQEFDPAPNIEAEFIWDGTHPDGTRAQDLVSGR
FT                   VSIGFEYQTFYLSAGNAATEDQPLENFPVAWATLSDRVTQVPGRENFIAWQQRGITVKN
FT                   TYERQLAEGWSLSSVHEFDPKGTVYLGNGEVVDVATPSLILKTGQTFSHLDKDDGYYQA
FT                   GGKNIDYAVNDENILVDRVTGLEWQYLQPRALFRTTDKQAAINYCANQAEPRNSGWRLP
FT                   TEKELGYSIDKSGRGAGHIIYSLTQARNIWTQLTLNTEQRELIAICVRGTPLNETTVND
FT                   LIRNSTDNVVVDKANGLMWQDTSANTQLKLNWEAGIHYCESLDHAGYHNWRLPNINELL
FT                   YLLPNQVFEHQTHFPANTPWTITAPERKPYWSSTTNAQNDDQAWAIESIAFNSERFNKL
FT                   DSYHVRCVREDGTTARMPYRFNSNGQHTATIDMLSGAKRNTLDYNEQGELSRIADQFGN
FT                   TLHIERNSQGTPVRIIAPNGQVTWLNINAQNQLTQITYEDGSHYRFNYQDGGLLTEKID
FT                   PRNERFTRHYNAIGRLSWSSDPMGGLWQLFDERLPDNTSRYGYTTAENNRHQTTRQKLE
FT                   NGDIQTIQVTKTGGQHTQLTSADGLSETSSAYGMTTHIHYVLDEKSLRPVPNLVTVSTP
FT                   SGLTNITHLTKTYAENGADTSRYTLVTENNSNTSTTQVDGRAGIHSFTSAEERSNTTYS
FT                   DPQTLLTQRTQVSGLHDTHYEYDNRGRLTKTRTNTRAIHYAYDAFGNLSEITSADGRKT
FT                   HYEYDLLGRVTRITYPDGHSTQTRYDANGNATKVIVPSFAEHDMTFNGVNLVETETRPA
FT                   PETTQYSYNRDRQLTEIKLPSGETLHYIYQEGRLARLQTPEGDTHYRYQQGDQLHEIQQ
FT                   GSEKVNYSYDGTLLTQQTYQGQLNATINFGYNTDFRVNNLSYAGGNTTLSYDKDGLLTG
FT                   IHGFTIEHHPNNGLPQRLSRGQWNKNWQWNAYGETTSVNYRWGSQVNFGYDLEYNLTGQ
FT                   IVRKTEYLPDGSTATFDYTYDNRYRLTEVKRNNEIVEAYGYDANGNRTLHTSVDMGITN
FT                   QSATYTQGDQLQSHGNTTYLYDANGRLGSKLKATDDGLALTTYIYGSQGQLLQVDTPDK
FT                   SIRYLHNALGNRVAKLVNGTVTEQYLWQDLTTLLAIYDGSGNLKQRFEYTLGHTPTSFT
FT                   QNNQRYFIHTDHLGSPRIITDSNGNIVKTVSYDSYGNIIEDSNPEFQIPFGFAGGLKDD
FT                   DTGLIRFGYRDYDPETGRWTARDPIGFEGGDTNLYGYVLGDAINFIDIDGLQRNTSNSW
FT                   NRHQQYYGGTGMTRSQLSQQYRADQLKQWASGRNPDLHWWLGNLPDNSQIQIVGSGGGT
FT                   SSLIFGYQHPWIEFLICECFRAAPQNYCAIPNSDGHSISGDPKHDPNCFCYTKRYVKLG
FT                   "
FT   repeat_region   416782..417425
FT                   /note="RPT8B"
FT   repeat_region   417796..418091
FT                   /note="RPT26B"
FT   gene            428711..429667
FT                   /locus_tag="CJA_0344"
FT   CDS_pept        428711..429667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0344"
FT                   /product="gluconolactonase precursor"
FT                   /note="identified by match to protein family HMM PF01436;
FT                   match to protein family HMM PF03758"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83490"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="UniProtKB/TrEMBL:B3PHE7"
FT                   /protein_id="ACE83490.1"
FT                   /translation="MPHHSTAWQFHIYSEVDMTQHIKTILFFSSLFGAAAMAGGVQVQT
FT                   QDFVGDGVFTAGIEGPAVDAQGHLYAVNFAEEGTIGVVDPHGNARLLLKLPEGSTGNGI
FT                   RFGPDGVMYVADYTGHNILKIHPRTLQVAVYAHSAAMNQPNDIAIARDGTIYASDPNWS
FT                   DSTGNLWMIAPDGKVTLLEREMGTTNGIEVSADEQRVYVNESVQRKVWQYDRDPKTGKL
FT                   ANKRLLIEFPDHGLDGMRSDSQGNLYIARYGAGVIAVVSPAGDLLHTISLKGEKPTNLA
FT                   FGGEDGRRVYVTLQDRGAIETFTAPHPGREWALWRRD"
FT   gene            429921..431216
FT                   /gene="dsd"
FT                   /locus_tag="CJA_0345"
FT   CDS_pept        429921..431216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsd"
FT                   /locus_tag="CJA_0345"
FT                   /product="D-serine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84565"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR026956"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="InterPro:IPR042208"
FT                   /db_xref="UniProtKB/TrEMBL:B3PHE8"
FT                   /protein_id="ACE84565.1"
FT                   /translation="METENNLQKRLAQRPLEPVHKGLGALPAGTVARAVGHVGSLGWNL
FT                   LREDVSLPVAVLSDVRLRHNLGWMESFIRTYGLKLAPHGKTTMSPALFHWQLEQGAWGI
FT                   TLATAAQVQAAYQFGIKRVILANQLVGRANMAILSRLQEDANFECYVLVDSPVNAARLG
FT                   RFFSERGQQLHVLVELGVEGGRSGVRDAAALESLLTEIGRWPQSLFLAGVEVYEGVLGD
FT                   EAAIRQFLRRALDVLRELDERGLLKSDRPLLTGAGSAWFDLVAEEWAGLDLGRPVDIVL
FT                   RPGCYLTHDVGIYRAAAERIQSHNPVARSMQRGLLPALQLWAYVTSMPEPGLAILGLGK
FT                   RDAAFDAGLPVPALHFRPGDMPAPVPAPVQWQLVKMMDQHAFMQIPATADVQVGDMLAL
FT                   DISHPCLTFDKWRQLLIVDDHYQVVDAVETFF"
FT   gene            431225..432580
FT                   /locus_tag="CJA_0346"
FT   CDS_pept        431225..432580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0346"
FT                   /product="gluconate permease"
FT                   /note="identified by match to protein family HMM PF02447;
FT                   match to protein family HMM TIGR00791"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85078"
FT                   /db_xref="GOA:B3PHE9"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:B3PHE9"
FT                   /protein_id="ACE85078.1"
FT                   /translation="MESVLSPGHWLLVYALVAIIALILLIARYRLNPFISLTLVSLGLG
FT                   LVAGMPAKDLVFAYEAGVGKTLGHIALIVALGTMLGKMMAESGGAEQIARTLIGWFGEK
FT                   NVHWAMVFIAFIVGLPIFFEVGFVLLIPIAFNVARRTGTSMLLVGLPMVAGLSVVHGLV
FT                   PPHPAAMIAVGEYQASVGRTIFYALLVGIPTAIIAGPLFAKWIAPRVQLPAVNPLEAQF
FT                   IHESRERELPGFGITLFTILLPVVLMLLGGWANQIAAPGTALNDVLLVVGNSVVALLIA
FT                   TLVSFYTLGIARGFNRDSILKFSQDCLAPTAGITLLVGAGGGLNRILVDAGIAKEIVAF
FT                   SSGIALTPLLMGWFVAALMRIATGSATVAMSTAAGIVAPIALAANYPHPELLVIATGAG
FT                   SLILSHVNDGGFWLIKEYFNMTVTQTLKTWTVIETIISVVALGFVLLIASFL"
FT   gene            432577..433461
FT                   /locus_tag="CJA_0347"
FT   CDS_pept        432577..433461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0347"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="identified by match to protein family HMM PF01380;
FT                   match to protein family HMM PF01418"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACE86239"
FT                   /db_xref="GOA:B3PHF0"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B3PHF0"
FT                   /protein_id="ACE86239.1"
FT                   /translation="MRKNMTALFDIVYHIRSNRDRLSATEQKIADIILDDIAFAAAASI
FT                   DQLATKASVSIATISRFAKAVGCEDIRDLKLKLAQASAVGTRFLADVPVVEESAFYARI
FT                   CSEVESTLRANLARFVEADFRAGANALNSARLIYVGGMGGGSTMLADEVQYRIARLGLP
FT                   VTAYHDPVLLRMLAATLTEKDVLVLLSVTGVTPELLEVADIAREYGAQIIAMTAPQSPL
FT                   AEKANVLLPVMTEETDFIFKPSASRYGVLLAVDILATELALLRKQESKELLRRVKFALD
FT                   EYRGGDNRLPLGD"
FT   gene            433418..434941
FT                   /gene="ndeD"
FT                   /locus_tag="CJA_0348"
FT   CDS_pept        433418..434941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndeD"
FT                   /locus_tag="CJA_0348"
FT                   /product="N-acyl-D-amino acid deacylase family protein"
FT                   /note="identified by match to protein family HMM PF01979"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82777"
FT                   /db_xref="GOA:B3PHF1"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR023100"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B3PHF1"
FT                   /protein_id="ACE82777.1"
FT                   /translation="MNIGVAITAYPWAIKDVCVIYEWVIRQAHIIDGSAQPSYRADLAI
FT                   TAGKIAAIGNLSGVQAQREIVASNWVLAPGFIDVHTHDDLQVIRNPDMLPKVSQGVTTV
FT                   IVGNCGISASPVVLQGELPDPMNLLGAVEDFSYADLASYARAVNEIQPAVNVAALVGHT
FT                   ALRNNHMDRLDRAATAYEIAQMRAQLHLALEQGALGLSTGLAYASAIESTTEEVQALAE
FT                   VLREQGGVYTTHLRTEFDGILDAMEEAFAIGHSVNAPVIISHLKCAGAGNWGRSKEVLG
FT                   ALETAARKHWVGSDCYPYSASSSTLDLQQVTRDFDIVITWSEPHPEQGGKTLAAIADEW
FT                   QTSLMDAARRLQPAGAVYHGMNEQDVQAILAHPLTMVGSDGLPVDPLPHPRLWGAFPRV
FT                   LGHYSRDLQLFSLTEAVYKMTRLSADRFGLDNRGRIEVGAAADLVLFDPLNVRDTATFA
FT                   APQQLAEGIEAVWVNGILTYCNKAMTGQRAGKFLHRQRDLRKGFFLFNE"
FT   gene            434950..435339
FT                   /locus_tag="CJA_0349"
FT   CDS_pept        434950..435339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0349"
FT                   /product="Endoribonuclease L-PSP superfamily"
FT                   /note="identified by match to protein family HMM PF01042"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85394"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:B3PHF2"
FT                   /protein_id="ACE85394.1"
FT                   /translation="MSDIKRYGVEGGKGTGGQHLPFARAAGADGWLFVSGQVPMVKGEI
FT                   VEGGIVTQSHQAINNMLAILAEAGYGPEHVVRCGVWLDDPRDFMSFNRVFMEYFGANPP
FT                   ARACVVSSMVVDCKVEVDCVAYKKP"
FT   gene            435336..437747
FT                   /gene="hex20A"
FT                   /locus_tag="CJA_0350"
FT   CDS_pept        435336..437747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hex20A"
FT                   /locus_tag="CJA_0350"
FT                   /product="N-acetyl-beta-hexosaminidase, putative, hex20A"
FT                   /EC_number="3.2.1.52"
FT                   /note="identified by match to protein family HMM PF00728;
FT                   match to protein family HMM PF02178; match to protein
FT                   family HMM PF02838"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84946"
FT                   /db_xref="GOA:B3PI11"
FT                   /db_xref="InterPro:IPR015882"
FT                   /db_xref="InterPro:IPR015883"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025705"
FT                   /db_xref="InterPro:IPR029018"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI11"
FT                   /protein_id="ACE84946.1"
FT                   /translation="MKYLLPVLLLVLPFTLVNAADLPLLPYPHSVIQQSGQFLAGNQWN
FT                   LVIKGKQTAELKTALERFRQRVTLQTGKTIRFVKGREKNAHLFIHIQSSEVIGNSLSSM
FT                   DESYRLQVRPGRIELHAEQLVGVVRGLETLLQLVGLQRDVLALPLVDIQDKPRFIWRGL
FT                   LLDSSRHFFSVASIKRQLDIMAAAKFNLFHWHLTDDQGWRLESKKFPRLQQFASDGQYY
FT                   TREQVRDIVAYARDRGIHVLPEIDIPGHASAIAVAYPELMSAPGPYAMEYRWGVHKPTL
FT                   NPANERVYEFVDQLIAEVVELFPFDYVHIGGDEVDPQHWQENADIQAFMQANGLVDHLA
FT                   LQAYFNQRVQKILSQHKRNMIGWDEIQHPDLPNNIVIHSWQGPDGVSNAIRHGFNAILS
FT                   TGYYLDQPQTAAYHYRQDPLPQPPFRIDAPAVGESWQSWSFTLPRQRGRPVSGSFTLLD
FT                   DGKQTRGFIDFAGKSRREVKVHRYTKNRAQFSLDTWMGPVEFDVNMDQRLGGKAWVGNV
FT                   AYPVSGKQIAGSNHAQTGLPEPQVAPYVLRAEDYARVLGGEVALWSELVDEGTLDLRLW
FT                   PRALAVAERLWSAQDRRDEVDLYQRLETTMTWARMSVGVQDQQQREIALRRLAAGAGIE
FT                   PLAIFSEALEPAHYYHRQHQKSVSETYSKADHLNQLVDALPAENNFKQNQLAIFENELS
FT                   VLDENDKKYLRKSLKTAFEKWNKNYQPLLDLVQKRKDLQGLLPLAERLNVLSELAMELL
FT                   RNCEASTTLSPAQIVKAQAAVDQAKTMDQEMVIGAAWVVEKMLQSDAYCP"
FT   gene            437776..437886
FT                   /locus_tag="CJA_0351"
FT   CDS_pept        437776..437886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0351"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84033"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI12"
FT                   /protein_id="ACE84033.1"
FT                   /translation="MQIDNVVLWGVLLPEPVGIPVNPLGLQAVARQDKNN"
FT   gene            437915..439087
FT                   /locus_tag="CJA_0352"
FT   CDS_pept        437915..439087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0352"
FT                   /product="transcriptional regulator, AraC family domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84908"
FT                   /db_xref="GOA:B3PI13"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI13"
FT                   /protein_id="ACE84908.1"
FT                   /translation="MAEMAIFNLNDISLLFGGFLSLVVAVRLMLGQSEGPLVPHHGLLL
FT                   ALFFLLGTLRALDGMVNTNPALRQMLITWYPISVFGLGFIYFLQGPLLFWFARASFSQM
FT                   MNLTYKDALHLIPLLGYPFYLWFMGTNISAPVDPDFGNAAVAQKNAPAEVLIWAQHISL
FT                   FIYSLLCVSRLFEYQRHLKLLQLPSQKMDLQGLRLLLIGFLAINAWSFIILLDSRFLHW
FT                   LSPTLLGESTSHLLFIYMSVLIVYLLKNAQGFSDIQPEHKLNHALVSEEPQLQLVEKLQ
FT                   SFMESNKPYLEPHITVERLAIKLNVSPKLLSSTINNQLQMNFFELIGSYRVEEAKRKLA
FT                   DEQLRDLPIHEIMKHCGFSSKSVFNQAFKKAVGVTPSHYRQQYLGCRLAG"
FT   gene            439360..442629
FT                   /locus_tag="CJA_0353"
FT   CDS_pept        439360..442629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0353"
FT                   /product="TonB-dependent receptor"
FT                   /note="identified by match to protein family HMM PF00593;
FT                   match to protein family HMM TIGR01782"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85207"
FT                   /db_xref="GOA:B3PI14"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010104"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI14"
FT                   /protein_id="ACE85207.1"
FT                   /translation="MFESKKILAKLPQQRFKKSLLAVSIVALSSPVIAQVSSGNENLEE
FT                   VVVVGMRGSIETAQDLKRNADTVKDVITALDIGALPDKSVTEALQRVPGVTIERFASSD
FT                   DPKHYADEGTGVLVRGLDRVRSEINGRDAFSANPWGGLSYEDFPAELLGAVEVVKNQTA
FT                   DKISGGIAGTVNLITRKPFDSNEQLISFSAKANYGDFREEVTPSFSALFADSWETSAGK
FT                   FGFLIAGSKSEYQTRGDGVGMGNYHSRGKLDTFSYDEWGTPSPGVVAGMYSNPCIPGDP
FT                   GWRACGPGFEDTVVYSDEDAAAYVPLYDGTELPGQPEGTTWYAPANFHVSTAENDRERT
FT                   GFTTSLQWANADETIIATLEHINSKASLEWREYVIASGDRGFLAGNGNALQWSEDTENG
FT                   YDFSVDANGFLTSGIGRNTDPNFPLQFRSRYNYNENTVEDTSFNVTIKPTERLTASFDY
FT                   QHVDSEQIVHNYGLTSRINGNQTATYAPFYLDLRGSTPTIEFLNENVSYPADVAENTNP
FT                   ILRLASGMQQEIHNTAKSDSVKLDVQYDFDGVFTAIKAGVYYSDKDLNVADTEYEGWQA
FT                   LGTPWDAVDSYNASPQVAPHLFERVSFADQYNGKVIKGDYNSFLFPSMALTKNYIQTLR
FT                   DGCGTWSALGNAMDGSGKCAQPYEDLADRVDSHFAARHMSSTNEERTEFYVRGDFDFAE
FT                   LPVPIKGNVGLRYVGYQLESSGSVTLPATSRRGTSPDQSLYQVMQAQYPSLFALASGEA
FT                   VPSTVKGTDYNTVLPSLNLAFGVADDVVVRFGASKGLYFPSLLDTRNSMVVSLDYTEVL
FT                   QDPTEGKDETTNPVVDLTDIEISANARNAFLEPEESVNLDLTAEWYFAPAGSVAVGVFH
FT                   KKLSNIIRNKQFDLELEYAGTTYPVSAYGPDNTGSGTIRGVEFSYSQFYDMLPGAWSGL
FT                   GLQFNYTYIDQSGLEDPNTNPAEGLRYDGSGTPITDNRNSFRVFTGLPLQGYSDENLNI
FT                   VGMYEYNDIAFRLAYTWRSEYMLTMRESEEFVPAYAKAQGMMDASLYYTINENWKVGIE
FT                   GSNLLNAETKTQYQLNQDGVKTDALSFTTDRRYALSVRATF"
FT   gene            442666..444258
FT                   /locus_tag="CJA_0354"
FT   CDS_pept        442666..444258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0354"
FT                   /product="tryptophan halogenase"
FT                   /note="identified by match to protein family HMM PF04820"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82985"
FT                   /db_xref="GOA:B3PI15"
FT                   /db_xref="InterPro:IPR006905"
FT                   /db_xref="InterPro:IPR033856"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI15"
FT                   /protein_id="ACE82985.1"
FT                   /translation="MNKKRAALLLRAFFMVDKYLTRQIATMQKNTLNSICIVGGGTAGW
FT                   MAASLLSSALQGSHIKITLIESPDIATIGVGESTVPSMMEFLRVCRINLKEFVEATSAT
FT                   FKLGIRFDDWLKPGEQYFHPFGRVGQDINGFAFYQAWLKNSVDGYGTRWVDHSPSAIMA
FT                   EHQRFMLRPSQQQNWVLRSYGYALHLDAILVARYLRDFSQGCGVERIEATVDKVVIDER
FT                   QFIHTLALNNGITITSDFFIDCTGFKGLLIEEALKVGYEDWTHYLPCNRAVAVQTTNAG
FT                   TLPPFTIATAREAGWTWRIPLQHRTGNGYVYSSQYCSDDQAIHTLLTAVEGELLIEPRV
FT                   IPFATGRRKKIWHNNCLALGLAAGFLEPLESTAIHLIYKTLVHFIRYFPDQDFEVYTEQ
FT                   AFNQKINIDYQEIRDFIILHYCTTGRDDTEFWRWCQGMPVPDSLQEKICLFRARGQIEH
FT                   TPDQFFSQDSWCSILEGMKVRPKKYHPLMDAFDGQGLASTLQESAQSVYETVMQMPMHG
FT                   DYIQQHCAAKKMM"
FT   gene            444293..445309
FT                   /locus_tag="CJA_0355"
FT   CDS_pept        444293..445309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0355"
FT                   /product="Pass1-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83516"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR041667"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI16"
FT                   /protein_id="ACE83516.1"
FT                   /translation="MTAYKQIPEYRKLPAPQFFEEIAPEQQPVVIRGFTQHWPLVAAAQ
FT                   KTPHDFAAYLMRFYTGKKARIFVAPPAANKRFYYNDDMTDVNYMRGEERVDLFLGRLLE
FT                   LMDREIYPAISMQNSLPSEILPGLIDENKSEFFPDVEPRLWVGNEGIVSAHYDGADNIA
FT                   CVVAGRRRFVLFPPEQTGNLYPGPLNFTPAGAPTSMVDLNAPDFVRYPHFKTALANAWS
FT                   VELEPGDAIFIPMLWWHHVESLEKVNALMNYWWNGSSAKSSTPPSPIDSLNIALLAMRD
FT                   LTPRQRNAWRHMFDHYLFKQGIDPASYIPEHQQHVLGKLSPEYVRAIKDYFIDKLKK"
FT   gene            445322..446845
FT                   /locus_tag="CJA_0356"
FT   CDS_pept        445322..446845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0356"
FT                   /product="tryptophan halogenase"
FT                   /note="identified by match to protein family HMM PF04820"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84380"
FT                   /db_xref="GOA:B3PI17"
FT                   /db_xref="InterPro:IPR006905"
FT                   /db_xref="InterPro:IPR033856"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI17"
FT                   /protein_id="ACE84380.1"
FT                   /translation="MPNSELTKMTTMKKPEKILIVGGGTAGWMAANLLVSRWKDIDVCL
FT                   LESTEIGIIGVGEGSTPHLKFFFDAIDVADSEWMPRCNATYKNGISFANWSSIPGFESY
FT                   FHPFPAQTDDVFTVPFFFSNIKARMQGNNVNAHPDHYFLETYLTRANLGPIPAESFPFG
FT                   VAYGYHFDSGLLGQFLAEKAMSRGVKRILGTITEVVLDANGSLAAVRLDDDSLLDASFF
FT                   IDCSGFKSLLLQGALKATFKSFKENLFNNAAVVMPTAISEIIPPETRSTALSNGWAWKI
FT                   PLTNRYGNGYVYSTDYITPEQAEIELRQHLNLVDSDVAARHLQMKVGRVEKHWEKNCLA
FT                   VGLSQGFIEPLEATALALSFNTISLFMAHYEKGLYTNQFEDAFNKEVNAKFDSVRDYIV
FT                   CHYKVNQRKDTDYWKDNAANTYLSETLNQILYFWQRGGDFAKNMYMNNLVGSYQPKSWA
FT                   CLLAGYGVFPPLTSDAKAAQFKPVQDMEQLADFIRRCGLNFKQHNELLH"
FT   gene            complement(447137..449092)
FT                   /gene="gt2K"
FT                   /locus_tag="CJA_0357"
FT   CDS_pept        complement(447137..449092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gt2K"
FT                   /locus_tag="CJA_0357"
FT                   /product="glycosyl transferase, putative, gt2K"
FT                   /EC_number="2.4.1.-"
FT                   /note="identified by similarity to SP:P20401; match to
FT                   protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85536"
FT                   /db_xref="GOA:B3PI18"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI18"
FT                   /protein_id="ACE85536.1"
FT                   /translation="MSGTRMRSNPTRTINSEPESVSAFAIIDIPGQRARRYLFALLSLV
FT                   TTLGGVYTMFDILSANGLNTLETVLLVLFSITFGWISMAFWSAAFGFTLQMLRLDPLSL
FT                   KPLERGSDNSPIIARTAIVMPVYNEDTQRVIAGFEATLRSLEATGELAHFDFFLLSDTT
FT                   QPHIAQDELKAWQQLQARLGDIGKQCFYRRREKNIGRKVGNLSEFCQRWGANYEHMIVL
FT                   DADSLMTGNCLLSLVRAMQANPRAGLIQTVPIPVRQTTFFGRFVQFAAVLYSPMLATGL
FT                   AFWQTDAANYWGHNAIIRLRAFMDHCGLPSLPGKAPFGGDILSHDFVEAALLRRAGWDV
FT                   FLLADLEGSYEEVPCNIIDYAKRDRRWVQGNIQHLGIIDLPGLHPISRLHFLLGALAYI
FT                   SSFIWLLMLMLSTTDAVVRALNSNVYFTEMYQLYPSWPIAKTTQIIALILLTTLLLMGP
FT                   KLLGVIVALTHRRKAFGGSWAIIKGAFTETFFAVLIAPIMMGYHAYFVVSVLLGFKVNW
FT                   DSQAREGRLLPWGEAIARTAKMTLIALLWGWVTFTYSPLFFWWLLPILTGMVLGAPIVR
FT                   YSSSLDWGRRCRKHGILLCPSETTEIDALETLDTLLQIPPATVPEPAQTPLLPPDNRHP
FT                   MPHPPLDEYRHVDWRN"
FT   gene            complement(449067..450710)
FT                   /gene="mdoG"
FT                   /locus_tag="CJA_0358"
FT   CDS_pept        complement(449067..450710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdoG"
FT                   /locus_tag="CJA_0358"
FT                   /product="periplasmic glucans biosynthesis protein MdoG"
FT                   /note="identified by match to protein family HMM PF04349"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83497"
FT                   /db_xref="GOA:B3PI19"
FT                   /db_xref="InterPro:IPR007444"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014438"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI19"
FT                   /protein_id="ACE83497.1"
FT                   /translation="MRFCLTCKSSPTQTLFLSRRWLSLCALPFLLWHHNPLAQIAEPPK
FT                   PNPVQESATLTDIAKPGLFDALSERARKLAKHDYEPIHANIPSELADMDYDQYRAIRFR
FT                   PEAALWRGQSLFEIQLFHPGFLYREPIILHTAGDTPESVLQFKQAFFNYDGPAAPLAGL
FT                   APGNIGFAGFRVHYPLNSNEYKDEFLVFQGASYFRLIGPGLLYGLSARGLAIDTAEPKG
FT                   EEFPVFREFWLIKPAAEENRLVIYALLDSPSISGAYRFEVLPGAPTEMNVEARLFARQD
FT                   IVKLGVAPLTSMFMWGENHTRFVDDFRPEVHDSDGLLVAASNGEWIWRPLSNHRMLRVS
FT                   SLSDENPRGFGLLQRDRDFEHYMDMEARYELRPSMWIMPQGDWGKGRIELVEIPSDSET
FT                   NDNLVAYWVPAKAMKAGSSATYSYRLRSFDHFLPENAGAKVIRTRIGWGANPGQADPPP
FT                   KSKRKFVVDFRGGELDNLSPDAPIEAVLQQSSGNISELTVRRLPDDRTWRASFKLEPDG
FT                   NNYADMRLFLKLRDQRLSEVWSYVWYPDAL"
FT   gene            451161..453572
FT                   /gene="mmoS"
FT                   /locus_tag="CJA_0359"
FT   CDS_pept        451161..453572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmoS"
FT                   /locus_tag="CJA_0359"
FT                   /product="MmoS"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00512; match to protein
FT                   family HMM PF00672; match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83837"
FT                   /db_xref="GOA:B3PI20"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR033414"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI20"
FT                   /protein_id="ACE83837.1"
FT                   /translation="MLNLKRYMRENPIVARLLGLIIISSSVITLFAILLQLHSNFNDDI
FT                   AELEKRLDQVRISTLASITKSLWGFDQEQLNIQIHSVLDVDDVVQVSVTWHDWNNIKQH
FT                   LVATNPHYSLKDLETKPSQFLVRDYPLIYEDSSTPPQELGVLTVTASLAGIYEKLWERA
FT                   FFVALVQGTKTLIIALFIIWLVHTLLTRHIKIIANYTRNLNLESLTKPLKLQRMKMDSM
FT                   PDELDNVVNAINHMRETLLDDIEQRHAIELALLSEKEEKLETRRQKNAAEDASRAKSQF
FT                   LATMSHEIRTPMNGVIGMLDMLRDTPLDENQKHYIDVIHRSGETLLSIINDILDYSKIE
FT                   AGKMQLEEMVFELDDLVENCIQLFGATANKRNIELFGGLNPDVPRRLRGDPTRLRQIII
FT                   NLLGNAFKFTEEGFVSLEVGLDNTALQAEGRLMLRFVVQDSGIGIDPNSASNLFDSFNQ
FT                   ADASTTRKYGGTGLGLAICKSLAELMGGRIGVKSAKGEGAQFWFTAQFDVQELASPSLT
FT                   PDPTLKGKRLLMVETSAPLVTFTQRYCDHWGLLLETAFSAKQAVALLKHGLHAGEPFDF
FT                   VAFDYSLPDATGFELAQWLRDAPDFTELPVFMFSGGDVYHDQAVMQRLAIHTVLRKPIS
FT                   VKALYRELIALLGHEAAPTVLPAEKVLARDKFAHLQVLVAEDNPVNRMVIKGLLGKLGI
FT                   QPVFAENGREAVDLVHHGAQRFDLILMDCEMPEMDGFEATRNIRELERRSGRPAVPVVA
FT                   LTAHALQEHREAVFASGMNYYLAKPITFDSLYAAFDALGVVVNPENSASL"
FT   gene            453606..454022
FT                   /gene="trx"
FT                   /locus_tag="CJA_0360"
FT   CDS_pept        453606..454022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trx"
FT                   /locus_tag="CJA_0360"
FT                   /product="thioredoxin"
FT                   /note="identified by match to protein family HMM PF00085;
FT                   match to protein family HMM TIGR01068"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84700"
FT                   /db_xref="GOA:B3PI21"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI21"
FT                   /protein_id="ACE84700.1"
FT                   /translation="MPAWGGVLIIAPVFSGPWPWFNALNPGVFMSSDAIVHISDASFEQ
FT                   EVIAADIPVLVDFWAPWCGPCKMIAPILDDLAEQFEGKLKITKLNVDDNKESAAKFNVR
FT                   GIPTLIIFKNGAAHATKVGALSKPQLVDFINGAL"
FT   gene            454377..455636
FT                   /gene="rho"
FT                   /locus_tag="CJA_0361"
FT   CDS_pept        454377..455636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rho"
FT                   /locus_tag="CJA_0361"
FT                   /product="transcription termination factor Rho"
FT                   /note="identified by match to protein family HMM PF00006;
FT                   match to protein family HMM PF07497; match to protein
FT                   family HMM PF07498; match to protein family HMM TIGR00767"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85958"
FT                   /db_xref="GOA:B3PI22"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI22"
FT                   /protein_id="ACE85958.1"
FT                   /translation="MNLTDLKKKPIEELIDIAHGMGLENIARSRKQDIIFNILKRHAKG
FT                   GEDIYGDGVLEILVDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPP
FT                   KEGERYFALLKVNDINFDKPENSRNKILFENLTPLFPNERILLEAGNGSTEDLTGRIID
FT                   LIAPIGKGQRGLIVAPPKAGKTIMMQNIAQAITRNNPECHLIVLLIDERPEEVTEMQRS
FT                   VRGEVVASTFDEPPARHVQVADMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSS
FT                   GKVLTGGVDAHALERPKRFFGAARNIEEGGSLSIIATALVDTGSKMDEVIYEEFKGTGN
FT                   LELHLDRKLAEKRVYPAINIRRSGTRREDLLMKEDEQQRVWILRRLLNDMEDIAATEFL
FT                   IDKLKDFKTNDEFFLSMKRK"
FT   gene            455780..457261
FT                   /gene="ubiD"
FT                   /locus_tag="CJA_0362"
FT   CDS_pept        455780..457261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiD"
FT                   /locus_tag="CJA_0362"
FT                   /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
FT                   /EC_number="4.1.1.-"
FT                   /note="identified by match to protein family HMM PF01977;
FT                   match to protein family HMM TIGR00148"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83936"
FT                   /db_xref="GOA:B3PI23"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR023677"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PI23"
FT                   /protein_id="ACE83936.1"
FT                   /translation="MKYNDLRDFIALLEARGLLKRIKQEIDPHLEMTEICDRTLRAGGP
FT                   ALLFENPRGYTIPVLGNLFGTPERVALGMGQESVSALRDVGKLLAFLKEPEPPKGFKDA
FT                   WEKLPIFKQVLNMAPKVVGKAPSQEVVLEGDAVNLDQLPIQTCWPGDAGPLVTWPLVVT
FT                   RGPHKERQNLGIYRMQKIGKNRLIMRWLSHRGGALDFREFQLQHPGKPFPVAVALGADP
FT                   ATILGAVTPVPDTLSEYAFAGLLRGDKTEVVQCIGNDLQVPASAEFILEGFIAPGDMAP
FT                   EGPFGDHTGYYNEVDKFPVFTVERITHRRDPIYHSTYTGRPPDEPAILGVALNEVFVPI
FT                   LQKQFPEIVDFYLPPEGCSYRMAVVTMKKQYPGHAKRVMMGVWSFLRQFMYTKFVIVTD
FT                   DDVNARDWKDVIWAMTTRMDPARDTVMVDNTPIDYLDFASPVSGLGSKIGFDATNKWPG
FT                   ETQREWGTPIAMEQAVKDRVDAIWESLGIDLPTAY"
FT   gene            complement(457279..457638)
FT                   /locus_tag="CJA_0363"
FT   CDS_pept        complement(457279..457638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0363"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85803"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI24"
FT                   /protein_id="ACE85803.1"
FT                   /translation="MQYTRPMIDLVYEVRRRVDADMKPSVKLANPDLLKELATYYQATK
FT                   DTITKTLIKELLTMAGDEWAALLFPKPEQAEYTAPDTPRQIVKVYRGQTMLIDAPSQPQ
FT                   EHKPGRMYRGQPVSD"
FT   gene            457664..457822
FT                   /locus_tag="CJA_0365"
FT   CDS_pept        457664..457822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0365"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84195"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI25"
FT                   /protein_id="ACE84195.1"
FT                   /translation="MRAAKNKPNADWRENYVKQVSLGDWSALKENAMPKVVQGVFGGEE
FT                   NHAGRIW"
FT   gene            complement(457801..458604)
FT                   /locus_tag="CJA_0364"
FT   CDS_pept        complement(457801..458604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0364"
FT                   /product="serine acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /note="identified by match to protein family HMM PF00132;
FT                   match to protein family HMM PF06426; match to protein
FT                   family HMM TIGR01172"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84810"
FT                   /db_xref="GOA:B3PI26"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI26"
FT                   /protein_id="ACE84810.1"
FT                   /translation="MTLPAAALVVDSLWENIRSQTRKQAECEPVLASFLYATILNHETL
FT                   EAALSFHLANKLDSPALPAMLIREVIEEALAADVTIGEALRADLLAVSERDSACCSLVT
FT                   PLLYFKGFHALQAYRIAHWLWQQGRDSLALFLQNRISSVFAVDIHPAARIGKGIMFDHA
FT                   TGIVIGETAVVEDMVSIMQSVTLGGTGKEAGDRHPKVGRGVLIGAGAKILGNIRIGDCA
FT                   KIGAGSVVIKDVPARAVVAGVPAKIIGENLCGQPAQEMDHQIRPA"
FT   gene            complement(459060..459860)
FT                   /locus_tag="CJA_0366"
FT   CDS_pept        complement(459060..459860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0366"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83201"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI27"
FT                   /protein_id="ACE83201.1"
FT                   /translation="MRKIKLLLLALPIIVLGIWFVNTQLNISNVETADAATNAIENVQI
FT                   SSQSFVKPTIGNQSSASFKQDMLIEWKLVMTPQEEAEQREWLKTSGNHYGITEYDSYDV
FT                   ETLKKLAEADDVQAMHKLARWYMQLDNFLDYGFKAAEPLLWKAAIYGSTGAIAELASIQ
FT                   DSKRFGVSDDAEKRDLLLESFALYKAAELRGDRWGSLTMKKPTMKINNYSFSQQEEAEI
FT                   NRRAQKIYNELQTQRHEIGLGDFDNSVSPAVKKLFDIVENPPRK"
FT   gene            complement(460552..461532)
FT                   /locus_tag="CJA_0367"
FT   CDS_pept        complement(460552..461532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0367"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06111"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85458"
FT                   /db_xref="GOA:B3PI28"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR032882"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI28"
FT                   /protein_id="ACE85458.1"
FT                   /translation="MNSGHPYETLTPDLVLDAIEAAGFMTDARILALNSYENRVYQVGI
FT                   EGASPLIAKFYRPGRWSDAQILEEHQFTQALQDLEISVVPPLADGAGHTLREYQGFRFA
FT                   LYPRQGGHAPNLDDFDALLSLGRSLGRIHALGKAKPFDLRPALDIQSFGYDSYQFLLDN
FT                   DFIPASLRESYRSLGADLLKGCDAMFARVKYQPIRLHGDCHPGNILWRDEPHFVDFDDA
FT                   RMGPAVQDLWMLLSGERDQQIAQLSELLEGYGEFCDFNPAELALIEALRSLRIMHYSAW
FT                   LARRWADPAFPRHFPWFNSERYWGEHILELREQLAALNEPPLVIC"
FT   gene            461691..462500
FT                   /locus_tag="CJA_0368"
FT   CDS_pept        461691..462500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0368"
FT                   /product="ATPase, ParA family"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84137"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI29"
FT                   /protein_id="ACE84137.1"
FT                   /translation="MHQPEAERNNDTKTGIAMIKIAFYNLKGGVGKTTTAVNMAYMAAS
FT                   AKKDTILWDLDPQAAASWFCQQEAETSKAIKLFSKGKAIGEMELYSPYLRLMLIPADLS
FT                   LRSLDSEFDELAKDKKFFKQLLKPLADKADVLIFDCPPTLSPSVELLLQEVDILLIPMI
FT                   PSPLSIRAMEQVVEFLKTKKSAPERIYGFFNQVDLRRSLHREAIENSKKMPVPMLKTWI
FT                   PNDAAVEQMGLRRAPLTSYNQRSRAALAYLDLWKEIARLLRAAEKDN"
FT   gene            462507..462986
FT                   /locus_tag="CJA_0369"
FT   CDS_pept        462507..462986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0369"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83292"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI30"
FT                   /protein_id="ACE83292.1"
FT                   /translation="MNHCDWNEPSMMLPRLLPLILVALVTGCTSVVHEPAPTRDTQVYP
FT                   QPDIQQPGPDPAVVVPTPKPEPVAPAINPAVESLLRQARTQYQSQNYQGAIATAERGLR
FT                   IDRRSADLYLVLAQSYVQLALPQKAKMFVQQGLRYAQQGSDAAVGLMRVQEVVGN"
FT   gene            complement(463490..464842)
FT                   /locus_tag="CJA_0370"
FT   CDS_pept        complement(463490..464842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0370"
FT                   /product="Fic family protein"
FT                   /note="identified by match to protein family HMM PF02661"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82991"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI31"
FT                   /protein_id="ACE82991.1"
FT                   /translation="MSTNTSASNLLLQTIQATNGLSLNQLLEQHPNISRRTAQRLISEL
FT                   IGSGQIVATGKARSRRYFAATKSSTVLVGFPDYIPLSSDSRDIVAYINQPLAARKPVGY
FT                   QLEFLAAYQPNNSYYLPQTLRLQLHKMGRTKLHQEPAGTYSRAILNRLLIDLSWASSHL
FT                   EGNTYSRLDTIELIEQGKVAQGKALLETQMILNHKTAIEMLVANSDSVGFNHYTLMNLH
FT                   SALAENLLTNPADEGRIRMHAVDISQSVYRPLGAPQQIQTALDMLLTKVNQINDPFEQS
FT                   FFMMVHLPYLQPFADINKRTSRLAANLPLFQANLCPLTFLDVPEQAYSCATLGVYELTR
FT                   VELLRDLYLWAYERSTQEYLAIKQSLAEPDPARLVWRDLIKTTVRDIVLHPEIDSLIKI
FT                   SDTVANHVTAAERTNVQALIIEELRRLHEGVLARYGLRPSEFSAWKKVQQQ"
FT   gene            complement(464946..468029)
FT                   /locus_tag="CJA_0371"
FT   CDS_pept        complement(464946..468029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0371"
FT                   /product="RND efflux transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00873"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84867"
FT                   /db_xref="GOA:B3PI32"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI32"
FT                   /protein_id="ACE84867.1"
FT                   /translation="MTIAEPFIKRPVASCLVALGIVLLGLLSWRMLPVAPLPQVDFPAV
FT                   QIYAALPGASPESMAATVATPLERALGSIPGVTAINSNSTQGSTFIWVEFTLDRDLDSA
FT                   ARDVQAALNEARGQLPAGMPGNPGYRKISPSQAPIMALALSSPNLSLSDLYDAASTILA
FT                   QQLSQIKGVGQVGIDGASLPAVRIQLNPNALSSYGIALDEVRNAISNANVQRPLGLLEE
FT                   NDSRWQVYTNESLRTAVDYQDLVIRYGEAGPVRLRDVATVTDSVENRYTNGFHNQSSAV
FT                   TLTVSRQTGANIVATIDAINAQLPTLRALMPADTQLKVVMDRSPGIRATLKEAEITLML
FT                   AVLLVVGVVWAFLRSPQSALIPSLSLPVSIIGAFVVMYLWGFSLNNLSLMALIVAAGLV
FT                   VDDAIVVLENIKRHIERGAPPFEAAIQGAREVGFTLLAMNITLVVIFVSILLMGGVIEK
FT                   LFREFSITLAAAMLISLVVSLSLTPALCGQLLKPEAPKETKPGIFDDLKQGYASLLSWA
FT                   LRHSRIVMLILVGVIGVNIYLYIAIPKTMLPDQDTGQMTAFIRGDDGFSFQIMQPKIEA
FT                   FRQYLLTDPAIEDVFGASGGGNGVTNAWMRISLKPMAERGVPVSEVVDRLRRNMPRIPG
FT                   AIMMVNADQDIRLSSPFSRSSHEVMMLSDDLRLLHTWAAKLTTAMQQMPEVTDIDGVRE
FT                   EGTQQVVLTIDREAAQRLGVDMATIASLLNNSFSQRQVSTMYEAMNQYRVVMELEPGYT
FT                   ATPDVLNHLQVITRTGARVPLSTLSSFTYGLAEDRIRRSNQFVSESIGYGLAEGYNEQQ
FT                   ARAAIETKVAELMMPKEVYLAAPGSTRPGWGPSVPGMSQNPAILIGCVLLAVYLILGIL
FT                   YESTIHPLTILSTLPSAGIGALLALQLSDTPFSLIAMLGLFLLIGIVMKNAILMIDFAL
FT                   ELERREGLSSRDSIYQAALMRFRPILMTNLAGVLGALPLILGFNEGSELRTPLGITIIG
FT                   GLAVSQVLTLFTTPVVYLYMEKVRNWGLGKKYAHPAGV"
FT   gene            complement(468026..471109)
FT                   /locus_tag="CJA_0372"
FT   CDS_pept        complement(468026..471109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0372"
FT                   /product="RND transporter, Hydrophobe/Amphiphile Efflux
FT                   family"
FT                   /note="identified by match to protein family HMM PF00873"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83893"
FT                   /db_xref="GOA:B3PI33"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI33"
FT                   /protein_id="ACE83893.1"
FT                   /translation="MSISKPFILRPVATSLVMLALLLAGLLGYRLLPVAALPQVDYPII
FT                   QIFTFNPGASPDVMARTITAPLERSLGQIPGVKQMSSTSSTGASIITLQFLLEIDLGVA
FT                   EQEVQAALNTASNLLPGDLPTPPVYRKVNPADAPIMTLAVTSGSLPLPEVYDLVNTRMA
FT                   QKLAQLPGVGMVTLAGGQRPALRIKVNPNALANTQLSMEQVRNTIVTANTNQPKGSFDG
FT                   TYRSTMLDANDQIRSLDEYRNLIVSWRDGSPLRLGDVATVENGAEDRFLAAWANEQPAV
FT                   LINIQRQPGANVIEVADNIQALLPKLTATMPASVSIAILSDRTHSIRASIRDVQKELIF
FT                   AIFLVVAVTLVFLRSVPATIIPSLAVPLSLIGTFATLYFLDFSINNLTLMALTIATGFV
FT                   VDDAIVMLENIARHREQGETPLNAALKGAGEIGFTLVSLTISLIAVLIPLLFMGDLVGR
FT                   LFQEFAITLAVAIGISLLVSLTLTPMMCARMLKTAPMHDDSKPDFMERVIRRYGTLLDK
FT                   VLEHQTAAMAVMLGTIALTAGLYLLVPKGFFPIQDSGAIQAITEAPQDTSFAAMTERQQ
FT                   QLAELILQDPDVEGLSSFIGVDGSNITLNSGRLLINLKPHHERSSHASDVIRRLQERIA
FT                   PTSGITAWFQPLQELSIEDRVSRTQYQFTLTAPDISLLDEWAPQLLERLRHEPALADVT
