(data stored in ACNUC7421 zone)

EMBL: CP000941

ID   CP000941; SV 1; circular; genomic DNA; STD; PRO; 2475130 BP.
XX
AC   CP000941;
XX
PR   Project:PRJNA17823;
XX
DT   22-FEB-2008 (Rel. 94, Created)
DT   05-DEC-2011 (Rel. 111, Last updated, Version 2)
XX
DE   Xylella fastidiosa M12, complete genome.
XX
KW   .
XX
OS   Xylella fastidiosa M12
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Xanthomonadales;
OC   Xanthomonadaceae; Xylella.
XX
RN   [1]
RP   1-2475130
RA   Chen J., Han S., Civerolo E.L., Stenger D.C., Van Sluys M.A.;
RT   "Two whole genome sequences of Xylella fastidiosa almond leaf scorch
RT   strains";
RL   (in) Unknown A. (Eds.);
RL   AMERICAN PHYTOPATHOLOGICAL SOCIETY ABSTRACTS (S21);
RL   Unknown Publisher (2007)
XX
RN   [2]
RP   1-2475130
RX   DOI; 10.1128/JB.00651-10.
RX   PUBMED; 20601474.
RA   Chen J., Xie G., Han S., Chertkov O., Sims D., Civerolo E.L.;
RT   "Whole genome sequences of two Xylella fastidiosa strains (M12 and M23)
RT   causing almond leaf scorch disease in California";
RL   J. Bacteriol. 192(17):4534-4534(2010).
XX
RN   [3]
RP   1-2475130
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Chertkov O., Brettin T., Detter J.C.,
RA   Han C., Tapia R., Gilna P., Schmutz J., Larimer F., Land M., Hauser L.,
RA   Kyrpides N., Lykidis A., Chen J., Richardson P.;
RT   ;
RL   Submitted (07-FEB-2008) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 62cdb34d3fcda34fc0a4133b19a63039.
DR   EnsemblGenomes-Gn; EBG00001136920.
DR   EnsemblGenomes-Gn; EBG00001136921.
DR   EnsemblGenomes-Gn; EBG00001136922.
DR   EnsemblGenomes-Gn; EBG00001136923.
DR   EnsemblGenomes-Gn; EBG00001136924.
DR   EnsemblGenomes-Gn; EBG00001136925.
DR   EnsemblGenomes-Gn; EBG00001136926.
DR   EnsemblGenomes-Gn; EBG00001136927.
DR   EnsemblGenomes-Gn; EBG00001136928.
DR   EnsemblGenomes-Gn; EBG00001136929.
DR   EnsemblGenomes-Gn; EBG00001136930.
DR   EnsemblGenomes-Gn; EBG00001136931.
DR   EnsemblGenomes-Gn; EBG00001136932.
DR   EnsemblGenomes-Gn; EBG00001136933.
DR   EnsemblGenomes-Gn; EBG00001136934.
DR   EnsemblGenomes-Gn; EBG00001136935.
DR   EnsemblGenomes-Gn; EBG00001136936.
DR   EnsemblGenomes-Gn; EBG00001136937.
DR   EnsemblGenomes-Gn; EBG00001136938.
DR   EnsemblGenomes-Gn; EBG00001136939.
DR   EnsemblGenomes-Gn; EBG00001136940.
DR   EnsemblGenomes-Gn; EBG00001136941.
DR   EnsemblGenomes-Gn; EBG00001136942.
DR   EnsemblGenomes-Gn; EBG00001136943.
DR   EnsemblGenomes-Gn; EBG00001136944.
DR   EnsemblGenomes-Gn; EBG00001136945.
DR   EnsemblGenomes-Gn; EBG00001136946.
DR   EnsemblGenomes-Gn; EBG00001136947.
DR   EnsemblGenomes-Gn; EBG00001136948.
DR   EnsemblGenomes-Gn; EBG00001136949.
DR   EnsemblGenomes-Gn; EBG00001136950.
DR   EnsemblGenomes-Gn; EBG00001136951.
DR   EnsemblGenomes-Gn; EBG00001136952.
DR   EnsemblGenomes-Gn; EBG00001136953.
DR   EnsemblGenomes-Gn; EBG00001136954.
DR   EnsemblGenomes-Gn; EBG00001136955.
DR   EnsemblGenomes-Gn; EBG00001136956.
DR   EnsemblGenomes-Gn; EBG00001136957.
DR   EnsemblGenomes-Gn; EBG00001136958.
DR   EnsemblGenomes-Gn; EBG00001136959.
DR   EnsemblGenomes-Gn; EBG00001136960.
DR   EnsemblGenomes-Gn; EBG00001136961.
DR   EnsemblGenomes-Gn; EBG00001136962.
DR   EnsemblGenomes-Gn; EBG00001136963.
DR   EnsemblGenomes-Gn; EBG00001136964.
DR   EnsemblGenomes-Gn; EBG00001136965.
DR   EnsemblGenomes-Gn; EBG00001136966.
DR   EnsemblGenomes-Gn; EBG00001136967.
DR   EnsemblGenomes-Gn; EBG00001136968.
DR   EnsemblGenomes-Gn; EBG00001136969.
DR   EnsemblGenomes-Gn; EBG00001136970.
DR   EnsemblGenomes-Gn; EBG00001136971.
