(data stored in SCRATCH zone)

EMBL: CP000938

ID   CP000938; SV 1; circular; genomic DNA; STD; PRO; 3936 BP.
XX
AC   CP000938;
XX
PR   Project:PRJNA27853;
XX
DT   13-FEB-2008 (Rel. 94, Created)
DT   30-JAN-2014 (Rel. 119, Last updated, Version 2)
XX
DE   Francisella philomiragia subsp. philomiragia ATCC 25017 plasmid pFPHI01,
DE   complete sequence.
XX
KW   .
XX
OS   Francisella philomiragia subsp. philomiragia ATCC 25017
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Thiotrichales;
OC   Francisellaceae; Francisella.
OG   Plasmid pFPHI01
XX
RN   [1]
RP   1-3936
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Chain P., Malfatti S., Shin M., Vergez L., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Richardson P.;
RT   "Complete sequence of plasmid of Francisella philomiragia subsp.
RT   philomiragia ATCC 25017";
RL   Unpublished.
XX
RN   [2]
RP   1-3936
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Chain P., Malfatti S., Shin M., Vergez L., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Richardson P.;
RT   ;
RL   Submitted (11-DEC-2007) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; d8d70b5555bbd4ac45b9332e012073ba.
DR   BioSample; SAMN02598454.
DR   StrainInfo; 120024; 0.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID:  2773039
CC   Bacteria available from ATCC: ATCC 25017
CC   Contacts: Patrick Chain (chain2@llnl.gov)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3936
FT                   /organism="Francisella philomiragia subsp. philomiragia
FT                   ATCC 25017"
FT                   /plasmid="pFPHI01"
FT                   /strain="ATCC 25017"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:484022"
FT   gene            join(3817..3936,1..822)
FT                   /locus_tag="Fphi_0001"
FT   CDS_pept        join(3817..3936,1..822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fphi_0001"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cvi:CV_2292 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fphi_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ88136"
FT                   /db_xref="UniProtKB/TrEMBL:B0U1B7"
FT                   /protein_id="ABZ88136.1"
FT                   /translation="MASFYEYIQHVIDSNKFLEEKNLDKKKLNLKDLSGGVNKKFDPSM
FT                   GRVITMKNNARSDYEKEDRVKKVLEENDYTPSFLKSLDKPYYYYFISFQNSLDDSDDVE
FT                   ELYGRERVDFRRVSIYENMNPSGYLYIDQRQQLFSCIHQLMFIHFILFVNRIKHGDMHM
FT                   KNIKWIKFHKNNKDFYSVKAFDFGHAEVNCGGIIGSRYTDINYLFKLKSQKKSLVGFFE
FT                   GRSRFNDYISGENQNRMEKHFPLHHLLTNHQVPNLRKIHKNIAIDFLNREGDRLERNLR
FT                   EIKDKNITNEYSCNLVLKEFAASSERVVGILR"
FT   gene            1458..2378
FT                   /locus_tag="Fphi_0002"
FT   CDS_pept        1458..2378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fphi_0002"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ssn:SSON_PC01 Rep"
FT                   /db_xref="EnsemblGenomes-Gn:Fphi_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ88137"
FT                   /db_xref="GOA:B0U1B8"
FT                   /db_xref="InterPro:IPR000989"
FT                   /db_xref="UniProtKB/TrEMBL:B0U1B8"
FT                   /protein_id="ABZ88137.1"
FT                   /translation="MKNNNSILAQKQHITQLKNNQTRIQRLFSFNTKIQNNICDCGRYI
FT                   QLNKKRNYDTAEIKKEVEQAYTCKYRYCPLCNYYRICSVSPQMVKALEDQQNKGNKILF
FT                   LTLTVPNCDYSETRKTISNMNRAYKRLTEQNLFKNIEAWIRTTEVTFNTKGEAHPHFHI