FT                   TDLQTRGLQAYVEIDRDAAARLGVSVSNIASSLQTAYAQRQIATLFTQANQYRVVLEVD
FT                   PDYAQGLKALENTYVTSSSGRPVLLATLASISQRPAPLLINHQSQFPSTTFSFNLAEHA
FT                   SLGEAISAIEAVQVELALPAGVELRFQGAAEAFRASLSNTLWLILAAIVTMYIVLGVLY
FT                   ESFIHPVTILSTLPSATVGALLALLLVGQPLDLIAVIGVVLLIGLVKKNGIMMVDFALD
FT                   AQRNLGMNPRQAIHRAALMRFRPILMTTLAALFGAIPLMLASGSGAELRQPLGLVMVGG
FT                   LLVSQVLTLFTTPVVYLFFDRWVTRRRATADAAEVQGL"
FT   gene            complement(471125..472321)
FT                   /locus_tag="CJA_0373"
FT   CDS_pept        complement(471125..472321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0373"
FT                   /product="HlyD family secretion protein"
FT                   /note="identified by match to protein family HMM PF00529;
FT                   match to protein family HMM TIGR01730"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84396"
FT                   /db_xref="GOA:B3PI34"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI34"
FT                   /protein_id="ACE84396.1"
FT                   /translation="MLSSMQGLSRKQRWLLGLGFVVVILLVWFFWLRQPEAKRPPPPNP
FT                   WMGPTPVHTVSVIKEDLTLRLKALGTVTPLNTVTLRSRVSGPLVEVLFREGQPVKAGDL
FT                   LAVIDPQPYKVGLAQAEGTVQQTAAQLKSAEEDLRLYERLLKQNSIAKQQYDKQVALVD
FT                   QLRGTLKTHEAQREDARLQLGYTRITAPITGRTGLRQVDIGNLVNAGDSNGLVTITQTH
FT                   PITVVFTIPENQLMAVRQAHHQALASQQPLVVEAWDRSEQQLLASGQLTTLDNQIDTAT
FT                   GTLRLRAEFDNSDDSLFPNQFVNARLQVQTVKDALTIPADAVQYGSKGAYVYVIDAEGK
FT                   ARMRRITLGVQEDQRIAVTEGLSEGEQVVLEGIDRLWEGKDAKVIEQEEPAAESGKPQ"
FT   gene            472760..474295
FT                   /gene="cel45A"
FT                   /locus_tag="CJA_0374"
FT   CDS_pept        472760..474295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cel45A"
FT                   /locus_tag="CJA_0374"
FT                   /product="cellulase, putative, cel45A"
FT                   /EC_number="3.2.1.4"
FT                   /note="identified by match to protein family HMM PF00553;
FT                   match to protein family HMM PF02013; match to protein
FT                   family HMM PF02015"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82688"
FT                   /db_xref="GOA:P18126"
FT                   /db_xref="InterPro:IPR000334"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR002883"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR009031"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="InterPro:IPR018366"
FT                   /db_xref="InterPro:IPR036601"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/Swiss-Prot:P18126"
FT                   /protein_id="ACE82688.1"
FT                   /translation="MNLLSGWVRPLMLGCGLLGAALSAGSIQAAVCEYRVTNEWGSGFT
FT                   ASIRITNNGSSTINGWSVSWNYTDGSRVTSSWNAGLSGANPYSATPVGWNTSIPIGSSV
FT                   EFGVQGNNGSSRAQVPAVTGAICGGQGSSAPSSVASSSSSSSVVSSTPRSSSSSVSSSV
FT                   PGTSSSSSSSVLTGAQACNWYGTLTPLCNNTSNGWGYEDGRSCVARTTCSAQPAPYGIV
FT                   STSSSTPLSSSSSSRSSVASSSSLSSATSSSASSVSSVPPIDGGCNGYATRYWDCCKPH
FT                   CGWSANVPSLVSPLQSCSANNTRLSDVSVGSSCDGGGGYMCWDKIPFAVSPTLAYGYAA
FT                   TSSGDVCGRCYQLQFTGSSYNAPGDPGSAALAGKTMIVQATNIGYDVSGGQFDILVPGG
FT                   GVGAFNACSAQWGVSNAELGAQYGGFLAACKQQLGYNASLSQYKSCVLNRCDSVFGSRG
FT                   LTQLQQGCTWFAEWFEAADNPSLKYKEVPCPAELTTRSGMNRSILNDIRNTCP"
FT   gene            474559..475122
FT                   /gene="ahpC"
FT                   /locus_tag="CJA_0375"
FT   CDS_pept        474559..475122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahpC"
FT                   /locus_tag="CJA_0375"
FT                   /product="AhpC"
FT                   /EC_number="1.8.1.-"
FT                   /note="identified by match to protein family HMM PF00578"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACE86367"
FT                   /db_xref="GOA:B3PI36"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017559"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI36"
FT                   /protein_id="ACE86367.1"
FT                   /translation="MASINSEIKPFSAQAYHQGKFIHLTEADLKGKWSVVFFYPADFTF
FT                   VCPTELGDLADNYADFQKLGVEIYAVSTDTHFTHKAWHDSSETIGKIQYPMIGDPTGAI
FT                   TRNFGVMIEEAGLADRGTFVIDPQGKIQIIEINAGGIGRDASELLRKVKAAQYVAAHPG
FT                   EVCPAKWKEGDATLAPSLDLVGKI"
FT   gene            475220..476770
FT                   /gene="ahpF"
FT                   /locus_tag="CJA_0376"
FT   CDS_pept        475220..476770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahpF"
FT                   /locus_tag="CJA_0376"
FT                   /product="AhpF"
FT                   /EC_number="1.8.1.-"
FT                   /note="identified by match to protein family HMM PF00070"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84838"
FT                   /db_xref="GOA:B3PI37"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR012081"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI37"
FT                   /protein_id="ACE84838.1"
FT                   /translation="MLDAAIKGQLKAYLEKLQRPIELVASLDDTAKSRELKSLLDEITA
FT                   LSDNVSARLDGNSVYRPSFGVARPGETPRIEFAGIPLGHEFTSLVLALLHTGGHPARID
FT                   AATLEQIKAIDGQFHFDIFVSLSCHNCPDVVQAVNTMAAQNPNISATMIDGALFQGEVE
FT                   KRQIMAVPSVYLNGQHFGQGRMTLEEILAKIDTGAAEREAKLLNGKVPFDVLVVGGGPA
FT                   GSAAAIYAARKGIRTGVVAERFGGQVLDTLAIENFISVTETEGPKLAMALEQHVKEYDV
FT                   DVMNLQKAAELIPGDLIEVKLASGASLKSKSVILTTGARWREMNVPGEKEYRGKGVAYC
FT                   PHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVAHVTLLEFDSTLRADAVLQRKLLSLP
FT                   NVTVITEALTSEVLGDGQKVTGLTYKNRNTDDLTQVELEGIFVQIGLLPNTDWLKGTVA
FT                   LSQRGEIEINTRGETSVPGVFAAGDCTTVPYKQIIIAMGAGSTAALGAFDHLIRASAP"
FT   gene            complement(476817..477845)
FT                   /locus_tag="CJA_0377"
FT   CDS_pept        complement(476817..477845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0377"
FT                   /product="beta-1, 4-galactosyltransferase, putative, gt2a"
FT                   /EC_number="2.4.1.-"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83759"
FT                   /db_xref="GOA:B3PI38"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI38"
FT                   /protein_id="ACE83759.1"
FT                   /translation="MTYGDPCLSTCQPAISVIVPVYNVDTYVANCIRSLLMQENAPTYE
FT                   IILVNDGSTDNSKAICEVLQQTTPAIIRLFNHEFNQGLSIARNTGLAQVRGEYFTFVDA
FT                   DDLIPPSALGDLYAAACEYNADIVKGNNWIFSKEQRYPANYNTKRTRIFHSDKILIAFY
FT                   EHQLMRGHTWGKLFRTSVFVDIPNQPGVAMAQDTLYCAEMFAKANTLVVIPRPVYEYRL
FT                   RAGSATGRKYETKAYLWWLYSIEQAGRFARTPKQKRRHKQLQMRTLIQISKEARQLNNL
FT                   ALGPVVNEVHQHQARWNLLNLWQVARHGLGVRWILHFIQFAFILARLERRLEKPVRFSN
FT                   AS"
FT   gene            complement(478085..478714)
FT                   /locus_tag="CJA_0378"
FT   CDS_pept        complement(478085..478714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0378"
FT                   /product="Alpha/Beta hydrolase family of unknown function
FT                   (DUF1234) family"
FT                   /note="identified by match to protein family HMM PF06821"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85817"
FT                   /db_xref="GOA:B3PI39"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI39"
FT                   /protein_id="ACE85817.1"
FT                   /translation="MSAQLIPDSITKSLSQALANYAVIIVPGLRNSDENHWQSLWQTQL
FT                   PNSRRIHLSNWDTPDLDAWKAAIRTQLKYVDKPAVLIAHSFGTLASASIAEEFPEKIAA
FT                   LFLVAPADPDKFGIAKRLPQHPLQVGAKIIASSNDPWLRDSKAAFWSLQWGADFLRLQN
FT                   VGHINSESNLGFWAEGIQLLTQFLRKARNEKLWLRNGIADNKHALA"
FT   gene            complement(478871..479479)
FT                   /locus_tag="CJA_0379"
FT   CDS_pept        complement(478871..479479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0379"
FT                   /product="probable homoserine/homoserine lactone efflux
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01810"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84542"
FT                   /db_xref="GOA:B3PI40"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI40"
FT                   /protein_id="ACE84542.1"
FT                   /translation="MEQLWLFVTLTFFVSASPGPVMLSCMIDAARFGLGHSWFTMLGAS
FT                   AGNLVLILLSALGLSLVIHQAEWIFHTIKWLGAAYLAYLGLKLYSAAVLPISLARQQVR
FT                   RNHLFGRAFMVAITNPKGLIYFGALLPQFIQPQQPIAAQFALLAMIFLAIDLVWMLVYA
FT                   KGGKMLMHWLQAPSHQRWFNRLCGAALLCAGIALAFSQR"
FT   gene            479611..479955
FT                   /locus_tag="CJA_0380"
FT   CDS_pept        479611..479955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0380"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83940"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI41"
FT                   /protein_id="ACE83940.1"
FT                   /translation="MSNNSIAKAIRILEGLLRGLDQAYWEANSLDRKDFFYDLISALHA
FT                   ELSELGKLSVQDHDLEYEPVTEEFRAARPKLSRLRKLVDDFALRSTTALSLEGLIDETR
FT                   VLLGRHSPVL"
FT   gene            complement(479976..480125)
FT                   /locus_tag="CJA_0381"
FT   CDS_pept        complement(479976..480125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0381"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83069"
FT                   /db_xref="GOA:B3PI42"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI42"
FT                   /protein_id="ACE83069.1"
FT                   /translation="MSLSHSHLGFHTLTGFGPQEATAADTLSIVQFSVIASIFMTIFKL
FT                   FGDN"
FT   gene            480200..480331
FT                   /locus_tag="CJA_0382"
FT   CDS_pept        480200..480331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0382"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83001"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI43"
FT                   /protein_id="ACE83001.1"
FT                   /translation="MVLADIVMVSAFFMACYSRRAVADTALKMAPGHFLWAIVSAWA"
FT   gene            480370..480837
FT                   /locus_tag="CJA_0383"
FT   CDS_pept        480370..480837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0383"
FT                   /product="putative lipoprotein"
FT                   /note="identified by similarity to GB:ABD80772.1"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85020"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI44"
FT                   /protein_id="ACE85020.1"
FT                   /translation="MRKHRAITMLLAAISWSCSSQLHADCLAPDAVLKLDATYEEALRI
FT                   GDVKLLDSLLAPEYSWVHNLASLTEDKTGLLARLQKPGEIPKARRSHDIRSHRLGDTVV
FT                   LQGLSSVEKWNPDGKTYRTSRYQFMRTYVRVGETCQLLGVQTMKVWSSDGQ"
FT   gene            complement(480900..482099)
FT                   /gene="pel10C"
FT                   /locus_tag="CJA_0384"
FT   CDS_pept        complement(480900..482099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pel10C"
FT                   /locus_tag="CJA_0384"
FT                   /product="pectate lyase, putative, pel10C"
FT                   /EC_number="4.2.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84681"
FT                   /db_xref="GOA:B3PI45"
FT                   /db_xref="InterPro:IPR012669"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI45"
FT                   /protein_id="ACE84681.1"
FT                   /translation="MRTILKYSLAVIALCQLPLSFAADQSATANSTQAALEAQWQAYIN
FT                   HSAALRKADWEVVKKEAKRRGLKEPLLPGYTKEFGFETNQPLEWFKSDEGKAIMEAILS
FT                   LQTPSGGWSKRTDMTKKRKPGMAFGTEKNYIPTFDNDATTMQLTLLAKAFAATGNKVYS
FT                   DAFARGLELIFTAQYPNGGWPQNYPLVGGYHNYITYNDELMVNIMFLLRDVAKGEGNYA
FT                   FASAEQRKRAQQSLDRAIECALNTQVMIGNKLTVWGAQHDPITLMPAKARAYEMASLTS
FT                   TESVWMVEFFMSLDNPSPAIIESVHSAIAWYQATKMTGKTWTRGDKALTDDPNAPPLWS
FT                   RFYELGTDKPIFGDRDDSIHYDIGEVSKERREGYAWFSTAPNKILKHYEKWAKKYPRPS
FT                   "
FT   gene            complement(482279..483121)
FT                   /gene="panB"
FT                   /locus_tag="CJA_0385"
FT   CDS_pept        complement(482279..483121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panB"
FT                   /locus_tag="CJA_0385"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /EC_number="2.1.2.11"
FT                   /note="identified by match to protein family HMM PF02548;
FT                   match to protein family HMM TIGR00222"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83798"
FT                   /db_xref="GOA:B3PI46"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI46"
FT                   /protein_id="ACE83798.1"
FT                   /translation="MPYGTLSQSTPTANTALTKSVTINTLYKLKASGEKFVVISLYDAH
FT                   MAAMAQRCGVEVVLIGDSLGMTVLGYDSTIPVTMEQMIYHVEAVARGNKKSLIIGDLPF
FT                   MTYGTPEDALRNCARIMQAGAQMVKLEGGTWLADTVRMLAERGVPVCAHLGLTPQSVNK
FT                   FGGFRVQGRDADSAAKILADAKLLAEAGADLLVLECVPAALAAQITREISIPTIGIGAG
FT                   KDTDAQVLVINDILGLTEQPPKFSKNFLLEANDIAGAMQKYVADVKAGVFPAEENTFF"
FT   gene            complement(483147..483830)
FT                   /locus_tag="CJA_0386"
FT   CDS_pept        complement(483147..483830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0386"
FT                   /product="predicted deoxypurine kinase"
FT                   /note="identified by match to protein family HMM PF01712"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84624"
FT                   /db_xref="GOA:B3PI47"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI47"
FT                   /protein_id="ACE84624.1"
FT                   /translation="MDAIFEELGLDLTREQLPRFIAVEGCIGVGKTTLARNLAQLFNYD
FT                   TLLEQPEQNPFLERFYRDPKSTALPTQLFFLFQRANQIHSLRQNDLFEPVRVADFLIDK
FT                   DQLFARVTLDDDEFAIYRQVYDKLVIDAPRPDLVIYLQAPLNVLGDRIRQRGIAAEQYI
FT                   SQDYLQALNDAYTEFFHYYDSAPLLIVNAQDLNLASNRGHFKQLVEYILTIKSGRHYYN
FT                   PIPAL"
FT   gene            complement(483844..484323)
FT                   /gene="folK"
FT                   /locus_tag="CJA_0387"
FT   CDS_pept        complement(483844..484323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="CJA_0387"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /note="identified by match to protein family HMM PF01288;
FT                   match to protein family HMM TIGR01498"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84017"
FT                   /db_xref="GOA:B3PI48"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI48"
FT                   /protein_id="ACE84017.1"
FT                   /translation="MTRVYIGLGSNIEEPLAQITQALAELAQLPDTQWLAQSRLYRSKA
FT                   IGPVQPDYINAVALLDTRLTPLALLDALQALEQHHRRVRLEHWGPRTLDLDILLFGDQV
FT                   IASERLTVPHPFLTQRSFVLYPLADISPALVLPDGTSLQQHLNACAPEGLQVLGD"
FT   gene            complement(484320..485693)
FT                   /gene="pcnB"
FT                   /locus_tag="CJA_0388"
FT   CDS_pept        complement(484320..485693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcnB"
FT                   /locus_tag="CJA_0388"
FT                   /product="polynucleotide adenylyltransferase"
FT                   /EC_number="2.7.7.19"
FT                   /note="identified by match to protein family HMM PF01743;
FT                   match to protein family HMM TIGR01942"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83431"
FT                   /db_xref="GOA:B3PI49"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR010206"
FT                   /db_xref="InterPro:IPR025866"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI49"
FT                   /protein_id="ACE83431.1"
FT                   /translation="MLKRLLNLIIPRPRDSASTSSAQSNARKPRVIPRDQHGVSRKNIS
FT                   QAALKIIKQLHEAGFEAYLVGGGVRDLLLGGHPKDFDVATNAKPEEVRRLFRGARIVGR
FT                   RFQIVHVRIGREMIEVTTFRGHHDEDLNHTRNEDGMLLRDNVYGTLETDAMRRDFSVNA
FT                   LYYDLKTFSIIDYCGGMEDLKKRTLRIIGEPVTRYKEDPVRILRALRFAAKLGFALEPS
FT                   TAKPIRPLGNLLLNVSEARLFEEVLKLFLNGSATATFNLMREYDLLQQLFPGTDEALKA
FT                   NEPAMAELVELCMANTDKRIRSDKTVTPAFIYAALLWPGLQRRYLQLQDSYTPAQAWNQ
FT                   AAQDVINQQLTRTSIPKRFLIPMREIWDLQQRLPNRLGLRALRLLDHPRFRAAYDFLLM
FT                   REEAGEPLDGLGSWWTHFQGANDEEREAMVRALSRPTGSGKPRRRRPRKPRNAGDSSA"
FT   gene            complement(486530..487924)
FT                   /locus_tag="CJA_0389"
FT   CDS_pept        complement(486530..487924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0389"
FT                   /product="galR two-component system response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00158; match to protein
FT                   family HMM TIGR01199"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85670"
FT                   /db_xref="GOA:B3PI50"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI50"
FT                   /protein_id="ACE85670.1"
FT                   /translation="MSKILIVEDETIIRTALRKLLERNQYEVCEAPSVKEATTKHNLKD
FT                   FDLIISDLRLPGAPGTDLIKLAGDTPVLIMTSYASLRSAVDSMRMGAVDYIAKPFDHDE
FT                   MVTAVKRVIGKAKAANKAANASQTASHTIAGIIGSSDVMQDLYNRIHKVAPTNATVLIH
FT                   GETGTGKELVARALHEESSRSNHLMISVNCAAIPDTLIESELFGYEKGAFTGASTNREG
FT                   LVAAADGGTLFLDEIGELPLEAQARLLRVLQEGEVRPLGSVESRKVDVRLVAATHRDLR
FT                   KLTKEGKFREDLYFRLNVVQLELPPLRERGRDIINIAESLLQRYCAQFGKPQLKLSNAA
FT                   MDAIMGYNWPGNVRELENAMQRAVILCEDSTEIGANLLSLDQEANQLEDDGTSILEAPR
FT                   LANRGNGRSSPTEDLSLEDYFQRFVLEHQDTMSETELARKLGVSRKCLWERRQRLGIPR
FT                   SKSSAK"
FT   gene            complement(488039..491008)
FT                   /gene="galS"
FT                   /locus_tag="CJA_0390"
FT   CDS_pept        complement(488039..491008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galS"
FT                   /locus_tag="CJA_0390"
FT                   /product="galS His Kinase A (phosphoacceptor) domain"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF02518; match to protein
FT                   family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85093"
FT                   /db_xref="GOA:B3PI51"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI51"
FT                   /protein_id="ACE85093.1"
FT                   /translation="MTFDLSQVALIGISYLLLLFGIAYVTERGWIPDSITSHPVTYILS
FT                   LGIFASAWAFYGVIDLAFQYGYGALAYYLGTGALFLFAPVALAPLAELARRHQVHSLAD
FT                   LLVFRYHSNAVGALTTLCMMCGILPLMALQIQAIADTMHILTVSSNPTLPLEGTGLTFK
FT                   DLMALCYCSILAFFTVSFGANRDQHRGLITAMAFESMLKVCALCTVGFVAVFGVFDGLD
FT                   GLDQWLLEHPENLALLHNPIHTDSAHTLLLVFVATAVTMPHIFHLGLAENPLMRNSHTV
FT                   TWAFPLFLLLMALPIFPILWAGAELAVPLPPQYYTLGVPILFGSPGLTLLAFIGGLSAS
FT                   TGAMVIISLALSTMVMNHWLLPSLKLRARHDIYSQLIWLRRILIAAIFLGGYLLYWLLD
FT                   NRYSLTNLALTAFIATLQFLPATFAIVFWSKGNRRGLLAGLGLGTAIWAVGLLIPMLTG
FT                   IEYIQLPILEHPLRIGSNYWQEVALLSLGLNTLCFVVISLFTRQTEDEEYNADLCAADE
FT                   LSHPVRLALDVHSASEFKVRLAKPLGKVTASREVDIALKELGLTINERRPYALRRLRDQ
FT                   IEGNLSSLMGIHVASEIMDKYIPHQIAEARDTVDINLIENRLNQYRDRLTGMAAELNNL
FT                   RLYHRKTLEELPLAVCSLGRDMEILMWNKAMAALTQTPSEDVTGSYLEDIPEPWCSLLI
FT                   DFSSSSERHFYRREIDLDGRPHWISLHKANISGPVSAEAYDQVMLLEDVTETQLLEQEL
FT                   VHSERLASVGRLAAGVAHEIGNPITGIACLAQNLRYEVEEPGAVLDTAEQILSQTDRVS
FT                   RIVQSLVSYSHAGHASKSDFEAVSLRDCANEAIQLLSLQKDKNQVLFCNDIPKSAIVDG
FT                   DAQRIIQVFINLLSNARDASPDQGRVMLESNEDEYSVTVSVTDEGHGIPPELIERILEP
FT                   FFTTKEPGEGTGLGLAMVYSIIEDHSGHLDIISPADTVNNRGAQFVFTLPRHMDFPPED
FT                   "
FT   gene            complement(491054..491236)
FT                   /locus_tag="CJA_0391"
FT   CDS_pept        complement(491054..491236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0391"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84229"
FT                   /db_xref="GOA:B3PI52"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI52"
FT                   /protein_id="ACE84229.1"
FT                   /translation="MNNQRLVILLLLVAYIFSPSVFNWIVAPDGAWYRPYIAWVMIIVI
FT                   AFIMQLRRHKTRDVD"
FT   gene            complement(491267..492205)
FT                   /locus_tag="CJA_0392"
FT   CDS_pept        complement(491267..492205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0392"
FT                   /product="glutamyl-and glutaminyl-tRNA synthetase"
FT                   /note="identified by match to protein family HMM PF00749"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACE86026"
FT                   /db_xref="GOA:B3PI53"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR022380"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI53"
FT                   /protein_id="ACE86026.1"
FT                   /translation="MTGILLQPPPPASASYIGRFAPSPSGPLHFGSLVTALASYLDAKA
FT                   HQGRWLVRMEDLDPPREQPGAADSILRSLDTHGLHWDGEVLYQSQRVDVYQAQLDTLIQ
FT                   AGLAYPCNCSRQRLQNLGGSYDGHCRLHPPASHTAIAWRLKLYDLPYGFALPETIGFTD
FT                   VIQGVQAQGLRIAAGDQILKRRDGFYAYQLAVVVDDIAQGITHIIRGADLLAVTGRQIA
FT                   FFLLLGQPAPTFGHLPLALQPNGQKLSKQNQAPALVDTQAAQNLWQALHFLGQNPPVDL
FT                   RTSHCEELLSWAVAHWQRTAIHGLGHCHKPE"
FT   gene            complement(492247..492783)
FT                   /locus_tag="CJA_0393"
FT   CDS_pept        complement(492247..492783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0393"
FT                   /product="DnaK suppressor protein"
FT                   /note="identified by match to protein family HMM PF01258;
FT                   match to protein family HMM TIGR02420"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83957"
FT                   /db_xref="GOA:B3PI54"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR012784"
FT                   /db_xref="InterPro:IPR020458"
FT                   /db_xref="InterPro:IPR020460"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI54"
FT                   /protein_id="ACE83957.1"
FT                   /translation="MGFDGEFAKPGSPVDTHIEKFTEESNEALITMAKKTPSTETFALR
FT                   PFTPYEEKKGEEYMNDNQKAHFRQLLLNWRSELMEEVDRTVSHMKDEAANFPDPADRAS
FT                   QEEEFSLELRTRDRERKLIKKIDSTLELIENDDYGYCDACGVEIGIRRLEARPTATLCV
FT                   DCKTLAEIKEKQIGG"
FT   gene            493010..493714
FT                   /gene="sfsA"
FT                   /locus_tag="CJA_0395"
FT   CDS_pept        493010..493714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfsA"
FT                   /locus_tag="CJA_0395"
FT                   /product="sugar fermentation stimulation protein"
FT                   /note="identified by match to protein family HMM PF03749;
FT                   match to protein family HMM TIGR00230"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83067"
FT                   /db_xref="GOA:B3PI55"
FT                   /db_xref="InterPro:IPR005224"
FT                   /db_xref="InterPro:IPR040452"
FT                   /db_xref="InterPro:IPR041465"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI55"
FT                   /protein_id="ACE83067.1"
FT                   /translation="MFKPAVLLRRYKRFLADIRLADGREITVHCPNTGSMRNCVVAGSP
FT                   CWYSDSESKTRKYPQTLELVTTPGGHLAGINTARANELVRQALVDGVITELTGYGSCLR
FT                   EQVYGCERSRIDFLLRDHAQDGRDCYVEVKSVTLMEAEGEGYFPDAVSERGSKHLRELM
FT                   GAVAQGQRAVLLFCVQHTGIRRVSPADHIDATYGKTLREAQAAGVEVMAYGAVIDPERS
FT                   LLVLRQPVPVVV"
FT   gene            complement(493711..494634)
FT                   /locus_tag="CJA_0394"
FT   CDS_pept        complement(493711..494634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0394"
FT                   /product="Permeases of the drug/metabolite transporter
FT                   (DMT) superfamily"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85586"
FT                   /db_xref="GOA:B3PI56"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI56"
FT                   /protein_id="ACE85586.1"
FT                   /translation="MSHTSSRLSPEGILLLLGIGFGWGLNWPIMKYIISEIPPLSFRGF
FT                   CLLLGGLGILALARIGGHSLRIPRAYWGKIFWVCLFNILAWNIMATFGLSLLPAGRSAL
FT                   LGYTMPLWTVLLSVLILKDSFSVRIGLALVLGLGGIFALLSDSLLSWFGGPLNSSLLLG
FT                   AGLMVGAAWGWALGTVLLKRWKIPLHSVVLTGWLLLLASLPTLVAAAWFDGIPHSMPDQ
FT                   WALWGVVYNVFIGFMFCYWAWVRLVELVPVSVSSLSSLITPLIGVASSIILLGEEPGWP
FT                   EISATLLILGAVAVVNWKPGNAKQKY"
FT   gene            complement(494717..495253)
FT                   /locus_tag="CJA_0396"
FT   CDS_pept        complement(494717..495253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0396"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACE86173"
FT                   /db_xref="InterPro:IPR025411"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI57"
FT                   /protein_id="ACE86173.1"
FT                   /translation="MTRHSLFSPWLLLLSIILVGCASPKYQQDSKSGAVLNDLHTYQWR
FT                   SLDVEIAGANKAQIQQLLDEQLLRQGYRLATDKPDMLLDLQAFSRVSQGGNTGIGIGIG
FT                   LPVGRHGSVGLGTSQILGRNKQEGVVVLDITRTDNNTLVWRGSAESLPLSYFELGKEQK
FT                   LRDSLNKLLAQFPPQ"
FT   gene            495470..496294
FT                   /gene="uppP"
FT                   /locus_tag="CJA_0397"
FT   CDS_pept        495470..496294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uppP"
FT                   /locus_tag="CJA_0397"
FT                   /product="undecaprenyl-diphosphatase UppP"
FT                   /EC_number="3.6.1.27"
FT                   /note="identified by match to protein family HMM PF02673;
FT                   match to protein family HMM TIGR00753"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85837"
FT                   /db_xref="GOA:B3PI58"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PI58"
FT                   /protein_id="ACE85837.1"
FT                   /translation="MDLLLVIKAIIMGIVEGITELLPISSTGHLILAADVMNFLSHDKR
FT                   VVFEIFIQMGAMLAIVWEYRVKIFSSLAGAVRPGIERNLFINVAIAFFPAALVGFLFSD
FT                   FIRTVLFSPYVVAGGFIVGGVIIMWVEKYAYAPRLDDMDRISYADAFNVGLCQCLALIP
FT                   GTSRSGATIIGGMYFGLSRRASTEFSFFLAIPMIGAASLYALWEAREQMEIEDMGILAI
FT                   GFITSFFVTFAVMRALLRFVSKHTYMAFAWYRIAFGLLVLATAYTGVINWSV"
FT   gene            496406..498520
FT                   /gene="amy13F"
FT                   /locus_tag="CJA_0398"
FT   CDS_pept        496406..498520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amy13F"
FT                   /locus_tag="CJA_0398"
FT                   /product="alpha amylase, putative, amy13F"
FT                   /EC_number="3.2.1.1"
FT                   /note="identified by match to protein family HMM PF00128;
FT                   match to protein family HMM PF02412; match to protein
FT                   family HMM PF03714"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84068"
FT                   /db_xref="GOA:B3PI59"
FT                   /db_xref="InterPro:IPR005323"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI59"
FT                   /protein_id="ACE84068.1"
FT                   /translation="MKIMLSVLALLLVLTACGGGGGSSQPSHPSDSSTSASSLSSLPSS
FT                   SSLPGSSSIAASPGSSPSSSSQSTSSAVSVSSAFSSSSAAPVVTVYYQRLDKTYSGWGL
FT                   HLWGSAIPASTVTTWANARPFDGTEGDWAVARVPLSNGSVAFNFIVHKGDFKSPTADLG
FT                   FVPATSGNQVWVIQDDNTLYFNQAEAELALANVGNASAALDLSPVEPVANNSGLPPDWH
FT                   KRANFMQIFVRSYKDSDGDGVGDFQGLISKLDYLQALGITGIWLMPMTESSDNDHGYAV
FT                   SDYRKVESDYGTADDFAQLLAEAHARGIGVIIDYVINHSSSANPLFIDAASAANNSKRD
FT                   WYIFSNTNPGWTSWGGNPTWHSAPSGDYYYGVFTAGLPDFNLRNQQVVDYHRDNLRFWL
FT                   NRGVDGIRFDATGVLFENGPGQWSEQPENHPLLAEIRSLIDDYGNRYAICESPDAPDEY
FT                   VSEDSCGRVFAFGHQWTIRDSARNRSLHTGLVQQLNSAQRLHMPFILSNHDSFAGSRPA
FT                   TDLTLAEYRVASAIAILASDTPFTYYGEEIGMANGSQSGDPGLRTPMSWTANTSNAGFT
FT                   TATPYRGLSTNVASRNVAAQEGVAGSLLEHYRSLYQLRNQYPVLAMGELQLQSNTGNSH
FT                   VVFRRTLADGVAAILINLSNSAQVLTADIGQANLSLSQRLPDSSVTVMTDNAGNVSLSV
FT                   PAQSVVVISN"
FT   gene            498743..499009
FT                   /locus_tag="CJA_0399"
FT   CDS_pept        498743..499009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0399"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85126"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI60"
FT                   /protein_id="ACE85126.1"
FT                   /translation="MRKLLFIALASFSSLAIAGPQCTETDKSQWLDQAKFQEDLKSQGY
FT                   DIKVFKVTDGNCYEIYGWNKDKQKVEIYFDPVTGAVVKEEIDD"
FT   gene            499009..499548
FT                   /locus_tag="CJA_0400"
FT   CDS_pept        499009..499548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0400"
FT                   /product="cytochrome b561 family protein"
FT                   /note="identified by match to protein family HMM PF01292"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85367"
FT                   /db_xref="GOA:B3PI61"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI61"
FT                   /protein_id="ACE85367.1"
FT                   /translation="MASPTVTLWDPLVRVFHWSLVIIFVSNMYLNEQGGDWHQWLGYAA
FT                   VVLLLVRFLWGFIGKGAARWSDFFPTPARLKQHVRALVCGEPCHRLGHSPLGALVMILM
FT                   MLAVLALGITGYMMEEIDYFWGEDWVENLHGIIANSLLGLVIVHILAAVVESVRLRENL
FT                   PLSMVTGKRRNLPSDD"
FT   gene            complement(499581..501404)
FT                   /locus_tag="CJA_0401"
FT   CDS_pept        complement(499581..501404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0401"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF00884"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84178"
FT                   /db_xref="GOA:B3PI62"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012159"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024588"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI62"
FT                   /protein_id="ACE84178.1"
FT                   /translation="MERKYLIAHGYFTLWVLLLSLAPLLSFWWVMPRPDHLMGEIYRFT
FT                   TLGYYGLLLSVIAVLCLPLSTSRWTRPLYAILLAGWLLYLVIDVATFNLYLFHVDWVMI
FT                   EMFLMDFTGLGVPVFLLVLAGLLALATCAVLCWLSAKTPSMAFAQRGKPLLLAVGLFIV
FT                   LLTGNSIINIWADRYHRQEISYITPYLPLYQPITSSKHAEPLARLLPGIFPAEFGTLDR
FT                   EAVQEKSVIQYPLEPLQCTPPEKPASILMLVVESWQADALNPEVMPNLSRFSEQALRFD
FT                   RHISGGSATVPGLFSLFFGLHASYYPAFKATPDANPSLFTETLANLGYDTRVYTNTNLE
FT                   RFSLRRLIFPRVPENHFSQQETDRRVVNDFLKRNTKVNRTPQFDFVFLTSSHSPYKYPR
FT                   QFAYFHPLPKVKGGYALNKHSDNRVYKNDYYNSLVYVDHLLGEILQQLEQTGALENTWV
FT                   VITGDHAEEFNENQAGFWGHGSNFTRWQTQTPLLVRAPGKVLPAHEPRPSTHQDIVPTL
FT                   MHEVLGCTTARESYSTGENLLALPEHRNSVISSYYNHAYWVDGTILDRSTGKEYQWNDF
FT                   NQRANSIDKDRLHQLRAEERRFFKSKASLRE"
FT   gene            complement(501653..502036)
FT                   /locus_tag="CJA_0402"
FT   CDS_pept        complement(501653..502036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0402"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAO58569.1; match to
FT                   protein family HMM PF06155"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85291"
FT                   /db_xref="InterPro:IPR010376"
FT                   /db_xref="InterPro:IPR038492"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI63"
FT                   /protein_id="ACE85291.1"
FT                   /translation="MTPTKIQLHKQSRQLELHFGPEQFVLSAEFLRVHSPSAEVKGHGP
FT                   GQAVLQYGKRDVGIQRIERAGNYALKLVFDDGHETGIYTWDYLYQLGKQQASLWESYLT
FT                   ELHNAGKTRQANTSVVRLIDPAQ"
FT   gene            502148..502267
FT                   /locus_tag="CJA_0403"
FT   CDS_pept        502148..502267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0403"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85533"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI64"
FT                   /protein_id="ACE85533.1"
FT                   /translation="MLSRTNNNSLVLLNKIRINIMENMHKKTAAYYWLPFLNG"
FT   gene            complement(502284..503606)
FT                   /gene="hslU"
FT                   /locus_tag="CJA_0404"
FT   CDS_pept        complement(502284..503606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslU"
FT                   /locus_tag="CJA_0404"
FT                   /product="heat shock protein HslVU, ATPase subunit HslU"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM TIGR00390"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82854"
FT                   /db_xref="GOA:B3PI65"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PI65"
FT                   /protein_id="ACE82854.1"
FT                   /translation="MSSMTPREIVHELDKHIVGQQDAKRAVAIALRNRWRRMQLPADMR
FT                   SEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGRDVESIIRDLV
FT                   DVAIKLRREQAMKAVQYRAAEAAEERILDVLLPPARDTSEEESKHESSTRQIFRKKLRE
FT                   GQLDDKEIEIDVAAASVGVEIMAPPGMEEMTSQLQNMFSSLGRERTKKTKMTVKKAFKQ
FT                   LQDEEAAKLVSEEDIKTQALETVEQNGIVFIDEIDKVARRGNVSGADVSREGVQRDLLP
FT                   LIEGCTVSTKHGMVKTDHILFITSGAFHLSKPSDLIPELQGRLPIRVELQALTPDDFER
FT                   ILTEPKASLTEQQQALLKTEGVDIQFTQDGIRRIAETAFDVNERTENIGARRLHTILER
FT                   LLEDVSFDAGNDTSSIRIDGAYVDAHLGELAKNEDLSRYIL"
FT   gene            complement(503656..504180)
FT                   /locus_tag="CJA_0405"
FT   CDS_pept        complement(503656..504180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0405"
FT                   /product="peptidase, T1 family superfamily"
FT                   /note="identified by match to protein family HMM PF00227"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84840"
FT                   /db_xref="GOA:B3PI66"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PI66"
FT                   /protein_id="ACE84840.1"
FT                   /translation="MTTILSVRRDGQVVIGGDGQVSLGNTVMKGNARKVRRLYKNQVLA
FT                   GFAGGTADAFTLFERFEAKLESHNGQLTRAAVELAKDWRTDRSLRRLEALLAVADKEAS
FT                   LIITGNGDVIQPEDDLIAIGSGGMYAQAAARALLENTQLDARNIVEKGLKIAGDICVYT
FT                   NQNHTIEVLDY"
FT   gene            complement(504270..504818)
FT                   /locus_tag="CJA_0406"
FT   CDS_pept        complement(504270..504818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0406"
FT                   /product="Sporulation related repeat family"
FT                   /note="identified by match to protein family HMM PF05036"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83308"
FT                   /db_xref="GOA:B3PI67"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI67"
FT                   /protein_id="ACE83308.1"
FT                   /translation="MSRDYAKKSRSPNRKSSTGNHTPGWVWFIVGGILGAFAASLYFIK
FT                   HPVEVVKPAKEAPKPKAQSDIPKPRFDFYKLLQESETIVPASETNSPEDKPAAEKDTTE
FT                   YILQVGSFPGAEDADKLRAQLILINLDARIEKVEIRKGEIWHRVVVGPFASQAALTKAR
FT                   TTLVNNQYNALVLKRAKTR"
FT   gene            complement(504878..507073)
FT                   /gene="priA"
FT                   /locus_tag="CJA_0407"
FT   CDS_pept        complement(504878..507073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="priA"
FT                   /locus_tag="CJA_0407"
FT                   /product="primosomal protein N`"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271; match to protein
FT                   family HMM PF04851; match to protein family HMM TIGR00595"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84106"
FT                   /db_xref="GOA:B3PI68"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI68"
FT                   /protein_id="ACE84106.1"
FT                   /translation="MTILEVALPTPLRRRFDYLLPGNWSGDNPMPGSRVKVPFGNQELI
FT                   GLLITCKSHSHLAEHKLKPALEILDEIPVMDTELLELSLWAADYYQCAPGEALQTALPV
FT                   LLRQGVPAHLAGETVFTLTPEGKGLPQGALKRSPKQAALLAALQQQDYLRRSDLAPLGI
FT                   SRPILKQLQDKGLVETKELLPERPDTLHLLREQPLVLGDEQTKVMASLHTEGFTTYLLD
FT                   GATGSGKTEIYLQAIEKVLTQGKQALVLVPEIGLTPQTLARFHRRFAAPVVTLHSGLND
FT                   RERLDAWLQARAGHASIIIGTRSAIFTPLAKPGIIIVDEEHDGSFKQQDGFRYSARDLA
FT                   VMRAQRLGIPLILGSATPSLESLHNAQSQRYQHLQLRARAGSAIPPELRLLDIRNQALH
FT                   EGFAAASLAAIDATLKAGNQVLVFLNRRGYAPALECHACGWLAQCNHCDARLTLHQSPR
FT                   HLHCHHCDHQRAVPHTCPECKSPQLFPLGQGTERSESALQQLFPQVPVIRVDRDSTRAK
FT                   DGMQKLLAGVHQGIPCILVGTQMLAKGHHFADVTLVVIIDADAGLFSTDFRGPERMGQL
FT                   LLQVAGRAGRAEKPGQVLIQSYHSDHPLMQTLVSRGYHTLAEQILHERQLTQMPPYRHL