DR   EnsemblGenomes-Gn; EBG00001136972.
DR   EnsemblGenomes-Gn; EBG00001136973.
DR   EnsemblGenomes-Gn; EBG00001136974.
DR   EnsemblGenomes-Gn; EBG00001136975.
DR   EnsemblGenomes-Gn; EBG00001136976.
DR   EnsemblGenomes-Gn; EBG00001136977.
DR   EnsemblGenomes-Gn; EBG00001136978.
DR   EnsemblGenomes-Gn; EBG00001136979.
DR   EnsemblGenomes-Gn; EBG00001136980.
DR   EnsemblGenomes-Gn; EBG00001136981.
DR   EnsemblGenomes-Gn; EBG00001136982.
DR   EnsemblGenomes-Gn; EBG00001136983.
DR   EnsemblGenomes-Gn; EBG00001136984.
DR   EnsemblGenomes-Gn; EBG00001136985.
DR   EnsemblGenomes-Gn; EBG00001136986.
DR   EnsemblGenomes-Gn; EBG00001136987.
DR   EnsemblGenomes-Gn; EBG00001136988.
DR   EnsemblGenomes-Gn; Xfasm12_R0001.
DR   EnsemblGenomes-Gn; Xfasm12_R0002.
DR   EnsemblGenomes-Gn; Xfasm12_R0003.
DR   EnsemblGenomes-Gn; Xfasm12_R0004.
DR   EnsemblGenomes-Gn; Xfasm12_R0005.
DR   EnsemblGenomes-Gn; Xfasm12_R0006.
DR   EnsemblGenomes-Gn; Xfasm12_R0007.
DR   EnsemblGenomes-Gn; Xfasm12_R0008.
DR   EnsemblGenomes-Gn; Xfasm12_R0009.
DR   EnsemblGenomes-Gn; Xfasm12_R0010.
DR   EnsemblGenomes-Gn; Xfasm12_R0011.
DR   EnsemblGenomes-Gn; Xfasm12_R0012.
DR   EnsemblGenomes-Gn; Xfasm12_R0013.
DR   EnsemblGenomes-Gn; Xfasm12_R0014.
DR   EnsemblGenomes-Gn; Xfasm12_R0015.
DR   EnsemblGenomes-Gn; Xfasm12_R0016.
DR   EnsemblGenomes-Gn; Xfasm12_R0017.
DR   EnsemblGenomes-Gn; Xfasm12_R0018.
DR   EnsemblGenomes-Gn; Xfasm12_R0019.
DR   EnsemblGenomes-Gn; Xfasm12_R0020.
DR   EnsemblGenomes-Gn; Xfasm12_R0021.
DR   EnsemblGenomes-Gn; Xfasm12_R0022.
DR   EnsemblGenomes-Gn; Xfasm12_R0023.
DR   EnsemblGenomes-Gn; Xfasm12_R0024.
DR   EnsemblGenomes-Gn; Xfasm12_R0025.
DR   EnsemblGenomes-Gn; Xfasm12_R0026.
DR   EnsemblGenomes-Gn; Xfasm12_R0027.
DR   EnsemblGenomes-Gn; Xfasm12_R0028.
DR   EnsemblGenomes-Gn; Xfasm12_R0029.
DR   EnsemblGenomes-Gn; Xfasm12_R0030.
DR   EnsemblGenomes-Gn; Xfasm12_R0031.
DR   EnsemblGenomes-Gn; Xfasm12_R0032.
DR   EnsemblGenomes-Gn; Xfasm12_R0033.
DR   EnsemblGenomes-Gn; Xfasm12_R0034.
DR   EnsemblGenomes-Gn; Xfasm12_R0035.
DR   EnsemblGenomes-Gn; Xfasm12_R0036.
DR   EnsemblGenomes-Gn; Xfasm12_R0037.
DR   EnsemblGenomes-Gn; Xfasm12_R0038.
DR   EnsemblGenomes-Gn; Xfasm12_R0040.
DR   EnsemblGenomes-Gn; Xfasm12_R0041.
DR   EnsemblGenomes-Gn; Xfasm12_R0042.
DR   EnsemblGenomes-Gn; Xfasm12_R0043.
DR   EnsemblGenomes-Gn; Xfasm12_R0044.
DR   EnsemblGenomes-Gn; Xfasm12_R0045.
DR   EnsemblGenomes-Gn; Xfasm12_R0046.
DR   EnsemblGenomes-Gn; Xfasm12_R0047.
DR   EnsemblGenomes-Gn; Xfasm12_R0048.
DR   EnsemblGenomes-Gn; Xfasm12_R0049.
DR   EnsemblGenomes-Gn; Xfasm12_R0050.
DR   EnsemblGenomes-Gn; Xfasm12_R0051.
DR   EnsemblGenomes-Gn; Xfasm12_R0052.
DR   EnsemblGenomes-Gn; Xfasm12_R0053.
DR   EnsemblGenomes-Gn; Xfasm12_R0054.
DR   EnsemblGenomes-Gn; Xfasm12_R0055.
DR   EnsemblGenomes-Gn; Xfasm12_R0056.
DR   EnsemblGenomes-Gn; Xfasm12_R0057.
DR   EnsemblGenomes-Gn; Xfasm12_R0058.