FT                   ALAVNENYFKKGNYKTTREWSKIWSKAYKSDKQLIVDIRKSYKSKKHSKRDLDIHSTVK
FT                   ELAKYCIKSTDLQRIKTPENMEIIFNQLKGLRFIATSQNIKLSEDKKDELNSNEWELIE
FT                   SIILKYYPDMKQYLHHRTVSKNETV"
FT   gene            2365..2646
FT                   /locus_tag="Fphi_0004"
FT   CDS_pept        2365..2646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fphi_0004"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fphi_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ88139"
FT                   /db_xref="UniProtKB/TrEMBL:B0U1B9"
FT                   /protein_id="ABZ88139.1"
FT                   /translation="MKQFDLFGGFSKPTKSKTKTGNQGRPKKITPGVVFETKKLLSSKK
FT                   KISNDEIMQKLNLTKSIFYRIKKGYYDDLFKRFLETNIQNFSLTQEEN"
FT   gene            complement(3155..3415)
FT                   /locus_tag="Fphi_0003"
FT   CDS_pept        complement(3155..3415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fphi_0003"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fphi_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABZ88138"
FT                   /db_xref="UniProtKB/TrEMBL:B0U1C0"
FT                   /protein_id="ABZ88138.1"
FT                   /translation="MDNLAFKIQLGVILPKLDEKISKSTLEIFDELVGFVQSGEVEGQD
FT                   INVEEIKEILVKDFEIFLDKKIIPKSQKLKKEEASEEIEEA"
XX
SQ   Sequence 3936 BP; 1436 A; 519 C; 600 G; 1381 T; 0 other;
     tttgatccaa gtatgggacg tgttattaca atgaaaaata acgcaagaag tgattatgaa        60
     aaagaagata gagtgaaaaa agttttagaa gaaaatgatt atactccttc attcttaaaa       120
     tcattagaca aaccatatta ttattatttt atatcattcc aaaatagttt agatgatagt       180
     gatgatgttg aagaattata cggtcgcgaa agagttgatt ttcgtagagt tagtatttac       240
     gaaaatatga atccatccgg atatttatat atagatcaaa ggcaacaatt attttcctgt       300
     attcatcagt taatgtttat tcattttatt ttattcgtaa atagaataaa gcatggagat       360
     atgcatatga aaaatattaa atggattaaa tttcacaaaa ataataaaga tttttattct       420
     gttaaggctt ttgattttgg gcatgctgag gtgaattgtg gtgggattat aggttcacgt       480
     tatactgata ttaattattt atttaaattg aaatctcaaa aaaaatctct cgtaggattt       540
     tttgagggca gatcaagatt taatgactat ataagtggtg aaaatcaaaa tagaatggaa       600
     aagcactttc cattacatca tttgttaacc aatcaccaag taccaaattt aagaaaaatt       660
     cataaaaata ttgctattga ttttttaaat cgagaaggtg atcgattgga gagaaattta       720
     agagaaatta aagacaaaaa tattactaat gaatattcat gtaatttagt tctcaaagaa       780
     ttcgcagcat catctgaaag agtagttggt atacttagat gaaattttat tctggattgc       840
     ttatagaggt tttaaggcga tttaagagcc atttttgatt ttaacgtgaa aaactatatc       900
     gaagcttaaa atcgcttaaa atcgctttct atgtttccag aatgcgacaa tttgaagtgg       960
     ctagccgtct gcaagactat tagccttgat gatttttaaa atgtccaaaa atgataatac      1020
     aatcataaca taatcatttt tttgttttct gttttatttt gttttctttc tcagtttctt      1080
     ttttgtcttt tgctatgact tgctttagtc tttctttttg agattttttc cttttgagaa      1140
     agttaaacat ttttctgttc ttctgagttg aatgtctaat ttttccacct tttttcttaa      1200
     agctcaatat gcattgactg cgtcaaagta aaattgagtt gttttcacag ttagtaaaaa      1260
     tcgctaatcg ctggatttta acccctgcaa aaatgaaaaa atgaagcttg agaagatcgc      1320
     caaaaaaggc gaagccgttt tggtctttac ttgatacaaa gtatattgga aacaagtgca      1380
     gattttatga ttgaatagat acaaaaaaag tcctatactt ttaagcgacc aaactaaaaa      1440
     atacaggact aattttaatg aaaaataata attcaatttt ggcacaaaag caacacataa      1500