FT                   ALLRAESQRPELALQFLERARLLAEDTLPPSPLLSYLGPLPAMMEKRGDRFRYQLQFNA
FT                   AQRKPLQQLLSQLALQLEADPLGRRVRWALDVDPQEM"
FT   gene            507207..507485
FT                   /gene="hip"
FT                   /locus_tag="CJA_0408"
FT   CDS_pept        507207..507485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hip"
FT                   /locus_tag="CJA_0408"
FT                   /product="High potential iron-sulfur protein (HiPIP)"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85199"
FT                   /db_xref="GOA:B3PI69"
FT                   /db_xref="InterPro:IPR000170"
FT                   /db_xref="InterPro:IPR036369"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI69"
FT                   /protein_id="ACE85199.1"
FT                   /translation="MKRREFIKWSGLIAGSSLISAYELQAQEPLSEDNPQAKALGYVEQ
FT                   SEAAARHCTNCLQATGDLSAEWVGCKIFPGKLVKGAGWCKVWSPRPA"
FT   gene            507595..507870
FT                   /gene="rpmE"
FT                   /locus_tag="CJA_0409"
FT   CDS_pept        507595..507870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmE"
FT                   /locus_tag="CJA_0409"
FT                   /product="50S ribosomal subunit protein L31"
FT                   /note="identified by match to protein family HMM PF01197;
FT                   match to protein family HMM TIGR00105"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85257"
FT                   /db_xref="GOA:B3PI70"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI70"
FT                   /protein_id="ACE85257.1"
FT                   /translation="MCGAWPMPGWRHTLFKASVMKPEIHPSYKEVTVNCSCGNNFQTRS
FT                   TLGKDFHVDVCNECHPFYTGKQKEASTGGRVDRFTKRFGSRIAVKK"
FT   gene            507875..508765
FT                   /locus_tag="CJA_0410"
FT   CDS_pept        507875..508765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0410"
FT                   /product="staphylococcal nuclease homolog"
FT                   /note="identified by match to protein family HMM PF00565"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACE86348"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI71"
FT                   /protein_id="ACE86348.1"
FT                   /translation="MVRVTASHKKTPSALGLGVFLWRTIHGRHPSGRRCTTLKMAPGHF
FT                   LWLLLTLSLHSLADCGQGDGRWFTVERVVDGDTLRLSDGRSVRVLGMNAPELDRKGQPG
FT                   QSLGVEAKRAAELFVEQAKGRVQLGLEQEQRDHYGRVLAHVYNPQGQSLAVSLLQQGLA
FT                   FPIAVPPNIDQAECLFAAHEEARQVRRGIWGKAAWKAKPATQLNQRDTGFQRIKGRIEK
FT                   VDINSAVWLELEGALVLRIAREDWPYFSYTANDWKSLKGKSLEVQGWVTARRNTNPSFK
FT                   PLVMAVRSPLVLRFD"
FT   gene            complement(508779..511241)
FT                   /gene="gt51D"
FT                   /locus_tag="CJA_0411"
FT   CDS_pept        complement(508779..511241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gt51D"
FT                   /locus_tag="CJA_0411"
FT                   /product="murein polymerase, putative, gt51D"
FT                   /EC_number="2.4.1.129"
FT                   /note="identified by match to protein family HMM PF00905;
FT                   match to protein family HMM PF00912; match to protein
FT                   family HMM TIGR02074"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84037"
FT                   /db_xref="GOA:B3PI72"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031376"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI72"
FT                   /protein_id="ACE84037.1"
FT                   /translation="MPAFRSVFANPLIHIEKMPSMKSLFRVFFWLLLSGLSVTLVASAG
FT                   LYLYLSPKLPPVDSLREVKLQTPLRVYSSDGKLIGEFGEQRRTPLKYDQIPPLYIKALL
FT                   AAEDAEFFEHHGVSLRGLVRAGSHLLKSGQIQSGGSTLTMQLARDFFLTRKQIFSRKFN
FT                   EILLSIEIERKFTKEEILELFNNKMFFGNRAYGLQAAAQIYYGRDVQDLSAAQYAMIVG
FT                   VLKAPSAYNPLANPKRAMIRRDWILGRMHKLNYIDQATYQAAINEPNTASYHGTTLDVN
FT                   APYVAEMARQEALDRFGEATYIDGYRVYTSVDSSLQAAAQTALIRGLMDYDQRHGYRGP
FT                   ERHLKPSTDQDYNDWLDELQTIPVLGGLLPAAVLEVKPREIKVLLSDSDIVELTWEQGF
FT                   ENLRPYLTEDSRGAVYKAATEFLKTGDVVRIIRDADGNWRFNQVPAVQSALVALDPVDG
FT                   AIRSLVGGFDFKQSHFNRVTQGARQPGSSFKPLLYTAALENGFTPASIINDAPIVIENT
FT                   GSGVAWRPENDDGKFVGPMRLRQALYRSRNLVSIRLLRAIGMQNALDSLERFGFNKRDF
FT                   PRDLTLALGTHELTPLQMATAYASFANGGFKVTPYLVTRIEDSNGRIVYEANPQKVCRS
FT                   CAQPNQPELDETGQAAQPVTVTNAAPRIIDERIAYLMDSMLKDVVEKGTGRLAKQRLER
FT                   SDLAGKTGTTNGPRDTWFAGYNPKMVATVWVGFDQNTLLGRREFGSSAALPIWIDFMRA
FT                   ALEGMPEQLRRQPEGIVTVRINPDTGKPAQSGDPDAIFEVFLSEDRGRTASSSLEETEQ
FT                   ATLPEELF"
FT   gene            511345..512412
FT                   /gene="pilM"
FT                   /locus_tag="CJA_0412"
FT   CDS_pept        511345..512412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilM"
FT                   /locus_tag="CJA_0412"
FT                   /product="type IV pilus assembly protein PilM"
FT                   /note="identified by match to protein family HMM TIGR01175"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83309"
FT                   /db_xref="GOA:B3PI73"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR005883"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI73"
FT                   /protein_id="ACE83309.1"
FT                   /translation="MGILSFLDKKAKPVIGLDISSTSVKLLELTRSGDRYRVESYSVKP
FT                   LPPNAVVEKNIADPVAVAEVIRTMVKQSKTKLKHAAVAVAGSAVITKVIDMPAELNEDA
FT                   MESQIAAEADQYIPFPLEEVALDFEIQGPSPRNPEQVEVLLAACRRENVEVREQVLAES
FT                   GLLAEKVDIEAYCMERAFELIAEQLEDQEGQVVAIIDIGATMTTLSVLVDGKTVYTREQ
FT                   LFGGRQLTEEIQRRYGLSREEAGLAKKQGGLPDDYEMEVLNPFKDAVVQQVTRSLQFFF
FT                   SASQYNDVDYIILAGGVASLEGLVGLIEEKLGTQTVVANPFARMSVSSRVNAVSLATDA
FT                   PSLMIVTGLAMRSFD"
FT   gene            512412..513002
FT                   /gene="pilN"
FT                   /locus_tag="CJA_0413"
FT   CDS_pept        512412..513002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilN"
FT                   /locus_tag="CJA_0413"
FT                   /product="type 4 fimbrial biogenesis protein PilN"
FT                   /note="identified by match to protein family HMM PF05137"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83007"
FT                   /db_xref="GOA:B3PI74"
FT                   /db_xref="InterPro:IPR007813"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI74"
FT                   /protein_id="ACE83007.1"
FT                   /translation="MAKINLLPWRQAYREEKKREFLVVIGFVLGLSVLGAYLWISSVEA
FT                   SIDNQNSRNRLLDQEIKKLDEQVKEISELKKVRDDLLARIKVIQDLEGTRPVIVRYFDE
FT                   FAKAVPDGVYVTMVDKKGSAITIEGVAESYNRVASFMRNLDASDWFASPNLTSVTAAPS
FT                   EGEQASSFKMTVQTSAPADADPAAASTSTGAAK"
FT   gene            513002..513655
FT                   /gene="pilO"
FT                   /locus_tag="CJA_0414"
FT   CDS_pept        513002..513655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilO"
FT                   /locus_tag="CJA_0414"
FT                   /product="pilO"
FT                   /note="identified by match to protein family HMM PF04350"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85997"
FT                   /db_xref="GOA:B3PI75"
FT                   /db_xref="InterPro:IPR007445"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI75"
FT                   /protein_id="ACE85997.1"
FT                   /translation="MSLQDSINKLNEFDVNDIDFDKIGVWPLPAKIAVCTLLVVIVIAL
FT                   TYYLKISDLNMQLASVEAKEKTLRQTFQTKSFEAANLDAYKAQMEEMKVTFDSLLSRLP
FT                   AKTEVPGLLEDIGTRGSESGLTINSVAIQPDVVAEYYIEVPIAIDVKGGYHDMGGFVSG
FT                   VAGMPRIVTLHDFTISSLKDDRGLNMKIAAKTYRYKTQEQDGGSTAVRAGGQIK"
FT   gene            513652..514176
FT                   /gene="pilP"
FT                   /locus_tag="CJA_0415"
FT   CDS_pept        513652..514176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilP"
FT                   /locus_tag="CJA_0415"
FT                   /product="type IV pilus biogenesis protein PilP"
FT                   /note="identified by match to protein family HMM PF04351"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84579"
FT                   /db_xref="InterPro:IPR007446"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI76"
FT                   /protein_id="ACE84579.1"
FT                   /translation="MRLCSLACILALFLLSGCGQSGQYQDLQDFMAETKRRPKGQIEPL
FT                   PTFRPYQPFVYSAMTLRSPFEKPVPVDESAAKGGRSVSPDFNRVKEFLEGFNVTSLKMV
FT                   GSISKEDKLWALIDNGEGSVVPATIGNYLGKNHGKIISADLMQIEIMEIVADGSSGWVE
FT                   RPRIIKLEEKE"
FT   gene            514213..516357
FT                   /locus_tag="CJA_0416"
FT   CDS_pept        514213..516357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0416"
FT                   /product="fimbrial assembly protein PilQ"
FT                   /note="identified by match to protein family HMM PF00263;
FT                   match to protein family HMM PF03958; match to protein
FT                   family HMM PF07660"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83780"
FT                   /db_xref="GOA:B3PI77"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR013355"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI77"
FT                   /protein_id="ACE83780.1"
FT                   /translation="MRKIAILIVCFASALANANSINKIDFSQLPGERFEVHIGFDSVPP
FT                   EPKGYTIERPARIVLDFPDTSSSLKERRFPLAVDNGQSALLLASEGRTRLILNLNQLST
FT                   YTTRTDGNSFIVEVGAAQVGGAKSNAQHGSGLISNASGGLSAQDSIKGVRVTNIDFRRG
FT                   ATGEGRVIVSLSNPKVSANMVGTGTGVRLSFKDVWLPPELRRRLDVVDFATPVSLVAAA
FT                   QDGENSVLNISASGDFDYLAYQTDNEYVVSIKPLTEREKQEKKKDFEYTGQKLSLDFQD
FT                   IEVRAVLQIIADFTDLNLVASDTVQGRITLRLQNVPWDQALEMVLKNKGLDKRQVGNVL
FT                   MVAPAAEIAERERQEIATKKQLEELAPLRTEYIRVRYANAKEMFELFRGGQGAGSGRGG
FT                   ASAGGQGGNQSTGSVLSERGQGIVDERTNSIIITDTADRIEAFRRLVEQIDIPIRQVMI
FT                   ESRIVIANTDFERQLGIRWGGAGYHLNNSRLINVAGSQSGLDDEDGTSPANWFTNGGTL
FT                   NLTENNMVNLPVNNPAGSIAVGVLTDSVFLDMELSALETSGYAEIVSQPKVITSDKQKA
FT                   VIKSGKEIAYQETSPSGGTTTGFKEAVLMLEVVPQITPDNRIIMDLFVTKDSVGEITQQ
FT                   GVPSLDVTRLQTKVLVNNGQTVVLGGVFSLESTKGESKVPVLGDIPYLGRLFKRTVDNQ
FT                   FKTELLIFVTPKLIADSLTN"
FT   gene            516358..516882
FT                   /locus_tag="CJA_0417"
FT   CDS_pept        516358..516882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0417"
FT                   /product="shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="identified by match to protein family HMM PF01202"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85168"
FT                   /db_xref="GOA:B3PI78"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI78"
FT                   /protein_id="ACE85168.1"
FT                   /translation="MSKSNVFLVGPMGAGKSTIGRLLAAELDFVFRDSDRVIEERTGAD
FT                   IPWIFDMEGEEGFRERESAVLSELAEERASVIATGGGIVLRELNRQLMKSSGYVCYLTA
FT                   SIDQLVERTARDKKRPLLQVENPRQKIIDLVTLRDPLYRDAADVIVNTDRRPPKSVAQE
FT                   IAALVKNRGLT"
FT   gene            517026..518117
FT                   /gene="aroB"
FT                   /locus_tag="CJA_0418"
FT   CDS_pept        517026..518117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroB"
FT                   /locus_tag="CJA_0418"
FT                   /product="3-dehydroquinate synthase"
FT                   /EC_number="4.2.3.4"
FT                   /note="identified by match to protein family HMM PF01761;
FT                   match to protein family HMM TIGR01357"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84122"
FT                   /db_xref="GOA:B3PI79"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI79"
FT                   /protein_id="ACE84122.1"
FT                   /translation="MTMHVLNVDLGDRSYPIYIGEHLLAQGELLHRHIKGRQICIVTNE
FT                   TIAPLYLRPVQESLAGHQVDTCVLPDGEAYKTLAVLNQVFDKLLGARHNRTTTLIALGG
FT                   GVVGDMTGFAAACYQRGVDFIQIPTTLLSMVDSSVGGKTGVNHPLGKNMIGAFYQPQAV
FT                   LADMALLRTLPERELSAGIAEIIKYGLIGDYPFFVWLEQNMDALMARDMDALAYAVKRS
FT                   CENKADVVAQDEREGGLRAILNFGHTFGHAIETAQGYGNWLHGEAVGAGMAMASDLSWR
FT                   RGAISDGELARILSLLERSKLPTKAPADMTPEQFTSLMGVDKKVLDGRLRLVLLESMGK
FT                   AITTSDINPDQLQQTFVACRAGA"
FT   gene            518261..519805
FT                   /locus_tag="CJA_0419"
FT   CDS_pept        518261..519805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0419"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83514"
FT                   /db_xref="GOA:B3PI80"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI80"
FT                   /protein_id="ACE83514.1"
FT                   /translation="MADYRQRYGLAEDPFSDDYSFPLFTGAGRRQVLDRLLHLCQFSSS
FT                   LLVVMGDYGVGKTRVAHGFMDSLSEHDKLSYLPLKSGQTSRELLAAMVEDLDLGCDGEP
FT                   TETSLLACLDHMMAVDPLEDDGLAVVVIDNAHLLAGETLQLLADLLQRHPQQTSLHLVL
FT                   FGEPVLMDNLDRCNLESLLLNDFYLQPFTLAETVDYLNFRMEMADYLGPEIFTESMVNP
FT                   WWRQAQGQLSIIHQSAQERLLESVVTQTSAPLVSKRNLPVMHILAISGLIALVAVLFLY
FT                   MDEDSSEQPAAAVSVPAPASAPVASSGVDLTRTDTPVQPIMPSLPATQASQPALAPAPS
FT                   AEDKVVPLAELPVSSRPQEPAIHVPAPTQVAAPPQPVAVPEHKPQTVPVAAEPKPQPSA
FT                   SKPQAAAAKPVAATAGSAQERTILGWPASHYTIQLLGVSNEKAARDYIAAQPNKADLLM
FT                   FKSKRQGKDWFVVITGRYPSTVQARQAMASLPSVQREAGPWPREIGAIQQEIRAAQ"
FT   gene            complement(519866..520258)
FT                   /gene="gcvH"
FT                   /locus_tag="CJA_0420"
FT   CDS_pept        complement(519866..520258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvH"
FT                   /locus_tag="CJA_0420"
FT                   /product="glycine cleavage system H protein"
FT                   /note="identified by match to protein family HMM PF01597;
FT                   match to protein family HMM TIGR00527"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACE86272"
FT                   /db_xref="GOA:B3PI81"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PI81"
FT                   /protein_id="ACE86272.1"
FT                   /translation="MSDIRKELKYLSSHEWARVEEDGTVTIGITDHAQDALGDVVYVET
FT                   PEVGSRVSLGEEAGVVESVKAASDIYSLVSGKVVAVNELLQDAPETVNSSPYDEGWFFR
FT                   VQPDDVSELDEALSADEYRELLESEE"
FT   gene            complement(520301..521416)
FT                   /gene="gcvT"
FT                   /locus_tag="CJA_0421"
FT   CDS_pept        complement(520301..521416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvT"
FT                   /locus_tag="CJA_0421"
FT                   /product="glycine cleavage system T protein"
FT                   /EC_number="2.1.2.10"
FT                   /note="identified by match to protein family HMM PF01571;
FT                   match to protein family HMM TIGR00528"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85491"
FT                   /db_xref="GOA:B3PI82"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR022903"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PI82"
FT                   /protein_id="ACE85491.1"
FT                   /translation="MGNKTALYDIHQSMGGKIVDFGGWDMPLHYGSQIDEHHKVRQHAG
FT                   MFDVSHMTVVDVTGSDAKAYLQYLLANDVAKLDNLVGKALYSGMLNEQGGVIDDLIVYN
FT                   MGDWYRVVVNCSTREKDLAWMSQVANNYQVKLQERADLAMIAVQGPQAIAITKTLVSAE
FT                   AATLIDNLQVFQGLASTQQGSDWFFGRTGYTGEDGLEIMLPNEQAGTFWQALAAAGVAP
FT                   CGLGARDTLRLEAGMNLYGHEMDENISPLAANMGWTIAWQPEARNFIGRAALTAEKSAG
FT                   QRHKLVGLVLRERGVLRAEQLVHIANSDERGVITSGTFSPSLGYSIALARVPVTQVPLT
FT                   PGAQCQVEMRGKLVTVDVVAPGFVRQGKALV"
FT   gene            complement(521536..522105)
FT                   /locus_tag="CJA_0422"
FT   CDS_pept        complement(521536..522105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0422"
FT                   /product="YbcL"
FT                   /note="similar to Escherichia coli (strain K-12) YbcL;
FT                   identified by match to protein family HMM PF01161; match to
FT                   protein family HMM TIGR00481"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84733"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI83"
FT                   /protein_id="ACE84733.1"
FT                   /translation="MLKRTLFLAKATLLGSCLLASQALLAAEFTLGSPSIKPESTLTLD
FT                   QVFNGFGCTGKNISPALNWRGAPEGTKSFALTVYDPDAPTGSGWWHWVVYNLPANTQSL
FT                   PAGAGTVEGKDLPAGAAQGRTDFGTTGFGGACPPEGDKPHRYIFTLYALKVEKLEIPEG
FT                   ATAALIGYMINANRIDKASFTAYYSR"
FT   gene            complement(522133..523155)
FT                   /locus_tag="CJA_0423"
FT   CDS_pept        complement(522133..523155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0423"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83830"
FT                   /db_xref="GOA:B3PI84"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI84"
FT                   /protein_id="ACE83830.1"
FT                   /translation="MSFPVFVEILNPDGSVQARHTCHQLPIRLGRAYDNDIILDDPHTA
FT                   PHHAVIERNQLDELVLTDLESLNGISHNHQREAFFVVNGEQAYRLGRTRLRIRTRDFVV
FT                   APEQADDTNHHWEGWRPALAGLAILGLSSLLGSWLNDLNQQSAADYLLAVIYMMLFALG
FT                   WSGLWALLGRLFTGHPRFGRQLFITCCALVAVELWEHLRSIIAYALSWEWLATFTSPPI
FT                   IALIAVAFYFHLRTAGHKRPGRLKISLVSLTLVSSAIVMTTQYQSSKHLADELYLSNLY
FT                   PPALRLSRDQPAEAFIDEMQTLQARVDAQRKPKEKDDDKGEATSASAESASSSALPSDH
FT                   "
FT   gene            complement(523152..524558)
FT                   /locus_tag="CJA_0424"
FT   CDS_pept        complement(523152..524558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0424"
FT                   /product="trypsin domain protein"
FT                   /note="identified by match to protein family HMM PF00089"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82976"
FT                   /db_xref="GOA:B3PI85"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI85"
FT                   /protein_id="ACE82976.1"
FT                   /translation="MKIKHLALAGLLASTCQFTLAQDVASSSEPPSSAAQQLYATAQYD
FT                   LLQLRVLLKNGDSQSSVGSGFLIGTSNLVVTNYHVVSQIALEPETYLGQYKTTDGNSGS
FT                   IELLAVDVLHDLAVVRVDRRGSGFFHIPPQGDLAKLDQGERLYSLGNPLDLGFTITEGT
FT                   YNGISSRGFSDQLMFTGPVNPGMSGGPNITASGELAGVNVAHRRDGELVSFLVPASYVQ
FT                   ALLAKVSEDMVPPKDFEPIIGEQLLQHQTIMVDKLLEKPFTLKRLGSYQVPVRESDQVR
FT                   CWGGSNNSNKGYSSASIHCSMESEIFVSGDLQTGHITLRHKYLHSKKLNAMQFSRLVSS
FT                   EFGSQVYSTAKSDTITPAACYESFVRTNQLPVRALVCSEAYHQFPGLYDFTLITASTDD
FT                   PAKNLQSMINILGVSFDNGVRLAEAFLAGLDKAPTTAPLDEAVPLDDAATEEPPGQTPD
FT                   PDQNAREVLP"
FT   gene            complement(524652..525410)
FT                   /locus_tag="CJA_0425"
FT   CDS_pept        complement(524652..525410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0425"
FT                   /product="competence protein ComF"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85579"
FT                   /db_xref="GOA:B3PI86"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI86"
FT                   /protein_id="ACE85579.1"
FT                   /translation="MTTSPWLTRLLDHLLPCPCLLCDGDLDTTTDTTLLCQTCVQSLPL
FT                   LDSYRCHCCSLPLASTAYFCGQCLAEPASFTASIIPYRYAYPLDALIHRFKYQQQPSAG
FT                   RCLGKLLLQHIRQRLETDPRLRPDLLVPVPLHWRRRWQRGFNQASLLSRQLGQALGIAV
FT                   LPICTRLQHTHSQKGLNRQERLRNLRRAFAQEPKRCPAIQGKHLALVDDVVTTSATARC
FT                   LSELLVRAGAARVDIWALARTPAPGESNGL"
FT   gene            525588..526688
FT                   /gene="bioB"
FT                   /locus_tag="CJA_0426"
FT   CDS_pept        525588..526688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioB"
FT                   /locus_tag="CJA_0426"
FT                   /product="biotin synthase"
FT                   /EC_number="2.8.1.6"
FT                   /note="identified by match to protein family HMM PF04055;
FT                   match to protein family HMM PF06968; match to protein
FT                   family HMM TIGR00433"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84739"
FT                   /db_xref="GOA:B3PI87"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PI87"
FT                   /protein_id="ACE84739.1"
FT                   /translation="MPFLWMPVMNASFAPSSSFVAGLRHDWSRAEIKALFELPFSDLMF
FT                   QAQSVHRAWFNPNEVQVSTLCSIKTGACPEDCAYCPQSARYDTGLEKEKLMAVEKVIEE
FT                   ARAAKASGATRFCMGAAWRSPKGKDMPYVTAMVKGVKSLGMETCMTLGMLSEAQAQDLA
FT                   DAGLDYYNHNLDTSPEYYGEIITTRTYQDRLETLDNVRKAGMKVCCGGIVGMGEEVLDR
FT                   AGLLQQLANMAEHPESVPINMLVKVGGTPLEREADLDPIDFIRTIAVARILMPKSHVRL
FT                   SAGREQMNEQTQALAFLAGANSIFYGEKLLTTPNPEANKDMQLFNKLGIKPEAYDVHET
FT                   EEEQEAALVHQLEEAKLDAFFYNAAR"
FT   gene            526721..527923
FT                   /gene="bioF"
FT                   /locus_tag="CJA_0427"
FT   CDS_pept        526721..527923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioF"
FT                   /locus_tag="CJA_0427"
FT                   /product="8-amino-7-oxononanoate synthase"
FT                   /EC_number="2.3.1.47"
FT                   /note="identified by match to protein family HMM PF00155;
FT                   match to protein family HMM TIGR00858"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83909"
FT                   /db_xref="GOA:B3PI88"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004723"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022834"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PI88"
FT                   /protein_id="ACE83909.1"
FT                   /translation="MPMPSHLDQTLAAALSERRAQYRYRQRKLLQSPQTPELVVDGKTY
FT                   LAFCSNDYLGLANHPQVIAAQQQAAARWGAGSGASHLVAGHTQEHHALEEELAAFTGRQ
FT                   RALLFSTGYMANLGVISTLVGQGDGVFEDRLNHASLLDGGLLSGARFQRFLHSDINNLQ
FT                   ARLRKTDAARKLVVVDGVFSMDGDCAPLPQLAQVCAQENAWLMVDDAHGFGVLGETGAG
FT                   TCEHFGLDQQQVPVLMGTLGKALGSFGAFVAGSETLIETLINFARPYIYTTAMPPPVAA
FT                   ATRASLRLVQSEAWRRTHVQQLIAQFRNGAQDLGLQLMDSFSPVQPLLVGSEAKALAIA
FT                   EALAHRGILIIAIRPPTVPVGSSRLRITLSAAHTEAQVAQLLDVLGEVMNSTAIRGLAD
FT                   D"
FT   gene            527916..529424
FT                   /gene="bioC"
FT                   /locus_tag="CJA_0428"
FT   CDS_pept        527916..529424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioC"
FT                   /locus_tag="CJA_0428"
FT                   /product="biotin biosynthesis protein BioC"
FT                   /note="identified by match to protein family HMM PF00561;
FT                   match to protein family HMM PF01209; match to protein
FT                   family HMM TIGR02072"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82969"
FT                   /db_xref="GOA:B3PI89"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR011814"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PI89"
FT                   /protein_id="ACE82969.1"
FT                   /translation="MTRPVLVLVHGWGCDSRTWQPVLDGLRELVPVQLVDLPGFGNTPA
FT                   LETFSLPAVLAAIESQLPERCVLLGWSLGAMLAVQLAARLPQQVLGVISLAANARFVAS
FT                   DDYPHAMAPDVNRQFNSRFAEQPQAALKMFTGLLAQGDVQERALLKQLRTQVPDAINHN
FT                   WAQALQLLAELDNRAALVQLSQPLLHLLAEQDALVPIAAAESLRGLNSQHQIHVIAGSA
FT                   HAVHWSQPQQLISAVQDFYETLATAVDKKRVAQSFGKAAATYDSVAGLQRAVGAQLLDY
FT                   LPAQLDRTRLLDIGSGTGFFTAQLATRGAEVIALDIAQGMLDFARQQHPQAADWVCGDA
FT                   ENLPFAQSSVDFIFSSLVIQWCARVPQLMQELARVLKPGGRAYISTLGPGTLVELKRAW
FT                   QQVDNYVHVNRFVGRTSLEQAVQQAGMQCLAFVESTRRLYFSRLRDLTHELKALGAHNI
FT                   NPGQAQGLTGRQRLQAFSLAYERERSPQGLPASYEVYYLVLCKP"
FT   gene            529444..530130
FT                   /gene="bioD"
FT                   /locus_tag="CJA_0429"
FT   CDS_pept        529444..530130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioD"
FT                   /locus_tag="CJA_0429"
FT                   /product="dethiobiotin synthase"
FT                   /EC_number="6.3.3.3"
FT                   /note="identified by match to protein family HMM TIGR00347"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACE86043"
FT                   /db_xref="GOA:B3PI90"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PI90"
FT                   /protein_id="ACE86043.1"
FT                   /translation="MSKKAFFITGTDTDAGKTLVATGLLAAARLRGLSTLGLKPVAAGC
FT                   TRTEQGLRNSDALALQAQSTLPVVYEQVNPVALEAAIAPHIAALQEKRSLSADRLAGFC
FT                   RSSLRQADFTLVEGAGGWRVPLNPSETLANLAQLLRLPVVLVVGMRLGCINHALLTVEA
FT                   IRNDGLPLVGWVANVLDADMPVLEENIASLAQRIPAPCLGVVPRLSMASADAASAHLDL
FT                   TPLLDA"
FT   gene            530133..530831
FT                   /locus_tag="CJA_0430"
FT   CDS_pept        530133..530831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0430"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85178"
FT                   /db_xref="InterPro:IPR011727"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI91"
FT                   /protein_id="ACE85178.1"
FT                   /translation="MEIVARLRAGLGVCVLVLLLSGCVSSPREADVPLRDTQHVIYFIY
FT                   QGWHTSLLLEAEPVRRYSRHLQADVVGQDYVRIGWGDGDYFTGKSKSMGTATRALFVSD
FT                   YSAVQVLTYRQSPLAHIPSETRVPLAITERSFKRLVRYLDSAFALDAQRQLIRLPAYEE
FT                   NTGTFYRAEQHYSLFSNCNTWSGRALQAAGLPVRSRLHLTAQSVFEQARTISRIQMAHG
FT                   LVPAASNPGL"
FT   gene            531004..531270
FT                   /locus_tag="CJA_0431"
FT   CDS_pept        531004..531270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0431"
FT                   /product="Domain of unknown function (DUF1078) family"
FT                   /note="identified by match to protein family HMM PF06429"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85275"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI92"
FT                   /protein_id="ACE85275.1"
FT                   /translation="MDVGSVVNQGLIGMQTSQASMLQSAQQIARAGTAQPTPANQPAPQ
FT                   ASQEQDLVEPLVNLRVQAQVFDANAKVVKTAEETIGTLLDVKA"
FT   gene            531284..532159
FT                   /locus_tag="CJA_0432"
FT   CDS_pept        531284..532159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0432"
FT                   /product="srpA-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84044"
FT                   /db_xref="InterPro:IPR021973"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI93"
FT                   /protein_id="ACE84044.1"
FT                   /translation="MIGPIPSNFANAIAPYAPVGRQPVSQETSDLKESSFRPAEQLDEA
FT                   ARSENRRLPDERRNDEVEQDRVSRNRSQADDQRSAQRDREQLELEQVQELAARDREVRA
FT                   HEQAHAAAAGQYASSPSYEYVRGPDGVSYAVGGSVQIDTSPIPGDPEATLRKAEQLQRA
FT                   ANAPAGPSGQDRQVAAQVAQMEQQARAEIREQAAIEAEQQAEQVREEEEQRRLADSERE
FT                   SERLAAERAREEQVQAGFSEEQRQLDQRRARADLFNQASQRNIDINRRLIEIGVFPGAN
FT                   AAGRLFDSRA"
FT   gene            532265..532343
FT                   /locus_tag="CJA_3844"
FT   tRNA            532265..532343
FT                   /locus_tag="CJA_3844"
FT                   /product="tRNA-Met"
FT   gene            532489..533079
FT                   /locus_tag="CJA_0434"
FT   CDS_pept        532489..533079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0434"
FT                   /product="Uncharacterized BCR, YhbC family"
FT                   /note="COG0779 family; identified by match to protein
FT                   family HMM PF02576"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACE86031"
FT                   /db_xref="GOA:B3PI94"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PI94"
FT                   /protein_id="ACE86031.1"
FT                   /translation="MKWALGPFLFSGSGTVQRAPVRVRWQAQVVVVMASKQERLTDLIV
FT                   PVVESLGCELWGLEYLTQGRYTTLRIFIDGPQGVSLDDCERVSRQISAVLDVEDPIDGE
FT                   YTLEVSSPGLDRPLYTEAQYARYVGETVNLRLRIAVEGRRRFKGVISAIEEGALLLQFD
FT                   NQTVRLPIETIDKGNLVPRYDDILREHAAGLDE"
FT   gene            533180..534661
FT                   /gene="nusA"
FT                   /locus_tag="CJA_0435"
FT   CDS_pept        533180..534661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusA"
FT                   /locus_tag="CJA_0435"
FT                   /product="N utilization substance protein A"
FT                   /note="identified by match to protein family HMM PF00013;
FT                   match to protein family HMM PF00575; match to protein
FT                   family HMM PF00633; match to protein family HMM TIGR01953;
FT                   match to protein family HMM TIGR01954"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85136"
FT                   /db_xref="GOA:B3PI95"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR010214"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI95"
FT                   /protein_id="ACE85136.1"
FT                   /translation="MNKEILLVADAVSNEKGVDKELIFQAIETALATATKKRFDEDSTI
FT                   EVIINRTTGDYETWRSWDVVSDDILAELGTQFTLEEAHEKDTSLKAGDVYREKIENAEF
FT                   GRIAAQTAKQVIVQKVREAERAQMVDEYRDRMGELVSGTVKKVTRDSIIVDLGNNAEGV
FT                   LPRDQLIGREIFRMGDRVRALLLDVRTEARGPQLLLSRSAPQMLVELFKIEVPEIAEEV
FT                   IEIKGAARDPGLRAKIAVKTNDGRIDPVGACVGMRGSRVQAVSNELGGERVDIVLWDDN
FT                   PAQFVINAMSPAEIESIVVDEDARSMDLAVNEENLAMAIGRGGQNVRLACELTGWNINV
FT                   MSVADWQAKQEAESGSYIQIFMSALDVDEDIAGVLVEEGFTTLEEVAYVPLEEMLAIDG
FT                   FDQDIAEELRARAKDALLTQALASEERLEGVAPAEDLLSMEGMDSQLAIRLASRGIVTM
FT                   EDLAEQSIDDLLDIEGVDETRAAALIMKAREPWFV"
FT   gene            534715..537507
FT                   /gene="infB"
FT                   /locus_tag="CJA_0436"
FT   CDS_pept        534715..537507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infB"
FT                   /locus_tag="CJA_0436"
FT                   /product="translation initiation factor IF-2"
FT                   /note="identified by match to protein family HMM PF00009;
FT                   match to protein family HMM PF03144; match to protein
FT                   family HMM PF04760; match to protein family HMM TIGR00231;
FT                   match to protein family HMM TIGR00487"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84775"
FT                   /db_xref="GOA:B3PI96"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR013575"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PI96"
FT                   /protein_id="ACE84775.1"
FT                   /translation="MAEVTVNELATSIGAPVERLLKQMQEAGLQHKTASAKVSDEEKQR
FT                   LLAYLKGSHGEAAVEPRKITLQRKTTTTIKTGTGNAKKTVNVEVRKKRTYVKREDDVVD
FT                   NTQAAQSQEQDDELASTVVEEVQQAEPSVVPVVDVAPEPEPEPVVEEVDVAAEEAEPVE
FT                   AAVDTSAPTRFSFTDGIEEKRRAAIERRQAEEAARQAELKAIEEAKRAAEEAKRTQPRA
FT                   EKPADKSAAAGKGAKPDNRQPAKGKQAPVAVPVEREDAKHGHGHKKHHHGRNDDDFDDD
FT                   SADRGNKRGAGKAVKKAAAPKKSSKIDLLDFVGDDSEDSDVLARRSHIRAHHKKNNKHA
FT                   FKKPTTQIVHEIDIPETIAVSELAQRLTIKVGELIKRLMKMGVMASMNEQIDQDTAVLI
FT                   VEELGHKANLVSENDIEHALEKSLETAGELTTRAPVVTVMGHVDHGKTSLLDYIREAKV
FT                   AAGEAGGITQHIGAYRVTTSRGEITFLDTPGHAAFTAMRARGAKATDVVILVVAADDGV
FT                   MPQTEEAIMHARAAEVPIVVAINKCDKPSADPDRVTNELVAKGVIPEAYGGDTQFVQVS
FT                   AHTGQGIDELLEAISLQAEVLELTAVTNAAAKGVVIEARVDKGRGTVATVLVQQGTLKQ
FT                   GDLILAGQSYGRVRAMVNERGEQVKEAGPSTPVEILGLDMPPSAGDDFVVLDDERKARE
FT                   VAAFRAEKERKEKLARFQAAKLENMFSNMEAGQKKTLTVVIKADVRGSLEAIQASLADI
FT                   GNDEVQVNVISSGIGGITENDVNLAVTSGAIIVGFNVRADGATRRLAETEGVDIRYYSI
FT                   IYQLLDEVKAALSGMLDPERVETIVGIANVREVFNSPKFGQVAGCMVVEGTVYRNKPIR
FT                   VLRDNVVIFTGELESLRRFKDDVNEVRNGFECGIGVKNYDVKVGDQIEVYEVKEVARQL
FT                   "
FT   gene            537609..538019
FT                   /gene="rbfA"
FT                   /locus_tag="CJA_0437"
FT   CDS_pept        537609..538019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbfA"
FT                   /locus_tag="CJA_0437"
FT                   /product="ribosome-binding factor A"
FT                   /note="identified by match to protein family HMM PF02033;
FT                   match to protein family HMM TIGR00082"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83776"
FT                   /db_xref="GOA:B3PI97"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PI97"
FT                   /protein_id="ACE83776.1"
FT                   /translation="MPREFTRSDRVSDAIQRLLAQVIPQEVRDPRLGMVNINAVAVSRD
FT                   MAFAKVYVTFVGVTDEPKSLEGIGILNKASGFLRSFVARELSMRTVPKLQFIYDKTSIR
FT                   GQELSSLIDRAIAEDRLHPQGDQTDDQQEGRD"
FT   gene            538019..538978
FT                   /gene="truB"
FT                   /locus_tag="CJA_0438"
FT   CDS_pept        538019..538978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truB"
FT                   /locus_tag="CJA_0438"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /EC_number="5.4.99.-"
FT                   /note="identified by match to protein family HMM PF01509;
FT                   match to protein family HMM TIGR00431"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85191"
FT                   /db_xref="GOA:B3PI98"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR015240"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="UniProtKB/TrEMBL:B3PI98"
FT                   /protein_id="ACE85191.1"
FT                   /translation="MAKRKGRPVDGVLLLHKPAGMTSNQALQRAKRLFFAEKAGHTGSL
FT                   DPLATGVLPLCFGEATKFSQFLLDADKGYRTCIRLGITTDTCDADGDVLETRSAAAITR
FT                   AQLDSALDAFRGNILQVPPMYSALKLNGQPLYKIARQGVEVEREPRAVTIHSLDVLAFR
FT                   PGEVAEVELDIRCSKGTYIRSIAEDLGRALGCGAHVKVLHRSLAGSFGEDQCIGLEQLE
FT                   ADYERGGYDALDAHLVSADAPVASLPAVDLPANSAYYFRQGNPVMDTKVYRIARQGDIV
FT                   RVFCAESAQSPRQFLGLGEITDDGRVAPKRIIANRSAG"
FT   gene            539133..539402
FT                   /gene="rpsO"
FT                   /locus_tag="CJA_0439"
FT   CDS_pept        539133..539402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsO"
FT                   /locus_tag="CJA_0439"
FT                   /product="ribosomal protein S15"
FT                   /note="identified by match to protein family HMM PF00312;
FT                   match to protein family HMM TIGR00952"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83979"
FT                   /db_xref="GOA:B3PI99"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PI99"
FT                   /protein_id="ACE83979.1"
FT                   /translation="MALSAAEKAGIVAKYQKVAGDTGSPEVQVALLTANINKLQNHFVA
FT                   HKADHHSRRGLIRMVNSRRKLLDYLKDKDAPRYSALIQDLGLRR"
FT   gene            539639..541771
FT                   /locus_tag="CJA_0440"
FT   CDS_pept        539639..541771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0440"
FT                   /product="polyribonucleotide nucleotidyltransferase"
FT                   /EC_number="2.7.7.8"
FT                   /note="identified by match to protein family HMM PF00013;
FT                   match to protein family HMM PF00575; match to protein
FT                   family HMM PF01138; match to protein family HMM PF03725;
FT                   match to protein family HMM PF03726; match to protein
FT                   family HMM PF07650"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82892"
FT                   /db_xref="GOA:B3PIA0"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PIA0"
FT                   /protein_id="ACE82892.1"
FT                   /translation="MNPIIKKFQYGNQTVTLETGRIARQATGAVLVSIGEVAVLCTVVG
FT                   AKEASPGQDFFPLSVHYQEKAYAAGRIPGGYFKREGRPSEKETLTSRLIDRPIRPLFPE
FT                   GFLNEVQVICTVVSTDKKQDPDIAAMIGTSAALAVSGIPFNGPIGAARVGYTQGEGYIL
FT                   NPSYKQLETSELDMVVAGTKDAVLMVESEAKELPEDIMLGAVLYGHQEMQAVIQACAEL
FT                   ARDAGKARWDWQPVPENTELKTAIKAAFGVAIGDAYRITDKAERYNRLGELRSEAVAQF
FT                   ATEESGISADAVKSLFGTLEYNIVRSRIVANEPRIDGRDNKTVRPITVDVGVLPKAHGS
FT                   ALFTRGETQALVVATLGNARDVQIIDQLEGEKKEAFLLHYNFPPYSVGECGRMGSTGRR
FT                   EIGHGRLAKRGVQAVLPKAESFPYTLRVVSEITESNGSSSMASVCGSSLALMDAGVPLK
FT                   APVAGIAMGLVKEDNGFAVLTDILGDEDHLGDMDFKVAGTTSGVTALQMDIKIEGITEE
FT                   IMEIALEQALAARLHILGEMNKVLSQSRTAVSENAPRFETIKIHPDKIRDIIGKGGATI
FT                   RSITEETNSSIDIDDDGTVKVYADDNEALQAALNRIGAIVAEAEIGAIYEGTVVRIVDF