DR   EnsemblGenomes-Gn; Xfasm12_R0059.
DR   EnsemblGenomes-Gn; Xfasm12_R0060.
DR   EnsemblGenomes-Tr; EBT00001727469.
DR   EnsemblGenomes-Tr; EBT00001727470.
DR   EnsemblGenomes-Tr; EBT00001727471.
DR   EnsemblGenomes-Tr; EBT00001727472.
DR   EnsemblGenomes-Tr; EBT00001727473.
DR   EnsemblGenomes-Tr; EBT00001727474.
DR   EnsemblGenomes-Tr; EBT00001727475.
DR   EnsemblGenomes-Tr; EBT00001727476.
DR   EnsemblGenomes-Tr; EBT00001727477.
DR   EnsemblGenomes-Tr; EBT00001727478.
DR   EnsemblGenomes-Tr; EBT00001727479.
DR   EnsemblGenomes-Tr; EBT00001727480.
DR   EnsemblGenomes-Tr; EBT00001727481.
DR   EnsemblGenomes-Tr; EBT00001727482.
DR   EnsemblGenomes-Tr; EBT00001727483.
DR   EnsemblGenomes-Tr; EBT00001727484.
DR   EnsemblGenomes-Tr; EBT00001727485.
DR   EnsemblGenomes-Tr; EBT00001727486.
DR   EnsemblGenomes-Tr; EBT00001727487.
DR   EnsemblGenomes-Tr; EBT00001727488.
DR   EnsemblGenomes-Tr; EBT00001727489.
DR   EnsemblGenomes-Tr; EBT00001727490.
DR   EnsemblGenomes-Tr; EBT00001727491.
DR   EnsemblGenomes-Tr; EBT00001727492.
DR   EnsemblGenomes-Tr; EBT00001727493.
DR   EnsemblGenomes-Tr; EBT00001727494.
DR   EnsemblGenomes-Tr; EBT00001727495.
DR   EnsemblGenomes-Tr; EBT00001727496.
DR   EnsemblGenomes-Tr; EBT00001727497.
DR   EnsemblGenomes-Tr; EBT00001727498.
DR   EnsemblGenomes-Tr; EBT00001727499.
DR   EnsemblGenomes-Tr; EBT00001727500.
DR   EnsemblGenomes-Tr; EBT00001727501.
DR   EnsemblGenomes-Tr; EBT00001727502.
DR   EnsemblGenomes-Tr; EBT00001727503.
DR   EnsemblGenomes-Tr; EBT00001727504.
DR   EnsemblGenomes-Tr; EBT00001727505.
DR   EnsemblGenomes-Tr; EBT00001727506.
DR   EnsemblGenomes-Tr; EBT00001727507.
DR   EnsemblGenomes-Tr; EBT00001727508.
DR   EnsemblGenomes-Tr; EBT00001727509.
DR   EnsemblGenomes-Tr; EBT00001727510.
DR   EnsemblGenomes-Tr; EBT00001727511.
DR   EnsemblGenomes-Tr; EBT00001727512.
DR   EnsemblGenomes-Tr; EBT00001727513.
DR   EnsemblGenomes-Tr; EBT00001727514.
DR   EnsemblGenomes-Tr; EBT00001727515.
DR   EnsemblGenomes-Tr; EBT00001727516.
DR   EnsemblGenomes-Tr; EBT00001727517.
DR   EnsemblGenomes-Tr; EBT00001727518.
DR   EnsemblGenomes-Tr; EBT00001727519.
DR   EnsemblGenomes-Tr; EBT00001727520.
DR   EnsemblGenomes-Tr; EBT00001727521.
DR   EnsemblGenomes-Tr; EBT00001727522.
DR   EnsemblGenomes-Tr; EBT00001727523.
DR   EnsemblGenomes-Tr; EBT00001727524.
DR   EnsemblGenomes-Tr; EBT00001727525.
DR   EnsemblGenomes-Tr; EBT00001727526.
DR   EnsemblGenomes-Tr; EBT00001727527.
DR   EnsemblGenomes-Tr; EBT00001727528.
DR   EnsemblGenomes-Tr; EBT00001727529.
DR   EnsemblGenomes-Tr; EBT00001727530.
DR   EnsemblGenomes-Tr; EBT00001727531.
DR   EnsemblGenomes-Tr; EBT00001727532.
DR   EnsemblGenomes-Tr; EBT00001727533.
DR   EnsemblGenomes-Tr; EBT00001727534.
DR   EnsemblGenomes-Tr; EBT00001727535.
DR   EnsemblGenomes-Tr; EBT00001727536.
DR   EnsemblGenomes-Tr; EBT00001727537.
DR   EnsemblGenomes-Tr; Xfasm12_R0001-1.
DR   EnsemblGenomes-Tr; Xfasm12_R0002-1.
DR   EnsemblGenomes-Tr; Xfasm12_R0003-1.
DR   EnsemblGenomes-Tr; Xfasm12_R0004-1.
DR   EnsemblGenomes-Tr; Xfasm12_R0005-1.
DR   EnsemblGenomes-Tr; Xfasm12_R0006-1.
DR   EnsemblGenomes-Tr; Xfasm12_R0007-1.
DR   EnsemblGenomes-Tr; Xfasm12_R0008-1.