     cccaattgaa aaataatcaa actcgcatac aacgattatt ttctttcaac acaaaaatac      1560
     aaaataacat ttgtgattgt ggtcgctata ttcagctaaa caaaaaaaga aattacgata      1620
     cagcagaaat taaaaaggaa gttgaacaag cttatacatg caaatatcgt tattgtccgt      1680
     tgtgtaatta ttaccgtatt tgttctgtgt ctcctcaaat ggttaaagca cttgaagacc      1740
     aacaaaacaa aggaaataag atattgtttc taaccttaac tgttccaaat tgcgattatt      1800
     cagaaactag aaaaactatc tcgaatatga atagggcata taagagattg actgaacaaa      1860
     atttatttaa aaatattgaa gcttggatac gaactacaga agtaacattt aacacaaaag      1920
     gcgaagcaca cccacatttt cacattgccc tagcagttaa tgaaaactac ttcaaaaaag      1980
     gtaattacaa gactactaga gagtggtcta aaatatggtc aaaagcttac aagagcgata      2040
     agcaattaat cgtagatatc cgaaaatcat acaagagtaa aaagcactca aagagagatt      2100
     tagacattca ttcaactgtt aaagagttgg ctaaatactg cataaaatca accgacttgc      2160
     agagaattaa aacccctgaa aatatggaga ttatattcaa tcaattaaag ggtttgaggt      2220
     ttattgccac tagtcaaaac atcaaactat cagaagataa aaaagatgag ttaaattcta      2280
     atgaatggga actaattgag tcaattattt tgaagtacta cccagacatg aaacaatatt      2340
     tacatcatag aacggtatca aaaaatgaaa cagtttgatt tgtttggggg attttctaaa      2400
     cctacaaaat caaaaactaa aactggtaat caagggcgac caaaaaagat aacgcctgga      2460
     gttgtttttg aaactaaaaa acttttgagt tccaaaaaga aaatctcaaa tgatgaaatt      2520
     atgcaaaaac ttaatctaac aaaatcaatt ttttatcgaa tcaagaaagg ttattatgat      2580
     gaccttttta aaagattttt agaaacgaac attcaaaact tttcacttac tcaagaagag      2640
     aattagataa gatatatttt tttatttttt ttgctcatac cctttttgaa aaagtaaaat      2700
     ttatcttttg tattgctttt gtatcaagct ttttagtgtt cgacgctatt cgctctttaa      2760
     acaagcatct tgaagcatct tttagatttt tctaaaggct cattatccat tgaaaaaatt      2820
     tcaatggtaa ttcgtagaaa atagacacgc tataaactca aattttgagt ttatagcgtg      2880
     cccttttatc cctgtcaatt tgcataattt ttgagcatag tgacagggtg ataaaactag      2940
     tgatgattaa ttgtactcaa aggggattac tagaatgtta aaaagtgata agccgtttta      3000
     aggcgattta agagccattt ttgattttaa cgtgaaaaac tatatcgaag cttaaaatcg      3060
     cttaaaatcg cttttaaatc atctagaatg agctgttttg atgctgttat tgatttaaaa      3120
     gattatattt cttgatattt ttgattttga tattttatgc ttcctctatt tcttcagatg      3180
     cttcctcttt ctttagtttt tgagactttg gtattatttt tttatcaaga aatatttcaa      3240
     aatcttttac tagaatttct tttatttctt ctacatttat gtcttgacct tctacttctc      3300
     cggattgaac aaaacctaca agttcatcaa aaatctctaa agttgatttt gatatttttt      3360
     cgtctaattt tggaagtatt acacctaatt ggattttaaa agctaagttg tccattttaa      3420
     tctatattgt ttttttttga ttttgatatt ttctcataaa agttttgtga ttaaaaaaat      3480
     atttacactt tccagaatgc gacaatttga agtggctagc cgtctgcaag actattagcc      3540
     ttgatgattt ttaaaatatt aaaaaataat aatgcagtca taacagatta ttgaaggcaa      3600
     taaaaataac tgccctttat tagcctttga aagaatttga acctttgata atgctaaatt      3660
     gcgaatagcg ttaaggggtg tgctttcttt gagtgttatt tttagaacta aagtgaatta      3720
     gaaaggaaag cacaataaaa tcatagcata attatttttt tgttttatac gtttaggttt      3780
     attgttacaa tgtttttttt ggcaattttt taatatatgg caagttttta cgaatatatt      3840
     cagcatgtta tagattctaa taaattttta gaagaaaaga atcttgataa aaaaaaatta      3900
     aatcttaaag atttatccgg tggggttaat aaaaaa                                3936
//

If you have problems or comments...

PBIL Back to PBIL home page