FT                   GAFVNFLPGKDGLVHISQIADERVNNVSDYLKEGQVVKVKCLDVDQRGRIKLSIKEALA
FT                   EEAGTAPAAEPVADAE"
FT   gene            complement(541871..543439)
FT                   /locus_tag="CJA_0441"
FT   CDS_pept        complement(541871..543439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0441"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85755"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B3PIA1"
FT                   /protein_id="ACE85755.1"
FT                   /translation="MQKNRPPLTICAFYMAQQGRRMVFSRCAQWLHLLVFSTVLWGCGG
FT                   GSSSTNNTANSSIADASSSSISYSSSSVLSVVSSSLSSQPVSTQSISSLSSVQSTSSAM
FT                   LSSTSSSHISSRAESSSSVSEKEFEPVSLQSQINRVQPMTGIVFWSDNTSALSALGQDV
FT                   QLEFSYMLYRDVVTRIGTYSWAAVDQKLAQAAARGHQMIFRFRDTYPGITQSSIPDGLP
FT                   YHISKVEGQNTFIPDWSSTGLREFILDFFTRFAARYDNDPRLAFVQVGFGSYAEYHLYD
FT                   GQPELGKNFPDKSFQANFLNHMAEVFSQTPWSISIDATSSDYSPFQATPALKNLRFGLF
FT                   DDSFMHKEHSENDSEYNRASWLFFGANRYHTNPAGGEFSYYSTYDQRNVLSTNGPYGKT
FT                   FEDFAHQYNVTYMIGNDQYAYQSKARIRQAAMATGYAFRLTLLESNGNRVRLRIRNEGI
FT                   APLYYDAYPSVNNQRATQSLKGLLPSNSLDMEIHPGTHNPLDIQIKIDSDRLVTGQVIQ
FT                   FNANL"
FT   gene            complement(543529..544824)
FT                   /locus_tag="CJA_0442"
FT   CDS_pept        complement(543529..544824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0442"
FT                   /product="AmpG protein, beta-lactamase induction signal
FT                   transducer"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85440"
FT                   /db_xref="GOA:B3PIA2"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B3PIA2"
FT                   /protein_id="ACE85440.1"
FT                   /translation="MHSAPATRHPLLWVPSGYFTMALTYNMLTAAAVIMFSNLGMDNGE
FT                   AAAYASALGLAYTIKPFFAAFLEMYKTKKFFVLLSQILLGVGFIGVSLVMNLPNYIPLM
FT                   LAFFWVLSFIGSSQDITTDGVYVTSLDAKSQALFCGWQSLSWNLGKLAMMSVMVMLSGF
FT                   LHEHYFGNDPHASGPEWINSWQLVFLMMGIIMLVMALWHWRVMPDGARAENTPRTPGEA
FT                   ISTLVDAFVTFFQKQGIWLMIGFALLFRISFGFLNAPSMLFMKDSLENGGLSLTNQEFG
FT                   LIYGTFGLIALLVGSLIGGAYVAKKGLQKALFPLCCCVNIPNITFLLMAFYQPDSHVLI
FT                   SLGVVIEQFFFGIGSVGFMIYLMQQLAPGKYATTHYAFGTALMGLCMMLTGMVSGHLQV
FT                   AMGYVGYFVFVMLATIPSFLICWFAPFPHKHD"
FT   gene            complement(545126..545659)
FT                   /gene="ppa"
FT                   /locus_tag="CJA_0443"
FT   CDS_pept        complement(545126..545659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppa"
FT                   /locus_tag="CJA_0443"
FT                   /product="inorganic pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="identified by match to protein family HMM PF00719"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACE86242"
FT                   /db_xref="GOA:B3PIA3"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:B3PIA3"
FT                   /protein_id="ACE86242.1"
FT                   /translation="MSFEKIPAGKSLPDDFYVVIEIPANSSIKYEIDKDADALFVDRLI
FT                   STPMYYPCNYGYIPQTLCGDGDAADVLVVFPQPVQAGSVIRCRPLGVLKMTDEAGEDAK
FT                   IVAVPHDKLTTLYSKVQSLSDLPEVTVKQIEHFFEHYKDLEKGKWVKVAGWGDVEEARA
FT                   EILKAVETYKASNK"
FT   gene            complement(545752..546576)
FT                   /locus_tag="CJA_0444"
FT   CDS_pept        complement(545752..546576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0444"
FT                   /product="FHA domain protein"
FT                   /note="identified by match to protein family HMM PF00498"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83200"
FT                   /db_xref="GOA:B3PIA4"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="UniProtKB/TrEMBL:B3PIA4"
FT                   /protein_id="ACE83200.1"
FT                   /translation="MLKLHFKDHRLPPLWVVEKLYSIGSAPDNQLVIKDEDIDPVHAKV
FT                   IREDNKFFLKDNNSHSGCFVNGQRITQKEIIPGDILRFGSVEIIVLDPRSLPDKGHNQA
FT                   PWRLVSDSSWLAGKQFQVPPDKSLVMGRGNQCDIVIPGTHLSRRHAEICVEGNHLRIRD
FT                   LGSANGTFLNDVQISNATANNGDRLRLDVYSFRIIAPDTDSNKTRLRKPIDELAKPIER
FT                   KQPSSQPKRWKTRPTSPGNRIEPTYNNSRRGTWLALAAAVLAAIAIVAILLW"
FT   gene            546664..547125
FT                   /locus_tag="CJA_0445"
FT   CDS_pept        546664..547125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0445"
FT                   /product="Selenoprotein W-related family"
FT                   /note="identified by match to protein family HMM PF05169;
FT                   match to protein family HMM TIGR02174"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84235"
FT                   /db_xref="InterPro:IPR011893"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B3PIA5"
FT                   /protein_id="ACE84235.1"
FT                   /translation="MAPVVAIWQPNGAFLLIFAPYAELLHIDRILVTQPIKSNHMSDKN
FT                   ASSPVTPEIPLARNRVVIHYCNLCRWMLRSAWLAQELLTTFDGELDEVSLHPGTGGVFH
FT                   VWLNDQLVWDRVRDGGFPEAKELKQRVRDLLCPERSLGHSDGHKKADTD"
FT   gene            547268..549862
FT                   /locus_tag="CJA_0446"
FT   CDS_pept        547268..549862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0446"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85577"
FT                   /db_xref="GOA:B3PIA6"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:B3PIA6"
FT                   /protein_id="ACE85577.1"
FT                   /translation="MHLLSSLYRALIIERPRLALGILILLTLIAAYGMRYMKLDASADS
FT                   LTLENDTSIDYFREISQRYQHGDFLVLTYSPKAEMFSDESIETLKALTSELAAVEGVAG
FT                   VNSIISVPLLYSPMRSLAEQKESTRTLLTPGVEREMVRQEFLHSPIYRKMLLSPDSKTS
FT                   AIQLNLKVNNKYIELARQRDALRYKRHHEGLTAEEERELEQVAAEFLAYRTQVAARDAE
FT                   RVQEVRDIVAKYQGKAQIFLGGVTMITSDMISYIKSDLVVFGAALLLLMIVMLGVLFRQ
FT                   WRFVILPMGACIASVILMLGWLSWIDWRMTVISSNFVALLLIIVFAFNIYLVVRYREVH
FT                   AQHPDRPQSELVLMAMRFMAVPCVYSALTTMVAFVSLVMSGIRPVIDFGWMMTIGLVVG
FT                   FSVTFIVLPAGLMLLPKGEPKDRGDKSAATTLKFSRLAEFHGSKILLVSLIALIISIWG
FT                   ISKLQVENRFVDYFKDTSEIYKGLTVIDQQLGGTVSLDIILDADPAILADMRDEPSADT
FT                   APVSAETDAFFGDDDPFASASSSDDGNEEDPFSGDDPFAGAAEEAFGDGHQAAESSYWF
FT                   SIAGLDQIKKVQEYLETLPEVGKVQSLAVTYQLAQDINKGRLNDFELNVMRNMLSADIK
FT                   HLMLDPYLNDGKQQARITLRVVETTPNLKRVELVERIRQALVNDLGFTREQVSFTGMLV
FT                   LYNNMLQSLFKSQIATIGVVFAAIMLMIMVLFRSFSIALISILPNLLAATTVLGAMGLV
FT                   GIPLDMMTTTIAAIVVGVGVDQAIQYFYRFRDEYAIDKDYVAAMHRSHASIGRAMYYTS
FT                   VIIVIGFSILMLSQFIPSIYFGALTAFAMLMAVLGTLTLLPKLILMLKPFGK"
FT   repeat_region   549890..551174
FT                   /note="RPT4D"
FT   mobile_element  complement(549895..551168)
FT                   /mobile_element_type="insertion sequence:ISCja2"
FT   gene            complement(549917..551068)
FT                   /locus_tag="CJA_0447"
FT   CDS_pept        complement(549917..551068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0447"
FT                   /product="ISCja2, transposase"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83075"
FT                   /db_xref="GOA:B3PC11"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025399"
FT                   /db_xref="UniProtKB/TrEMBL:B3PC11"
FT                   /protein_id="ACE83075.1"
FT                   /translation="MSHSNTAFHQLLKPLSRHEFEAEAKKHHVGQKLRSATRWDQFVGM
FT                   AMSQLSGRQSLRDIQSNLEAQQHKLYHLGAKPIARSTLARINEVQPAELYKHVFARLLH
FT                   RCKSMQGKHKFQFKNPLYSLDASAIDLSLSVFPWAAHRDDTANVKLSVGLNHGTQVPEF
FT                   VALSDGQENDMIEGRKFDFPKGSIVAFDKGYVDYRWFKLLTDKGVFFVTRLRAKAVYRV
FT                   EERRYADSSKGIISDQVIQLSSAHAIKRGAPKLRRIGYRDATTGKFYEFLTNNFQLAAA
FT                   TIAAIYKDRWQVELFFKAIKQNLKIKAFVGTSRNAVLTQIWIAMITYLLLAFSRHSTKA
FT                   GWTVQRIMRVIQLNLFERRSLKSILIPDPPNHKKSEPQMRLAL"
FT   gene            complement(551202..552218)
FT                   /locus_tag="CJA_0448"
FT   CDS_pept        complement(551202..552218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0448"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83815"
FT                   /db_xref="UniProtKB/TrEMBL:B3PIA8"
FT                   /protein_id="ACE83815.1"
FT                   /translation="MLEHDSLTPALKITPLAWSDTDNWKRQARTELGDTYDFNGATVTA
FT                   VINVPASYTTDGSLILQLVLQGTGAVYSWNPVTDLVAGDNTIVWEINPETPANAQGITH
FT                   FGIQLTTPPSSLTILDPFLVKSIEVNFADGGSASSSSVASSEASSSVASSVSAVLTVDF
FT                   ENDDAGTVYGATGWAATDATPTVVTIASITAGSGLPANGSSTKVLRVTVGNWNSSPVVN
FT                   VSLPGDKTLANYEVKVDAYFPHNTLGLSEANNGYKDLTLMAGATVTGAVQTDNALYHSH
FT                   VATQGNVDAWTTFTLPVDATKGASLSGDIQLSVGISRSAGTDADAYYLDNIRLVELP"
FT   gene            552226..552648
FT                   /locus_tag="CJA_0449"
FT   CDS_pept        552226..552648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0449"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84193"
FT                   /db_xref="UniProtKB/TrEMBL:B3PIA9"
FT                   /protein_id="ACE84193.1"
FT                   /translation="MPPPLTNHPSIPAAKPRLRSADGWLFSEEETLLATELLSEDSSLD
FT                   DDDDSTLEELGSCSELETLDTTELTVLEDDASEETDELTLLLDTTEDDELLERLLSPSL
FT                   PPQALNTTDTAKIKERFFNMLLAPVRREITCCHKPG"
FT   gene            complement(552921..553997)
FT                   /gene="axe2C"
FT                   /locus_tag="CJA_0450"
FT   CDS_pept        complement(552921..553997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="axe2C"
FT                   /locus_tag="CJA_0450"
FT                   /product="xylan esterase, putative, axe2C"
FT                   /EC_number="3.1.1.72"
FT                   /note="identified by match to protein family HMM PF00657"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84991"
FT                   /db_xref="GOA:B3PIB0"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="InterPro:IPR037461"
FT                   /db_xref="InterPro:IPR040794"
FT                   /db_xref="PDB:2WAA"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PIB0"
FT                   /protein_id="ACE84991.1"
FT                   /translation="MKLLFPILLLTGSYFLSACNNTQSLMSSTHTIAASDPHIQVMGRT
FT                   HINDDASLTFGYPGVSLSTIVAGSRLTAEMQSSNGNSWIDVIIDNHPPTSIKLDAQQQT
FT                   VELFHFPNSGEHRVEIIHRSENWHGQVTLKQLTLTGTQFLPAPVLPQRKILVLGDSVTC
FT                   GEAIDRVAGEDKNTRWWNARESYGMLTAKALDAQVQLVCWGGRGLIRSWNGKTDDANLP
FT                   DFYQFTLGDTGQAPQWDHHRYQPDLIISAIGTNDFSPGIPDRATYINTYTRFVRTLLDN
FT                   HPQATIVLTEGAILNGDKKAALVSYIGETRQQLHSNRVFYASSSHHPGDNSDAHPTKDQ
FT                   HAAMARELTPQLRQIMDW"
FT   gene            complement(554068..554676)
FT                   /locus_tag="CJA_0451"
FT   CDS_pept        complement(554068..554676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0451"
FT                   /product="mucin-desulfating sulfatase
FT                   (N-acetylglucosamine-6-sulfatase)"
FT                   /note="identified by match to protein family HMM PF00657"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85659"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:B3PIB1"
FT                   /protein_id="ACE85659.1"
FT                   /translation="MSVATWERMHAEDVLIAEHDQVDLLFIGDSITAGWDWQLWQTHFA
FT                   PLKAANFAIGADHTGNVLWRLQHGTIGQLHPKLIVVLIGVNNLGHLQESPEQAADGITR
FT                   VVQQLQLAWPNSRILLNAVFPFDEKADSPNRAKAKRLNSIISKLGNNKTIFFKDYGHVF
FT                   LQKDGSIAAEVMADFLHPTPAGYKIWAEAMTPDIHKLLQ"
FT   gene            complement(554941..555990)
FT                   /gene="holA"
FT                   /locus_tag="CJA_0452"
FT   CDS_pept        complement(554941..555990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holA"
FT                   /locus_tag="CJA_0452"
FT                   /product="DNA polymerase III, delta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF06144;
FT                   match to protein family HMM TIGR01128"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84409"
FT                   /db_xref="GOA:B3PIB2"
FT                   /db_xref="InterPro:IPR005790"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR010372"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032780"
FT                   /db_xref="UniProtKB/TrEMBL:B3PIB2"
FT                   /protein_id="ACE84409.1"
FT                   /translation="MPKLRPEQLAAALTKQLAPIYLVSGDEPLLIQEACDSIRAAARKQ
FT                   GFGERELYHADSNFEWGQLLSAANSLSLFAEKKIIELRMPSGKPGDKGGKILQEYAQSP
FT                   APDNLLLIVTEKLDGAAQKSKWFKALEDAGQHIQVWPITAGNLPRWIGQRLQQAGLQAD
FT                   PDAIELLASRIEGNLLAAVQEIEKLKLLANQGRINYELMASAVADSARYDVFGLTDKAL
FT                   HGDARAAVKTLHGLKTEGTEPITILWAITRDIRILIQVSQAVGQGKHFDWAAKQAGVWD
FT                   KRQPLIKAALNRLKPAQLQQLLRKANGIDKAIKGMRNAEPWDELLDLVLNIAGVQSLHP
FT                   ANERLSLKI"
FT   gene            complement(555996..556532)
FT                   /locus_tag="CJA_0453"
FT   CDS_pept        complement(555996..556532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0453"
FT                   /product="putative rare lipoprotein B precursor"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83849"
FT                   /db_xref="GOA:B3PIB3"
FT                   /db_xref="InterPro:IPR007485"
FT                   /db_xref="UniProtKB/TrEMBL:B3PIB3"
FT                   /protein_id="ACE83849.1"
FT                   /translation="MVVAMKKIITCLFLFTLSACGWHLRGSETTDNSSAYNQPLKLVIT
FT                   STDNHGPLMNAIRQQLPTYNLTEVKSDSSAYSLNLKDVKTDKRAAGVGSDALVNAYELI
FT                   LSVDYQIRSPAKILTNPNTRGSISRTYNFEVNQANYSEQEEALILREMYRDLAQQILRR
FT                   LKVLAYQEKTASKAN"
FT   gene            complement(556577..559171)
FT                   /gene="leuS"
FT                   /locus_tag="CJA_0454"
FT   CDS_pept        complement(556577..559171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuS"
FT                   /locus_tag="CJA_0454"
FT                   /product="leucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.4"
FT                   /note="identified by match to protein family HMM PF00133;
FT                   match to protein family HMM TIGR00396"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83294"
FT                   /db_xref="GOA:B3PIB4"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PIB4"
FT                   /protein_id="ACE83294.1"
FT                   /translation="MQEQYNPAEVEAQAQQYWEEHQSFNVIEDPGKEKFYCLAMFPYPS
FT                   GKLHMGHVRNYTITDVIARYQRMQGKNVLHPMGWDAFGLPAENAALKHNTAPAKWTYSN
FT                   TDHMRNQLKQLGFGFDWSRELTTCKPEYYQWEQWFFTRLYEKGLVYKKMSTVNWDPIDQ
FT                   TVLANEQVIDGRGWRSGALVERKEIPQWFIKITDYAEELLNDLDKLPNWPEQVKTMQRN
FT                   WIGKSRGLEMRFDLQSPVGEFTSFDIYTTRPDTLMGVTYVSLAAEHPIAKYLADSNPAL
FT                   AQFIADCKVQSVAEADMATMEKKGMDTGIKALHPITGEPVAVWVANYVLMDYGSGAVMA
FT                   VPAHDQRDYEFAQKYHLGITQVIAPQNGETIDLSQAAFTDKGVLVNSGEYDGLDFNAAF
FT                   DAIASTLEMANKGRVKTNYRLRDWGVSRQRYWGAPIPMFNLPEGGEIPVPAHKLPILLP
FT                   EEVVMNGVQSPIKADPEWKKDELDGQYVERETDTFDTFMESSWYYARYTCPNFTDGMIN
FT                   KAAADYWLPVDQYVGGIEHAILHLLYSRFFHKLMRDEGLVSGDEPFERLLCQGMVNAES
FT                   FFIKSEGKENWIEPENVVIERDDKGRFIAAKHKITGDAVEFGGVIKMSKSKANGVDPES
FT                   VINQYGADTVRLFTMFAAPPEQSLEWSDSGVEGASRFLRRLWKAVEGHINAGTPGKLDA
FT                   ASLPQQQKDLRRKTHETIQKVSDDYGRRQTFNTAIAAVMELLNETSKLSDRANPQGLAV
FT                   EREALEAAILLLAPIVPHITQALWIELGNSGIPLNQPWPTLDESALVRSTIEVVVQVNG
FT                   KLRGKIDAAVDAPKELLEQIAVQQENVQKFLEGVTVRKVIVVPNKLVNIVAN"
FT   gene            559325..559660
FT                   /locus_tag="CJA_0455"
FT   CDS_pept        559325..559660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0455"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85597"
FT                   /db_xref="UniProtKB/TrEMBL:B3PIB5"
FT                   /protein_id="ACE85597.1"
FT                   /translation="MKRDNPYHSTPMDYPFSAEETGALAGVQQALEHEVDELVRLELAA
FT                   EQMLVEEVDLAKAYLEDDSQHVWADLREGLQRWEVVAGEWLLSAADPSRVNWQLNHWWG
FT                   DDEVHLH"
FT   gene            559837..560769
FT                   /locus_tag="CJA_0456"
FT   CDS_pept        559837..560769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0456"
FT                   /product="endo-1,4-beta-xylanase B"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84975"
FT                   /db_xref="GOA:B3PIU5"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B3PIU5"
FT                   /protein_id="ACE84975.1"
FT                   /translation="MPANYRQPWCWLCLLFSLSVVPDAMSAPDSQSRPQGAIYLWAEKP
FT                   LVAPDREHVKDQRVYAVDNPSMTPYWPEPDKANGTAVVIFPGGGYVRLALNNEGHGVAK
FT                   WFAERGVAAFVVKYRMVEYGFPAPLLDGLRAVRLVRQNASDWGIALDKVGVIGFSAGGH
FT                   LAASVTTRHDFTVDDGDPLAAISARPDFSILGYPVITLEGADAHAGSRKALLGENPDPA
FT                   LVHENSLQHQVTAEVPPVFMLHGAGDQSVPVTNSLAFFTEVQKFNKRSELHVYQSNIHG
FT                   VGMIQGQGTISSWPTALELWLKQNNFLYP"
FT   gene            complement(560863..563010)
FT                   /gene="aquI"
FT                   /locus_tag="CJA_0457"
FT   CDS_pept        complement(560863..563010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aquI"
FT                   /locus_tag="CJA_0457"
FT                   /product="aqualysin precursor"
FT                   /EC_number="3.4.21.62"
FT                   /note="identified by match to protein family HMM PF00082"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84702"
FT                   /db_xref="GOA:B3PIU6"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034193"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="InterPro:IPR037045"
FT                   /db_xref="UniProtKB/TrEMBL:B3PIU6"
FT                   /protein_id="ACE84702.1"
FT                   /translation="MNLTNRIFILLARLFPVLTPVTHYHILWLLLVSLMGNYSLAKAPI
FT                   YGLEHPDRIPGQFVVVLRPGTQTTSVTLASAQVQSHGFAIEQQFTHTFPGFTIRSNGSP
FT                   SAQALDTALEQLANNPQVAFIEADRRVYLNQQPSPSLIQTPATWGLDRIDQRRLPLNNQ
FT                   YSYKTTGTGVHAYVIDSGIRADHSEFGGRVRGGASFTGNLPALEDCTGHGTHVAGTLGG
FT                   NLYGVAKAVNLWSVRVFDCSNSAPWSYVIAALEWVIANHQRPALINMSLSGWSFYSADI
FT                   AVDNAVAAGITVVVAAGNNSDNACNYSPAGATSAITVGATTATDMRAGFSNWGSCLDLF
FT                   APGESITAAWNSGPNDTNILSGTSMASPHVAGAAALYLQSHPSAAPAEVGEFLRNQASL
FT                   NLIGDAGSNSPNRLLYTNTSGYAANLPQVYLRGDVNQWGTSSMQLVADNLWEIEITQAA
FT                   NSDYRFKFDVYGDWSINYGDNQGDGLADLYGSDISLPAPGNYRIRFNDNSLQYQIQPLD
FT                   NGTPPTPWKRTIVFIEGITQSGQDLFVRGGIDHNHAQSLGIQCTPENKLCAIPIRHLNL
FT                   RNSTTVPWKAGDSFLDWYGPENDQSANAQGSPLDWTTNLWPQSWGNKRTVEIDGYGETP
FT                   LNLWGDHYWMLDVEMDCSRTLDGWFELKSFISGGPGWEGNISQPGAPYISNNHFARCGH
FT                   ITAFRRNQHQPLWESDIPSNL"
FT   gene            563502..563819
FT                   /gene="rplU"
FT                   /locus_tag="CJA_0458"
FT   CDS_pept        563502..563819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplU"
FT                   /locus_tag="CJA_0458"
FT                   /product="ribosomal protein L21"
FT                   /note="identified by match to protein family HMM PF00829;
FT                   match to protein family HMM TIGR00061"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85496"
FT                   /db_xref="GOA:B3PIU7"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/TrEMBL:B3PIU7"
FT                   /protein_id="ACE85496.1"
FT                   /translation="MSAYAIFESGGKQHRVVVGETLKLEKIEFATGGTVEFNKVYLVAN
FT                   GADIKIGAPVVDGATVTAEVVSHGRADKVKIIKFRRRKHHLKRQGHRQWFTEVKITAIN
FT                   G"
FT   gene            563834..564091
FT                   /gene="rpmA"
FT                   /locus_tag="CJA_0459"
FT   CDS_pept        563834..564091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmA"
FT                   /locus_tag="CJA_0459"
FT                   /product="ribosomal protein L27"
FT                   /note="identified by match to protein family HMM PF01016;
FT                   match to protein family HMM TIGR00062"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83451"
FT                   /db_xref="GOA:B3PIU8"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PIU8"
FT                   /protein_id="ACE83451.1"
FT                   /translation="MAHKKGVGSSRNGRDSEAKRLGVKAFGGELVSGGSIIVRQRGTKF
FT                   HAGENTGLGKDHTIYAKVDGRVKFEVKGAFGRQYVSIIPA"
FT   gene            564229..565425
FT                   /locus_tag="CJA_0460"
FT   CDS_pept        564229..565425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0460"
FT                   /product="GTP1/OBG family"
FT                   /note="identified by match to protein family HMM PF01018"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84320"
FT                   /db_xref="GOA:B3PIU9"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PIU9"
FT                   /protein_id="ACE84320.1"
FT                   /translation="MKFVDEAPISVEAGKGGNGALSFRKEKFVAKGGPDGGDGGDGGSV
FT                   FLVADENLNTLIDYRFQPKYRAEDGEKGASKNCTGAKGDDLLLPVPVGTTVIDMDTEEV
FT                   FGDLTEHGQRLKVAQGGFHGLGNTRFKSSTNRVPRKTTPGTEGEKRNLKLELKVLADVG
FT                   MLGLPNAGKSSFIRAVSSAKPKVADYPFTTLVPNLGVVKVQQHRSFVIADIPGLIEGAS
FT                   EGAGLGVRFLKHLTRCRLLLHMVDMAPVDGSNPVDNVRVIANELQKFSPTLSNRDRWLL
FT                   LNKIDLLPIDEVEARCAAVVKELEWTGPVFRVSALKHEGTAELSGKIMDHLEAIWEEER
FT                   ENPDARALELERQNQMAAEARERIEELREARRQARLAAGEDDDFNEDDYDVEVIYVNY"
FT   gene            565447..566586
FT                   /gene="proB"
FT                   /locus_tag="CJA_0461"
FT   CDS_pept        565447..566586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proB"
FT                   /locus_tag="CJA_0461"
FT                   /product="glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /note="identified by match to protein family HMM PF00696;
FT                   match to protein family HMM PF01472; match to protein
FT                   family HMM TIGR01027"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83955"
FT                   /db_xref="GOA:B3PIV0"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/TrEMBL:B3PIV0"
FT                   /protein_id="ACE83955.1"
FT                   /translation="MSAQGFMSKRDIIPQAKRWVVKIGSALLTDDGKGLDAVAIAGWVK
FT                   QMAELRQRGIELVLVSSGAVAAGMRRLGWSSRPTEIHQLQAAAAVGQMSLVQTYEVEFQ
FT                   RYGLLTAQVLLDHDDLSSRQRYLNARSTLKTLVNLQVVPVINENDTVVTDEIRFGDNDT
FT                   LGALVANLIDADLLVILTDQKGMYDSDPRSNPSAQLLNEIAAADPRLEQMAGGGGVLGR
FT                   GGMITKVRAARVAARSGADTIIVGGRIENALLRIAEGESLGTFLWAEQQPQAARKRWLS
FT                   GQLQTRGTLVLDDGAVRVVREQGKSLLPVGVKEVRGDFTRGDMVICVDLQGREVARGLV
FT                   NYHAEEAAKIIGKPSSQIEQILGYRDDNELIHRDNLVLS"
FT   gene            complement(566653..568611)
FT                   /locus_tag="CJA_0462"
FT   CDS_pept        complement(566653..568611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0462"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84839"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:B3PIV1"
FT                   /protein_id="ACE84839.1"
FT                   /translation="MQIQTTTKLISAALLSLLISACGGGDSSPLDGYKSSTGNSSTGSD
FT                   TNTSGSSSFSSVDSVTARKIGFGSGTSFVNGQIGIGILSETLSAGGSTTLTVNIVSDTN
FT                   TLVTSNIAVRFNSKCVAAGEAVLTDQLGVAAQTVTSTSGEATIVYTAKGCVGPDLITAT
FT                   ATIDQVTKEAQTTINVEQGTVGSIKFVDATPSLVGIAGTGGQETSVVRFQVLSNNNNQD
FT                   PIKDVDVEFSLSNTTGGITLSTAASKTDRQGYATTTVKSGTVHTSVRVTARTGSISTQS
FT                   DRLVISTGIPDQDSFSLGATVTNPVGFDIQGVESTITARLGDAFNNPPPEGTTIAFTAE
FT                   GGSIDDSCNTNTAGACTVVWRSQNPQIQRDSSDYSVNRLLCVNDSGFSLQGTELAICRK
FT                   ERAGRTTILATAVGNESYIDGDGSGRFDNTQRDIFSKENSNCSLNAPLSTSQIPTGSDL
FT                   VPCDDLAEAYLDKNENGIRDANEEFIDFNNNQEYDPSNGMYNGILCSEESAAQGTCSKA
FT                   QVTIRQDLVLVVTSHNLLFDNTTGRLPFIDQNILVPAGGSGATWFWLADKNGNGVPQGT
FT                   ELSLDTSGLKNATATISPKGPFTAMDDPQQISISVIANDEGSPAGQIGVRVSIKAPQPV
FT                   GDIIYERTISVNQLNLQ"
FT   gene            568838..570148
FT                   /locus_tag="CJA_0463"
FT   CDS_pept        568838..570148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0463"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84319"
FT                   /db_xref="GOA:B3PIV2"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041532"
FT                   /db_xref="UniProtKB/TrEMBL:B3PIV2"
FT                   /protein_id="ACE84319.1"
FT                   /translation="MRLLAFPVGIIAVVWQALQATSSCNRYNPRPCCLHEAMAMNLPSL
FT                   ILKPQADRRLKLGHLWIYSNEVDTERSPLKNFAMGQQVVVTSNAGKPLGIALMNPNALI
FT                   CGRLVNRDPSHPLDKSLLVHRIKQALSLRELAFAEPYYRLIYGDSDLLPGLVVDRFGDY
FT                   LVVQIASAGMEQVKDAIVEALVQVIKPAGVLLSNEHSARVLENLPEYTEVAYGEMPEVV
FT                   ALVENGVRFMAPVQGGQKTGWFYDHRVNRAQLQQYVAGKRVLDVFSYIGGWGVQAAVAG
FT                   AQEVFCVDASTAATDAVLENASVNGVADKVAAIQGKAIDVLKQLIADQERFDVVVLDPP
FT                   AFIKKRKDQKAGEAAYRHINELGMRLLGRDGLLVSASCSMHLAKDTLLDIVRASGRHLD
FT                   RHVQIIGQGGQGPDHPIHPAIPETDYLKAVFARVYLA"
FT   gene            complement(570173..570826)
FT                   /locus_tag="CJA_0464"
FT   CDS_pept        complement(570173..570826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0464"
FT                   /product="HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01488; match to protein
FT                   family HMM TIGR01490"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83482"
FT                   /db_xref="GOA:B3PIV3"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B3PIV3"
FT                   /protein_id="ACE83482.1"
FT                   /translation="MNLAIFDLDNTLIAGDSDHSWGQFLVERGLVDAELYKRANDQFYQ
FT                   DYKNATLDIDAYLKFSLKPLTEHSLEQLAQLHSEFMATHIAPMLLPKAQALLGEHRAKG
FT                   DYLLIITATNGFVTRPIATYLGVDDIIATDPELVGSRYTGNYVGTPSFQHGKVLRLQEW
FT                   LQAKDFDLGEAYFYSDSINDLPLLEQVGHPVAVDPDERLISIAHQREWPIISLR"
FT   gene            571035..571547
FT                   /locus_tag="CJA_0465"
FT   CDS_pept        571035..571547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0465"
FT                   /product="hydrolase, NUDIX family"
FT                   /note="identified by match to protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84976"
FT                   /db_xref="GOA:B3PIV4"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR022927"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PIV4"
FT                   /protein_id="ACE84976.1"
FT                   /translation="MIDADGFRPNVGIILTNHQGQLLWARRVGGQDAWQFPQGGINAHE
FT                   SPEQALYRELHEEVGLYPQDVEILACTRGWLRYRLPHRLVRHNSLPLCVGQKQKWFLLR
FT                   LLSDDARVCLENGGRAEFDDWRWVSYWYPLGKVVAFKRDVYRRALRELSLAHAQLENSN
FT                   RKELSRG"
FT   gene            571587..573857
FT                   /locus_tag="CJA_0466"
FT   CDS_pept        571587..573857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0466"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase
FT                   PtsP"
FT                   /EC_number="2.7.3.9"
FT                   /note="identified by match to protein family HMM PF00391;
FT                   match to protein family HMM PF01590; match to protein
FT                   family HMM PF02896; match to protein family HMM PF05524;
FT                   match to protein family HMM TIGR01417"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83640"
FT                   /db_xref="GOA:B3PIV5"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B3PIV5"
FT                   /protein_id="ACE83640.1"
FT                   /translation="MLNSLRSIVQEVNAARDMKSALVIIVTRVKQAMKTQVCSVYLRDA
FT                   QGDYVLMATDGLNASAVGQVRLAAGEGLVGRVVVREEPINLEHAEAHPSYQYFPETGEE
FT                   RYSSFLGVPIIHHRKVLGVLVVQQIEQRRFDEGEEAFLVTMSAQLAGVIAHAEATGVVV
FT                   APGEKATQAKFAGVSGAPGVAVGQAVIISPLADLRSVPYQACKDVDEELAFFHRSLAAV
FT                   REDIKSLGSQLKSRINREEQALFDAYLAMLDDASLGGEVSERIRKGAVAAYAWSEVILE
FT                   HESIFNSMSDPYLRERAADLRDLGRRVLAYLQESNQKTRIYPDKTVLIGEELTASMLGE
FT                   VPKEKLVGLVSVLGSSNSHVAILARAMDIPTVMGAVDLPFTQLEGRQVIVDGYKGNVYS
FT                   DPSDNLLKQYEAIELEEQAIVKGLEALKDLPCETLDHYRLPLFVNTGLMADVVRSLERG
FT                   AEGVGLYRTEVPFLLRDRFPSEEEQRAIYREQLGAFAPHMVTMRTLDIGGDKALPYFPI
FT                   EEDNPFLGWRGIRVTLDHPEIFLSQIRAMIKASEGLDNLRILLPMITNVHEVDASKALI
FT                   HRVYSELVEEGYSVKVPQIGAMVEVPAAVYQARELSKKVDFLSVGSNDLTQYLLAVDRN
FT                   NVQVAGLYQAYHPAVLQALQHVVDAGHAEQVSVSICGELAGDPGAAILLMAMGYDVLSM
FT                   SATNLPKVKSVIRNITLVQAKELLAEVMQMAYAEQIQARVNRALREAGVTRLMRTAVTD
FT                   EAS"
FT   gene            573924..574784
FT                   /gene="lgt"
FT                   /locus_tag="CJA_0467"
FT   CDS_pept        573924..574784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lgt"
FT                   /locus_tag="CJA_0467"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /EC_number="2.4.99.-"
FT                   /note="identified by match to protein family HMM PF01790;
FT                   match to protein family HMM TIGR00544"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82905"
FT                   /db_xref="GOA:B3PIV6"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/TrEMBL:B3PIV6"
FT                   /protein_id="ACE82905.1"
FT                   /translation="MCFMLSYPDINPIALSIPGFELMGRDFGPFNVHWYGIMYLCAFAS
FT                   AWALAVYRARRPGSVITVPQVENLITYGAFGVIIGGRCGYVFFYGFDQFLADPLWLVRI
FT                   WEGGMSFHGGLIGVIVAMLIYARRLKISYLKLMDFVAPIVPLGLGFGRLGNFIGQELWG
FT                   RVSDAPWAMVFPKAMDPAGIARHPSQLYQAFLEGLVLFLIVFWFSSRPRPRAAVCGVFL
FT                   VFYAIFRFSVEFVREPDEGVGFVLLGWMTRGQELCIPMFLLGIGLLVYAYIYSPDKVVS
FT                   GTGKN"
FT   gene            574820..575668
FT                   /gene="thyA"
FT                   /locus_tag="CJA_0468"
FT   CDS_pept        574820..575668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thyA"
FT                   /locus_tag="CJA_0468"
FT                   /product="thymidylate synthase"
FT                   /EC_number="2.1.1.45"
FT                   /note="identified by match to protein family HMM PF00303"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85858"
FT                   /db_xref="GOA:B3PIV7"
FT                   /db_xref="InterPro:IPR000398"
FT                   /db_xref="InterPro:IPR023451"
FT                   /db_xref="InterPro:IPR036926"
FT                   /db_xref="UniProtKB/TrEMBL:B3PIV7"
FT                   /protein_id="ACE85858.1"
FT                   /translation="MKQMKQYLDLMRDVVENGVTRGDRTGTGTRSVFGRQLRFDLARGF
FT                   PLVTTKTVHLKSVIVELLWFLQGRTDVTWLQERGCSIWNEWAAESGDLGPVYGKQWRSW
FT                   ACPDGSTIDQISQVIEQIKAKPNSRRLIVSAWNPADLPDEALSPQENVRQGRMALAACH
FT                   TLFQFYVADGKLSCQLYQRSADLFLGVPFNIASYALLTHMIAQQCDLGVGDFVHTFGDC
FT                   HLYNNHITDDIVYEQLTREPRNLPRLIIRRRPSSIFDYELEDFEFEGYQPYPRIAAPIA
FT                   V"
FT   gene            575690..576205
FT                   /gene="folA"
FT                   /locus_tag="CJA_0469"
FT   CDS_pept        575690..576205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folA"
FT                   /locus_tag="CJA_0469"
FT                   /product="dihydrofolate reductase"
FT                   /EC_number="1.5.1.3"
FT                   /note="identified by match to protein family HMM PF00186"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84710"
FT                   /db_xref="GOA:B3PIV8"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:B3PIV8"
FT                   /protein_id="ACE84710.1"
FT                   /translation="MQVALIVAAAANGIIGRDNQLPWHLPQDLKYFKATTMGKPVIMGR
FT                   KTYESIGKPLPGRPNIVVTRNPLWRATEGVKLAGSLEEALAHAEELIADSPDLLPEAMV
FT                   IGGAEIYRSALPLASRVYLTRVDVQVDGDAFFPVLDEGEWQLASSRDGEKNAALPHRFL
FT                   VYDRLANK"
FT   gene            576442..576555
FT                   /locus_tag="CJA_0470"
FT   CDS_pept        576442..576555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0470"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85336"
FT                   /db_xref="UniProtKB/TrEMBL:B3PIV9"
FT                   /protein_id="ACE85336.1"
FT                   /translation="MLSQTQLIEYPSWGDYEKSAIESRGCVHSAFCQRAYG"
FT   gene            576563..577270
FT                   /locus_tag="CJA_0471"
FT   CDS_pept        576563..577270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0471"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84140"
FT                   /db_xref="InterPro:IPR016866"
FT                   /db_xref="UniProtKB/TrEMBL:B3PIW0"
FT                   /protein_id="ACE84140.1"
FT                   /translation="MADQTLDAVLQVGQAKTTLAQDSQKRIDRLAQETDELTQQFKQQN
FT                   KLIEDLRVFNAQMEKQVAKQLEVVSDLEQSIEKVTVIERQIQPLIFRMLDSLDQFVSLD
FT                   KPFDVQERKDRIQSLRNNQDRADISVSEKFRQVLEAYKIESAYGSTIEAYKDTLNVNGQ
FT                   EREVNVLRVGRISLMYQTTDAKESGAYDPTAKEWIALDSSYNSRILKGLRIARDQASKD
FT                   IMVMRVQAPEAAQ"
FT   gene            577267..578649
FT                   /locus_tag="CJA_0472"
FT   CDS_pept        577267..578649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0472"
FT                   /product="MotA/TolQ/ExbB proton channel family protein"
FT                   /note="identified by match to protein family HMM PF01618;
FT                   match to protein family HMM PF01851"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85986"
FT                   /db_xref="GOA:B3PIW1"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR017270"
FT                   /db_xref="UniProtKB/TrEMBL:B3PIW1"
FT                   /protein_id="ACE85986.1"
FT                   /translation="MKMKFVKSCLFAAAAGLLASSFAMAQEKAATLDQLLDMVKKSQVS
FT                   ESAEHKQREAEFARDKANQANLLAQAKATRQAEEARSAALEKKYAEQQLLVSQKRAQLN
FT                   ERLGSMRELFGHLTATAGDLRATLDTSLVSAQYPNRGDFLEALIEKMNGSTKLPDIEEI
FT                   ERLWYEIQREMVESGRVVKFNANVIKPSGEQTSQEVVRVGTYNLVSDGKYLTFDGSKVQ
FT                   ELPRQPSAHLAGAQALQNAAPGSGTVDFGVDPTGPAGGQLLTALIDTPTFLERVDQGGA
FT                   VGYVIVVIGIFGVLLGFWRILVLFTVSGKVKAQLKSQKPSTNNPLGRVLKVAEENAKVD
FT                   TETLELKLEEAVLKERPAIESGLAILKIIAAVAPLLGLLGTVTGMIETFQAITIFGAGD
FT                   PKNMAGGISAALVTTVQGLVVAIPVVLMHTLVNTRAKAVIQVLDEQTTGIIAENSERSH
FT                   KA"
FT   gene            578662..579189
FT                   /locus_tag="CJA_0473"
FT   CDS_pept        578662..579189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0473"
FT                   /product="TonB system transport protein ExbB2"
FT                   /note="identified by match to protein family HMM PF01618"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85141"
FT                   /db_xref="GOA:B3PIW2"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:B3PIW2"
FT                   /protein_id="ACE85141.1"
FT                   /translation="MQALTEAFAAIGAFMDQGGPVMYAIAALTFVMWALVFERVWYFRG
FT                   GLKGDVQQALSSWEKRPERKSWNAHQIRAAMVSRMSAKINQNMDMITTLIALCPLMGLL
FT                   GTVTGMIEVFSVLSLTGGGDAKQMAGGVSRATIPTMSGMVAAISGLFANTYLTRVAERE
FT                   DRLFADHLTMDH"
FT   gene            579234..579638
FT                   /locus_tag="CJA_0474"
FT   CDS_pept        579234..579638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0474"
FT                   /product="TonB system transport protein ExbD2"
FT                   /note="identified by match to protein family HMM PF02472"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83856"
FT                   /db_xref="GOA:B3PIW3"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:B3PIW3"
FT                   /protein_id="ACE83856.1"
FT                   /translation="MSRNNAKQDEEAQAIDLTPMLDVVFIMLIFFIVTATFIKETGKEV
FT                   TRPEATTADDKKNATILVAVGADNEIWIDKKKVDPRGVRQVIERMRADNPKGGVSIQAD
FT                   TASRIEFVLEVADAAREAGVTDVSVSTPKK"
FT   gene            579644..580273
FT                   /locus_tag="CJA_0475"
FT   CDS_pept        579644..580273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0475"
FT                   /product="putative tonB2 protein"
FT                   /note="identified by match to protein family HMM TIGR01352"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83026"
FT                   /db_xref="GOA:B3PIW4"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:B3PIW4"