DR   EnsemblGenomes-Tr; Xfasm12_R0009-1.
DR   EnsemblGenomes-Tr; Xfasm12_R0010-1.
DR   EnsemblGenomes-Tr; Xfasm12_R0011-1.
DR   EnsemblGenomes-Tr; Xfasm12_R0012-1.
DR   EnsemblGenomes-Tr; Xfasm12_R0013-1.
DR   EnsemblGenomes-Tr; Xfasm12_R0014-1.
DR   EnsemblGenomes-Tr; Xfasm12_R0015-1.
DR   EnsemblGenomes-Tr; Xfasm12_R0016-1.
DR   EnsemblGenomes-Tr; Xfasm12_R0017-1.
DR   EnsemblGenomes-Tr; Xfasm12_R0018-1.
DR   EnsemblGenomes-Tr; Xfasm12_R0019-1.
DR   EnsemblGenomes-Tr; Xfasm12_R0020-1.
DR   EnsemblGenomes-Tr; Xfasm12_R0021-1.
DR   EnsemblGenomes-Tr; Xfasm12_R0022-1.
DR   EnsemblGenomes-Tr; Xfasm12_R0023-1.
DR   EnsemblGenomes-Tr; Xfasm12_R0024-1.
DR   EnsemblGenomes-Tr; Xfasm12_R0025-1.
DR   EnsemblGenomes-Tr; Xfasm12_R0026-1.
DR   EnsemblGenomes-Tr; Xfasm12_R0027-1.
DR   EnsemblGenomes-Tr; Xfasm12_R0028-1.
DR   EnsemblGenomes-Tr; Xfasm12_R0029-1.
DR   EnsemblGenomes-Tr; Xfasm12_R0030-1.
DR   EnsemblGenomes-Tr; Xfasm12_R0031-1.
DR   EnsemblGenomes-Tr; Xfasm12_R0032-1.
DR   EnsemblGenomes-Tr; Xfasm12_R0033-1.
DR   EnsemblGenomes-Tr; Xfasm12_R0034-1.
DR   EnsemblGenomes-Tr; Xfasm12_R0035-1.
DR   EnsemblGenomes-Tr; Xfasm12_R0036-1.
DR   EnsemblGenomes-Tr; Xfasm12_R0037-1.
DR   EnsemblGenomes-Tr; Xfasm12_R0038-1.
DR   EnsemblGenomes-Tr; Xfasm12_R0040-1.
DR   EnsemblGenomes-Tr; Xfasm12_R0041-1.
DR   EnsemblGenomes-Tr; Xfasm12_R0042-1.
DR   EnsemblGenomes-Tr; Xfasm12_R0043-1.
DR   EnsemblGenomes-Tr; Xfasm12_R0044-1.
DR   EnsemblGenomes-Tr; Xfasm12_R0045-1.
DR   EnsemblGenomes-Tr; Xfasm12_R0046-1.
DR   EnsemblGenomes-Tr; Xfasm12_R0047-1.
DR   EnsemblGenomes-Tr; Xfasm12_R0048-1.
DR   EnsemblGenomes-Tr; Xfasm12_R0049-1.
DR   EnsemblGenomes-Tr; Xfasm12_R0050-1.
DR   EnsemblGenomes-Tr; Xfasm12_R0051-1.
DR   EnsemblGenomes-Tr; Xfasm12_R0052-1.
DR   EnsemblGenomes-Tr; Xfasm12_R0053-1.
DR   EnsemblGenomes-Tr; Xfasm12_R0054-1.
DR   EnsemblGenomes-Tr; Xfasm12_R0055-1.
DR   EnsemblGenomes-Tr; Xfasm12_R0056-1.
DR   EnsemblGenomes-Tr; Xfasm12_R0057-1.
DR   EnsemblGenomes-Tr; Xfasm12_R0058-1.
DR   EnsemblGenomes-Tr; Xfasm12_R0059-1.
DR   EnsemblGenomes-Tr; Xfasm12_R0060-1.
DR   EuropePMC; PMC2937377; 20601474.
DR   EuropePMC; PMC2982844; 21103383.
DR   EuropePMC; PMC3080875; 21533033.
DR   EuropePMC; PMC3294468; 22194287.
DR   EuropePMC; PMC3843690; 24312333.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00373; RNaseP_arch.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02221; sRNA-Xcc1.
DR   RFAM; RF02223; sX4.
DR   RFAM; RF02232; sX13.
DR   RFAM; RF02235; asX1.
DR   RFAM; RF02241; Xoo2.
DR   SILVA-LSU; CP000941.