FT                   /protein_id="ACE83026.1"
FT                   /translation="MNFAKVSLSGLLGLITTLLLLYVMYQLVNNEMKPQEAKAAVKIPD
FT                   IRMPDTKIETRFEDAKPEKPQEPDAPPPEILEPQFDTPEISAESLNMQVPIANTGIEVG
FT                   AGALAFSEGEYLPIVKVPPEYPSTALSRGIEGFCTVVYTVTETGSTRDPEPIPGECVTK
FT                   DGKPTTVFNRASVRAALKFKYKPKVVDGKPVEVPGVKNRFTYELAK"
FT   gene            580285..581667
FT                   /locus_tag="CJA_0476"
FT   CDS_pept        580285..581667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0476"
FT                   /product="TPR domain protein"
FT                   /note="identified by match to protein family HMM PF00515"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84861"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B3PIW5"
FT                   /protein_id="ACE84861.1"
FT                   /translation="MRQVIPAVSLALNKSLLAALLVASPLVVSTVAKHFAPESALASVS
FT                   AVQAQVTAKNKHANEQRKFPNLSEAFGKRIQEAANALQPPEESKAQPDPRKALQILGEL
FT                   SAKGNLNAYEQVLLNQYTGYAHLGAENYPKAIESFNKMLTLVPNMPVATEAQTYLTLGQ
FT                   LYSAQDNPRKALELLLKWTEYVDSLRPEQQYMFASLYYQLEDNRNSLLNINEAVKNQEA
FT                   TGKVPIESWYLLQRGLYFDKEDYKSGLVVLEKLIKHYPKAQYWRQASQVYRMMNREKDA
FT                   LAAMEACYLLNGLESEKDLLNLAYMFLEAEVPYKAAKVLNRGIYETKKVEPSAKNLKLL
FT                   ADSWRLAQNVRNSLTEYEKAAAKSTDGELIIGLAGAYLANDNYKDASKWGRDALRKGGI
FT                   KRVDLANFTVAQAELEMKNYDEAIKFFKEAGKDARSSKVANQWATYAEKEKEKAELAKR
FT                   GI"
FT   gene            complement(581824..583668)
FT                   /gene="ilvD"
FT                   /locus_tag="CJA_0477"
FT   CDS_pept        complement(581824..583668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvD"
FT                   /locus_tag="CJA_0477"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="identified by match to protein family HMM PF00920;
FT                   match to protein family HMM TIGR00110"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83597"
FT                   /db_xref="GOA:B3PIW6"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PIW6"
FT                   /protein_id="ACE83597.1"
FT                   /translation="MPVYRSKTTTSGRNMAGARALWRATGMKDEDFQKPIIAVANSFTQ
FT                   FVPGHVHLKDLGQLVAREIEKAGGVAKEFNTIAVDDGIAMGHDGMLYSLPSRDIIADSV
FT                   EYMVNAHCADALVCISNCDKITPGMLMAAMRLNIPVIFVSGGPMEAGKTRLAEHKLDLV
FT                   DAIVIGTDKNASDEQVEAYERSACPTCGSCSGMFTANSMNCLTEALGLSLPGNGSLLAT
FT                   HADREQLFLEAGRRIVEITKRYYEQDDASVLPRAIATFEAFENAMALDIAMGGSTNTIL
FT                   HLLAAAQEGGVPFTMTDIDRLSRKVPQLCKVAPNTQKYHMEDVHRAGGVVGILAELNRG
FT                   GLLHNQVPTVHSKTLQEGLDQWDIISTGSDAVATFYRAGPAGIPTQVAFSQATRWPTLD
FT                   ADRVEGCIRSVEHAYSKEGGLAVLRGNIALDGCVVKTSGVDESIWVFEGPAYVVESQDQ
FT                   AVKDILDGKVKAGDVVVIRYEGPRGGPGMQEMLYPTSYLKSQGLGKACALLTDGRFSGG
FT                   TSGLSIGHVSPEAAAGGAIGLVETGDIIHIDIPNRSINVKLSNQELAERRDAMAAKGNK
FT                   AWKPIEARPRKVSASLKAYAMLATSADKGAVRDLSKLD"
FT   gene            complement(583801..584268)
FT                   /locus_tag="CJA_0478"
FT   CDS_pept        complement(583801..584268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0478"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82765"
FT                   /db_xref="GOA:B3PIW7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B3PIW7"
FT                   /protein_id="ACE82765.1"
FT                   /translation="MTMDIIDLRSAPEHLPTLARWHHEEWGYLNPGETLADRIDKMRAY
FT                   LGEATIPTLLIAVENDKVLGSAALIAADMDNKPELSPWLANVFVRNDQRGRGLGSALVK
FT                   AIMALAASSQWPHLYLFTPDQEVFYSKLGWKPLSKEVYRDTPITIMQLDCL"
FT   gene            complement(584265..585593)
FT                   /gene="argA"
FT                   /locus_tag="CJA_0479"
FT   CDS_pept        complement(584265..585593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argA"
FT                   /locus_tag="CJA_0479"
FT                   /product="amino-acid N-acetyltransferase"
FT                   /EC_number="2.3.1.1"
FT                   /note="identified by match to protein family HMM PF00583;
FT                   match to protein family HMM PF00696; match to protein
FT                   family HMM TIGR01890"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85699"
FT                   /db_xref="GOA:B3PIW8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR010167"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR033719"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:B3PIW8"
FT                   /protein_id="ACE85699.1"
FT                   /translation="MPNISQDYVKWFRHSSPYINKHRGRTFVLMLPGEGIKHPNFHNII
FT                   HDVALLSSLGVRLVLVHGARPQIDERLQVADTYSNFHKNLRITDSESLSLVIQAIGEAR
FT                   TTVEAALSTGLPNSPMHGADMQVISGNFVVAMPYGVIEGIDLQHTGKVRRINTRALHTA
FT                   LDSGAVVLLSPCGYSPTGEVFNLSFSDVATHVAIAIKADKLLAFIEGDGVLDDDSHLIR
FT                   QLSLQECKHYLETYYEKLGEHANPDLQQAVSACYLSCLQGVPRAQLVSYTTDGALLTEL
FT                   FTRDGLGTMIYSGHYEQLRSATIDDVGGILELIRPLEEEGILVRRSREVLETEISKFHV
FT                   MEKDGAIIACAALYPYGDTAELSCVATHPDYRKGGRAALLLQQVEHQARKQKIKQLFLL
FT                   TTQTAHWFIEQGFMQGKLDDLPVQRQLLYNYQRNSKIFIKSLV"
FT   gene            complement(585620..586774)
FT                   /gene="argE"
FT                   /locus_tag="CJA_0480"
FT   CDS_pept        complement(585620..586774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argE"
FT                   /locus_tag="CJA_0480"
FT                   /product="acetylornithine deacetylase (ArgE)"
FT                   /EC_number="3.5.1.16"
FT                   /note="identified by match to protein family HMM PF01546;
FT                   match to protein family HMM PF07687; match to protein
FT                   family HMM TIGR01892"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83279"
FT                   /db_xref="GOA:B3PIW9"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010169"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B3PIW9"
FT                   /protein_id="ACE83279.1"
FT                   /translation="MTFDAKHYRQQLRDLVAIPSVSCAVPEWDMPNRPVIDYLANSFAD
FT                   MNFITRVMPLEQPGKANLIATLGKGEGGLLLAGHTDTVPYDANRWQSDPFTLTEKDGKL
FT                   YGLGATDMKGFFPVIIEAVKPYLYTRFRHPLIVLATADEESSMSGARALVREGMQGSTP
FT                   GCAIIGEPTGLVPVRAHKGIMMEAIRVRGKSGHSSNPALGNNALEAMHNVMGELLALRS
FT                   ELQLKYRDPGFAVQTPTLNLGCIHGGDGANRICADCELHFDLRLLPGMENEAIRQAIQQ
FT                   RLTPIAERTGTDIVLSSLFEGVDPFAQDRTSDLVQVCEQLTGHSAESVAFATEAPFMQQ
FT                   LGMQTLVLGPGSINQAHQPDEFIPLDQIEPAVKILRELIERYCL"
FT   gene            complement(586912..588186)
FT                   /locus_tag="CJA_0481"
FT   CDS_pept        complement(586912..588186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0481"
FT                   /product="pho4 family protein"
FT                   /note="identified by match to protein family HMM PF01384;
FT                   match to protein family HMM PF01851"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84111"
FT                   /db_xref="GOA:B3PIX0"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:B3PIX0"
FT                   /protein_id="ACE84111.1"
FT                   /translation="MTLFAEYGQVLFVLACVFGLFMAWGIGANDVSNAMGTSVGSRALT
FT                   MKQAIIIAMVFEFAGAYLAGGEVTETIRSGIVELDIMSSHPDLFVYGMLSSLLAAGSWL
FT                   LIASILGWPVSTTHSIVGAIIGFAAVGISVDAVQWGQVWGIVGSWIITPVIAGFISFWI
FT                   FRSVQHLILDTEDPFGNAKRYIPFYMFAVGFFLSMVTLLKGLKYVLKEHHIEFGFIQAV
FT                   VIAALIGIAVAGIGIYLLSRINQDTHADKSNRFSSVERVFGVLMIFTACSMAFAHGSND
FT                   VANAVGPVAAVIAVVQAGAVETKALVPSWVLLLGATGIVIGLATYGYKVMVTIGKKITE
FT                   LTPSRGFAAEMAAAATVVIASGIGLPISTTHTLVGAVLGVGLARGIGALNLGVIGGIFA
FT                   SWVITLPAGAGLSILFFYFFKGLFS"
FT   gene            complement(588212..588889)
FT                   /locus_tag="CJA_0482"
FT   CDS_pept        complement(588212..588889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0482"
FT                   /product="conserved hypothetical protein TIGR00153"
FT                   /note="identified by match to protein family HMM PF01865;
FT                   match to protein family HMM TIGR00153"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84932"
FT                   /db_xref="InterPro:IPR002727"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:B3PIX1"
FT                   /protein_id="ACE84932.1"
FT                   /translation="MPFANLSNLFGRSPIKPMQEHMAVAIKAAGQLVGFFEAVTDGNWV
FT                   LAGEIQQQVVKYEHEADDIKKQLRLHLPKSLFLPVPRTDLLELLTMQDRIPNRAKDIAG
FT                   IIMGRKMTIPASMQDQMNEFVRASVAAAEQALTAINELDELLETGFSGRELTVVENMIK
FT                   ELDKLEEKADHLEIGVRTSLFALEAQLPPVDVMFLYNIIDWVGDIANRAHDVGGRLQLL
FT                   LAH"
FT   gene            589058..590857
FT                   /locus_tag="CJA_0483"
FT   CDS_pept        589058..590857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0483"
FT                   /product="type IV pilus biogenesis protein"
FT                   /note="identified by match to protein family HMM PF00437;
FT                   match to protein family HMM PF05157"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACE86015"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:B3PIX2"
FT                   /protein_id="ACE86015.1"
FT                   /translation="MNNDGIPLMMVQPILDRFLDLRGIVDDLVAAGHMSRVDANVLLGA
FT                   SRTREQAIMHPLSYIATQAIEDQQRPGKTLDAETLTAWLAEMARMPQFHIDPMKIDVAK
FT                   CTEVVSYAFAKRHGILCVQVNQDHVVIACLQPFMGGWEPQVEHVARRQIKKVVANPADI
FT                   ERYMVEFYTLARSISGASGAAAASAITNFEQLVELGKASDPDANDQHIVKIVDWLLQYA
FT                   YDQRASDIHIEPRREFGRIRFRIDGVLHYVYELPANVATAVTSRLKVLARLDIAEKRKP
FT                   QDGRIKTRRNDGSEVELRMSTLPTAFGEKLVMRIFDPEVLLRSFADLGLVGDDYQRWHG
FT                   MLTRPNGILLVTGPTGSGKTTTLYSSLRQLATSEVNVSTIEDPIEMVEESFNQTQVHHK
FT                   IGLDFAAGIRSLMRQDPDIIMVGEIRDLETAQMAVQAALTGHLVLSTVHTNDAPSTIAR
FT                   LLDLGVPSYLINATLLGVMAQRLVRTLCPHCKEEGTIHAQDWQELVSPWKVNVPAKVYH
FT                   PVGCLECRNTGYLGRQGIYEILVLSDNLKERVTPSCNLQDMRRQAMKEGMRTLRLSGAQ
FT                   KIAAGLTTMEEVMRVAPPPEKAN"
FT   gene            590945..591628
FT                   /locus_tag="CJA_0484"
FT   CDS_pept        590945..591628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0484"
FT                   /product="putative glutathione S-transferase"
FT                   /note="identified by match to protein family HMM PF02798"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85636"
FT                   /db_xref="GOA:B3PIX3"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:B3PIX3"
FT                   /protein_id="ACE85636.1"
FT                   /translation="MYRLHIANKNYSSWSLRPWVLMRALDIPFDEILHPFPEQGAWDQY
FT                   RQFAPNGKVPCLQDGDLTIWDSLAIVEYLAEQHAGVWPGDTAARAWARSAVAEMHSGFQ
FT                   ALRSTCGMNCGLRIELPGLSLAVQKDLARIDELWSQGVSRFGGPFLAGSQFTAVDAFFA
FT                   PVAFRVQTYGLPLSAIAQAYSETLVQLAAMQQWYQAALLEPWRESAHEQEALDAGRLLA
FT                   DYRSA"
FT   gene            591691..591900
FT                   /locus_tag="CJA_0485"
FT   CDS_pept        591691..591900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0485"
FT                   /product="twin arginine-targeting protein translocase,
FT                   TatA/E family"
FT                   /note="identified by match to protein family HMM PF02416;
FT                   match to protein family HMM TIGR01411"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85402"
FT                   /db_xref="GOA:B3PIX4"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:B3PIX4"
FT                   /protein_id="ACE85402.1"
FT                   /translation="MIMALSFWQVLLVVVLFLLLFGRGKIPQLMGDLAEGIRSFRKGVS
FT                   DVSDTPNTANAEQKTERVDEQKQA"
FT   gene            complement(592119..592676)
FT                   /locus_tag="CJA_0486"
FT   CDS_pept        complement(592119..592676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0486"
FT                   /product="PEP-CTERM putative exosortase interaction domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84061"
FT                   /db_xref="InterPro:IPR013424"
FT                   /db_xref="UniProtKB/TrEMBL:B3PIX5"
FT                   /protein_id="ACE84061.1"
FT                   /translation="MKPLLAACFLLVLAAGAKALPVHYYGEIQGSGNYTGAVDINFGWS
FT                   DAPFGLNSWGEQVNLWGFNATEGETLALDLTSNELSLGFSLYFGEVSASDLLFGLFDNS
FT                   GDIGSAVYLAGASLWSYGQSLSDFAIGQTGFYTLIVGGRDFGGYDGYHYNLAVSQVPEP
FT                   AGLLLLASGLLGLGVLRYRARG"
FT   gene            complement(592703..594100)
FT                   /locus_tag="CJA_0487"
FT   CDS_pept        complement(592703..594100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0487"
FT                   /product="Tat (twin-arginine translocation) pathway signal
FT                   sequence domain protein"
FT                   /note="identified by match to protein family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83245"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008557"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:B3PIX6"
FT                   /protein_id="ACE83245.1"
FT                   /translation="MNNSPEVPVPDTLFPVEPVVNRREFMKGGAAGAAAISLAAMANSA
FT                   NAAFTSDYGPVMPVADESTGLPLLQLPAGFKYWSYGWTGMIMKDGVATPGVHDGMGVVA
FT                   AQGNTIALVRNHEVRGAGTAVKSPAIYDTRGGGGCSNLLFDAFNGQWLASYMSISGTST
FT                   NCAGGITPWGSWLTCEETTDTYSGITHGWIFEVPGFGKASPTPIKAMGRRAHEATATDP
FT                   VTGYVYITEDAGTSSGFYRYRPNVYGKLLEGGVLEMLAVTNLPQANLLASYPNGTTWDV
FT                   EWVIIDQPESINPRNYTQGYNKGAARFARLEGAWYDTGLIYFVSTSGGGIGGGQVFHYD
FT                   PRRETLTLTFESRNNTSHPVAPDNMTVSPRGGLLLCEDRGGISRLMGLNQAGDVFEFGR
FT                   NNMNLNAADVAIIHSRFPGTAGRINAGNYIGAETCGACFYDRWLFVNIQSPGVTFAITG
FT                   PWNEGIL"
FT   gene            complement(594225..595040)
FT                   /locus_tag="CJA_0488"
FT   CDS_pept        complement(594225..595040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0488"
FT                   /product="Sec-independent protein translocase TatC"
FT                   /note="identified by match to protein family HMM PF00902;
FT                   match to protein family HMM TIGR00945"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85846"
FT                   /db_xref="GOA:B3PIX7"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:B3PIX7"
FT                   /protein_id="ACE85846.1"
FT                   /translation="MNDHSSVDLSRAPLLSHLVELRKRLLLCLMAFVLAFIACYLVAEQ
FT                   IYQFLMQPLVDILGEEPGRRMIYTGLHEAFITYLKLAFFAALFITLPLILIQLWKFIAP
FT                   GLYRHEKRGLSLLFAMTPVLFVAGAALAYYLVFPLAWSFFISFETTGLDGNMPVQLEAR
FT                   VSEYLGLVIQLILAFGLSFELPVILLLLAHTGALTADSLVKGRRYAIVGIYALAALITP
FT                   PDLISQIALGTPILLLYEVSIWLIRWQEKTRTKPADKKPSANKPATQTS"
FT   gene            complement(595045..595440)
FT                   /locus_tag="CJA_0489"
FT   CDS_pept        complement(595045..595440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0489"
FT                   /product="TatB"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83836"
FT                   /db_xref="GOA:B3PIX8"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="UniProtKB/TrEMBL:B3PIX8"
FT                   /protein_id="ACE83836.1"
FT                   /translation="MFDLSWSELLFLAVLALVVIGPQDLPRLARILGQLWGKLQRIYRD
FT                   SLMGIRTLENEINLASQPDQRQQPSYYDLLPEHVRQVMEQAEPSRDATHNQQVQAMYQQ
FT                   AMEDVQRQHSAPSPTTASPTANSPANT"
FT   gene            complement(595510..596376)
FT                   /locus_tag="CJA_0490"
FT   CDS_pept        complement(595510..596376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0490"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF01925"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85373"
FT                   /db_xref="GOA:B3PIX9"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:B3PIX9"
FT                   /protein_id="ACE85373.1"
FT                   /translation="MRILPPTVSLRALLKNQHLPVFSPESCFMDFHIGYIVAGLVVGFI
FT                   VGMTGVGGGSLMTPILLYFGVSPANAVGTDLLYAAITKAGGIHVHHKKKNIDWRITGEL
FT                   ALGSLPAAALTLLVLHSISIDTDTLNKIIKLTLGYALILTAIAILFKRKIFDYSRKNES
FT                   WITRMTRRQQFIATVLTGVILGVVVTITSIGAGALGTVALFMLYPLLPTVRLVGTEIAH
FT                   AVPLTLVAGMGHAGLGNVDWSLLANLLMGSLPGIYMGSHLANRVADHYLRPALAIMLML
FT                   VGCKLVF"
FT   gene            596606..597619
FT                   /gene="gal53A-1"
FT                   /locus_tag="CJA_0491"
FT   CDS_pept        596606..597619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gal53A-1"
FT                   /locus_tag="CJA_0491"
FT                   /product="arabinogalactan endo-1,4-beta-galactosidase,
FT                   putative, gal53A"
FT                   /EC_number="3.2.1.89"
FT                   /note="identified by match to protein family HMM PF00652"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85511"
FT                   /db_xref="GOA:B3PIY0"
FT                   /db_xref="InterPro:IPR011683"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B3PIY0"
FT                   /protein_id="ACE85511.1"
FT                   /translation="MKLSNLQRLLAGAGLLLAPLFAQHSLAAPVKGADVSWTSQIEDNG
FT                   YKYYNRSGVQKDVFAIMKEQGMTAVRLRVWVNPADGWYNGTQDVVAKARRVKAAGLKLM
FT                   VDFHYSDTWADPGKQTKPAAWRNYTFQQLMDAVWNSTRYTLQAIKDAGVTVDWVQVGNE
FT                   TNNGMLWDDGKASVNMRNYAWLTNTGYNAVKSIYSGAKVIVHLANCHDNANFRWIFDGL
FT                   RNNGAQFDIIGASNYPTNAGGYTWQNANTACLNNLNDMVSRYGVPVMITEIGVPWDHSQ
FT                   AYTIVKDMVTKVGQVSGGKGAGIFYWEPQARPGWQGYTLGAMDNNGKATAVWDAFK"
FT   gene            597653..598894
FT                   /gene="gal53B"
FT                   /locus_tag="CJA_0492"
FT   CDS_pept        597653..598894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gal53B"
FT                   /locus_tag="CJA_0492"
FT                   /product="arabinogalactan endo-1,4-beta-galactosidase,
FT                   putative, gal53B"
FT                   /EC_number="3.2.1.89"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACE86078"
FT                   /db_xref="GOA:B3PIY1"
FT                   /db_xref="InterPro:IPR011683"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B3PIY1"
FT                   /protein_id="ACE86078.1"
FT                   /translation="MDSLCAVFCCLAKLFNDVGTPMNAVYGATLVCVTALLLAACGGSE
FT                   SSAGGGVASSSPSSPASSLASSSASSVSSSHASTSSSEGPVLSSNFVLGADISWVSEME
FT                   ASGRRFYNRAGEEIEAFALMQALGVNAIRLRVWVNPADGWYNSPQDVVAKARRAKEQGQ
FT                   RIMIDFHYSDNWADPGKQTKPAAWADYTLEELQDALVEHTHSTLQALKDEGVTPEWVQV
FT                   GNETNDGFLWDSARPSVEPRATNMKNYADLTSAGYDAVKAVFPDALVIVHLANCHDNAN
FT                   FRWIFDGLTSNNARFDVIGASSYPLANSPMTWQTSTANCLVNLNDMVTRYGVPVMLTEI
FT                   GLPWDHVNAKTVVADLINKTAAVKDGMGLGVFYWEPLSYYGWKGYTLGAFDDSGKPAAA
FT                   MEAITEAAARIARE"
FT   gene            598910..599002
FT                   /locus_tag="CJA_0493"
FT   CDS_pept        598910..599002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0493"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85082"
FT                   /db_xref="UniProtKB/TrEMBL:B3PIY2"
FT                   /protein_id="ACE85082.1"
FT                   /translation="MLMRREWHFLFLALALDFSFFSDSIPGSSH"
FT   gene            599129..606433
FT                   /gene="cbp35C"
FT                   /locus_tag="CJA_0494"
FT   CDS_pept        599129..606433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbp35C"
FT                   /locus_tag="CJA_0494"
FT                   /product="carbohydrate binding protein, cbp35C"
FT                   /note="identified by match to protein family HMM PF01839;
FT                   match to protein family HMM PF03422; match to protein
FT                   family HMM PF05593; match to protein family HMM TIGR01643"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84402"
FT                   /db_xref="GOA:B3PIY3"
FT                   /db_xref="InterPro:IPR003284"
FT                   /db_xref="InterPro:IPR005084"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:B3PIY3"
FT                   /protein_id="ACE84402.1"
FT                   /translation="MQSFSVFRSLSVFLFLLFANQAWALTLEENTSGFCSYDGAVQSTH
FT                   AGAANNQYVNLSNEAGKGITWAVQVAQAGNYTVQFRYANAGTQSAIQAAIRVNGVVVSH
FT                   GFPFPKTTAWNSWTNSGLLTLALKAGNNTIRLETTVATEFANIDSLTVHGTGLSAGTCS
FT                   GAGTPQAPNNGVILQPQAPVLASTPSPSAGIDMARPAPGEFDVTSSGQASYTLPILTAP
FT                   GTAGLVPKVSVGYSSGAGNGPMGLGWSLSAGGAISRCRQTDSQDKNALPVTWSAQDRFC
FT                   LNGERLLVVSGNYGAPGSIYKTEIDNYARITAVGGTSGHPSYFTVEYKDGLIETFGNTA
FT                   HSANSQDQLSSTNTNTVLNWHLSRQTDSAGNKIEYQYTRDADGLRLASIGYAYGATQTP
FT                   GALIYIDYDDRSDPVSGYVAGHYYNMGKRVSVIRSVNLSEGQYKEIRRYKFTYNQNTAY
FT                   TTNDKLSRINKVEECVESVCPSFVEFDWQNFEQQIDTQGASSNFVGGVSDYRLGDINGD
FT                   GLLDVVWYEEAKTVPNTLHDVLQKRSYRYALGEINTEGRYIFNMGNSYKSPSAYDDRNL
FT                   HIVDSNNDGIGNIIAGGLRDVADIYLDVNGDGLVDKIKWINGARPWEFYYYPLQTISYA
FT                   SPNPNADTTSSEFYRYVGGGMRQQFDTTNHVPSINDASRWEDFSYFQPASGGQPAVDNL
FT                   HLAPIRFIWPFMGDFNGSGRMDLVAETYSQAFGCVDDGNEEGCPSIFSRPSVYTMQKPT
FT                   STEPQWANGIELKYFNASIAYMANRAFAVDLNGDGLTDMLVGGGTNWYFRLSNGLELGP
FT                   EQYINVPGGPFNTTDQVATDVAVADYNGDGYPDFIWHSPNAPFNSTGASSGQGSIKVKY
FT                   WDPAINNFEAGERFIKSEPYQVLTNYGDARYGWNFSFSRFKTTAINMMDLDGDGRSELV
FT                   VTPTRQTGAITVYKSTGSQSPINKVIGIRDSLGKNITVNYEAINRTGHYIGGHKVYNAN
FT                   DAEMCTTLANSSGYYTRSMCWSVDAAATQNDFYRNINDPWRNLSSDEQSLKPDSPVSSS
FT                   VGATFVVTNTAQSAPLSNNPSALKQTAYFYEHARTQAAGRGFLGFEAFTVVDRETGIRV
FT                   RNSFRQDWPYVGRLHKSQIFTEYGNKLSESVNQWALVACYYYGVANNTCVDNYRQTMKD
FT                   QGSAALGSLGVFLRKEDTKEYALLDEGYAQGTLLKNSVTTNTYEGNGNVLESTTQISSS
FT                   LPLESITKTTTNTYVYMSETWSMWKGRLQQIKTVTSNNRYGAITRTSSFDYYTSGSAIG
FT                   LLKTETVEPDNSDYNVTTTHSYHMGNRVASSTTADGQTRKTEIEYDTLGRYIDKTYEFF
FT                   TNGSDPNTPVKYLATQVITRDKYGTPTLSRRYYSTTAFVSHKTATTTFGTPYFNAASTG
FT                   EFTEVRMGVGTGSEGVCPSDTKIWSTAQMAGGGKSIQCVDLLGRVRRAGDLGFTGTNWS
FT                   LVDTEYDKQGRVVRSSAPYASGTADRYWTSYSYDVLGRVTETLVPYNNTHVATTTEYDN
FT                   LNVVITNPKGQVRTEKRDLVGQVIEVVDPNNGVTRFAYDARGNMREMKDPALNTTTIGY
FT                   DLRDRKTSMSDPDKGNWTYRYNRFNELVCQRDGKNQVITMGYDIRGRMVNRIERPNGAS
FT                   CDTTSISFGTYWVYDTASNGLGQLESVHTTPQGVPEFRQRFKYDSRGRLSTKETSFAGH
FT                   LGALTTHHEKITYDQFNRVYQQFDAAREVNTFETNGVQHLYNAQGYLHKVVDATSYSGS
FT                   QQAYYTIQDQDARGNVISALYGNGVTQAAVYEAATGLTKKLQATRAHPVSLLQDIQLEW
FT                   DEVGNLSSRHERGTAGESVARNIYESFGYDSLNRLNSWASSGDLTASQSVTYDAIDNIR
FT                   SKGGQSFLYGSECGASLNAGPHAVCNAHDYHYRYDNNGNLVNDGRGRNLQYTRDDLPSY
FT                   ISVESHNTRFFYDPLRARYKRVDTAAGNQVTTTLYVGAVEKVYYPDGSTEWKRNIAGVG
FT                   QITHTLNSQGVMAGEAQRYFIKDHLGSISLITDEIGSVEQAHYFDPWGMPQKVVTAGSI
FT                   KQWQEDLARYRLSSKPITTRGFTGHEHLAEMDLIHMNGRLYDARLGRFVQADPIIQDPL
FT                   RVQSLNRYSYVWNNPLNATDPSGFKCETVNDKQICTNDKPTEEVQVDGVKPPPQKNSGL
FT                   AYTITDPTAIQQWLSQQGKSMADFESRMSELGISKASGSNRARAGSGVLWADKDGDIVG
FT                   LGDKNNTAVFALGEVSAAAEEAIGLSPWVDSASPFAGRSVCGSDRACVAAADEFQTQGN
FT                   IIALSSAIPIEGLAFSALKIATLLKRADYAKDALVVAKGLGNFADEAKLLSHFEKHGAE
FT                   FGVKSADEYLSIARGVMQNGTKVQYVYKGETRTGFVQLMGNTNKGQSKFAFVGTNSQGQ
FT                   ITTLHAKSGKDFWKTLNGNAQNKTIYQVQ"
FT   gene            complement(606961..607857)
FT                   /locus_tag="CJA_0495"
FT   CDS_pept        complement(606961..607857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0495"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83323"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:B3PIY4"
FT                   /protein_id="ACE83323.1"
FT                   /translation="MKTLLLRLGLVLCAIGSTSTQAEQTLNINTSSDVNSPYAMQMIEL
FT                   ANQHIGNKYHIKTVDDGVTKSRIMEDVANGTYDVFWASTNNDTEAKFDPIRIPLFKGLL
FT                   GHRIFIIRQGDQARFDHIKTLEDLKQIKLGSGTTWADTGILKANGLTVVTANKYPNMFY
FT                   MLDGSRFDAFPRGAHEPFVEIEKNQHLPLTIEKNLMLVYRMPFYLFVRKGNTELVNDLT
FT                   RGLELALKDGSFDKLFINHPSVQDVIQKAGLQNRRIFYLDNPTLSQAPLDRPELWVDVK
FT                   TLGKPAQISETAEKAEQ"
FT   gene            complement(608083..610437)
FT                   /gene="bgl2A"
FT                   /locus_tag="CJA_0496"
FT   CDS_pept        complement(608083..610437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bgl2A"
FT                   /locus_tag="CJA_0496"
FT                   /product="beta-galactosidase, putative, bgl2A"
FT                   /EC_number="3.2.1.23"
FT                   /note="identified by match to protein family HMM PF00703;
FT                   match to protein family HMM PF02836; match to protein
FT                   family HMM PF02837"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84496"
FT                   /db_xref="GOA:B3PIY5"
FT                   /db_xref="InterPro:IPR006101"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032311"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="UniProtKB/TrEMBL:B3PIY5"
FT                   /protein_id="ACE84496.1"
FT                   /translation="MMKHLQSLKTLPALALCALLGACAPGDKTDHYFADLNLDKDWQFM
FT                   RSDAVLDLATAQAHSAWEKVDVPHTPRIEPLIVNDQFQGDAWYKKTLTPEANWKGKHIS
FT                   LKFEAAMNVAEVWVNGEKLTRHLGGYLPFSVDLSNKLNWNAPNDILVRLDNRDNPVTGP
FT                   KPLHDLDFNTYGGIYRHVYLNINNPVHITDAVAAGKKASGGIFVTYPEVGKDKARLQVQ
FT                   THIANTGTTDQQLQVVQRLLDGDKTIAEVRSESFNLNAGSDSENRLEISLQQPRLWSPK
FT                   APNLYQLVTQVYQGKTLVDEQKTHIGIREFKWVDNQLYINGEKTFLRGVNRHQEYPYIG
FT                   YATSDAADYRDAVRIKSAGFDYVRLSHYPHSPAFMAAADELGLVLLDAILGWQYVSEDP
FT                   AFQAQIQQTCRDLIRRDRNHASVMAWECSLNESWMSEPFIDSLTRIVKEEYPGSLSAGW
FT                   QEYGYDIYLQARQHRLEHYHTPTKPYVVSEYGDWEYYAMNAGLNQSAWADLLQADRSSR
FT                   QLLSDGEKRLLQQASNIQEAHNDNFNTPAFADGYWVMFDYNRGYAPDLEASGIMSIERL
FT                   PKYSYYFYQSQRDPAEQSASYSSGPMVFIASEWTATSALDVRVFSNAEQVELLLNGTSL
FT                   GKQAPDQNSNTNNLKHPPFTFALEKFEAGELTARAYLGGKQVAEHKVATPGDASSIKLW
FT                   LDTSGVAPQTGVKDAVFVHAQLVDAAGNPVRSNGIAVDFKIAGDGQLISPAQINTQYGI
FT                   ASALVQIGANLDALSVSASSGELTGQPLDIR"
FT   gene            complement(610492..611622)
FT                   /gene="gal53A-2"
FT                   /locus_tag="CJA_0497"
FT   CDS_pept        complement(610492..611622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gal53A-2"
FT                   /locus_tag="CJA_0497"
FT                   /product="Arabinogalactan endo-1,4-beta-galactosidase
FT                   gal53A"
FT                   /EC_number="3.2.1.89"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83887"
FT                   /db_xref="GOA:P48841"
FT                   /db_xref="InterPro:IPR011683"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/Swiss-Prot:P48841"
FT                   /protein_id="ACE83887.1"
FT                   /translation="MKKKILAATAILLAAIANTGVADNTPFYVGADLSYVNEMESCGAT
FT                   YRDQGKKVDPFQLFADKGADLVRVRLWHNATWTKYSDLKDVSKTLKRAKNAGMKTLLDF
FT                   HYSDTWTDPEKQFIPKAWAHITDTKELAKALYDYTTDTLASLDQQQLLPNLVQVGNETN
FT                   IEILQAEDTLVHGIPNWQRNATLLNSGVNAVRDYSKKTGKPIQVVLHIAQPENALWWFK
FT                   QAKENGVIDYDVIGLSYYPQWSEYSLPQLPDAIAELQNTYHKPVMIVETAYPWTLHNFD
FT                   QAGNVLGEKAVQPEFPASPRGQLTYLLTLTQLVKSAGGMGVIYWEPAWVSTRCRTLWGK
FT                   GSHWENASFFDATRKNNALPAFLFFKADYQASAQAE"
FT   gene            complement(611718..614444)
FT                   /locus_tag="CJA_0498"
FT   CDS_pept        complement(611718..614444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0498"
FT                   /product="putative TonB-dependent receptor"
FT                   /note="identified by match to protein family HMM PF00593;
FT                   match to protein family HMM TIGR01782"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84787"
FT                   /db_xref="GOA:B3PIY7"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010104"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:B3PIY7"
FT                   /protein_id="ACE84787.1"
FT                   /translation="MKHVPIHQTFTRSTLFVALSLASSLAMAQAPADENIEEIVVTGKF
FT                   LKSLQSAMEVKRNAASVVEAISPEDIGQLPDVSISDSLKRLPGLAQDRDRGNGSQISIR
FT                   GMGGMLGFTTLNGREVAILEETRNIRYDQFPSELINAAQVYKTPQAWIAEGGVSGTVNL
FT                   DTIKPLDYDSTKVVVDLRASMSELGKDIDDAYNDGIGQRLSISYIDQFLDNTLGVALGY
FT                   STRSEPIATQRAELWNYGDTWHNTQWNNELGANVVAPWGGSALVRGGEDKRQGVMAAIQ
FT                   WRPNDNLEIAYDGFWSAFDIAETQRGFDFQISNDWNNQWIPLKTTPTAYDNVPEAGAVD
FT                   LLAGTVPLSSLRNLNEEYVQDDELISNGINVKWQEGAWTIKADAAVSETSRDKRWATVR
FT                   TINDAPGWATFSSTGDGRMTFELLDADLADVTQNRVTELHVQPQAEGGDKVQSFKLDFQ
FT                   YDVDAGILQSVKFGAAASQRDKYEHNQIWTQSPTASDTSLTSAYVVNAKSSSYWGDLPA
FT                   YLSLDRNAVIADYFGGLQNPTPGDADDLTASWDVSEDISAQYIQFDLATQVFGRDLSGN
FT                   IGVRNVRTETLARGYEQGETQEVWEEIPAGSGTWVMTGSVETVTAVATPHDYNDVLPST
FT                   NWTLSLTDEHLIRIGAAKTMARAPVNMMSPSLNLNQDLWGANPGESTSGNPKLNPFRAT
FT                   QYDLAYEWYYSEKSQIAINLFYKELDSFIMRAADAETIERNGQEYSVSRPVNGSGGYIR
FT                   GYELLWQQSFDFLPAPFDGLGIYTNFSHNESNVEQALPLHSSYKAGLTGLSENVGNFTL
FT                   WYYHNGFEARTSYSYRSEFQRDINLVMGEEGVNDAEGYWDLSLSYEFDDHYKVYFQVQN
FT                   LTNEPYKTYGLESNNPAHINRYEEFGTRYSVGINWKL"
FT   gene            614495..614599
FT                   /locus_tag="CJA_0499"
FT   CDS_pept        614495..614599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0499"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83965"
FT                   /db_xref="UniProtKB/TrEMBL:B3PIY8"
FT                   /protein_id="ACE83965.1"
FT                   /translation="MMLNLCPSVNQRQQKFLSGGIGDRQIVACQQGDR"
FT   gene            614655..617621
FT                   /gene="glnE"
FT                   /locus_tag="CJA_0500"
FT   CDS_pept        614655..617621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnE"
FT                   /locus_tag="CJA_0500"
FT                   /product="glutamate-ammonia-ligase adenylyltransferase"
FT                   /EC_number="2.7.7.42"
FT                   /note="identified by match to protein family HMM PF03710"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82957"
FT                   /db_xref="GOA:B3PIY9"
FT                   /db_xref="InterPro:IPR005190"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="InterPro:IPR023057"
FT                   /db_xref="UniProtKB/TrEMBL:B3PIY9"
FT                   /protein_id="ACE82957.1"
FT                   /translation="MLNFAGVPAELQAAPQHSWEQFEASVLAQQLTHPRDLLPASISAE
FT                   TFSLQLTRALVGSEFIAKTCAVRPAYLLEQIASGELFEAWGEDALAPFAAAIQACTGDN
FT                   ELDACLRRFRQKAMIRLIWRDLNRQDSMQSITAELSRFADTAIALAADYHYRALQQLYG
FT                   TPRGRESGEAQPFMVLGMGKLGAGELNISSDIDLMFTFPEGGETDHPSRSVGNQEFFVK
FT                   LGQRLIKSLDTITAEGFVFRVDMRLRPHGQSGSLAMSFVGMEDYYQTQGREWERYAMIK
FT                   ARTVAMVGGEGAVQRERARQQLRSLLQPFTYRQYIDFSAIESLREMKGLIARQVQRRGM
FT                   NLDVKLGEGGIREVEFVVQVFQLIRGGRDARLRQRKVTVLLPFLEQENYLPAGAGSSLL
FT                   EAYIFLRNTEHAIQGYQDKQTQSLPTDAVGQLRLAWVMGFDSWEAFSAQLSLYRQRVNS
FT                   EFKAVIAAPDEEDSVDQKALDFWLGFWEGSLQGEDALQALQAQDVEQAEALLKAIGDLQ
FT                   QSRAVLAMQASSRSRLDAFIPRLLQTLSQHSLAGKLAPLTMAPVFQRIAPLVEAIARRS
FT                   AYLVLLVENPTAIQQLVRLCAASPWIADQLAQYPALLDELLTPESLYSPPDKDQLRDEL
FT                   RREVLRLGWDDLEGHMEALRYFRSAHALRVAASEVSGTLPLMKVSDYLTYIAEVVLEHA
FT                   LQLAWQYMVARHGRPTHSDGRVDEEPDFVVIGYGKLGGIELGHGSDLDLVFIHNAESAC
FT                   ESDGQVAIDNLTYYTRLGQRIIHILNTQTISGKLYEVDMRLRPSGNSGLLVSSLVAFEK
FT                   YQMNDAWTWEHQALVRARVVAGKASLGKQFEAVRYKVLTRARDLDELRREVADMRRKMR
FT                   DQLGSGAKSERLFNLKQDVGGIVDIEFMVQYAALAWACQAPGIIQYTDNIRILGSLEEA
FT                   GLLDADSVSHLIAAYKAYRSTGHRLALQRQEAVLEGENHFVEERAQVTAIWDRLIGRP"
FT   gene            617648..618577
FT                   /gene="ilvE"
FT                   /locus_tag="CJA_0501"
FT   CDS_pept        617648..618577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvE"
FT                   /locus_tag="CJA_0501"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /EC_number="2.6.1.42"
FT                   /note="identified by match to protein family HMM PF01063;
FT                   match to protein family HMM TIGR01122"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85634"
FT                   /db_xref="GOA:B3PIZ0"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:B3PIZ0"
FT                   /protein_id="ACE85634.1"
FT                   /translation="MSFADRDGVIWLDGELIPWRDAKVHVLTHTLHYGMGVFEGVRAYK
FT                   SDSLGTSIFRLKEHTDRLFRSAHIMRMKMPFTKDVVNEAHKLVVRENQLAEAYLRPMAF
FT                   YGSEGMGLRADNLKVHVMVAAWNWPSYMSPEARDMGIRIRTSSYTRHHVNISMCKAKAN
FT                   GHYINSLLALQEALDSGCEEALLLDNEGYVAEGSGENFFLVRDGVIYTPELTSCLDGIT
FT                   RNTIFHLATECGYTIREKRITRDEVYVADEAFFTGTAAEVLPIRELDGRVIGEGRRGPV
FT                   TTRLQDLYFKSVRGELENHTDWLSPVAG"
FT   gene            618658..619725
FT                   /gene="gt9A"
FT                   /locus_tag="CJA_0502"
FT   CDS_pept        618658..619725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gt9A"
FT                   /locus_tag="CJA_0502"
FT                   /product="glycosyl transferase, putative, gt9A"
FT                   /EC_number="2.1.4.-"
FT                   /note="identified by match to protein family HMM PF01075;
FT                   match to protein family HMM TIGR02195"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84435"
FT                   /db_xref="GOA:B3PIZ1"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011910"
FT                   /db_xref="UniProtKB/TrEMBL:B3PIZ1"
FT                   /protein_id="ACE84435.1"
FT                   /translation="MDFPASLKAIRTILIVGPAWIGDMMMAQSLFILLKRRNPQVKLHL
FT                   LASAWTRPLVAAMPEIDEVIDMPFGHGQLDVMARYRLGKSLADRGYDQAILLPNSFKSA
FT                   LVPFFAGIPLRTGWRGEMRYGLLNDWRPLDKKRYPLMVQRYLALAYARDAALPADFPYP
FT                   QLQLDPSRRQPLLTKFALHLNRPLLILCPGAEYGSAKRWPEAYYATVAAQRIRAGWQVW
FT                   LLGSAKDQPVAETIRDQLPPTLQVHMNNLAGRTNLGEAIALMACADAVLSNDSGLMHIA
FT                   AALNRPLVVVFGSTSPEHTPPLSQRVRVVTNTLECSPCFERECPLGHHKCLRELKPAQV
FT                   QAELDELLASPATVS"
FT   gene            619746..620591
FT                   /gene="waaP"
FT                   /locus_tag="CJA_0503"
FT   CDS_pept        619746..620591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="waaP"
FT                   /locus_tag="CJA_0503"
FT                   /product="lipopolysaccharide core biosynthesis protein
FT                   WaaP"
FT                   /note="identified by match to protein family HMM PF06293"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83350"
FT                   /db_xref="GOA:B3PIZ2"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017172"
FT                   /db_xref="UniProtKB/TrEMBL:B3PIZ2"
FT                   /protein_id="ACE83350.1"
FT                   /translation="MQSDFQQRLILRDELQTLWQGQDIFALVQQLDGDLVRDVPGRQTL
FT                   RFTLNGKAYYCKRHTGVGWGEILKNLLSLRLPVISARSEWLALNRLAELQVPSLEPVAY
FT                   GERGSNPATRISFIVTRELAGKVQLDDYLRAHPRLAPKERRCLLDAVAHIARQIHRNGI
FT                   NHRDLYLCHFLLDTDSLASWRTGAGQVQLFLVDLHRAQLRARVPRRWQVKDLASIYFSA
FT                   MDLGVTQRDIWRFLQVYFDQPLAVVVHQQRDLLAAVARRADKLYRREQRLRARGQRGQV
FT                   "
FT   gene            620588..621718
FT                   /gene="gt4E"
FT                   /locus_tag="CJA_0504"
FT   CDS_pept        620588..621718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gt4E"
FT                   /locus_tag="CJA_0504"
FT                   /product="glycosyl transferase, putative, gt4E"
FT                   /EC_number="2.4.1.-"
FT                   /note="identified by similarity to SP:P25740; match to
FT                   protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACE86120"
FT                   /db_xref="GOA:B3PIZ3"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B3PIZ3"
FT                   /protein_id="ACE86120.1"
FT                   /translation="MKLAFTLFHYFPYGGLERDMLAMARTCKARGHQVTIYTQRWAGEL
FT                   PADIPVQLVPVRALSNHGRAREFARRFMALRHQQTIDLVVGFNKMPGLDVYYAADTCFA
FT                   QKVYEGRHWLYRFSGRSRAYLDLENAVFAPASSTQILLIAPAQKAAFQRYYQTPDVRLH
FT                   RLPPGIRRDRVMPADYAIQREQGRAALGAAPDTLVLLAVGSDFARKGLSRTIKAMAALP
FT                   PDIRARTRLWVAGQDDATSAVRLAGQLGIASQVQVLGARDDVAQLMWSADMLLHPAHSE
FT                   AAGAVLLEAMVAGLPVIATAVCGYAPYIAQWQLGKVIADGDTQLADAIVDIAAQDRAHW
FT                   LARARDFIAHGDVFSMMDHAVAIIESMGTGKLSDRL"
FT   gene            621728..622912
FT                   /locus_tag="CJA_0505"
FT   CDS_pept        621728..622912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0505"
FT                   /product="O-antigen polymerase family protein"
FT                   /note="identified by match to protein family HMM PF04932"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83996"
FT                   /db_xref="GOA:B3PIZ4"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:B3PIZ4"
FT                   /protein_id="ACE83996.1"
FT                   /translation="MLANVVSRTRREAFCLKWAALGVYLFLSAFFWASGPAPLRGIFYL
FT                   FLLLPFLAVLPWRRWRLDEYGGYFTLSALVFAAYSVAASLWGRPEDIGFFLKQWVFLAF
FT                   WLCGIAWLFYHRPVDLQRLYSVVIAVGVVCALVTVYGFFMGANSDPEGRLSGFGLAENS
FT                   TVVAQIFGVAALLAYIKSLQADSAKLSWLFLGAALVCAWVILLSGSRGAALALVLVALA
FT                   ALVIIRPRPSIWVPQVILGGLVLGAAILSVGVATLLEVRVTAFSLRDVIWRELLQRVPG
FT                   HLLFGIGYYEDSRILIADVGVFHHAHNSWLDILYYGGALGLLLALWHGVLLARTFSCDR
FT                   DLLPLYLWWVYGCLCLLTNGSSLLTRPDAQWLMYWVPAGLLAAVVMSRRRCPHP"
FT   gene            622897..624021
FT                   /gene="gt4D"
FT                   /locus_tag="CJA_0506"
FT   CDS_pept        622897..624021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gt4D"
FT                   /locus_tag="CJA_0506"
FT                   /product="glycosyl transferase, putative, gt4D"
FT                   /EC_number="2.4.1.-"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85073"
FT                   /db_xref="GOA:B3PIZ5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B3PIZ5"
FT                   /protein_id="ACE85073.1"
FT                   /translation="MPAPIKIMILQTRHIESISYLTAGLVSAFPAGQYQVTLVYLEDGA
FT                   ATPEDRLAHQCVFLGLDKTDYKGLRLKAMGKLRPFLQQHHFDVIIANMYKPIHLLMQLR
FT                   RFVSAPVCIGIIHAFGEFDRLGRRLMMRWWLDKRWHLVGVSEPVRQYLINAGAGVHPGN
FT                   SAAINNAVDVAAIQHAVLGRVEARERLGLPVDGRVFGTIGRCVKGKRHLELIQAFERFS
FT                   SARNNVFLAIIGAGELLPSLEQYVRERDLGNKVFLCGYIPRAAGLVRALDVFVFPSESE
FT                   GFGLALLEAMAAGVPAIVNRVEPLASIVAECGYSVDCANTDTLVQAMDDCYRQSPGELS
FT                   ALGEAHYERVRTHYDIAGFRQAYRALVERLLRGV"
FT   gene            624014..624133
FT                   /locus_tag="CJA_0507"
FT   CDS_pept        624014..624133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0507"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACE86177"
FT                   /db_xref="UniProtKB/TrEMBL:B3PIZ6"
FT                   /protein_id="ACE86177.1"
FT                   /translation="MYNPVPGLAIQPLRDNMPGSFYLGMDDRFPNPIKAFYGK"
FT   gene            624123..625895
FT                   /gene="msbA"
FT                   /locus_tag="CJA_0508"
FT   CDS_pept        624123..625895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msbA"
FT                   /locus_tag="CJA_0508"
FT                   /product="lipid A export permease/ATP-binding protein MsbA"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664; match to protein
FT                   family HMM TIGR02203"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83134"
FT                   /db_xref="GOA:B3PIZ7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR011917"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B3PIZ7"
FT                   /protein_id="ACE83134.1"
FT                   /translation="MASKNTSLRPQAETSAWNIYGRLLRYLKPYVFWFCLSVVGYIVYA
FT                   CANVMYSHVMEKLVAAIESDDAAARWWVPTQIVIATLLRGAGMFVGGYFMAKVAFNVVN
FT                   DLRVQVFNHMTHLPVSAFDARPSGHMISLITYNINGVTVAATDALKKGIREGATVIGLL
FT                   AWLFYLDWKLTLMFLSVAPIMGLLVTKVAKRLRRLSSKVQDSVGDITQVSSEMINGYKV
FT                   MRTFGGEAYEQQRFTQASKKNYAQNMKIVITSAANAPVMHLLIAVSMSLLIYAALSFMQ
FT                   LESTAAFIGYITAVGLIVTPIRQLGEVAPMILKGVAAADSVFTLLDEAPEADTGTRTLG
FT                   RVKGEVEFRDVSFRYPSQERAALSHFNLRVEPGKVVALVGKSGSGKSTLVNLLPRFYDP
FT                   RSGDILLDSVSIRELRLANLREQIALVNQQVVLFEGSVADNIAYGRREHVSAEQIKQAA
FT                   DLAFVTEFVQNLPQGFDTLIGEGGARLSGGQRQRIAIARAILKDAPILILDEATSALDN
FT                   ESEHMIQAALESVMKGRTTFVVAHRLSTIERADLIVVMADGEIVEQGTHQALLALNGHY
FT                   ARLHSRQFDDDSER"
FT   gene            625951..627387
FT                   /gene="rfaE"
FT                   /locus_tag="CJA_0509"
FT   CDS_pept        625951..627387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfaE"
FT                   /locus_tag="CJA_0509"
FT                   /product="LPS biosynthesis protein RfaE"
FT                   /note="identified by match to protein family HMM PF00294;
FT                   match to protein family HMM PF01467; match to protein
FT                   family HMM TIGR00125; match to protein family HMM
FT                   TIGR02198; match to protein family HMM TIGR02199"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACE86096"
FT                   /db_xref="GOA:B3PIZ8"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011913"
FT                   /db_xref="InterPro:IPR011914"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023030"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B3PIZ8"
FT                   /protein_id="ACE86096.1"
FT                   /translation="MQLSMPYFEQAKVLVVGDVMLDRYWHGASSRISPEAPVPVVNISQ
FT                   TEDRPGGAANVALNLAALGCQVTLLGVIGLDEAGMVLEQRLQSTAIVTDFHRSLSKPTI
FT                   TKLRVISRHQQLLRMDFEDRYTWEDSCALAARVESHLDGVDVLILSDYAKGSLQDCQAL
FT                   IQKARSHNIPVLVDPKSSNYQRYQQATLLTPNLHEFEQVVGNCRSERELLDKAREMIDS
FT                   LQLNALLITRGEQGMTLIRPGHSELHLPARAREVFDVTGAGDTVIAALSGALAAGETLP
FT                   ESVAIANLAAGIVVGKLGTATVSAPELRWAIYAEQGFECGVVTEEQLLLALADVRANGE
FT                   KIVFTNGCFDIIHAGHVGYLEEARKLGHRLVVAVNSDASVKRLKGDGRPINTLDRRMAV
FT                   LAGLEAVDWVIGFDEDTPERLIDTLKPDILVKGGDYREDQVVGAPIVKTYGGQVKVLSF
FT                   FDNCSTTSIVNKIRKNALFN"
FT   gene            627350..627982
FT                   /locus_tag="CJA_0510"
FT   CDS_pept        627350..627982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0510"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85421"
FT                   /db_xref="GOA:B3PIZ9"
FT                   /db_xref="UniProtKB/TrEMBL:B3PIZ9"
FT                   /protein_id="ACE85421.1"
FT                   /translation="MLTKSAKTPCLIEQLRFYFALRVVPGSARLRNNVQDLILIQRQVL
FT                   AVNNRFNPASRFTHSSVAPREGLVDFVINYRTYIDRIMLWLTLGAWLMSLLYATQHNTW
FT                   GLALVLGGVLTGINWVAIDVVRHPRITPCVIGVVYMVFVSLHVHQLKGMIEAHFGYFVF
FT                   LAALFTYLDWRPLVWAALTAAVLHIAIHMMQHAGIPIYFPTMRTPGA"
FT   gene            627988..628704
FT                   /locus_tag="CJA_0511"
FT   CDS_pept        627988..628704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0511"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83729"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJ00"
FT                   /protein_id="ACE83729.1"
FT                   /translation="MHAFYVVIETAVLIVLVKLASRLLVVAQEVVNVTETMIGDSRYID
FT                   LNIRALARHNAILDHFNWLLDSIASALKSALGAQSEADKNLEVLSGNSRQLVAIADESH
FT                   QAAESIRVAMDNMHDSFVAVAEQIQRAAGLAEDTARAQEEGKVAVRHSREGIAELSHLL
FT                   GDTANAIDTLAGTARRSPVPWQRSRELPSKPTCWRSMRQSRRRAPVSRGGGLPWLQMKC
FT                   ALLPVAPSYRQRISSR"
FT   gene            628635..629042
FT                   /locus_tag="CJA_0512"
FT   CDS_pept        628635..629042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0512"
FT                   /product="methyl-accepting chemotaxis transducer"
FT                   /note="identified by match to protein family HMM PF00015"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82687"
FT                   /db_xref="GOA:B3PJ01"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJ01"
FT                   /protein_id="ACE82687.1"
FT                   /translation="MVADEVRALARRTQLSTENIKQIVDRLVAGSTQSVAAMGHSRVRV
FT                   EENVAKSASVEQTFDRIAAAIREINQITGQIASATEEQTRTSESITRQTAQLNDFNRET
FT                   SLIVNQNRERLGHLEAAFGDLQRALTRFREG"
FT   gene            complement(629086..630240)
FT                   /locus_tag="CJA_0513"
FT   CDS_pept        complement(629086..630240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0513"
FT                   /product="NADH-dependent butanol dehydrogenase"
FT                   /EC_number="1.1.1.-"
FT                   /note="identified by match to protein family HMM PF00465"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85896"
FT                   /db_xref="GOA:B3PJ02"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJ02"
FT                   /protein_id="ACE85896.1"
FT                   /translation="MQNFMFSNPTKILFGEGQIQALADLIPTHARVLLTYGGGSIKKNG
FT                   VYDQVVNALTGKTWFEFSGIEPNPHYETLMKAVDLVKQEKIDFLLPVGGGSVIDGTKLI
FT                   AAAVNFDGEPWDILAKHAPFHSALPIGCVLTLPATGTESNGNSVVTKAATQEKLSFGSP
FT                   LVYPQFAILDPTTTYSLPPRQIANGVVDAFVHIMEQYLTYPVDAKVQDRFAEGLLMTLI
FT                   EEGPRALEEPTNYNIRANVMWAATMALNGLIGVGVPQDWATHMIGHELTAMHGLDHAQT
FT                   LAVVLPAVMQHQRGPKRDKLLQYGRRVWGLDLSDEDALIDAAIAQTRQFFEAMGTPTRL
FT                   QGYGVGRESIPKLVDMLVKHQLIALGEHGLITPEASREILELAA"
FT   gene            complement(630209..630313)
FT                   /locus_tag="CJA_0514"
FT   CDS_pept        complement(630209..630313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0514"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84858"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJ03"
FT                   /protein_id="ACE84858.1"
FT                   /translation="MRSFTLPHSADTIGTSESTLLEVTDAKLYVFQPD"
FT   gene            complement(630333..630686)
FT                   /locus_tag="CJA_0515"
FT   CDS_pept        complement(630333..630686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0515"
FT                   /product="iron-sulfur cluster-binding protein, Rieske
FT                   family"
FT                   /note="identified by match to protein family HMM PF00355"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85002"
FT                   /db_xref="GOA:B3PJ04"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJ04"
FT                   /protein_id="ACE85002.1"
FT                   /translation="MSEEFTVLCALADIPAGGCRGFSEQRLFAVRSSAGDRVFIYNNQC
FT                   PHLGIPLEWVEHQFLDPSGSMIQCANHAALFVIDSGQCVSGPCAGQKLTAIPCRIEGNN
FT                   ILIRRVVSTVNNA"
FT   gene            complement(630683..631738)
FT                   /locus_tag="CJA_0516"
FT   CDS_pept        complement(630683..631738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0516"
FT                   /product="hypothetical protein"
FT                   /note="At3g27925/K16N12.18; identified by match to protein
FT                   family HMM PF00089; match to protein family HMM PF00595"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84340"
FT                   /db_xref="GOA:B3PJ05"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJ05"
FT                   /protein_id="ACE84340.1"
FT                   /translation="MTLWRWLVLTFLTGASALSASVQAFSTDDERNSMEVFETARPSVV
FT                   FVTNQQLARDPYSFDLITVPRGSGTGFVWDSKGYIVTNFHVVEGARQITITLQDQSNWP
FT                   AEVVGLAPERDIAVLRIKAPEDRLKPLPLGDSANLRVGRKVLAIGNPFGLDATLTTGVV
FT                   SALGREITSPNQRKITNVIQTDAAINPGNSGGPLLNSQGELIGVNTMIYSPSGASAGIG
FT                   FAIPVNTVKEVVPELIKHGRLVRPVLGIAVAPEQWARQIGVEGVPILRVEPNSPAAAAG
FT                   LEGAKRNAWGQITLGDVIVAIGDTPTTNDDQLLSALEKYKPGDQVNVSVVRSGKLITRS
FT                   LRLAAPRQHSS"
FT   gene            complement(631770..632651)
FT                   /gene="htpX"
FT                   /locus_tag="CJA_0517"
FT   CDS_pept        complement(631770..632651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htpX"
FT                   /locus_tag="CJA_0517"
FT                   /product="heat shock protein HtpX"
FT                   /EC_number="3.4.24.-"
FT                   /note="identified by match to protein family HMM PF01435;
FT                   match to protein family HMM PF06509"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83478"
FT                   /db_xref="GOA:B3PJ06"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PJ06"
FT                   /protein_id="ACE83478.1"
FT                   /translation="MLRIGLFLLTNLAVLVVAGVVLSLLGVGNYRTADGLDLTNLLIFC
FT                   AVFGFVGSFISLFLSKWMAKKTMGVQLIEQPRNADEKWLVDTVVELSQKAGIKTPEIGV
FT                   FAAQESNAFATGWNRNDALVAVSLGLLQRFERDEVKAVLAHEIGHVANGDMITLSLIQG
FT                   VVNTFVMFFARIIGDLVDRVIFKNEEGRGIAFFITTIVAELVLGILASMIVAAFSRYRE
FT                   YRADAAGATLADRGAMIRALQRLQAEMSAGVESPLPSSMRAFGISGGVRNLFASHPPLE
FT                   ARIQALRDSAHG"
FT   gene            complement(633064..633936)
FT                   /locus_tag="CJA_0518"
FT   CDS_pept        complement(633064..633936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0518"
FT                   /product="cAMP-dependent protein kinase"
FT                   /note="identified by match to protein family HMM PF00027"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84023"
FT                   /db_xref="GOA:B3PJ07"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJ07"
FT                   /protein_id="ACE84023.1"
FT                   /translation="MLATWGIFQRFPGLLPRAPGQPPCKLIEDPMHLPSKQSETLSDLA
FT                   AKLSALGDLLCADLPAERARISPGNDLFNDRPTTEILRLVDGQAEYLVNGKLVLAGDAG
FT                   DILGLPRSLNLPYGEWRNQEPIEVDIYTRDGLVNHINSDSKRQRHWAHYLLCLQSFYEQ
FT                   ALAQETPAAFQPSAGFLHFQAGETIIRQGDNADRVYTLLEGSADALCDGVKVGEINPNE
FT                   IFGALAVFTRQPRMASIVASSDCTLLAVRKEEFIDLIEHQPQICLSLIEEMAAKINQLN
FT                   GQLRDLKNE"
FT   gene            complement(634050..634346)
FT                   /locus_tag="CJA_0519"
FT   CDS_pept        complement(634050..634346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0519"
FT                   /product="TfoX C-terminal domain superfamily"
FT                   /note="identified by match to protein family HMM PF04994"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84614"
FT                   /db_xref="InterPro:IPR007077"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJ08"
FT                   /protein_id="ACE84614.1"
FT                   /translation="MTSSHSELLQLKNLGMASVNILRAIGINTQADLKRTGAVEAYRRI
FT                   KARDINVSKVMLYALQGALMDVHWNDLAPDLKRKLVEDAEGKGDTSQLGRVSA"
FT   gene            634569..635249
FT                   /locus_tag="CJA_0520"
FT   CDS_pept        634569..635249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0520"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /note="identified by match to protein family HMM PF02557"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84841"
FT                   /db_xref="GOA:B3PJ09"
FT                   /db_xref="InterPro:IPR003709"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJ09"
FT                   /protein_id="ACE84841.1"
FT                   /translation="MLIESRFLLGLDNSLLIASESYQCQLQAEVLAALDALSARAAAAG
FT                   FSVRVASGYRNFARQLSIWNNKAEGRRPVLDDRGEPLDMERLSEREKVFSILRWSALPG
FT                   ASRHHWGTDLDIYDASRMPACYEVKLTQAETCGDGVFAAFHRWLDTQLQAPDAVFYRPY
FT                   AHDRGGVAPEPWHLSYAPVAQQYARALTLDVLYEQLLHTDLALKETVLAHLPEIYSRFV
FT                   RVDH"
FT   gene            635271..636683
FT                   /locus_tag="CJA_0521"
FT   CDS_pept        635271..636683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0521"
FT                   /product="transporter"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85933"
FT                   /db_xref="GOA:B3PJ10"
FT                   /db_xref="InterPro:IPR024671"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJ10"
FT                   /protein_id="ACE85933.1"
FT                   /translation="MSMSASPSPDRAGIRGWMLFDWAAQPFFTVIITFIFGPYFVSRLV
FT                   ADPVTGQAFWGYTITISGVVIALFAPVLGAIADACGPRKPWLAFFALIKVSALVSLWWA
FT                   VPGSDLWLPMLAIILATIAAEFSIVFNDSMMPRLLSQRDIGRVSNQAWGLGYIGGLVVL
FT                   FSVLLLLAGNPETGKTLLGIAPLFGLDPALGEDARITGPYAALWYLVFIVPLFIWTPDS
FT                   RIGRPLGAAIRSGMQELRCTLAELNQRRGLLRFLIARMTYQDGVNGLLALGGTFAAGMF
FT                   GWQTLEMGLYGILLLVVAIGGCFYAGRLDARLGSKRVVQVALVILLVATLGIISTGPGY
FT                   TLFGLMPLSLADTGGSFGTAAEKAYILFGLLIGLAFGPVQASSRSYMARSVGVDEAGRY
FT                   FGIYALAGRATAFLAPMSVASLTLYTDSARIGMAALIVFLVLGYAILRSCPYPATTSPA
FT                   AERAGRGHLQPE"
FT   gene            636689..637501
FT                   /locus_tag="CJA_0522"
FT   CDS_pept        636689..637501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0522"
FT                   /product="serine acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /note="identified by match to protein family HMM PF00132;
FT                   match to protein family HMM PF02178; match to protein
FT                   family HMM PF06426; match to protein family HMM TIGR01172"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83442"
FT                   /db_xref="GOA:B3PJ11"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJ11"
FT                   /protein_id="ACE83442.1"
FT                   /translation="MILDVSLNTSPDLDVWAEIRAEAQISSAEEPVLASFYHTTILNHG
FT                   SFAAAISFHLANQLDSQAIPAMMIREVFEEAMQADPTIEIAMRADIRAHRERDPACSRY
FT                   CLPFLFFKGYHALQSWRVAHWLWQQGRNSLALYFQNQISQTFDVDIHPGARIGCGIMID
FT                   HATGVVIGETAVIEDNVSMLHSVTLGGSGCAKTDRHPKIRQGVLIGVGAKILGNIDIGE
FT                   GAKIGAGSVVLESVAPHTTVAGVPAKPVGRPKGDAPARDMDHLLGDDG"
FT   gene            complement(637502..637741)
FT                   /locus_tag="CJA_0523"
FT   CDS_pept        complement(637502..637741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0523"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84222"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJ12"
FT                   /protein_id="ACE84222.1"
FT                   /translation="MLPLQPDHNPDQADALINRDKVERDIAFLLDRLAAMKLQPKPNTQ
FT                   LIAHYETMLKSRQAVLNWLLDGHDNHDLPRHNQG"
FT   gene            637943..638683
FT                   /locus_tag="CJA_0524"
FT   CDS_pept        637943..638683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0524"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84424"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJ13"
FT                   /protein_id="ACE84424.1"
FT                   /translation="MSSPEFDIIFRGDIVIGHQVADVKNKLQQLFKTDAARVDALFTGR
FT                   PLPLKRNLDEVSAHKYREILLKAGALVEVVAAGKFAPPTAPLRPASPAAAAPVKTGWTL
FT                   APVGTHLLEPSQRRLIQPLAVDTSHLSLRAQAGNLVDQAEVQPEPIAEVIIPALAVADL
FT                   GADLLDADEKWELPLPEIELEDWGIAPPGIDLLTEDERTVVVPVVVDVSNIQLAPAGSD
FT                   LGQLKSQQPPVNPDISHLTLVDNG"
FT   gene            638722..640878
FT                   /locus_tag="CJA_0525"
FT   CDS_pept        638722..640878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0525"
FT                   /product="AsmA family superfamily"
FT                   /note="identified by match to protein family HMM PF05170"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85166"
FT                   /db_xref="InterPro:IPR007844"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJ14"
FT                   /protein_id="ACE85166.1"
FT                   /translation="MKLALKILGALIALLILAVVLLVTLVSPNQFKPHIEAAAKEQGIA
FT                   LHMGDLGWAFWPSIGVSLADITVAAVETPEKPIAELKNASLMLALMPLFRGEFQVDHVA
FT                   VDGAQIHLAVDKQGKGNWEALSQSSTPESSEKAQVQSQTQSQASEAKPLNLEVEKISLT
FT                   NSALDYHDEKTGQIINLRDLNIVLTGVNTQGNPFDAQLSWLLELVQANTDKLQVKGELN
FT                   NRVTLDKEFNNLQLDDGQLRLTLTQKSSADIALDYQLAVKDLQKDMSYQGKLQLLSLNA
FT                   RQVLAALGTRLDTANSDALKHVALGTAIKGDTKQVALDDLQLTLDKTRFTGNLAVTDLA
FT                   TSALKLKLTGDSINVDDYLPPPSETPAAAQQAAATEDTPLPLEALRGLNLDAEFALASM
FT                   RFNKMALSNIDLSVNAKNGVIRQKLSANAYQGDIQFNSNTDARTDKAIMNFDGGVQGFE
FT                   LAPLIKDLEIDENLGLSGAIQAKAQGNTQGASVNQLMAAMNSTANFSGAQVRLSPLNIE
FT                   QKFCELVNLVTQNTTEVNWDAFTEMRQLNGNIVWRDQVINLESFNAGVSQLLLTSNGKI
FT                   NLATDKYEFKLPIKLAEASEAASLKGCSLTTTNYWVDRGLSLLRCKGSFGAINPLKDCG
FT                   FDKSALGDLTKDFAEYKLREKHGDKIDAAEQKLKDKKQELLDKANEKLGGEGTVNKPAD
FT                   LLNNLLKKKLGTQSSSAESSVAAE"
FT   gene            640975..641067
FT                   /locus_tag="CJA_0527"
FT   CDS_pept        640975..641067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0527"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82756"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJ15"
FT                   /protein_id="ACE82756.1"
FT                   /translation="MINKNQEMISVNRFLVFLQLVRSFFIVIFC"
FT   gene            complement(641064..641261)
FT                   /locus_tag="CJA_0526"
FT   CDS_pept        complement(641064..641261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0526"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83602"
FT                   /db_xref="GOA:B3PJ16"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJ16"
FT                   /protein_id="ACE83602.1"
FT                   /translation="MSTFRNAINNLDDKSAYIMVGNMLVLATALNVIDDMVEVTLSAPI
FT                   SNGINKIFIHINNLVLASNS"
FT   gene            complement(642343..643218)
FT                   /locus_tag="CJA_0528"
FT   CDS_pept        complement(642343..643218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0528"
FT                   /product="nitrate ABC transporter permease protein"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR01183"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACE86188"
FT                   /db_xref="GOA:B3PJ17"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005889"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJ17"
FT                   /protein_id="ACE86188.1"
FT                   /translation="MSHSSATSQAGYTSSATGTDTRKTASQRFAQISNYLLVRVVPALM
FT                   MITLLVGLWEIICSRPDSNLPSASQVIEETIYLIENPFYDNGGTDVGMGWQILASLKRV
FT                   AVGYTLAVIAGVALGILVGQSLWAMRGLDPIFQVLRTVPPLAWLPLSLAGFQDSHPSAI
FT                   FVIFITSIWPIIINTSVGVRNIPMDYRNVARVIQLPGWQYFYKIMLPAAAPYIFSGLRI
FT                   GVGLSWLAIVAAEMLVGGVGIGFFIWDAWNSSRISDIILALIYVGLVGFALDRLVALVG
FT                   HLVTRGTSSG"
FT   gene            complement(643231..644580)
FT                   /locus_tag="CJA_0529"
FT   CDS_pept        complement(643231..644580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0529"
FT                   /product="nitrate-binding protein nrtA precursor,
FT                   periplasmic"
FT                   /note="AGR_L_1886p; similar to protein from
FT                   oscillatoriacean cyanobacterium; identified by match to
FT                   protein family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84646"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJ18"
FT                   /protein_id="ACE84646.1"
FT                   /translation="MDNKNIPDTQDPTTDKTSPTQMNRRKLLKTSLTALGGAAALGILP
FT                   SGLRSIAYAATSTLETTKAKLGFIALTDAAPLFVAAEKGFFAKYGMTGVEVLKQSSWGT
FT                   TRDNLVLGSDKNGIDGAHILTPMPYLIATGAVTANKQQVPMYNLLRLNLAGQCISVGKE
FT                   YADLKVGLDASGFKKAIAAKKASGKAVNAAVTFPGGTHDLWMRYWLSAAGIDPNKDIST
FT                   IVVPPPQMVANMKVGSMDTFCVCEPWNEQLINQKIGYTALTTGELWHNHPEKSLSLRAD
FT                   WVDKNPNATNALLMAVMEAQMYCEKPENREEVAKICADRKWIGAPFKDIINRMKGDFDY
FT                   GTGRVVKNSPEQMRYWADQASYPFKSHDLWFLTEDIRWGYLPANTDTKALVDKVNREDL
FT                   WRKAAADLSVPAADIPASSSRGVETFFDGKVFDPENPKAYLDSLAIKYLA"
FT   gene            645033..646148
FT                   /gene="mutY"
FT                   /locus_tag="CJA_0530"
FT   CDS_pept        645033..646148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutY"
FT                   /locus_tag="CJA_0530"
FT                   /product="A / G specific adenine glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /note="identified by match to protein family HMM PF00633;
FT                   match to protein family HMM PF00730; match to protein
FT                   family HMM TIGR01084"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84218"
FT                   /db_xref="GOA:B3PJ19"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJ19"
FT                   /protein_id="ACE84218.1"
FT                   /translation="MASTNTAFSKAILAWFDRHGRKHLPWQQGITPYRVWLSEIMLQQT
FT                   QVTTVIPYFERFVARFPDVQSLAAAPIDEVLHLWTGLGYYARARNLHRCAQTVVSQYGG
FT                   EFPGTVAELADLPGIGRSTAGAIVSIAFGKRAAILDGNVKRVLARYHAVEGWPGQTDVL
FT                   STLWEIAETYTPKTRANHYTQAMMDMGATLCTRSKPRCELCPVREGCIAHAQGNPQDYP
FT                   GKKPKKALPEKSVQLLMVRDPAGDVLLEQRPAQGIWGGLWSFPELALEQDVEAHAERLF
FT                   GSLASLETWDSYRHTFSHYHLDITPVLVQLNRVHKAVAQSGYHWYNPHQPDELGLAAPV
FT                   KKLLQQLAQLDPRAGATSPTRPSATKARSRR"
FT   gene            646152..646427
FT                   /locus_tag="CJA_0531"
FT   CDS_pept        646152..646427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0531"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04362"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83149"
FT                   /db_xref="GOA:B3PJ20"
FT                   /db_xref="InterPro:IPR007457"
FT                   /db_xref="InterPro:IPR036766"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3PJ20"
FT                   /protein_id="ACE83149.1"
FT                   /translation="MARMVFCRKYKQQLEGLDFPPYPGAKGQDLFDNVSKKAWQEWMAH
FT                   QTMLINEKRLNVMDMGTKVYLTEQMHKFLSGEGYDQADGYVPPSNQ"
FT   gene            646550..649342
FT                   /gene="bgl2B"
FT                   /locus_tag="CJA_0532"
FT   CDS_pept        646550..649342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bgl2B"
FT                   /locus_tag="CJA_0532"
FT                   /product="beta-galactosidase, putative, bgl2B"
FT                   /EC_number="3.2.1.23"
FT                   /note="identified by match to protein family HMM PF00703;
FT                   match to protein family HMM PF02836; match to protein
FT                   family HMM PF02837"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85150"
FT                   /db_xref="GOA:B3PJ21"
FT                   /db_xref="InterPro:IPR006101"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR023232"
FT                   /db_xref="InterPro:IPR032311"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="InterPro:IPR040605"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJ21"
FT                   /protein_id="ACE85150.1"
FT                   /translation="MQLFSRSAGDTAGSLSYSHCWLILVLVLGLMLGACSDRPGDAAQA
FT                   SQAADTSPRERILLNSGWRFMKYPEGKSDALIYDVRPEVINENDAKDADSKPTEAVSVE
FT                   RNQQVLKPWILPSANPFIADPAKHHTRPQGNPGGDFPLVQADFDDSQWQMVNLPHDWAI
FT                   AGPFYEGEPALVGGGMGRLPSPGVAWYRKTLNIPASDVGKRLFLDVEGAMSYAMVWVNG
FT                   QLAGGWPYGYNSWRLDLTPYMKAGADNQIAIRLDNPNHSARWYPGGGLYRNVWLTKTQA
FT                   VHVAQWGTRVTTPEVSSASARIAVDVTVDNQSLRDVTLVTTTHIYALNTRGEREGESLG
FT                   QVITGPQTLAAGSSALLSGELRLANPRLWGPLPQQVPNLYLAHTSVYVGEQLVDTYDTR
FT                   FGIRQLEFHPTRGVLVNGEAIYLQGVNQHHDLGALGAAFNRRAAERQLEILREMGVNAI
FT                   RLAHNPPAPELLELTDAMGFLVVNEIYDSWERKKTAHDFHLIFPDWYEADLRSLIRRDR
FT                   NHPSVIMWSVGNEVGEQYTDEAGAVIARRLHDIVKEEDSTRPTAASFNYAKPQMPITAV
FT                   MDTISLNYQGEGIRNAPAYSHLQGIRTEPLYPAFHAAFPDKAIFSSENAAAVSSRGEYL
FT                   FPVVDGISAPVADGAGGDPVRHQVSAYELYTAPFGSSADKVLGSLARHPYVAGGFIWSG
FT                   WDYLGEPTPYYAARSSYFGVIDLAGFKKDRFYLYQAAWRPELPMVHILPHWNWPGREGQ
FT                   VTPVHLFTSGDEAELFLNGQSLGRKQKGEYEYRLRWDEVLYQPGELKSVAYKDGKPWAE
FT                   QRVQTTGPAAAIKLEADRAQIGSAGVDLSFITASIRDENGLLNPLAMNELRFSLEGPGE
FT                   IVATDNGDPTSFVPFVSHQRPAFHGLALVIVRATGPGKITLKATSDGLAAGELVVQATP
FT                   "
FT   gene            649594..651288
FT                   /gene="pel1B"
FT                   /locus_tag="CJA_0533"
FT   CDS_pept        649594..651288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pel1B"
FT                   /locus_tag="CJA_0533"
FT                   /product="pectate lyase, putative, pel1B"
FT                   /EC_number="4.2.2.2"
FT                   /note="identified by match to protein family HMM PF00544;
FT                   match to protein family HMM PF03422"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85953"
FT                   /db_xref="GOA:B3PJ22"
FT                   /db_xref="InterPro:IPR002022"
FT                   /db_xref="InterPro:IPR005084"
FT                   /db_xref="InterPro:IPR006584"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJ22"
FT                   /protein_id="ACE85953.1"
FT                   /translation="MMCKKFLSGAVLALASTVLSSHAAAITIQENDPGFCSYDGVISTA
FT                   HSGYTGAGYVDIHNAGGQGISYQINVATAGSYNVSFRYANRGSTSAALVVNGSSGSLSF
FT                   PRTASLSSWNTVTKTVNLVAGVNQLRLRATGSQEIANIDFMAVDGGAVSGACGSASSSV
FT                   GVSSSSSSVTVQSSSHIASLSSSSSAGTVVSSSVSSSLFSSTPSSSSRSSSSVPVSEVP
FT                   DFSMTGFAAVSALGVPTTTGGAGGEVVRVTTFEQLQHYVTASAPYVIQVEGSIQPPAGY
FT                   VKFNVTSNKTIVGVGSNATLRQIGFRVGGSIGCSDAYNANTAYVSNVIIRNLTFRDVYD
FT                   AGSNPDADAVTVECFSHHVWVDHNTFIYSAPNSTLMGRIDGAVDVKRGGDWVTVSWNHF
FT                   YQYNKTMLLGHVDSNALQDSGRLHVTYHHNYFENTHQRHPRVRFGKAHIFNNYFFNDKT
FT                   GPNRQISYIALAGPESELYLEANHIWVDSGELYVVSEDSDRNARVIFTHDNIVRLVNPN
FT                   AEWLLQVNNSQAFEPRDFYPYSINSASVLPTLVPAYAGAGKLAIVND"
FT   gene            complement(651388..651816)
FT                   /locus_tag="CJA_0534"
FT   CDS_pept        complement(651388..651816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0534"
FT                   /product="Transcriptional regulator family"
FT                   /note="identified by match to protein family HMM PF01638"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82683"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJ23"
FT                   /protein_id="ACE82683.1"
FT                   /translation="MKIVAQTPIPAPEELAQAGMTIAEMLEQGNVFAHQCPSRLILNHV
FT                   TSRWGVLVLVALLDGTHRFSELRRKIGGVSERMLAQTLQLLEGDGFVARHALPVVPPHV
FT                   EYTLTPLGQEIGEKVRSLVEWIEGNLGRINLENLADTE"
FT   gene            651801..652823
FT                   /locus_tag="CJA_0535"
FT   CDS_pept        651801..652823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0535"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAG77345.1"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84473"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJ24"
FT                   /protein_id="ACE84473.1"
FT                   /translation="MRQFSYLPFCSYLLFVSDVAILPPQVATLKSIFTVTAYFVEVCMI
FT                   AITGATGQLGRLVIDALLNKVPASQLVGLVRNPAKGADLRARGVSLRQADYTRPEELAD
FT                   AMQGVEKLLLISSSEVGQRLEQHRNLVEAAKKAGVKFIAYTSLLHTDTGTMALSVEHNA
FT                   TEELIRASGIPWAFLRNGWYTENYAASIPSALQFGALLGSAGNGRISSAARVDYAAAAV
FT                   EVLTRPDQAGKIYELAGDESYSLAEFAAELSRQTGKVISYQNLPEAEFRKILVGAGLPD
FT                   GLADLLASSDASAAQGALFDDSRQLSQLIGRSTTPLAEVIRQTLIRGEHQAQGGHNAAH
FT                   "
FT   gene            652810..653448
FT                   /locus_tag="CJA_0536"
FT   CDS_pept        652810..653448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0536"
FT                   /product="2-hydroxychromene-2-carboxylate isomerase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01323"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84776"
FT                   /db_xref="GOA:B3PJ25"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJ25"
FT                   /protein_id="ACE84776.1"
FT                   /translation="MPRIDFVADINCPWCTLGFIALDSALARLGQDPAQLVEIQPFELN
FT                   PQLGADGVNLVEYLSKRHGMGLAQIEDIHQRLRQLGEGLGFHFAERERLWNSFDSQRLL
FT                   HWAAVECPAGSQYALYRALIQAYQGQARNTSDHVVLVELVKSIGLDSDRAAEVLAGDEF
FT                   AHEVRQRQQQWQQAGINAVPSTVINHQQLLQGAQPVAVFEKALQDLLHA"
FT   gene            complement(653515..656940)
FT                   /gene="choB"
FT                   /locus_tag="CJA_0537"
FT   CDS_pept        complement(653515..656940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="choB"
FT                   /locus_tag="CJA_0537"
FT                   /product="cholesterol oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85653"
FT                   /db_xref="GOA:B3PJ26"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJ26"
FT                   /protein_id="ACE85653.1"
FT                   /translation="MKPISSDLSLIKKHYDIVVIGSGYGGAIAASRLARAGKSVCLLER
FT                   GREILPGEFPDTLAEASEEVQFHLPDKHLGSATALFDIHVEKQQNVVVGCGLGGTSLIN
FT                   ANVSLEPTRDVLDSPAWPAAIRNDPELITGFARAREMLKPVSYPDTQPSLNKLQAHQTS
FT                   AMKMGAKFSRPPVNVTFTTPEGGLNHVGVEQKACTLCGDCVSGCNHSAKNTTQMNYLPD
FT                   AWNHGADIFCLASVRYVEKQQQQWRIHYQQVGVGREKFDAPLLFVEADIVIVAAGTLGT
FT                   NEILLRSRAQGLPVSDRLGHGFTGNGDVLGFGYNCDQPINGIGFGTRKTGQQPPVGPCI
FT                   SGMIDLRDAPIRSQKMVIEEGSLPGAMGSLLPGALATAAKLIGQDTDDGILDNLREYVR
FT                   VLESSIRGPYQGAVNNTQTYLVMSHDDGQGQLRLVNDRLHIDWPGLGEQDNFHAAHHNL
FT                   VKATSALGGTYVKNPLWSPLLRNSLVTVHPLGGCCLGDNGSEGAVNHKGQVFSGSGNEV
FT                   HKGLYVTDGSVIPTSLAVNPLLTICAISERCCALIAKDYGWNINYQLPSAPRREHPSTK
FT                   PGIRFTEVMRGHLALGVDAGDELPRFLAAEQQGKAKREDIAFALTVYSDDLEQMLALPN
FT                   HPARISGTLEAKSLSAAPLTITDGEFSLFERLPSPPDTRQMRYRMRLHAIDGSEYFFDG
FT                   FKLIKNDAQLFELWTDTTTLYANIYRGQDTTGTLVAKAVLHIRAADFLRQLTTLKITRV
FT                   NDKLEQLRHTARFGRFFAGVLYETYGGVFYKADNQQLPPRKKRPLRAPAPEIYPVKTED
FT                   GLDLSLTRYSGGTKGPVLLVHGLGVASSIFSTDMIETNLVEFLVAHEYDVWLFDYRVSI
FT                   LLPTARLACNGDQVARFDHPAAVAKIREVTGAASVQALVHCYGSTTFFMSMLAGLQGVR
FT                   SIVSSQIAADVVVPTATAIKTGLHIPSFLKRLGVDSLTARLPEDGGSLLTKLYDKALDI
FT                   YALAEAQGRCNNDSCHRITFMYGSLYQHDRLNDLLHTHLDELFAEANIETLEHLAAICR
FT                   AGKLVNAKGDDSYLPHLDRLNLPILFISGADNACYLPESTRLTYDKLCQRFGNHQYRRE
FT                   EIPGYAHIDCIFGDRAATDVYPLMLEHLEASCRP"
FT   gene            complement(657048..657533)
FT                   /locus_tag="CJA_0538"
FT   CDS_pept        complement(657048..657533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0538"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85438"
FT                   /db_xref="GOA:B3PJ27"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJ27"
FT                   /protein_id="ACE85438.1"
FT                   /translation="MLDFSTPYAWLWLVSVVLLCVALFKRDAPLFLAVTLPAIVAMKYD
FT                   IHSLIIAAGVSVALAAVVLGTFLTVNKKDHRTSPLTDEETGHSVTFRLRVAFWIAVPLV
FT                   FLLNIALALLVLQLADPDTWFEQYPLMDEFRVMAYLVISFISALCLFTLFVTTEKNA"
FT   gene            657517..657618
FT                   /locus_tag="CJA_0539"
FT   CDS_pept        657517..657618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0539"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85500"
FT                   /db_xref="GOA:B3PJ28"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJ28"
FT                   /protein_id="ACE85500.1"
FT                   /translation="MEKSSMVLPLKIVIVNIPIGSLLIVNREHPNGK"
FT   gene            complement(658519..659898)
FT                   /locus_tag="CJA_0540"
FT   CDS_pept        complement(658519..659898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0540"
FT                   /product="hydroxydechloroatrazine ethylaminohydrolase"
FT                   /EC_number="3.5.99.3"
FT                   /note="identified by match to protein family HMM PF01979"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACE86300"
FT                   /db_xref="GOA:B3PJ29"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJ29"
FT                   /protein_id="ACE86300.1"
FT                   /translation="MSSPADAHHNTLWIKNPLACWTGNALDASNGLVIQGHKIIELVPA
FT                   GHTPHTAYDQTFDAANHVLLPGLINCHHHFYQTLTRALPAALNRELFPWLQALYPVWAN