DR   SILVA-SSU; CP000941.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4002191
CC   Source DNA and bacteria available from Jianchi Chen
CC   (Jianchi.Chen@ARS.USDA.GOV)
CC   Contacts: Jianchi Chen (Jianchi.Chen@ARS.USDA.GOV)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2475130
FT                   /organism="Xylella fastidiosa M12"
FT                   /strain="M12"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:405440"
FT   gene            20..1351
FT                   /locus_tag="Xfasm12_0001"
FT   CDS_pept        20..1351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0001"
FT                   /product="chromosomal replication initiator"
FT                   /note="KEGG: xfa:XF0001 chromosomal replication initiator"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11055"
FT                   /protein_id="ACA11055.1"
FT                   /translation="MTTLMESWSRCLERLETEFPPEDVHTWLRPLQAEQRGDSVILYAP
FT                   NPFIIELVEERYLGRLRELLSYFSGIREVVLAIGSRPKTTELPVPVDTTGRLSPTVPFN
FT                   GNLDTHYNFDNFVEGRSNQLARAAAWQAAQKPGDRTHNPLLLYGGTGLGKTHLMFAAGN
FT                   VMRQVNPTYKVMYLRSEQFFSAMIRALQDKSMDQFKRQFHQIDALLIDDIQFFAGKDRT
FT                   QEEFFHTFNALFDGKQQIILTCDRYPREVNGLEPRLKSRLAWGLSVAIDPPDFETRAAI
FT                   VLAKARERGATIPDEVAFLIAKKMHSNVRDLEGALNTLVARANFTGRAVTIEFSQETLR
FT                   DLLRAQQQTIGIPNIQKIVADYYGLQIKDLLSKRRTRSLARPRQLAMALAKELTEHSLP
FT                   EIGDAFAGRDHTTVLHACRQIKLLMETETKLREDWDKLMRKFSE"
FT   gene            1637..2737
FT                   /locus_tag="Xfasm12_0002"
FT   CDS_pept        1637..2737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0002"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: xfa:XF0002 DNA polymerase III, beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11056"
FT                   /protein_id="ACA11056.1"
FT                   /translation="MRFRLQRETFLKPLAHVVNVVERRQTRSILANLLIKVNEDQLSLT
FT                   GTDLEVEMISKTIIEDAESGEITIPARKIYEIVRALPDASQLSVYQSDDKITLQAGRSK
FT                   FTLATLPANDFPSIDKIEVTERIIIAEVLLKELIERTAFAMAQQDVRYYLNGLLFDLRD
FT                   TKLRCVATDGHRLALCETELEQAKDLKRQIILPRKGVMELQRLLEGSDRQIELEIARNH
FT                   IRMKSFDVTFTSKLIDGSFPDYEGVIPIGADREVKVAREVLRDALQRAAILSNEKYRGV
FT                   RIEVSPGQLKINAHNPEQEEAQEEIEAQTIVDGLAIGFNVNYLLDALSSLRGDFVNIQL
FT                   RDSNSSALIRESNSEKSLQVVMPLRL"
FT   gene            3041..4135
FT                   /locus_tag="Xfasm12_0003"
FT   CDS_pept        3041..4135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0003"
FT                   /product="DNA replication and repair RecF protein"
FT                   /note="KEGG: xft:PD0003 DNA replication and repair RecF
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11057"
FT                   /db_xref="GOA:B0U1G7"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U1G7"
FT                   /protein_id="ACA11057.1"
FT                   /translation="MHITQLVLRHFRCFDVVDFFPLPGLNFFIGENGSGKTSLLEAVHL
FT                   MGYGRSFRGRVRDGLIRHGSENLEIFVDWQETALINARRHRAGLSHYGQEWIGRLDGQK
FT                   IIHLASLCAALAVITFESSSYQLINSNAELRRRFLDWGLFHVEPDFLDLWRCYTHVLKQ
FT                   RNSLLKQKEELAMLEAWDQKLSEVGEQLTFRRFQYLERLKQRVIPLISRITPNLKIHGF
FT                   NFNHGWRRHELPLIDALFISRERDYQYGYTSLGPHRSDWTPQFSSIPGVHVLSRGQGKL
FT                   ITLMCLLAQAQDFFDQRGEWPILSLDDLASELDQKHQWRVLEMLAEIPAQVLITGTEIP
FT                   QGLKPFFSVGAMFHVEHGAITRMF"
FT   gene            4439..4648
FT                   /pseudo
FT                   /locus_tag="Xfasm12_0004"
FT   gene            4648..7092
FT                   /locus_tag="Xfasm12_0005"
FT   CDS_pept        4648..7092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0005"
FT                   /product="DNA topoisomerase (ATP-hydrolyzing)"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: xft:PD0005 DNA gyrase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11058"
FT                   /protein_id="ACA11058.1"
FT                   /translation="MTEKQNTSLLSNGGIYDSSKITVLRGLDAVRKRPGMYIGDVHDGT
FT                   GLHHMVFEVVDNSVDEALAGHADSILVKIHVDGSVSVSDNGRGIPVDIHKEEGVSAAEV
FT                   ILTVLHAGGKFDDNSYKVSGGLHGVGVSVVNALSERLWLDIWRDGYHYQQEYVLGDPQY
FT                   PLKQLEVSAKRGTTLRFKPAKEIFSDVEFHYENLAKRLRELSFLNSGLKVSLIDERGEG
FT                   RRDDFHYEGGIRSFVEHLAQLKTPLHSNVISVTGEHNGIVVDVALQWTDAYQETMYCFT
FT                   NNIPQKDGGTHLAGFRAALTRTLGNYIEQNGIARQAKITFSGDDMREGMIAVLSVKVPE
FT                   PSFSSQTKEKLVSSDVKPAVEATFGLRLEEFLQENPNEARAIAGKIVDAARAREAARKA
FT                   RDLTRRKGVLDIAGLPGKLADCQEKDPAMSELFIVEGDSAGGSAKQGRNRKNQAVLPLR
FT                   GKILNVERARFDRMLSSAEVGTLITALGTGIGKDEYNPDKLRYHRIIIMTDADVDGSHI
FT                   RTLLLTFFYRQMPELIERGHIYIGLPPLYKLKQGKSELYLKDDIALNVYLANSAVEGAQ
FT                   LLPAEGEPPIEGLALEKLLITYIAAKDTIVRHSHRYDSRLLEALLEFTPLDSTCFQSYS
FT                   DSEHLQSLMALLNQSSLGAPRYILKMQFPDEQHSAALLATRYHMGEELTQVLQLSALET
FT                   GELRPLYEAAKLLHGLIRNGAKIVRGTKSQSIECFGDAQAWLLEEAKKGRQIQRFKGLG
FT                   EMNPEQLWDTTVNPDTRRLLQVCIEDGIAADQIFSTLMGDVVEPRRGFIENNALKVTRL
FT                   DI"
FT   gene            7296..7967
FT                   /locus_tag="Xfasm12_0006"
FT   CDS_pept        7296..7967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0006"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0006 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11059"
FT                   /protein_id="ACA11059.1"
FT                   /translation="MLATQAQQRNQRLDSQSVAILIGQPGVLVQMLVALIAIGGTALLL
FT                   YFWRLPATVDERHHARLALRRMSTWNCIVGVAVLTFFFSTLSGLLARKLGIPIVPSNQA
FT                   LILEGLARWPLFVVLFVVFLVPAYEELLFRRVFLGRFLIAGRPILGITLSGLAFAFLHE
FT                   IPGLSSNGALAIIYLWLIYMILGMAFGWVYWRTGSLWASITTHSFNNIGALIGLYFFGM
FT                   Y"
FT   gene            8032..8847
FT                   /locus_tag="Xfasm12_0007"
FT   CDS_pept        8032..8847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0007"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0007 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11060"
FT                   /protein_id="ACA11060.1"
FT                   /translation="MKKLSFFLIATLSLGACSTATSPTGRHQVFSGVSQQQLNQLGEQA
FT                   FVEIKAKEKISGNVRQNAYVRCVVDALVTELPLQWRHVKWETVLFFNEEPNAFALPGGK
FT                   VGVNTGIFRAAKNQEQLAAVLGHEIGHVVSRHHEERITWQLGTQAGLGLLGVLAGTAYG
FT                   DSAATAVNQIGGLTAQAAFLLPGSRTQEREADIVGQRLMAQAGFDPIQAVYLWKNMLAI
FT                   AGQRPPQWLSTHPDPTNRIRQLEQQSTVLASVYAQARDAGRVPHCSPAA"
FT   sig_peptide     8032..8094
FT                   /locus_tag="Xfasm12_0007"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.630 at
FT                   residue 21"
FT   gene            8950..10143
FT                   /locus_tag="Xfasm12_0008"
FT   CDS_pept        8950..10143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0008"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0008 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11061"
FT                   /protein_id="ACA11061.1"
FT                   /translation="MKRLNYKNDLLSLLIPIFLGGGIAVPAAALQSDNTSLSRHAAKRG
FT                   NSENLYPQATRQEPKIKNSSRLAGNLQKLIDAYNKGQDYLAVRAQADGILANTSANEAD
FT                   KSLAAQLGAQAVYKLEDLVAAQHYLNQAIALNGLDNNNHYQSMLLLAQLQLQEGKYSEG
FT                   LATLDKYLAETKSQRAEDLILKGQALYQAGKYSEAIPVIKQAIAASSEPKESWEQLLIS
FT                   TYSEVGQTGEAIAMAEALAAKAPNDKKAQIDLASLYMQADQMGKAAVVLDQLRTVGKLT
FT                   EEREYKQLYSIYANTDNKEKDVINVINEGMSRGILKPDYQTYLALAQSYYYTDQITQAI
FT                   ENWKKAAPLSNDGETYLNLAKVLFQHGRLAEAQQAAQQALSKGIKKPEEAKKMINIK"
FT   sig_peptide     8950..9039
FT                   /locus_tag="Xfasm12_0008"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.778 at
FT                   residue 30"
FT   gene            10589..11254
FT                   /locus_tag="Xfasm12_0009"
FT   CDS_pept        10589..11254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0009"
FT                   /product="TonB protein"
FT                   /note="KEGG: xft:PD0009 TonB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11062"
FT                   /protein_id="ACA11062.1"
FT                   /translation="MSEELIVHRYEQEDVSDALNWPRILGIAFVIALHLAALMLLLIPA
FT                   ASLKAPPEKQRLAAVTIVDSPPPPPPPPPQEEEKKPAPPIKTLAPPRPAPVPPPPQPPV
FT                   VDVPQPRPSDVVVPPAPPAPPTPPSDISASVDISSKKMNPPKYPPTALRAGIQGEVVLI
FT                   IDVDADGNVTNVSVEKSSRNRDLDRAAIDAASKWKFNPSVINGKKSAGRVRVPVNFSL"
FT   gene            11350..12114
FT                   /locus_tag="Xfasm12_0010"
FT   CDS_pept        11350..12114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0010"
FT                   /product="biopolymer transport ExbB protein"
FT                   /note="KEGG: xft:PD0010 biopolymer transport ExbB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11063"