FT                   LDDEAIYASTQLALAELLLSGCTTAADHHYVFSSIMPHAIDAQVAAAKTIGNRVTLTRG
FT                   SMSLGQSKGGLPPDSVVESDATIVRESERLIRQYHNPAEDAFCQIALAPCSPFSVTQEL
FT                   MRETATLAQQHNVLLHTHLGETQDENQFCLDRFGMRPVDYLEDTGWLSNRVWLAHGIHF
FT                   NDDEISRLGHACVGVCHCPSSNMLLASGICRTRDLTRAGAAVGLGVDGSASNDGSNMIQ
FT                   EVRQAMLLQKLHYGSANFTHEHALHLATSGSAALLHRPELGSLDIGKQADLALFNLNEP
FT                   RFSGHGDPIGALVLCGAHKADYVMVGGEWKVKAGQLVNTDLAEIMHRHGVAARKLQKAV
FT                   G"
FT   gene            complement(659895..660620)
FT                   /locus_tag="CJA_0541"
FT   CDS_pept        complement(659895..660620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0541"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85697"
FT                   /db_xref="GOA:B3PJ30"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013573"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJ30"
FT                   /protein_id="ACE85697.1"
FT                   /translation="MAKLLDTVSDFNPTETPTGKYKPGKIRDRNLTNILNAAEEEFVQN
FT                   GYRGTSIQNIADRAGIPKANVHYYFKSKTNLYIAVLDNLIQLWNDFFDNITEDDDPACA
FT                   LDNFIRKKVELSYTHPRASKLFAMEMIQGAPHLKDYIRTQMRQWVRTKGKVIETWIEQG
FT                   RMAKVDPVQLIFLIWSSTQHYADFDVQVLTIMNRAEYEPDMIEDISNFLSHMILTGCGL
FT                   VPPVRTRQPSPLPEAEALP"
FT   gene            complement(660769..661836)
FT                   /locus_tag="CJA_0542"
FT   CDS_pept        complement(660769..661836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0542"
FT                   /product="bmp family protein"
FT                   /note="identified by match to protein family HMM PF02608"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84871"
FT                   /db_xref="GOA:B3PJ31"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJ31"
FT                   /protein_id="ACE84871.1"
FT                   /translation="MTLRVLLPLAAALLSWTSGAFAAPLKVGFVYVSPIGDAGWTYQHD
FT                   EARKIVQQEFADKIETTYVESVAEGADAERVIRNMASRGYDLIFTTSFGYMNPTLKVAK
FT                   MYPKVKFEHATGYKTAPNMGNYQARDYQGRYLAGMVAGAMSQKGVIGYVGAFPIPEVIR
FT                   GINSFMLGAQQMNPDVTMKVVWVNTWHDPAKEREAAESLILQGADVLTMHTDSAAVIQA
FT                   AEARAIYSVGFNSDMRNYGPKTHLTASTQHWESIYRTKIQQVIDGTWQPEAIWHGLKEG
FT                   VVGLSPMNEVVPKEVVAKVEQYKMEIINGSRDVYQGPIYDQAGTLKVEQGKALDDEALH
FT                   KQDWYVKGIDGKIPK"
FT   gene            complement(661863..662789)
FT                   /locus_tag="CJA_0543"
FT   CDS_pept        complement(661863..662789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0543"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84568"
FT                   /db_xref="GOA:B3PJ32"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJ32"
FT                   /protein_id="ACE84568.1"
FT                   /translation="MDINLIENILFATVRTGTPLLLVALGAMMSERSGVLNLGQEGMIL
FT                   VGAACAFMAAYGAGSLGLGILAGAAAGMAVSLIFAFIALSLMSNQVATGLALTIFGTGL
FT                   SAFLGAGYVGQSITGLAPVAIPLLSGIPLLGKAFFAQDALVYLSFVLFALVWGVMRYTR
FT                   LGLVIRAVGENPEVAHALGYKVLRVRYLAVMFGGAMAGLAGAYLSLAYTPMWSEGIAAG
FT                   RGWIALALVVFASWRSERILLGAWLFGFASILHLLLQGYGYEISPNLLAMLPYIVTILV
FT                   LVLMMYRQKNQGLFAPRSLGHPFHPSK"
FT   gene            complement(662793..663884)
FT                   /locus_tag="CJA_0544"
FT   CDS_pept        complement(662793..663884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0544"
FT                   /product="permease protein of sugar ABC transporter"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83745"
FT                   /db_xref="GOA:B3PJ33"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJ33"
FT                   /protein_id="ACE83745.1"
FT                   /translation="MRIEKRLQDSPLMLYLSPLLALLLTLISGALLFALLGRPPLGSLY
FT                   TFFIAPISDGYGLSELAVKVTPLLLCALGLTLCFKAKIWNIGAEGQFVFGALIGGAVSL
FT                   QFAEQQGWWVLPAIIASGALAGLVWAGIAALLLTRFNANEILTTIMLNYIAVNLLLWAV
FT                   HGPLKDPDGFNFPESALFAPHTLLPVLFEDYRVSIALFIALFMLVVIWVVLSRTLLGFQ
FT                   LRVMGENHQAARFAGFNGKALTWLLLLFSGAMAGVAAISETNGPVGQLIPTLSLGYGYA
FT                   AIIVVFMGRMHPLGILLSSGLLGLTYLGGEMAQIDQGLPKSITGLFQGMLLFYLLACDL
FT                   LISYRLVLNTRTPGAVTTTPASE"
FT   gene            complement(663874..665511)
FT                   /locus_tag="CJA_0545"
FT   CDS_pept        complement(663874..665511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0545"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82995"
FT                   /db_xref="GOA:B3PJ34"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJ34"
FT                   /protein_id="ACE82995.1"
FT                   /translation="MSELSRDLPTKHPPALPPGSLSGAATGTSPDSYRLRLELIGLTKA
FT                   YPGCIANDSVSLKVAPGEIHALLGENGAGKSTLMKMIYGVVKPDAGQMLWNDKEVSISG
FT                   PAQARQLGMGMVFQHFSLFETLTVTENIALYLTPAEYGNLARLRERIIAVGEDYGLAIN
FT                   PDRLVHSLSVGEQQRVEIIRCLLQDIQLLILDEPTAVLTPPEVEQLIAVLKKLASKGCS
FT                   ILFISHKLHEVNALCDRATILRGGRVTGSCIPRDTSPGQMARLMLGDELELQESMPAGQ
FT                   AGACLLSLEDVELTPRDTFGIHLHNIQLQLHQGEILGLAGVAGNGQDELVDLLNGEVLA
FT                   DRGQLLLGTRDITRTGVQARRRAGLGVVPADRIGRGALGAMSLTENNLLTSYITQAGRS
FT                   GWLNWNAIRARAADIIRRFKVKATSPAASAKSLSGGNLQKFIIGREILQNPRVLVCFHP
FT                   TWGVDVGAANLIHQQLIQLRDSGAAILVISEDLDELYLLADRLGALCGGRLSPLAPKAE
FT                   VSLERLGQWMTGAFTGTSPAVQEPAHAH"
FT   gene            665734..667212
FT                   /gene="xdhA"
FT                   /locus_tag="CJA_0546"
FT   CDS_pept        665734..667212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xdhA"
FT                   /locus_tag="CJA_0546"
FT                   /product="xanthine dehydrogenase, XdhA subunit"
FT                   /note="identified by match to protein family HMM PF00111;
FT                   match to protein family HMM PF00941; match to protein
FT                   family HMM PF01799; match to protein family HMM PF03450"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85969"
FT                   /db_xref="GOA:B3PJ35"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012175"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR014307"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJ35"
FT                   /protein_id="ACE85969.1"
FT                   /translation="MRFVVNQTLIERADLAPDTTLLSLLRRDRQWVGTKEGCASGDCGA
FT                   CTVLVGSARAGRWHYRAINACICPVGSLHNQRVITVEGLAPPGLGRGAALHPVQQALVD
FT                   CHGSQCGFCTPGFVMSLVGLHLESQAIAEGHERAAVIEAISGNLCRCTGYRPIIEAGIQ
FT                   SLKKPAQMANIVQEWLPDAPLTGSGPAYRLLGKDAAEGYWQPTTEAGLQQLLTDYPQAR
FT                   LVAGGTDVMLEVTQLYQSLPQVIDLNAIPGLRQWQLTEDSLCIGAATPYSELEQGLARV
FT                   APEFVALLKRLGSRQIRNRGTLGGNICNASPIGDTPPWLLVLDAELELVNSRGETRREY
FT                   LRDFYLGYKQTTRAPDEYLARIHIARQALAQPQRLFKVSKRYEDDISAVMGAFWWDAGH
FT                   IRIAYGGMAGVPKRAFLVEAVLNTEPWHRLGQVQESRLALACDQLRAEFSPLSDVRASA
FT                   GYRLAMACELLRKACYEFAAEAAGQAPERLFIHA"
FT   gene            667205..669562
FT                   /gene="xdhB"
FT                   /locus_tag="CJA_0547"
FT   CDS_pept        667205..669562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xdhB"
FT                   /locus_tag="CJA_0547"
FT                   /product="xanthine dehydrogenase"
FT                   /EC_number="1.17.1.4"
FT                   /note="identified by match to protein family HMM PF01315;
FT                   match to protein family HMM PF02738"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84052"
FT                   /db_xref="GOA:B3PJ36"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR014309"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJ36"
FT                   /protein_id="ACE84052.1"
FT                   /translation="MRKLIEAQAQPALFKPGVGHSVAHESACKHVSGSAQYIDDLPLLP
FT                   GLVHVATGQSIHPHARIILLDIRAVRAAPGVVDVIVQRDIPGEVDVGPVYGGDPLLAGD
FT                   LVEYIGQPLFAVAATSLEAAQRAVKLARVEYDILPAQLTVEDALAARSFVLPEHQLLMG
FT                   DPDSEIDKAPHRLQGEIYVRGQEHFYLEGQISQAQLTEDGGIHVISSSQHPSEIQKLVA
FT                   EVLDLPLHLVVAEVRRMGGGFGGKESQAAPLACMAAIFAKRLQRPVRYRMPRRDDMVQT
FT                   GKRHDFLNRWRVGFDSDGHILGVDMLLAGKCGYSPDLSEGIVDRAMFHADNAYFLRSAR
FT                   ILGVRCKTHTVSNTAFRGFGGPKGMMAIESLIEDIARHLGKDPLDVRKLNLYRPGADET
FT                   PYGQKIEQHVLQDLIARLELDSDYRVRREQVTRFNQTHRYLKKGLALTPVKFGISFTAK
FT                   HLNQAGALLQIYTDGSLMINQGGTEMGQGLYTKIQQIVASAFGVSVERVIVSATRTDKV
FT                   PNTSPTAASSGTDLNGMAAKDACDRIKADLIGFACEHFQLSTEQIVFANNRVQLGRESM
FT                   SFPDFIKLAYLNRIPLLATGYYRTPKIFYNRDTAKGQPFLYFANGAAVSEVTLDTRTGE
FT                   YQVNRTDILHDVGKSLNPAIDIGQIEGGFVQGMGWLTSEELLWDDKGRIISNSPANYKI
FT                   PTAFDVPADLRVALYHEPNLENTIHLSKAVGEPPLMLGIAVWAALRDACSSTSGYRFSP
FT                   RLDTPATPERVYWALQECAAFNACQAQEVDRA"
FT   gene            669528..670457
FT                   /locus_tag="CJA_0548"
FT   CDS_pept        669528..670457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0548"
FT                   /product="putative xanthine dehydrogenase accessory factor
FT                   XdhC"
FT                   /note="identified by match to protein family HMM PF02625"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85386"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR014308"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJ37"
FT                   /protein_id="ACE85386.1"
FT                   /translation="MRVRRRRSTVPSPGSADFLQPSAHSALNWSAAIARCQARGNAYVI
FT                   ATVINTQGSTPRDGGSKMVIDADSTYDTLGGGQLEFLVVQQARELIARNKNCQLLRAIP
FT                   LAAEAAQCCGGNMVVMLECFAARQWQMALFGAGHVCQALVQILGGLPCQVRVIDNRPEL
FT                   MTNTLPGNCHYAFYADPVSAVEVLPDNTWVVIFTHDHALDFALCRALLTDRRWAYCGLI
FT                   GSHTKALRFRKRLADAGFAADDIARIYSPVGLPEVKGKLPMEVAVSIAAQLQSLYYAQA
FT                   PVNTAPSSRWREIKSLLQQERSAHIVCE"
FT   gene            670503..671000
FT                   /locus_tag="CJA_0549"
FT   CDS_pept        670503..671000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0549"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84450"
FT                   /db_xref="InterPro:IPR017595"
FT                   /db_xref="InterPro:IPR018020"
FT                   /db_xref="InterPro:IPR036778"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJ38"
FT                   /protein_id="ACE84450.1"
FT                   /translation="MTLDEFNQQDEASALTALYSCCHCMAWAQAMTAARPFADLDQLLA
FT                   KADALWAGAGEAQILEAFSGHARIGDIELLRSRYAGRATAEQGQVLQASEAEIQALYQL
FT                   NKAYEEKNGFIFIVCASGKSAAAMLELLQQRSHNSRDRELINGAREQGAITRLRLQQLV
FT                   TD"
FT   gene            671012..671362
FT                   /locus_tag="CJA_0550"
FT   CDS_pept        671012..671362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0550"
FT                   /product="Transthyretin-like protein precursor"
FT                   /note="identified by match to protein family HMM PF00576;
FT                   match to protein family HMM TIGR02962"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83297"
FT                   /db_xref="GOA:B3PJ39"
FT                   /db_xref="InterPro:IPR014306"
FT                   /db_xref="InterPro:IPR023416"
FT                   /db_xref="InterPro:IPR036817"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJ39"
FT                   /protein_id="ACE83297.1"
FT                   /translation="MSLPVEKAAITTHILNLESGRPAADVQAYLYGPDSSEPIASARTD
FT                   ADGRVMQWDAPVELQPGIYKLQFAIGDWFARQERDSFYPEIKIAFRVANTREHYHVPLL
FT                   LNAHGYSTYRGS"
FT   gene            671389..672726
FT                   /locus_tag="CJA_0551"
FT   CDS_pept        671389..672726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0551"
FT                   /product="guanine aminohydrolase"
FT                   /EC_number="3.5.4.3"
FT                   /note="identified by match to protein family HMM PF01979"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACE86275"
FT                   /db_xref="GOA:B3PJ40"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR014311"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJ40"
FT                   /protein_id="ACE86275.1"
FT                   /translation="MRHSDVQAFRAKILHFTDRPDPTTGQGVEYFDDGVLLVEHGRIKA
FT                   LASAAAMAGQGFDLQQCRHSPEQLIMPGFIDSHIHYPQTAVIASYGEQLLDWLNHYTFP
FT                   AEQQFADAEFAALAAQQFLNILLANGTTSALVYTSVFAQSTQAFFQQAEAYNLRMIAGK
FT                   VMMDRHAPAALLDTAESSERECRALIEDWHNRGRLHYALTPRFAPTSTPQQLAVTGKLY
FT                   RDYPGLYLQTHLSENRAEIAWVKSLFPEASDYLDVYDRFGLLGRRSVFGHGIHVREREI
FT                   HRLAQTGSGIAFCPTSNLFLGSGLLDLARLESAGVAVSMATDVGGGTSFSLLRTLAEAY
FT                   KVLQMQQQNLHPLTAFYMATLGNARALDLDTHLGNFAPGKEADFVVLDLGATPLQALRQ
FT                   ASTRNLTEQLFALMTLGDEHNVARTYIMGKQVFRRASRKEDQQWTH"
FT   gene            672714..673958
FT                   /locus_tag="CJA_0552"
FT   CDS_pept        672714..673958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0552"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85397"
FT                   /db_xref="GOA:B3PJ41"
FT                   /db_xref="InterPro:IPR010389"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJ41"
FT                   /protein_id="ACE85397.1"
FT                   /translation="MDALILEWLNLAFRWFHVVAGIAWIGASFYFIWLDLSLREPPAWK
FT                   AKQGIKGDLWAIHGGGIYEVAKYHLRPQDMPSTLHWFKWEAYTTWLSGTGLLILLYYLQ
FT                   AQTYLVGHNTWILSPAVAIIASVSFMVIGQLVYECLLRTPLVKNGWAFAAALLVVIGFA
FT                   SWMAHQCFSPRAAYLHVGALMATWMAGNVFWGIIPAQRQFVQAVSENLPPNTDAMAFAK
FT                   LRSTHNNYLTLPVIFCMISNHYPFVYGHAHAWLALVGIGGCLAWGRHFFNLKHLGNRKP
FT                   LILWTSGAGLLLIAIVMANTGIQKVQAGVPAIPTPVIETQIAQVKNTAPVSHNSDAPIQ
FT                   KLVQHHCTNCHSNTPTQPGFNAAPAGLVIETLEQLGAQKIRALPSIASGYMPLGNFTQL
FT                   SSEERQQLMDWLQEH"
FT   gene            673960..674262
FT                   /locus_tag="CJA_0553"
FT   CDS_pept        673960..674262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0553"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07045"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83666"
FT                   /db_xref="InterPro:IPR010753"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJ42"
FT                   /protein_id="ACE83666.1"
FT                   /translation="MGAYVIVDIEVHNREKYPEYLAQITPTVYACGGRYWVRGAQAEVV
FT                   SGQWQPKRLVVMEFPSVEVARHWATCAEYAPIHALRNAYASANMIIVEGSVDFSG"
FT   gene            674427..674837
FT                   /locus_tag="CJA_0554"
FT   CDS_pept        674427..674837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0554"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82769"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJ43"
FT                   /protein_id="ACE82769.1"
FT                   /translation="MNNRSRKLIHSFPAAVAAVFALVAIAPWSFADTGAVPDMARILAN
FT                   LNHYPSTEQKEVLAAIGKDESNSEASRAIANAIHNIEHKIKAEDAAALKAITESDAASD
FT                   AEKKLASIALGINHFASEEDKKALEALAAPNE"
FT   repeat_region   675043..675281
FT                   /note="RPT28A"
FT   gene            complement(675057..675899)
FT                   /locus_tag="CJA_0555"
FT   CDS_pept        complement(675057..675899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0555"
FT                   /product="transposase"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82751"
FT                   /db_xref="GOA:B3PJ44"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJ44"
FT                   /protein_id="ACE82751.1"
FT                   /translation="MTAEKKTCAQALVEHGIDIASACKLADLSRASYYRPERDWRKCDA
FT                   AVIDAINNELKRSPQAGFWKCYGRIRHKGYPFNHKRVYRVYCQMGLNLKRRVKRVLPRR
FT                   IVQPLAVVAQANHQWALDFMHDSLYCGKRFRTLNVLDEGTRECLAIEVDTSLPAERVVR
FT                   ALEQIKVERGLPTQLRVDNGPELISARLTDWCEENGIRLVYIQPGKPQQNGFVERFNGS
FT                   FRREFLNAYLFESLTQVREMAWFWRMDYNEERTHESLGHLPPAAYRAKLENSSLEMSH"
FT   repeat_region   675285..675961
FT                   /note="RPT17A"
FT   gene            complement(675896..676165)
FT                   /locus_tag="CJA_0556"
FT   CDS_pept        complement(675896..676165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0556"
FT                   /product="transposase"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85928"
FT                   /db_xref="GOA:B3PJ45"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJ45"
FT                   /protein_id="ACE85928.1"
FT                   /translation="MKKSRFTETQIFSILKEVDAGLKVETVCRKHGISNATYYNWKSKY
FT                   GGMDTSELKRMRELEEENAKLKKMFADVSLQNQAMKELFAKKGW"
FT   gene            complement(676643..677041)
FT                   /locus_tag="CJA_0557"
FT   CDS_pept        complement(676643..677041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0557"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84118"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJ46"
FT                   /protein_id="ACE84118.1"
FT                   /translation="MNFKYNKGAAYLSESDWLKTCTFLEPYCLKLKNMAQELGFDMRIS
FT                   KIWPSYEFTKNGLFFYTIMRFSLNPDYLNDEKITFHCYFYKYKKIFLFKTNEIISKEDF
FT                   FILTKEEMTNEKYNLEKIYKCAVKVLEY"
FT   gene            complement(678420..678791)
FT                   /locus_tag="CJA_0558"
FT   CDS_pept        complement(678420..678791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0558"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83902"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJ47"
FT                   /protein_id="ACE83902.1"
FT                   /translation="MREKNSQYFFNLKIIQEGLLGLSAPKEDQLKLNKTGMNYLDDIFD
FT                   TMILDYVQYLEREKIISHETCKKIIDLYIDIENSVGNLNDKEIDSFIKNDQSNLNVWRE
FT                   KAVELIKEINNALESLEEK"
FT   gene            complement(678798..685997)
FT                   /gene="cbp35B"
FT                   /locus_tag="CJA_0559"
FT   CDS_pept        complement(678798..685997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbp35B"
FT                   /locus_tag="CJA_0559"
FT                   /product="carbohydrate binding protein, putative, cbp35B"
FT                   /note="identified by match to protein family HMM PF01839;
FT                   match to protein family HMM PF03422; match to protein
FT                   family HMM PF05593; match to protein family HMM TIGR01643"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84184"
FT                   /db_xref="GOA:B3PJ48"
FT                   /db_xref="InterPro:IPR003284"
FT                   /db_xref="InterPro:IPR005084"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJ48"
FT                   /protein_id="ACE84184.1"
FT                   /translation="MQSFSVFRSLSVFLVVLFSHHTWALTLEENTSGFCSYDGAVQSAH
FT                   AGATNNQYVNLSNEAGKGITWAVQVAQAGNYTVQFRYANAGTQSATQAAIRVNGVLLAH
FT                   ALPFPKTGAWSSWTNSSAFTLALNAGNNTLRLETTVATEFANIDSLTVHGTGLTAGTCA
FT                   GAGTPKAPNNGVVAQPQAPVLAAIPAPASGIDMAQPTEGEFNVNASGQATYRLPLVLPA
FT                   GSGGFAPQISLGYNSGAGNGTLGMGWSLNAGGSVSRCRQSESENRNFRPLTLDANDRFC
FT                   LNGEKLIVDENYIYGAVGATYKTAIDDFSRITAVGGIAGSPDYFKVEHKDGRIDYYGNS
FT                   LIQQSSMAKLPYGSANLRWMLTYSEDSAGNRIDYLYEKEHGNWPSLAEIRYAYGNGLPD
FT                   AKVVFTWDSRPDTIIHRILTAEFQQNVLLYQVEVINNGQSIRKYHLNYDEGNNNAEYDN
FT                   VSRLSSVTECVGSTCKAPLKFDWLLPDLSGFNNVSETFTLPSASSPFLANFFTYALGDI
FT                   NGDGLLDLVWMNYGVGYNNIYYALAQRQWNGRIEYVEATYVGGTGITATWNTVAMAPPL
FT                   LKFTDYNHDGRKDLVVTELFGTYRTRIFLSEPQSDGTWKLSASPVPENIPNGLGNKYIF
FT                   ADLNGDGLEDLIRLSGTINVRYLQPGGLGYAPEQEVPVVVPQHLISPHCSSPFSDVHSA
FT                   TGDFNADGRMDFIFIACTAGDPNVARYEQHVYTSHKASNGNVELRFHAKVSNDFSTKKM
FT                   VLNQCRRDTVVHTELPVASLRVADINNDGYDDISGAVDTCLDNEYRLNWGTGFSSKRNL
FT                   NHIAYATFNNFIDINGDGYLDAVYVGNSGGSKKVIYVSYWHETAFRTVNHEIPISIDVH
FT                   YENSVELRDFDGDGNIDFFITGRNYSPRASLYLNKANGKTRNKIYRVVNGLGSYIGITY
FT                   EAIAKTYQYSYIKGFNPSNTHEFMGMVTSNGLKRKVYAASNEELQDIIRNPFEGTYAGG
FT                   QHLGDPKFPAYNLVGSYYVVTRSFEQTSGSNDENVEIIHPSEGRDTQYFYENGRFQAGG
FT                   RGFLGFDRFTKAEYGRLVTINQYRQDWPFTGRLARQEKYNYYTGRLIDKKEYSWGVTQC
FT                   YISSTALPDCMREMAIDANYLGTSALGSMTPFVFKSVAEKYAMNTSGSQGGIESVTTIT
FT                   REVDSKGNTTYESTAIGNGSTTLHETLQTNTYAYPTYSYSASMGRLTQMQVETNQYGDL
FT                   GTDTAIRQSSFGYYSSGAAKGLLHYEIIEPNNPDYTIRTDHYYNAFGQRTLSETTADGQ
FT                   TRRSTEYEYDAKGRYVDKTYEYMTDGTNTNTGIKRLVSQVTQRDKYGTPTEIKNYVATN
FT                   RSVTRRVGTTAFGIPYFTANSDGSFAVITAGINYDPDYICPTGTSTWKKETLSGGFATT
FT                   QCMDIAGRVIRDGKKGSSDGEWIITDTRYTAEGQQLAKSEPIIHGDDPKYWIITYHDEL
FT                   NRLIYEVKPTREQDGQQATTQIYYENNQVRMVNAKNQERKEVHDPLGRIARVIDANGGT
FT                   THFTYDARGNLKTMRDPNNNTTTMTYDLRDRKTSMSDPDKGTWTYRYNRFNEQVCQLDP
FT                   KQQRTVMHYDIRGRLIARKENYQSNCNYLGGVDASASVSTHWVYDSATNGMGQLAKTYT
FT                   LLAVAGTQPEYTQRYTYDNWGRLSVTETSMQGHLSQLTTHYEKITYDQYGRIFQVFDAA
FT                   RATDSYEYNGIEHTYTNTGYLFQIKDAVRYGGAQKTYYTIGSVDAHGNRGGSYGNGLST
FT                   IVSSYADSGLLKNIITRKSIPGVNLQNSYYTWDLIGNLKTRRETGGGTWIENYLRSRNI
FT                   NESFEYDNLNRLTHWNTSGDFNSTESVTYDAIDNIRTKTGNAAYLYGNQCSSSANAGPH
FT                   AVCSIGGVNYNYDKSGNMISDTIGRSLQYTIDDLPSQISKNGHTTRFHYGPDRSRFKRV
FT                   DTTAGSTTTTLYIGNVEKIYRSDNTVEWKRHIGGVAIISQTYNSVGILQSTKEHYLHRD
FT                   HLGSLSMITDANGFVVKDFYYDPWGASRIPNNDITQWMSAQPFQKVASTISSRGFTNHE
FT                   HLDEVGLIHMNGRIYDPKLARFVQADPIIQDPLRVQSLNRYSYVWNNPLNATDPSGFTT
FT                   QGMTRSQLSGDSDDDWAEDPMDIWQLWWDSQAGEDCSASCRSNLRDSNRGGDGAAFMEA
FT                   IHNAMSGNYSSNSYYITRIGIGSSEGLSTVSVKAFVQWTGAARETQGSSGSGYSEGDSS
FT                   AQKERTWGSYLPGTAAGDRAAQYWADRLVANGGGFLDDPIASAGLFFSVLWTDQTAVNT
FT                   AVTLATGGIGTIGSVSIKANTYVANLILKYPSTLRWLPQAGVKGTLQEAGWVAGSMRQS
FT                   TAARGSWSMVLNPGPIARLQWSAAGGRHGGSYWKLTGPEYGTQKFNYFFSKNW"
FT   gene            complement(686290..688596)
FT                   /locus_tag="CJA_0560"
FT   CDS_pept        complement(686290..688596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0560"
FT                   /product="outer membrane ferric siderophore receptor"
FT                   /note="identified by match to protein family HMM PF00593;
FT                   match to protein family HMM TIGR01783"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85055"
FT                   /db_xref="GOA:B3PJ49"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJ49"
FT                   /protein_id="ACE85055.1"
FT                   /translation="MNTGNLRAKVLPITSLASTAPAKTALAIFMATYLASAYAADGQNA
FT                   SSTPQAKAGTLPTVMVEAGTVEEVNYTGKKASTSTKLDIDIKETPQSVSVITRKQIDDM
FT                   GASNLGQLLLYTTGVVLTGDNSERTNFSIRGFNVGDGWNSNLLQYDGVPINASNVASSK
FT                   PDMAMVETIEVLRGAAGLMQGSGEPSGTINIIRKKPTAELQANAAFTYGSWNTYRLEGD
FT                   VSNSLNESGTVRGRLVGVSQDGDSYMTAVTREINLIYGIVSADLTENTLLNVGYKRQAE
FT                   DSIAAHNLPRNPITGEDLELSRKNCSCNYGDYWDKENTDAFIDLSHQFDSGWSVKGAYV
FT                   KANYQMDMMFTSLAPVSAAQFDPANPQGNVNKYAYQYDQNLDVADVFAKGPFTLFGREH
FT                   QFVIGSNYQKSDNPGRWTSWDVVLEDYSLWNRVGTAPAPLLTVDLNTYNPYLLPYIPAR
FT                   YDQDGGRSYEERIQTGTYITTRLSLADPLNLILGVRQSDFEYDYQYKSNVTNQLVPSRG
FT                   NHYEKNHITTPYVGLTYDLNNTYTLYASFTDTFVVQSARDINNNLLDPIQGNVYEAGIK
FT                   GSFNDSRLMASLAAFRINQINRSIRDESSAGQCPQNGGDGYCNISAGKVISEGIEAELR
FT                   GEVLPGLNMSLGYTYNTTEYEKDPANQGRVFNETTPEHIARVFATYLFANELTIGAGVN
FT                   YQSEWLTGRYGAISARQEAYALVNIMASYPINETFTVSVNADNALDEKYYSYLSSTSNR
FT                   YGEPRNMKVTLRATF"
FT   gene            complement(688838..689734)
FT                   /gene="pda4B"
FT                   /locus_tag="CJA_0561"
FT   CDS_pept        complement(688838..689734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pda4B"
FT                   /locus_tag="CJA_0561"
FT                   /product="polysaccharide deacetylase protein, putative,
FT                   pda4B"
FT                   /EC_number="4.2.2.-"
FT                   /note="identified by match to protein family HMM PF01522"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85459"
FT                   /db_xref="GOA:B3PJ50"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR017625"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJ50"
FT                   /protein_id="ACE85459.1"
FT                   /translation="MTYPRDLMGYGPRPPHARWPGGARIAVQFVINYEEGGENCVLHGD
FT                   PASETFLSEIIGARAYEARHMSMESLYEYGSRAGFWRLHRLFGKYQLPVTVYAVAMAME
FT                   RNPAAVEAMLQSDWEIASHGYRWIDHQFMPLELEREHIRTAIEIHTRLTGSRPLGWYTG
FT                   RDSPNTRRLVLEAGGFMYDSDSYADDLPYWTRDYGRPHLIIPYTLDTNDMRFAAAQGFN
FT                   SGEQFFTYLRDAFDALYAEGEHSPKMLNIGLHCRIIGRPGRIQSLERFIQHILAHQDVW
FT                   VCRRIDIANHWYQYHSL"
FT   gene            complement(689744..689872)
FT                   /locus_tag="CJA_0562"
FT   CDS_pept        complement(689744..689872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0562"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83438"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJ51"
FT                   /protein_id="ACE83438.1"
FT                   /translation="MPSNIAAFAYPSYPIQACTLAQNLIGSDKALKLHALCNLFID"
FT   gene            690059..691582
FT                   /locus_tag="CJA_0563"
FT   CDS_pept        690059..691582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0563"
FT                   /product="putative adenosine deaminase"
FT                   /note="identified by match to protein family HMM PF00962"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85059"
FT                   /db_xref="GOA:B3PJF8"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJF8"
FT                   /protein_id="ACE85059.1"
FT                   /translation="MLLRNLSFARVAGKFFCIVGCWAVSQTLIAQPMLAQPAPLYPIPS
FT                   QPALAKPELVDDAWFEDFKTRATDAELYTFLYAMPKGGDLHNHMSGSVLSEWMYELALA
FT                   QKAHGYIFYTKVNINNCRAFGNNEFGRRPYLLLFHNLLESSYEKLPDCEKAEYKPLAEL
FT                   NEKEKAGWLDSIRLNHEHEGRDEFFQTHWQRMDELLYSPYMEAEMLYRNMQAFGAEGLI
FT                   YLESMMGSGGFRTPDGKPIANDEVVDIYRKRLQQADAKATGVTVRLQESILRFAPNAEL
FT                   QLIRAYELVARHRDLYVAVNMVGREDNDKGYPLRFAQTLRDLRKKYNNVRLSVHAGEVD
FT                   EPNYHIRDTLLIGADRIGHGVNLISDKELLRQMRHGPYMVEINLISNLLLEYIASYDQH
FT                   PFPEYLRLGIPVALSTDDRGMWDSNLTDEFFVAVKEYNLSWAELQALSRNSLQYSFVED
FT                   DIKQQLLATYERRARQFARQFRQKGVASLKGVKPVSYSFTCKRYQLCDF"
FT   gene            691593..691739
FT                   /locus_tag="CJA_0564"
FT   CDS_pept        691593..691739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0564"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83049"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJF9"
FT                   /protein_id="ACE83049.1"
FT                   /translation="MQHPGSSRLCMAHAFASSGSFSIRYQECKNLYFYINKQLNCFLLF
FT                   LIY"
FT   gene            691864..694281
FT                   /locus_tag="CJA_0565"
FT   CDS_pept        691864..694281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0565"
FT                   /product="putative TonB-dependent receptor"
FT                   /note="identified by match to protein family HMM PF00593"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83484"
FT                   /db_xref="GOA:B3PJG0"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJG0"
FT                   /protein_id="ACE83484.1"
FT                   /translation="MIILNRFTPKKLALMISLGCVISVPAAMAQDTKEDVVELETYTAE
FT                   GQVEDTMGLMPTEPVKSVFGFGKTILETPRGVTSVSADMMESYAITDIDDLVLISPGAF
FT                   TQSFFGVAGSLDVRGTPGEVYFRGVRRVNNPGNYPTPIGATDRIDIVRGPASPIYGPSK
FT                   IGGYLNFEPKSARAETGQFLEKPTGKISLTRGSWDKNVVSAEVGGPGSIGEKSLGYYLY
FT                   AETENSGSYYENSGTDQNILQASFNLDFSDKTRFEFGGMYHEYDGNQVAGWNRLTQDLI
FT                   DNGTYITGSPTSVDTDGDGYNSPDEYDAWIASFGGGGFFVSPGDVVNGDMKSAWALQDV
FT                   GTTKLKGSQTMVAPEDQLVTTVTTLYFDVIHNVSDSFTITNKAFYEKLENINENAYGFS
FT                   QFVDTYAFEDQLIFAFEAEHADWLKASYQISPSIRYTDFKQGDDFDYEYFDRRDLSKPS
FT                   TALDRKLLATVTDSDYANYLVGDFTDYGLAFLADYTIAEKLGVLLGARYDYLDLNSTQV
FT                   GEKRRGTPADVVASETEDGTSWTASISYKTDFGLTPYITKSTQATIVMGQGSEISPDLI
FT                   NGGNAIADSELEEVGVKGSFFDDRLYVAAAWFEQTRTNYSAQDQVSNNTTESKGYELEA
FT                   RFLITSNFTMTAAMTHLEITNLTALDGGSQFGFLGAGDLTGVTDPSLFYGYVMKGLNGV
FT                   ASEDDAKKSGIPENMYSLTGAYDFGNGIRFTASAVKADATYSGFSRAIKLPSYTLLNAG
FT                   ISYTTDEWTFGLQGKNLTDERYFRANFPDLFGSTIVLPELPRHFVATASFKF"
FT   gene            694354..695109
FT                   /locus_tag="CJA_0566"
FT   CDS_pept        694354..695109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0566"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84310"
FT                   /db_xref="InterPro:IPR016866"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJG1"
FT                   /protein_id="ACE84310.1"
FT                   /translation="MFLRKPLGAALVAAGLFALPALAVEETLQKQESIDKSAALSQARI
FT                   DALADQTADDLQAFRTASQRLESLTIFNQQMAKLIASQQTEINSIQRQTAEIDNIETGA
FT                   LPLMLKMTDTLADLVKVDVPFLKEERQERIDNLKALIDRADVTAGEKYRRIMEAYLVEV
FT                   EYGRTIEAYRGELVIDSEARTVDFLRIGRVGLYYQTLDGSETGHWNPQQKAWHMLGSHY
FT                   RVAVRDGLRIARKQTPPELLTLPVSAPAK"
FT   gene            695122..696498
FT                   /locus_tag="CJA_0567"
FT   CDS_pept        695122..696498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0567"
FT                   /product="TolR"
FT                   /note="identified by match to protein family HMM PF01618"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84659"
FT                   /db_xref="GOA:B3PJG2"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR017270"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJG2"
FT                   /protein_id="ACE84659.1"
FT                   /translation="MKSMFNLIPRAIAGCLVMGIALGGHAQSADSLNSLYQQISKEVSA
FT                   EAAHNTEREQRFRAAASEQKAMLADVKAKLAVEEKKRDDMKQVFDANETALAELSTQLS
FT                   KRTGNLGELFGVFRQMAGDTQQLLFDSLITVEYPERKALIESLASTKEVPTIPQMQQLW
FT                   TLMLQEISQSAVVSRFDTSIVKPSGEAYTAPVTRVGTFNIVSGDKYLNYVSDSQQLVEL
FT                   ARQPSGSVRSTAAGMSKASGGSVDFALDPSRGALLGLLVQSPSFMERVHQGQEVGYAII
FT                   LLGFIGMLIVAERMIKLSRISALMKKQLKNMGRASDDNPLGRMMLAYYENKHLKDLDVL
FT                   GKKLDEVIFKDLAELRKGLSTIKVMAAIAPLMGLLGTVTGMIGTFQAITLFGTGDPKLM
FT                   AGGISQALVTTVQGLVVAIPLLLSSNMLGSRAQQLGKVIGEQASGMIAEKAVDIAQSKA
FT                   "
FT   gene            696516..697028
FT                   /locus_tag="CJA_0568"
FT   CDS_pept        696516..697028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0568"
FT                   /product="TonB system transport protein ExbB2"
FT                   /note="identified by match to protein family HMM PF01618"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84763"
FT                   /db_xref="GOA:B3PJG3"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJG3"
FT                   /protein_id="ACE84763.1"
FT                   /translation="MNLASSLSDFLNTGGNVLWSILLVTFWLFFLIIERYWFFLREYPA
FT                   LRQQRRDAWNARVDKSSWVAEQQRKQLLSELDCMMSQRMTLIPALIALLPMLGLLGTVT
FT                   GMIQVFEVMAYLGSGNPRAMANGVSAATIPTMAGMVISLLGIPFATELKRRYLRELREN
FT                   AEAMPTH"
FT   gene            697112..697519
FT                   /locus_tag="CJA_0569"
FT   CDS_pept        697112..697519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0569"
FT                   /product="TonB system transport protein ExbD2"
FT                   /note="identified by match to protein family HMM PF02472"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85456"
FT                   /db_xref="GOA:B3PJG4"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJG4"
FT                   /protein_id="ACE85456.1"
FT                   /translation="MSDNRFLLNDEEESQIDLTPMLDVVFIMLIFFIVTSTFVKESGVD
FT                   VTRPQAETSVVTESNAIQIGITAANQIFMDKRQIDKRAIRANVEKSLAENPGASVIIVA
FT                   DRDSNTHTLIEVMDQARLAGATSVSVASEND"
FT   gene            697519..698151
FT                   /locus_tag="CJA_0570"
FT   CDS_pept        697519..698151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0570"
FT                   /product="TonB2 protein"
FT                   /note="identified by match to protein family HMM PF03544;
FT                   match to protein family HMM TIGR01352"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82720"
FT                   /db_xref="GOA:B3PJG5"
FT                   /db_xref="InterPro:IPR003538"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJG5"
FT                   /protein_id="ACE82720.1"
FT                   /translation="MLAKYSVSLAGAMVLAVLVFLSMRLLIATDGIFQEPDKSHTYLNF
FT                   VRVDNRNDDVNTKDRRLPEPPPPPETPPDVPDLSNQMMANTTDLSMQMPKIGTQVNKGS
FT                   GPFLGTLSAGDGLSGFDTDVIPVVRVPPAYPQRAKQAKLEGRVTMAVTIRPDGTVADVQ
FT                   VLESDPPRLFDQAAIQAMQRWKFRPKIVNGKPESQRARQTMEFKLNQ"
FT   gene            698187..699488
FT                   /locus_tag="CJA_0571"
FT   CDS_pept        698187..699488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0571"
FT                   /product="tetratricopeptide repeat domain protein"
FT                   /note="identified by match to protein family HMM PF00515"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83903"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJG6"
FT                   /protein_id="ACE83903.1"
FT                   /translation="MLFETGIAMRVRSQVFAANTIRYMRRFVRVGLLVAAVTGAPSALA
FT                   AGNSVSASTFKELTSIQEKISANQTAAALQDLKALHAKVEKDSLDEALVLQMLGYTEMG
FT                   NNNYANAIDYLKRSLALNKLPENVKYNVGYMVAQLYAAQEKYQEALIFAEAWFKTLASP
FT                   TPDQAIFMANIFAQTGDYAKAIPYVKQAINSGKEPRESWFQLYIACSFELKDYAQAAEA
FT                   LQAAIKQWPKKSEYWEQLASVYVLQGKDMKGLASLQLAWKMGVLEKESSIRSLVQLSVT
FT                   KGVPEMGARLLESALGQQVVPRNEAWVDLLANAWLAARETTPAVTVFEELAGITGSGDP
FT                   YVRIANIYVEQAKWKPAEQALRKALNAKLKEPGKAWLILGIVMTEQTQFDQGLEAFRKA
FT                   RAYAYSEKQAGSWLKYAEDLRRQHNWVTRNQSES"
FT   gene            699523..700449
FT                   /locus_tag="CJA_0572"
FT   CDS_pept        699523..700449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0572"
FT                   /product="methylthioadenosine phosphorylase"
FT                   /EC_number="2.4.2.28"
FT                   /note="identified by match to protein family HMM PF00896"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACE86194"
FT                   /db_xref="GOA:B3PJG7"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010044"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJG7"
FT                   /protein_id="ACE86194.1"
FT                   /translation="MSLYRFKPVLVLWLCCFVFIPLAASAAVPADIPRARIAVIGGTFL
FT                   NDIFFYRDVVKKEFTLETTLGTSPKIYYAEWDGIPFYYVHNHGDGQWQQTWVALYDLGV
FT                   EEAIGGATAGAINPSMKVYDYIIPHDLIDMNIDRPLGFPKQVYRDPNAIPLPRLTPAMD
FT                   TDLRQILLEQTRKAIKADKRYKSFKVHDKGVIVQARGGRFETVAEIKMFGQWGGDLVTM
FT                   SVGTEIVYARQLGINYATVVVISNPAEGVGEWDFSLMKELYPVINPLSLDIVLNSLKPI
FT                   AALHGKPRVADGLINHPEMTSQAQKDH"
FT   gene            700449..701549
FT                   /locus_tag="CJA_0573"
FT   CDS_pept        700449..701549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0573"
FT                   /product="putative purine nucleoside permease"
FT                   /note="identified by match to protein family HMM PF06516"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84903"
FT                   /db_xref="GOA:B3PJG8"
FT                   /db_xref="InterPro:IPR009486"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJG8"
FT                   /protein_id="ACE84903.1"
FT                   /translation="MKTISRLLLSSVLALAVLTGCSEKPTETVATAAVVAAPIPVKFVV
FT                   VTMFEIGEDTGDKAGEFQLWKERQKLDTRFPFPNGYHDIYMNETTGVMGIVTGIGTAYS
FT                   TASIMALGMDPRFDFSKAYWLVAGIAGIDPEDASIGSAAWAEYLVDGDLGHEIDAREIP
FT                   ADWETGYFARHTQKPYDPNKPKPTGEMWRLNPELTEWAYQLTKDIELPDLPGLADTRAL
FT                   YTGHPNAQKPPFVLKGDQLAAMTFWHGAIMNDWANKWTRYWTDGQGEFVTSAMEDTGTY
FT                   LSISMLHNIGKADKNRLMVLRTGSNYTMPPPGVSAVESLLAENEGYAGLDASLESAYIV
FT                   GTAVMDKILSHWETYKDKLPTPADLP"