FT                   /protein_id="ACA11063.1"
FT                   /translation="MLQDLFIVATAGGSNPSNALSKMGVWHLIGEMTASPAEFAVSWAV
FT                   LIILVTMSSLSWYWTVINILRALRLKGAGYLVINAFWKAKTPQEAISAMEKQSASEPFS
FT                   KIALDASQAAAHHQRTEGGNAMGLGERLSLSEFVDRALRQAVTRESSKLQSGMTLLATV
FT                   GATAPFVGLLGTVWGIYNALITIGATGSASIDAVAGPVGEALIMTAIGLFVAIPAVFAF
FT                   NFFSKINSSIIAKFDTFAHDLHDFFATGSRVR"
FT   sig_peptide     11350..11409
FT                   /locus_tag="Xfasm12_0010"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.694) with cleavage site probability 0.648 at
FT                   residue 20"
FT   gene            12171..12590
FT                   /locus_tag="Xfasm12_0011"
FT   CDS_pept        12171..12590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0011"
FT                   /product="biopolymer transport ExbD1 protein"
FT                   /note="KEGG: xft:PD0011 biopolymer transport ExbD1 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11064"
FT                   /protein_id="ACA11064.1"
FT                   /translation="MAFSNGNSNGPMADINVTPLVDVMLVLLIIFIITAPLMSHKVKVE
FT                   LPQANLVNKNNEEKRSNPITLAVKEDGSLYWNDIQISESELEQRFSLAAQQTPQPPLNL
FT                   RGDRTTKMSKISKIIKLAQGQGIMDIGFIATKEKE"
FT   gene            12597..13007
FT                   /locus_tag="Xfasm12_0012"
FT   CDS_pept        12597..13007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0012"
FT                   /product="biopolymer transport ExbD2 protein"
FT                   /note="KEGG: xft:PD0012 biopolymer transport ExbD2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11065"
FT                   /protein_id="ACA11065.1"
FT                   /translation="MAFSSGSNRGPMADINVTPLVDVMLVLLIIFIVTAPIMTYPIAVD
FT                   LPQRVLNPPPMDHEPPPPIQLKIDASNQIYWNNTLVAVSQLQQRMEEVVQKDPTNQPQL
FT                   QIDANPDSEYEVIAKVLAAAKNADMKKIGFHE"
FT   gene            13098..13241
FT                   /pseudo
FT                   /locus_tag="Xfasm12_0013"
FT   gene            complement(13400..13516)
FT                   /locus_tag="Xfasm12_0014"
FT   CDS_pept        complement(13400..13516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0014"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF0014 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11066"
FT                   /protein_id="ACA11066.1"
FT                   /translation="MSDVIKQHVDTSNLTPSNSVMPGVMSGMGITFLDSAIR"
FT   gene            13727..16114
FT                   /locus_tag="Xfasm12_0015"
FT   CDS_pept        13727..16114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0015"
FT                   /product="dipeptidyl-peptidase"
FT                   /note="KEGG: xft:PD0013 dipeptidyl-peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11067"
FT                   /protein_id="ACA11067.1"
FT                   /translation="MAALIMSRLLFLSLFLLASSVFAQTPSAPLTVEQIMANPDWIGPG
FT                   IRTAWWKWDSKEVQYELKRENSPVHEIYRQPLRSNVSQIVSNALLADVDAPHPVYDQQR
FT                   QRMLFVRHGDIFLRDLRKGVLIQLTRSNQSKDRPQFATDGSVIWRAGNDWYHWIPQGGV
FT                   AQLTDIHVGHDSDVTPKNDPLRDRQLERLATLRNDRAERQALKQQEHIWRAADATRATA
FT                   PVYLDEDVSMVDSSLSPDAKHLLLVTKAKNVDKGQIGKIPHYVTESGYEEFQDVRTRVG
FT                   RNMPAPHTLWLIDLKDGTARQLSFSSLPGINEDPLAALRKANRKDPFKGERPVRIETNA
FT                   ESNVPAIHWTQDGRNVAVDIRSIDNKDRWIAAVDLKQATLNVRHRLHDGAWINWDFNDF
FT                   GWLPDNRTLWLLSEESGYSHLYTIEETGIPKQRTFGHWEVSAPRLSADGRSVYFVCNPT
FT                   WPGGYEVCKLDLDSGHFDTLTALQGVEDFDLSPDGRQILVLYSGSYLPPQLAVISTNGG
FT                   QARVLTDTRTSTFKAKQWIQPEYVQIPSKHGSGVIWGKYYGPASLQPEKRYPIVMFVHG
FT                   AGYLQNVSARYTSYFREQMFHTLLVQKGYIVLDLDYRASAGHGRDWRTAIYRNMGHPEL
FT                   EDYLDGLDWLIAHKQGDQRRAGIYGGSYGGFMTYMAMFRAPGTFKAGAALRPVGDWMQY
FT                   NHEYTSNILNTPELDPDAYQRSSAINYAEALQGHLLILHGMIDDNVFFKDSVDMVQKLI
FT                   ELRKDNWEIVPYPLERHSFTHPDAWVDEYKRILKLFETQLKQ"
FT   sig_peptide     13727..13798
FT                   /locus_tag="Xfasm12_0015"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            16169..16711
FT                   /locus_tag="Xfasm12_0016"
FT   CDS_pept        16169..16711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0016"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0014 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11068"