FT   gene            701625..702806
FT                   /locus_tag="CJA_0574"
FT   CDS_pept        701625..702806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0574"
FT                   /product="amidase"
FT                   /EC_number="3.5.1.4"
FT                   /note="identified by match to protein family HMM PF01425"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84087"
FT                   /db_xref="GOA:B3PJG9"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJG9"
FT                   /protein_id="ACE84087.1"
FT                   /translation="MSLDQRVFAWRGHYVHPSPSSTRLSGLRLGVKDLFHIAGLPTAAG
FT                   NPDWLRTHPVPRQTSPVVEALLAAGAQLIGKTQTDELAYSLNGLNSHYGAPRNPVTPER
FT                   LPGGSSSGSAVAVAAQEIDIGLGTDTGGSIRVPASYNGLLGIRTSHGIIPSDHMVPLAP
FT                   AFDTVGWLTRDAQTLQAVGEVLLPPSLSVSARKPWRVSLLLPEMNGAALWTSAHQQWLD
FT                   SQPVLQVFKPLFVKQAWLARASETFRVLQGYEIWCTHGVWIQQQQPRFAPDIQARFQWC
FT                   SQLTQDQQQQAEQMRVQLCREIEHWFDQVDLVVMPTTPGPAPLLGADAAWMDAYRRQLM
FT                   GLTSPAGLARLPQIHLPVLQQQGAPVGVSLLGPHRSDKALLQVATELMNGSLA"
FT   gene            702806..704395
FT                   /locus_tag="CJA_0575"
FT   CDS_pept        702806..704395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0575"
FT                   /product="gamma-glutamyltranspeptidase"
FT                   /EC_number="2.3.2.2"
FT                   /note="identified by match to protein family HMM PF01019"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82723"
FT                   /db_xref="GOA:B3PJH0"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJH0"
FT                   /protein_id="ACE82723.1"
FT                   /translation="MRYVPAFSAPHAQAAQVGMEILREGGNALDAMIAAASAMTVLYPH
FT                   MNSLVGDSFWLIHKPGEAPCAIDACGAAAQLASIDWYQQQGHAQIPGRGHLACVTPGAT
FT                   LSGYQRARELAQQWSLAEALPLSHLLAPAIALARDGIRVTRSLQQASAKLLAENAGNAA
FT                   FRQLFTPRQQVLCEGDYLCNPDLANTLELLAAKGLHAIFNGDLATHTADYLSHAGSPLR
FT                   LGDLQQTRAQFVTPLSVQTRVGQCYNLPAPTQGVASLMILALYDRLYQSDWSDVERVHA
FT                   LIECTKQAFLVRDAQVADPRRLSAQWPQLLTDDYLDARATQIAAQALPWPHIAQPGDTV
FT                   WMGCVDQQGVMVSFIQSIYWEFGAAVVIPATGLVWNNRGVSFQLDAQARNALLPGMKPF
FT                   HTLNPALALLQDGRRMVYGTMGGEGQPQTQSALFTRYLYDGVPLADAIARGRWLLGRTW
FT                   GDQQQDLKLEQDLYEQVGDALRARGHQLRAVPLHSELMGHAGAVVSRRDGSADAVSDPR
FT                   SDGAGVVEHTHE"
FT   gene            704388..705215
FT                   /locus_tag="CJA_0576"
FT   CDS_pept        704388..705215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0576"
FT                   /product="hypothetical integral membrane protein"
FT                   /note="identified by match to protein family HMM PF01925"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85702"
FT                   /db_xref="GOA:B3PJH1"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJH1"
FT                   /protein_id="ACE85702.1"
FT                   /translation="MSDLLQQWLPTMIAMLATGACAGILAGLLGVGGGIVIVPVLYFVL
FT                   QGLGVSPATAMLVATGTSLLVIVPTSISSMRAHHKRGNVDWALIKRWWPWMVIGVIAGS
FT                   SVALRAKGLLLSTVFGVIAILVALNMLLRAKSPPLARQLPGAVGQGSMAGGIGFFSVMM
FT                   GVGGGTIGVPLLTACNYPSHRAVGTASFFGLLISIPGALAMLFASTPADAPEGMIGAVN
FT                   LPGFALIVPLTVLLAPVGAWLGAKLDAVMLKRVFAVFLCISGGRMLMQVVQSL"
FT   gene            705255..706517
FT                   /gene="pucG"
FT                   /locus_tag="CJA_0577"
FT   CDS_pept        705255..706517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pucG"
FT                   /locus_tag="CJA_0577"
FT                   /product="purine catabolism protein"
FT                   /EC_number="2.-.-.-"
FT                   /note="identified by match to protein family HMM PF00266"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACE86302"
FT                   /db_xref="GOA:B3PJH2"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJH2"
FT                   /protein_id="ACE86302.1"
FT                   /translation="MSNEFTVDAALLRPFAPPPRLLMGPGPITVDPRVLRAMSAQLVGQ
FT                   YDPAMTQCMNDTMALYRAVFKTNNRWTLLVDGTSRAGIEAVLVSLVEPGDKILVPIFGR
FT                   FGHLLCEIAERAGAEVHRIERPWGEVFTTEEIEQAIRQVQPKVLAIVQGDTSTTLLQPL
FT                   EHLGAICARYGVLFYSDATASIGGNPFETDAWQLDAVSVGLQKCLGGPSGSAPLTLSEK
FT                   AVERIRQRRHVEAGIRTAQHQVGSGRRIASNYFDLGMIMDYWGEERLNHHTEATTMLYG
FT                   ARECARILLEEGVDQSIERHRLHGRAMAESLAAMNLQLFGDQRYKMHNVVGVYIPDGIA
FT                   GEAVRSSMLNDFGIEIGTSFGPLHGKIWRIGTMGYNARKDAVLQTLAALEAVLRRAGHA
FT                   MSANAGVDRALAVYAETADIR"
FT   gene            706529..707596
FT                   /locus_tag="CJA_0578"
FT   CDS_pept        706529..707596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0578"
FT                   /product="adenosine deaminase"
FT                   /EC_number="3.5.4.4"
FT                   /note="identified by match to protein family HMM PF00962;
FT                   match to protein family HMM TIGR01430"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83754"
FT                   /db_xref="GOA:B3PJH3"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006330"
FT                   /db_xref="InterPro:IPR028892"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJH3"
FT                   /protein_id="ACE83754.1"
FT                   /translation="MIPSVIASDFSAIPLLDLPASREFLAAMPKAELHMHIDGALSPAM
FT                   MFELAQRNQVSLPYQSIADIEAAYQFTHLQSFLDLLYLGASVLKHEQDFYDVTRDYFTH
FT                   CHADNIRHTELSFDPQTHTERGIPFATVIGGILRAMADAQRDWGISSALTMDFLRHLSA
FT                   ASAMKALEQSLPWKAQIKAVGLDSSEVGHPPGKFTAVFARARAEGYRIVAHAGEEGPPA
FT                   YIWEAIHELQVERIDHGVRADEDPQLMQYLRDTQIPLTVCPLSNIRLCVFERMEEHNLI
FT                   QLMDAGLRVMVNSDDPTYFGGYLNDNFFALADAFGLTRRQALQLAHNSFTASFISDEEK
FT                   HRHIEQLHRFAQQFH"
FT   gene            707680..708993
FT                   /gene="amaB"
FT                   /locus_tag="CJA_0579"
FT   CDS_pept        707680..708993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amaB"
FT                   /locus_tag="CJA_0579"
FT                   /product="N-carbamoyl-L-amino acid hydrolase"
FT                   /EC_number="3.5.1.87"
FT                   /note="identified by match to protein family HMM PF01546;
FT                   match to protein family HMM PF07687; match to protein
FT                   family HMM TIGR01879"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83178"
FT                   /db_xref="GOA:B3PJH4"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJH4"
FT                   /protein_id="ACE83178.1"
FT                   /translation="MGSRRVSGPARQYPLPELLFIPMGDISGMNADLSIAHKVMNWCDQ
FT                   LATISASPDNISRFYLTPEHKRCNTLVAEWMQAAGMSTWIDAAGNLCGRYEASTAQAKT
FT                   LLLASHLDTIPNAGAYDGILGVMVSIAVVAQLHQQQKRLPFAIDVIGFGDEEGTRFGST
FT                   LLGSRALAGTWSEAWWTLSDKNSVSLHQAFTAFGLSPEAIHHAARRSQDILAYLEVHIE
FT                   QGPVLEQENLALGIVTAIAGARRFSIEVQGYAGHAGTVPMDLRRDALAGAAEGIVLVEK
FT                   IAKESAVVATVGQLECVPGAVNVIPGRVRFTIDIRSGSDTLRDQALEKIQQAFAECCAR
FT                   RNLKTNWTEIHNASAIACADWLQILQADVLTQMHLPAYRLMSGAGHDAMAMAAICDVAM
FT                   YFVRCKGGVSHHPDESVKVEDVALAIQALSLTLLNLAQ"
FT   gene            709015..709599
FT                   /gene="hpt-1"
FT                   /locus_tag="CJA_0580"
FT   CDS_pept        709015..709599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpt-1"
FT                   /locus_tag="CJA_0580"
FT                   /product="hypoxanthine-guanine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85904"
FT                   /db_xref="GOA:B3PJH5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJH5"
FT                   /protein_id="ACE85904.1"
FT                   /translation="MDKLFITANDLLLDSFRLAEQIYQRGFRPHFIVGVWRGGSPVGIA
FT                   VQEYLEYVGVTTDHIAIRTSSYYGIDKQSKDIRVHGLDYIVKNVDADQELLIVDDVFDS
FT                   GRSIKAIIDEIKRKSRRNTPNTIKVACPWYKPTRNVTDIKPDFYVHATDRWLVFPHELC
FT                   GLTPQEILQGKGSEIADTIARATDTGQFGKP"
FT   gene            complement(709927..710346)
FT                   /locus_tag="CJA_0581"
FT   CDS_pept        complement(709927..710346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0581"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84190"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJH6"
FT                   /protein_id="ACE84190.1"
FT                   /translation="MTDTTRKTIVLRPGDGRHYQMGNMSATFKADEGETASQYSISEWW
FT                   LEANTQGPGIHAHPEDDVFYVLEGTMSFFVDGTWVDCPRGAFVLVPGGTPHDFQNRTGS
FT                   RAGALNISAPGGFEQNMDMIVDWFAKNPPGPVVSE"
FT   gene            complement(710445..710633)
FT                   /locus_tag="CJA_0582"
FT   CDS_pept        complement(710445..710633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0582"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83298"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJH7"
FT                   /protein_id="ACE83298.1"
FT                   /translation="MSHPAPGILCCPGAIFNGKPRAHLDAKTTGTLKKDQGYPLIKVCR
FT                   KTEPAQIFKEFHETRNR"
FT   gene            complement(710633..711676)
FT                   /locus_tag="CJA_0583"
FT   CDS_pept        complement(710633..711676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0583"
FT                   /product="putative purine nucleoside permease"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82639"
FT                   /db_xref="GOA:B3PJH8"
FT                   /db_xref="InterPro:IPR009486"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJH8"
FT                   /protein_id="ACE82639.1"
FT                   /translation="MLNLIGSALLVLASLVVALNAQAAIPVKVVVVSMFEHGEVRGDQP
FT                   GEYQLWIERQKLDNTFPFPLGLYDLHMNDTGLLAICTGGGVTNATASIMALGMDPRFDL
FT                   SKAYWIIAGIGGGDPLDVSLGTGVWAKHVVDGDLLYEIDGREIPKDWQYGLIPLGAKKP
FT                   NQESTGWTVDTIHYALNPGLVNWAYQLTKDHPVADTPAMKAFREQYTGYPQALRPPFVT
FT                   IGDTIGSSTYWHGWKLNEWANDWMHLHAGKDSNFMTTNMEDNGTLTALHRMAKLGRVDT
FT                   QRILVLRTVSNFSAPPPGKTAAWSTTAPYPDKGLPAIEAAYALGNRVAQALINDWKAYE
FT                   KTIPSAK"
FT   gene            complement(711829..712842)
FT                   /locus_tag="CJA_0584"
FT   CDS_pept        complement(711829..712842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0584"
FT                   /product="adenosine deaminase"
FT                   /EC_number="3.5.4.4"
FT                   /note="identified by match to protein family HMM PF00962;
FT                   match to protein family HMM TIGR01430"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83757"
FT                   /db_xref="GOA:B3PJH9"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006330"
FT                   /db_xref="InterPro:IPR028892"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJH9"
FT                   /protein_id="ACE83757.1"
FT                   /translation="MQAFIEQMPKAELHVHLEGTLEPELSFALAKKNNVPLDYQTPEEL
FT                   IAAYNFYDLPSFLTIYYAAMKVLCEEEDFYQLTWDYLSKARSQETLYCELFFDPQAHTS
FT                   RGIAFDTVIRGIHRAQIDAEEKLGIKSQLIMCFLRDMSAESAMEHLLMAEPYRHWLIGV
FT                   GLDSDEKHNPPVKFAEVFRKARDMGLKLTMHCDVNQLNTLVHISQCLDDIQVDRIDHGI
FT                   NSLESDTLCEAIKARGLGLTICPVSNRFVVQSLTSNEIRQMLEKGMLATINSDDPAYFR
FT                   AYLNENLIELQREGNFNTEEITTLVGNAFRVSWLPEPEKQVYLDKLTQYVTHFQTH"
FT   gene            712875..712979
FT                   /locus_tag="CJA_0585"
FT   CDS_pept        712875..712979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0585"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82788"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJI0"
FT                   /protein_id="ACE82788.1"
FT                   /translation="MTPTARIVPNLYFPDRLGRKLKNLAKLATRCAQE"
FT   gene            713222..713297
FT                   /locus_tag="CJA_3849"
FT   tRNA            713222..713297
FT                   /locus_tag="CJA_3849"
FT                   /product="tRNA-Phe"
FT   gene            713510..715372
FT                   /locus_tag="CJA_0587"
FT   CDS_pept        713510..715372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0587"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85976"
FT                   /db_xref="GOA:B3PJI1"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJI1"
FT                   /protein_id="ACE85976.1"
FT                   /translation="MSDYVFGKNQPPHRRWPVAWYNPWVLLRSLREMLATDDQIRNLDR
FT                   REMYSSTLELIQVAETERDDDFWWDFVSDTGDGGNAAYAVARQMQIPLLNKKVREGLVG
FT                   DIPDTLPMGELLVLGGDLAYPGASVEEYQYRLAEMWTASGQQERPAQEAAAQLRPSLAI
FT                   PQNHDWFDNISSFNLYFVDRREKEPEQGFSIKSAETQVEVTPLSTRKLQKQSYFAARLP
FT                   NNWVILGLDFALVGDIDRKQHIAFRNLFNGSPGCEPQITPEDNIILLYPEPYWTRDLGD
FT                   HAREGYPKRYQRLEAFIRDKNGKIRLRIAGDIHHYAREFSSAGQSGADDMLITAGGGGA
FT                   FLHPTHTNNTKADKVRCHREEPFAMSDDLKSRIRLGVDSKGDAEVAKVYDRHELYPTAA
FT                   QSKSLLWRSVFSFFKPAESLCSQLRDKREDFWKYLRLSICQGNILFAVLLGVIFAFAVV
FT                   TSSWIPGILLLAIYAGISGEGGMGFKILGAFVGALVLGIAEAIASGLCISSWNMCGLIF
FT                   AWVGAALLGIVIGGLITGIYFWICSARGYLPNNAFSHLGHEGYKSFLRFRIDREGNLHG
FT                   YLWGTNHVPSFWVKNPAADYPLWVEADHCVKADWEIKDTFILRK"
FT   gene            715626..716045
FT                   /locus_tag="CJA_0588"
FT   CDS_pept        715626..716045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0588"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83926"
FT                   /db_xref="GOA:B3PJI2"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJI2"
FT                   /protein_id="ACE83926.1"
FT                   /translation="MRSFIRHPTSIPIQLSTSPCDSMCVNVRNLSAGGVCFLTDEPVKV
FT                   GDKVDFWIPHVRPEYQGKGVVVWRRDHKPKGYEVGVRFTSDDEYFRVRMVEQVCCIEDY
FT                   RQRLALKGRQLSSEAAAQEWIEKYAGKFDQRAMTH"
FT   gene            complement(716124..727181)
FT                   /locus_tag="CJA_0589"
FT   CDS_pept        complement(716124..727181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0589"
FT                   /product="Putative Ig domain family"
FT                   /note="identified by match to protein family HMM PF00818;
FT                   match to protein family HMM PF02412; match to protein
FT                   family HMM PF02415; match to protein family HMM PF05345"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84795"
FT                   /db_xref="GOA:B3PJI3"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR006644"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR025592"
FT                   /db_xref="InterPro:IPR041498"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJI3"
FT                   /protein_id="ACE84795.1"
FT                   /translation="MGKIIMANKLLTGLSSLLLPLGFYGMPAQSSMGYQRSYLSASINR
FT                   SSDITAVNMAATRILHEAATVVTGELDIINASPVKELVIIDAAVADKQVFYRGVKPGID
FT                   IVEIDSSASGLSQLTAILADYKNLTALHIVSHAEDGVLHLGSSRVDAAMLKQEVETFAA
FT                   LQGALVEGADLLLYGCDLASSEKGDELLEILRNNTHLDVAASTNKTGNTEQGGDWELEI
FT                   QRGHIETGLAFSEKSLRDFSAVLAPTAYNSLSFCWGPAAPGYGAGGNSDMCIGPLTSQD
FT                   GRIVLTASPAAVLSSGPNWGAGYSLITQNASAGQNSGWIEFSADGANLSAFTLSSVTRG
FT                   YTMYESCTSVTVTGTRQSDGTTVSDTLSGAAVGYGNDAVHTPVNLAGIALTSVRVSFNS
FT                   CTQNMGFFNLRGFTIEPAASNAAPVNTVLPSISGTATVGNALSTTTGTWTDADGDSLTY
FT                   TYQWYRADNNSGTNLAAIGGATSASYTLTTSDAHKYLRVVVTANDGNGGTTPANSTYTQ
FT                   ITNSAPVNSTPPSISGTATVGNALSTTNGTWTDADGDSLTYTYQWYRADNSGGTNLTLI
FT                   AGATSASYTLTTSDAHKYLRVEVTANDGNGGTQAANSAYTQVTNSAPVNSVAPSISGTA
FT                   TVGNALSTTDGSWTDADGDSRTYTYQWYRADDNGGTNLTLIAGATTASYTLTTSDAHKY
FT                   LRVEVTANDGNGGTQAANSAYTQVTNSAPVNSVAPSISGTATVGNALSTTDGSWTDADG
FT                   DSLTYTYQWYRADDNGGTNLTLIAGATSASYTLTTSDAHKYLRVEVTANDGNGGTQAAN
FT                   SAYTQVTNSAPVNSVAPSISGTATVGNALSTTDGSWTDADGDSLTYTYQWYRADDNGGT
FT                   NLTLIAGATSASYTLTTSDAHKYLRVEVTANDGNGGTQAANSAYTQVTNSAPVNSVAPS
FT                   ISGTATVGNALSTTDGSWTDADGDSLTYTYQWYRADDNGGTNLTLIAGATSASYTLTTS
FT                   DAHKYLRVEVTANDGNGGTQTATSIYTAVANTAPTDITLSNSNVNQSGGADAEVGVLGS
FT                   VDPDADTTFTYSFATGAGDTDNGSFNISGSSLRANDSSTLAAGTYSVLIRTTDSFAGVF
FT                   DKAFTITIVDDISPTITIGSDKASLKAGETATLTLTLSEASSDFAAGDVTVTGGTLSGF
FT                   SGSGTSYSATFTPSDNSTATATIDVNAATFTDAAGNDNTAATQLTMAVDTELPDAPSTP
FT                   VLDAASESGSSNTDNITNNTTPTITGTAEAGSTVTLYDTDGSTVLGTTTATGGNWSITT
FT                   SALSEGDHDLTATATDAAGNVSVASAALTITIDTTAHAKPAAPVLATASDTGESDSDGI
FT                   TRLTDLTLQGAVGSVEANAIVHARSDVEGGLTNTTANADGSWSLDISGLAENTHQLQIN
FT                   ATDVAGNTSVYSDALTVVIDTTAPTLGSVAFDQANVTTANQTAVSFSLSGAETGTKASY
FT                   SITSSGGGTAVTGSGLDVSTATQQFTDIDTSSLADGTLTVSLTLNDLAGNSATQTNTIA
FT                   KDTGAPVNNVPGAQTTTTVEPIVFEGSNYIGVSDAGSLTTVVSVDNGTLTAITTGGAGI
FT                   LGNGTASITLTGTASDINTALNGLIYQPGNAGSATLTIDSTDAVGNSDSDTIAITIGNS
FT                   VLRVTSNLDTGDDASIGASYAADQADGDGLSIREALYWARAEDTITFDLDSATAGNQGG
FT                   TITLDGGQLNITRSGLKIQGDLDGDGRPDVTLSANNASRVMSVDTGLSNIELTGLTLRD
FT                   GNDVAGAGLAIGFNTSLTLRDSVITNNNEPGIGGGGIYGSNVMLTIINSTISNNTSGSF
FT                   GGGIRIVGGSTLNLINSTVSGNTSDDNGGGIQYAGPGLTMVNTTVSGNTARGTNSDGGG
FT                   LQVSSGTANVYNSTIAGNAAGHAGGGVSANGTEAFINTVVAGNTAGTGATAGASGSPLA
FT                   TGGSADDVSGTIETGINNFFGTAATVTVDTNNLNNQGTGSLLLGDLTYNNGGNAQTHLP
FT                   QPGSALLDAGSNADLPVDTYDLNGNNDTAEPLPVDANGNKRISNIVDIGAVESNNPPVL
FT                   GNVNGGGTYVENGSAIVIDSDITVSDTELDLLNGGNGDYDGAAIVIARNGGALATDSLG
FT                   FHDGNGLSLAGGNLLKNGQNIASFDTSTAGQLTIIFTNANGETPTTTDVNRVLQQVTYS
FT                   STSEDPGTSVSLDITLDDGAGGSVTETASLTITEVNDAPSLTATGATPTFTEGGAAVSL
FT                   FSGATATTVEAGQSLIGLTLTLTNLSNGSAEILGLDGSDVALLHGNALTTITNAVNVTV
FT                   SVTGTTASVTLAKPAGITTAALATLVDGITYRNTSNNPGTQNRVVTITSLQDDGGTANG
FT                   GVDTATLAIAATVTVVSVNEAPVISGTPATSVNQDEAYNFIPSASDADGNTLTFSIANQ
FT                   PSWAAFDTATGALTGTPTNADVGTTNGIVISVSDGLASASLPAFNLTVMNVNDAPTISG
FT                   TPATSVNQGAAYSFTPTASDIDVGDSLSFSIANMPSWASFNTATGELSGTPGNDDVGTT
FT                   SGIVISVSDGSASASLPAFSLTVVNVNDAPTISGTPATSVNQGAAYSFTPTASDIDVGD
FT                   SLSFSIANMPSWASFNTATGELSGTPGNDDVGTTSGIVISVSDGSASASLPAFSLTVVN
FT                   VNDAPTISGTPATSVNQGAAYSFTPTASDIDVGDSLSFSIANMPSWASFNTATGELSGT
FT                   PGNDDVGTTSGIVISVSDGDDSASLPAFNLTVVNVNDVPTISGTPATSVGQDAAYSFIP
FT                   TASDADGDTLTFSIVNKPSWASFNNATGELSGTPTNADVGTTNGIVISVSDGDESASLP
FT                   AFNLTVVNVNDAPTISGTPGTSVNQDTVYSFSPTASDIDVGDTLTFSIANKPGWASFNT
FT                   TTGELSGTPTGADVGTTIGIVISVSDGALSASLAAFNLEVVQVVDPTQPVLTAPADIQV
FT                   NATALYTPISLRQLLSLQAGASDETVAQALAALASDGVNGNSCCTTHPQGLNANNVLLL
FT                   SPGRHELTWTTSNSQGKTATATQVINLHPLVSLSKSQVAIRDSQVEFRVILNGNAPSYP
FT                   FEVPYVIDTSNSTATGDEHDLVDGSVVFTQKGQTQISVPVTIHALSGLGDRQLVVGLGS
FT                   GINQGAANRHVISIREGNVAPTVQLKITQGGASTTIVTPSGGPVTVTAVVTDPNPNDTH
FT                   SFDWSATRGLPDTDGNPVDAARVFDPAGLSGSHSVVVTVTDSGGASTQAQTYFRILPNL
FT                   PILSEDVDTDGDGISDLDEGAGDDNGNGIPNYLDNMPDTNVLPQVGLITNAYLIECDPG
FT                   VRCGLGLYAMGGGSGGVQILDNELGTIDNLIVDSRYTPVGGIFDFVIQDLPTPGQSVRV
FT                   VIPQQAAIPANAVYRKFQDGSWNNFVANANNAVYSAPGNPGYCPPPGTDDWQVGLVAGY
FT                   YCVQLNIEDGGPNDADGLVNSAVVDPGAVSVEIVIPEPPAPIDIKSSSGGGAMHTLWIL
FT                   LLGVLLMTRKVSTKTLVVLALLVSAMTSQAAQDKPFYVRADIYDVNSTVTKQDFRQALE
FT                   DAGYEVTLNRYDTDRTGYQISVGYQWDQHWFSEAGYLDLNKVRVNLTLAGDTNLDEFTR
FT                   DFAAKYPISAQGFTLVQGLKVNLIGSINLLGEIGIYLWQSDIDVRNNVLSIDEDEGADP
FT                   LVGVRLEVPIGDSLGIGVGIRRIYFDQQQADLFSVSGTFRF"
FT   repeat_region   719038..719447
FT                   /note="RPT33A"
FT   repeat_region   719605..719821
FT                   /note="RPT33B"
FT   repeat_region   724282..725051
FT                   /note="RPT11A"
FT   repeat_region   725053..725478
FT                   /note="RPT11B"
FT   gene            complement(727182..728069)
FT                   /locus_tag="CJA_0590"
FT   CDS_pept        complement(727182..728069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0590"
FT                   /product="Sulfotransferase domain superfamily"
FT                   /note="identified by match to protein family HMM PF00685"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85594"
FT                   /db_xref="GOA:B3PJI4"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJI4"
FT                   /protein_id="ACE85594.1"
FT                   /translation="MPSGQFIYQTTLLRLSVTPRFHFISGLPRSGSTLLAGILRQNPLF
FT                   HAAMSSPVAGLLNGALEQMGAHSESYSFFDDAKRKRICKALFEAYYADKQQSVIFDTNR
FT                   QWTARMHQLVELFDDFRMICCVRNPAWIMDSFETIYRKNPFDYSRMFNPATRNTVYSRC
FT                   EALISAGGSVGSAWTALKEAYYGEFSDRLLLIDYDLLTQHPTRTLELIYQFIDEPVFDH
FT                   DFNYVDYDENEFDQTLGVKGLHTVKKKVEFKTRRSILPPDLFVKYQEMDFWQDNTGSSA
FT                   SIIAAKKPTVSSEK"
FT   gene            728304..728459
FT                   /locus_tag="CJA_0591"
FT   CDS_pept        728304..728459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0591"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82648"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJI5"
FT                   /protein_id="ACE82648.1"
FT                   /translation="MKQIHYLITQVYPTPDVLKPKDSVSQPFNTATNIADCNNTALHLK
FT                   KYSLSQ"
FT   gene            complement(728616..729143)
FT                   /locus_tag="CJA_0592"
FT   CDS_pept        complement(728616..729143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0592"
FT                   /product="microcystin dependent protein; MdpB"
FT                   /note="identified by match to protein family HMM PF07484"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84397"
FT                   /db_xref="InterPro:IPR011083"
FT                   /db_xref="InterPro:IPR037053"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJI6"
FT                   /protein_id="ACE84397.1"
FT                   /translation="MSEPFYGEIRQFPYSFAPRNFSYCQGQILTIQQNAPLFSLLGTLY
FT                   GGNGQTTFALPNLQGQVLMHQGSGPGLTPRTVGESSGSAGVSLIQAEMPNHNHLMVAKT
FT                   VNPAASVNVAEDAYLSISRAQTAYSPQQDNLVSLEPTMLSVTGSGAAHENRQPYIAMPF
FT                   CIALSGIFPVRN"
FT   gene            complement(729154..729675)
FT                   /locus_tag="CJA_0593"
FT   CDS_pept        complement(729154..729675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0593"
FT                   /product="microcystin dependent protein; MdpB"
FT                   /note="identified by match to protein family HMM PF07484"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85235"
FT                   /db_xref="InterPro:IPR011083"
FT                   /db_xref="InterPro:IPR037053"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJI7"
FT                   /protein_id="ACE85235.1"
FT                   /translation="MSSPFMGEVRVFAGTFAPQQWSLCNGQLLPISQNDALFALLGTTY
FT                   GGDGVSTFALPDARGRTPVGLGQGPGLANRILGEKYGTETVTLLSANLPAHTHTVSVSD
FT                   TTANQTAPDNNLPGNAPHYLPSTTTPTNTGTLHPLAISSVGGNQPHENMMPFLCLSFII
FT                   CLQGLFPSHN"
FT   gene            complement(729688..730419)
FT                   /locus_tag="CJA_0594"
FT   CDS_pept        complement(729688..730419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0594"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GB:AAN53271.1; match to
FT                   protein family HMM PF07484"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84502"
FT                   /db_xref="InterPro:IPR011083"
FT                   /db_xref="InterPro:IPR037053"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJI8"
FT                   /protein_id="ACE84502.1"
FT                   /translation="MKKMCIALVVIICLATTHLVKLSYLCRHMQQINTRSSLRGKNDVV
FT                   RNGEMDLTPEQWHFQSIRRILAMSQPYIGEVRMFAITYAPRHWTDCSGQLLAINQNQAL
FT                   FSLLGVNFGGNGTTTFGLPDYRGRTPIGEGSFQGNTYVRGNQGGSESVTLTVAQIPPHN
FT                   HLLFAQNAPGSAPNPIPPGGTGSLCAISSGDYYVVPDTNLVQLASDAVTNTGSNVAHSN
FT                   LQPSLVLRFAIALQGVFPSRN"
FT   gene            complement(730292..730576)
FT                   /locus_tag="CJA_0595"
FT   CDS_pept        complement(730292..730576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0595"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85135"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJI9"
FT                   /protein_id="ACE85135.1"
FT                   /translation="MKKFDFETLNNLIDQSIQLKDGENKIVELKVEKVSLPKASDPGYE
FT                   AFSVDLSSEKDVHCPSGNYLFSHDAFGETQLFMSPYAADKYQIVIARKK"
FT   gene            complement(730801..731310)
FT                   /locus_tag="CJA_0596"
FT   CDS_pept        complement(730801..731310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0596"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82833"
FT                   /db_xref="GOA:B3PJJ0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJJ0"
FT                   /protein_id="ACE82833.1"
FT                   /translation="MQNINLPDGLSVRPSRASDKPFLEKLHHSLRQDLQLIDAEQDMIE
FT                   SIIELQLKAQTQGYGNQFPNAMYFVIEKHHEPIGKATIDFGHNEVRLVDLALIPAARGK
FT                   GLGAAVIQALQQAAAMVAAPMTLSVLQSNIPAKALYQKLGFITSHVELPYELMVWYPPA
FT                   MKVIRA"
FT   gene            731532..732308
FT                   /locus_tag="CJA_0597"
FT   CDS_pept        731532..732308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0597"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83322"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJJ1"
FT                   /protein_id="ACE83322.1"
FT                   /translation="MYATFVLSTGRCGTQWLTEKLQALYPDAVVEHEPLSFNYRPDVNT
FT                   ERAPLQCNKELIMQHLSCIQHYLDQGKPYIETGFPCWRHLEWFKQQLGGRVKIIHVHRE
FT                   PLQTVSSLLKLNAFVPPFIPQLPIKNLFLPEDGYGYFKDWQHLWPHLNPAEKNLWYWGE
FT                   VQAHALLLQAQWPAADWLQLEFSTLFGPQAEARLIHFLGDTPYAGVQPPGHVDQYGHAL
FT                   VPYPLEFPLMERLPAINHLAGQCGYGAIFPEAVIAN"
FT   gene            732525..733394
FT                   /locus_tag="CJA_0598"
FT   CDS_pept        732525..733394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0598"
FT                   /product="GumN protein superfamily"
FT                   /note="identified by match to protein family HMM PF07446"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACE86160"
FT                   /db_xref="InterPro:IPR002816"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJJ2"
FT                   /protein_id="ACE86160.1"
FT                   /translation="MKKGILLWLVMLLVAPLASAESSIYEVSKGQSKLYLGGTIHLLRD
FT                   SDFPLPEEFEQAYHQSRKLVLEANLQKASSPEYGQQVARAMMYTDGRDLSKVLSPDTWK
FT                   ALQAYADKRGFPLSQVSMFKPLFVSLMMTVTEAQRLGMGEGVDAYFDRMARLANKPVGE
FT                   LESTDDVILYMQKIAEVKPDQMMRTTLRDLQTMESSIDDMIRHWRQGNMKALDKELNGS
FT                   MRKDLPEVYRSLVVERNNAWLPQIIELLATPEVELVLVGALHLSGKDGLLAQLKKRGYN
FT                   VKPYQLQR"
FT   gene            733414..734289
FT                   /locus_tag="CJA_0599"
FT   CDS_pept        733414..734289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0599"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85092"
FT                   /db_xref="GOA:B3PJJ3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJJ3"
FT                   /protein_id="ACE85092.1"
FT                   /translation="MGAIIQLDNLQRQFGSNRILKGLSVSVEPGQVIALLGKNGAGKTT
FT                   LLETLLGFGLPSDGQATLWGDAAAQLSAANKQRVGFVPQQDELLPSLTGTEHLKLFRAF
FT                   RSQWNQSLVERLVTEWEIPLTQTLARMSVGQRQKLSILLAIAHEPELLVLDEPVASLDP
FT                   IARRQFLQQLVELAADEQRSIIFSTHIVNDVERVANRVWMLRQGELVYQGDLDSLKESI
FT                   ARVNLRSEQVFDQVIEYPHLLQQQRQGRTARLTFSQWQPEWAVDLARRFHAQVEVEHLS
FT                   LEDIFLELNS"
FT   gene            734286..735659
FT                   /locus_tag="CJA_0600"
FT   CDS_pept        734286..735659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0600"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83008"
FT                   /db_xref="GOA:B3PJJ4"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJJ4"
FT                   /protein_id="ACE83008.1"
FT                   /translation="MSLQRELNTYWQLIRTLLLPMRWLRWSVLGALLVALLGGLYWWLN
FT                   ETIGLGLVMAAFLYGVLFFSVGGLLMPGQMLAMASSKQLSLMGDLRTRLWWLLLGFALV
FT                   ASLFLALLGTLKTDLSFGSTYIAILILVSLILAAVLLVGAYWPGLQGFVFVFAWAYLQA
FT                   LDWLMAQDPLLLAGILLVCWWLLRVWWLHWRPARYVKNFMTQGQSSWWGINGDDKPEWT
FT                   NAVIYQPKAGAKTWLGSSLRGQADGVKADMQRLVIGVAIGLFFGVLGFWGAGQEAWLKI
FT                   WQMLGPMLLLIMTLSVGVAINFIMYRRIHCLWLFFPGDRRALYHYVHKAYWRQLLPLAV
FT                   FLVVVIGLIDSMVGINRSWVVPAIMLVLGLLVAVQMFYLSMLVYRLSGASKRWLDWTTG
FT                   IFLVVWTLTVIMSGFFIVHQEAHYQELIPLVGVALVINAVFALILPRIWSSVSLVRSQ"
FT   gene            735662..736042
FT                   /locus_tag="CJA_0601"
FT   CDS_pept        735662..736042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0601"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00392"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85705"
FT                   /db_xref="GOA:B3PJJ5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJJ5"
FT                   /protein_id="ACE85705.1"
FT                   /translation="MFILNPQSGIPIYRQLVDQIRRLIAGGQLQPGDQLPSVRDLAVEQ
FT                   AVNPMTVSKAYSLLEAEGLLQRQRGKPMQVAPQKPGLVSESARLQQLAPHLEQLVLAAR
FT                   QLEISDKQLLSALRDTLRAADE"
FT   gene            736149..737597
FT                   /locus_tag="CJA_0602"
FT   CDS_pept        736149..737597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0602"
FT                   /product="hydrolase, alpha/beta fold family domain protein"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84672"
FT                   /db_xref="GOA:B3PJJ6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR013595"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJJ6"
FT                   /protein_id="ACE84672.1"
FT                   /translation="MKPCPGFAETGKPALVYGAQCGELLLRENPDDPASAEIRVAILRL
FT                   PAINPSPQKDPLFLIQGGPGGSSIDMAEQVLQTFADVRKNRDLVFVDQRGTGQSNPLNC
FT                   AEQDEADMQLPEQEQAQRHFARMRACGEQYAAQVPFYTTPYAVADLDAVRAALGYEQIN
FT                   LWGGSYGSRVVLEYMRTRPERLRAVVMDGLAPVQIALPKYFARDASTALQALNKECTQQ
FT                   PQCAEQYGDLMQQADAILAYLRKQQARGSPVRVDYEHPRNQQREILWLTPRNFSSLVFM
FT                   SLYSRDLTVLLPQALHKAAQQDYRLLASLHALASAQTAFIKVSEGMRYSVVCNEDARFI
FT                   TADDLAQGHLFLGMDMLYEFGEICAHWPKAEVPDRYFGPVVSDVPALLLSGGYDPVTPY
FT                   TWAEQVAAHLSQASLLAAPGGNHIVSTDGCVPQIITQFIEQGGIGTMNTECITRIKPLP
FT                   LVLGANEKKSSAGSSAGSSESVQP"
FT   gene            737594..738361
FT                   /gene="natA"
FT                   /locus_tag="CJA_0603"
FT   CDS_pept        737594..738361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="natA"
FT                   /locus_tag="CJA_0603"
FT                   /product="sodium ABC transporter ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84312"
FT                   /db_xref="GOA:B3PJJ7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJJ7"
FT                   /protein_id="ACE84312.1"
FT                   /translation="MIRIQHLSKTFGGTKKQPLIRALDNVSLELRDGEITGLLGLNGAG
FT                   KSTLMRLIYGLLEPSAGDIVIDGLDVRTDPDEARKHLGVLPDDTGLYKRLTSRENIRYF
FT                   GELQGLRGAALEAGIEQLIGWLGMETIADRRAEGFSLGERMKTALARALVHQPKHVLLD
FT                   EPTNGLDVITTRSVRRLLHELKDQGRCVLFSSHLMHEVSGLCDRILVIAQGRICADGNL
FT                   AAILETGQASNLEDAFVNLVQTAAKQEADHVAA"
FT   gene            738348..739538
FT                   /locus_tag="CJA_0604"
FT   CDS_pept        738348..739538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0604"
FT                   /product="ABC-2 type transporter"
FT                   /note="identified by match to protein family HMM PF01061"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84680"
FT                   /db_xref="GOA:B3PJJ8"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJJ8"
FT                   /protein_id="ACE84680.1"
FT                   /translation="MLPLKTLWIIFRKEWCDALRDKRSLRMAFLPPVYFAAVFVASVLF
FT                   IIHLKNTSTASVSEPLQLPVYGAEHLPAMMDWLEEKGIRVKPAGEDAYAQVEQKKLDYA
FT                   LIIPAEAADQFATGESATVWLVHDATNNKIQGSLGFIRQQLWSWNGRMGSLRLLARGIS
FT                   PSVVNPVYVREMNIASDEKMGLMVMLSLPMFLVLLAFIGSVGFSADMTAGERERRSLES
FT                   LLITPATSLAIIGGKWLTSLAITLLVLLLEVLLLAIAFAYVPFNELGLRVNVSIADLLV
FT                   IFVMLVPLAVLAIALQLSIAIFARSFKDAQTYIGLLVFIPMIPMFYTLFNPGAYEPWFN
FT                   WIPVLGHQAMVKELLIGSGFSWWPLAQFWIVSLPLTIGMLLFTARQLRKPKIVYGV"
FT   gene            complement(739583..740143)
FT                   /locus_tag="CJA_0605"
FT   CDS_pept        complement(739583..740143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0605"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83845"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJJ9"
FT                   /protein_id="ACE83845.1"
FT                   /translation="MKLYGSYTSPFVRHCRIVLLETAQACEFIETDQAGSAVQSPTKRV
FT                   PFLADGDVFLTDSSSIIQYLREKAGQAFCADARELDQLCLVNTALESCVNLFFLERDGV
FT                   VIAQVPYLQRQAARIESALAELNQFNLPDHAPYNDVQLRLACFMGWAKLRKRVDFSGYG
FT                   NLEQFYQGAQGYTHFQATQPPQS"
FT   gene            complement(740170..740646)
FT                   /locus_tag="CJA_0606"
FT   CDS_pept        complement(740170..740646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0606"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ACE82974"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJK0"
FT                   /protein_id="ACE82974.1"
FT                   /translation="MSFVSFCRSGLLTLVLIASTILSFPALAADKPDTAVNAVEQQVEA
FT                   LRLAMIAGDAKQLDKLAAAKLSYGHSGGLVENKAEFIHKLESGSSDFVTIELKNQHISL
FT                   SGDVALVRHDLHADIKDGGVPNTIHLGILLVWQLQDGEWKLLARQAFKYPPKNP"
FT   gene            740903..741265
FT                   /locus_tag="CJA_0607"
FT   CDS_pept        740903..741265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0607"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ACE83653"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJK1"
FT                   /protein_id="ACE83653.1"
FT                   /translation="MRNLPSPSPRLSNPGPSADSPNIAGSRLPGRTPLAQRLQQLSQDK
FT                   RGQQKAIPIDLGRYLNELQLLALHSLESFGWQLWFIRRPLFMQPIAVVSNPDSSRHAVL
FT                   EVDGSINIQSGIQLRT"
FT   gene            741344..741856
FT                   /locus_tag="CJA_0608"
FT   CDS_pept        741344..741856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0608"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ACE84952"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJK2"
FT                   /protein_id="ACE84952.1"
FT                   /translation="MQIIRVFVLAIATILGLSACHEDDGVAPEDYVPHLYRFDIIDSYD
FT                   QDTARPGYGDLALNPYLYDGLFEIFWQVNSLEDYRMTLRVNDRPSITTSLAVHSEVCGQ
FT                   GRWCDQGGSLICEYTSDYYLSCDNSGRLVDIVNLFSQVPDDLYLFLEVCDRDSSYCEYD
FT                   YYPVRFE"
FT   gene            complement(741909..742241)
FT                   /locus_tag="CJA_0609"
FT   CDS_pept        complement(741909..742241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJA_0609"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85763"
FT                   /db_xref="UniProtKB/TrEMBL:B3PJK3"
FT                   /protein_id="ACE85763.1"
FT                   /translation="MPSFSNPKIIIGLFLLVGAGFVFTLTREPLATETYESTQDSDAHI
FT                   TPKNDFYAEAERRREDKLEERAQQERQEKLQKARENSVECQFWRQQKNEKSTERVDEKI
FT                   AEFCSV"
FT   gene            742724..744115
FT                   /gene="cpsA"
FT                   /locus_tag="CJA_0610"
FT   CDS_pept        742724..744115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpsA"
FT                   /locus_tag="CJA_0610"
FT                   /product="capsular polysaccharide biosynthesis protein"
FT                   /EC_number="2.7.-.-"
FT                   /note="identified by match to protein family HMM PF02397;
FT                   match to protein family HMM TIGR03025"
FT                   /db_xref="EnsemblGenomes-Gn:CJA_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ACE85387"
FT                   /db_xref="GOA:B3PJK4"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_x