FT                   /protein_id="ACA11068.1"
FT                   /translation="MSTPSSARTFVKVIAFISLCLGALSVLTSLLSIVRLELFPDQERG
FT                   TLQGLLGVPIPPRLSWVLSDTRELSLTNGALSLLFICVGCGLLYQREWARRGIMVLLLI
FT                   VTLVNFSVLPLMGVLFDTVMILLTPEMIVAPETTTLLHQARWTFLGVGVVIAMAVAVLN
FT                   GWMIWRFRVPEIRAQFH"
FT   sig_peptide     16169..16255
FT                   /locus_tag="Xfasm12_0016"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.936) with cleavage site probability 0.715 at
FT                   residue 29"
FT   gene            16940..17857
FT                   /locus_tag="Xfasm12_0017"
FT   CDS_pept        16940..17857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0017"
FT                   /product="Coproporphyrinogen oxidase"
FT                   /EC_number="1.3.3.3"
FT                   /note="KEGG: xft:PD0015 coproporphyrinogen III oxidase,
FT                   aerobic"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11069"
FT                   /db_xref="GOA:B0U1G5"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U1G5"
FT                   /protein_id="ACA11069.1"
FT                   /translation="MSDFDRVRDYLTALQDRICNVVETIDGQSHFHEDHWQRTEGGGGR
FT                   TRLLRDGAVFEQAAIGFSDVCGTHLPPSASVRRPELAGANWRACGVSLVFHPKNPFVPT
FT                   THLNVRYFRAEREGKQVAAWFGGGFDLTPFYPFDEDVVHWHRVARDLCAPFGDERYAAH
FT                   KRWCDEYFVLRHRNETRGVGGLFFDDLDKDFERDFDYQRAVGDGFLDAYFPIVTRRHDT
FT                   PYGDRERAFQLYRRGRYVEFNLLFDRGTLFGLQSGGRAESILISLPPLVRWEYGYHPLP
FT                   GSAEARLADYLLPRDWLEESRICE"
FT   gene            complement(18925..19077)
FT                   /pseudo
FT                   /locus_tag="Xfasm12_0018"
FT   gene            19292..19621
FT                   /pseudo
FT                   /locus_tag="Xfasm12_0019"
FT   gene            complement(20523..20599)
FT                   /locus_tag="Xfasm12_R0001"
FT                   /note="tRNA-Met3"
FT   tRNA            complement(20523..20599)
FT                   /locus_tag="Xfasm12_R0001"
FT                   /product="tRNA-Met"
FT   gene            20634..20924
FT                   /pseudo
FT                   /locus_tag="Xfasm12_0020"
FT   gene            complement(21409..22572)
FT                   /locus_tag="Xfasm12_0021"
FT   CDS_pept        complement(21409..22572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0021"
FT                   /product="3-deoxy-7-phosphoheptulonate synthase"
FT                   /EC_number="2.5.1.54"
FT                   /note="KEGG: xfa:XF0026 phospho-2-dehydro-3-deoxyheptonate
FT                   aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11070"
FT                   /protein_id="ACA11070.1"
FT                   /translation="MCLAAFLLSPPLGLCLNVLRLHPMPPFTDDLRIRKIEPLTPPNKL
FT                   LLQLPCDEQASLTVATSRNALHDILHGHNDRLAVVIGPCSIHDPIAAIDYAQRLHPLRE
FT                   MYKDALEIVMRVYFQKPRTTIGWKGLVNDPDLDGSFQINKGLHIARNLLRDINHLGLPA
FT                   GVEFLDTISPQYLADLVAWGAIGARTTESQIHREMASGLSCPIGFKNSTSGDVKIAADA
FT                   IKAASHPHHFLSVTKTGVAAVVATQGNPDCHVILRGGKVPNYDAINVEAASQTLLKSKL
FT                   PVRLMIDASHANSGKNPNNQPKVIENIVEQLKAGERRIIGVMIESHLVGGRQELVLGNT
FT                   LTYGQSITDACIDWDTSVAMLEQLAQAVRVRQTLPTTATANKTSKTQ"
FT   gene            complement(22575..22712)
FT                   /pseudo
FT                   /locus_tag="Xfasm12_0022"
FT   gene            23734..24237
FT                   /locus_tag="Xfasm12_0023"
FT   CDS_pept        23734..24237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0023"
FT                   /product="pre-pilin like leader sequence"
FT                   /note="KEGG: xft:PD0019 pre-pilin like leader sequence"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11071"
FT                   /protein_id="ACA11071.1"
FT                   /translation="MVTIAILAILAGLAYPSFMNLINGERLTSSANELVASLQLARTEA
FT                   IRLGSPVTVCRSDDGSTCRTGGPWQRWVTVAKGRNNIIKVNDAIPNVTVQGSPRITSLS
FT                   DQIVFRPDGLARDVSGALLTAQLSLCMPNTRMANNLRFVSINGGSRIRVSPGATAPCSQ
FT                   PNDE"
FT   gene            24247..24726
FT                   /locus_tag="Xfasm12_0024"
FT   CDS_pept        24247..24726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0024"
FT                   /product="pre-pilin leader sequence"
FT                   /note="KEGG: xft:PD0020 pre-pilin leader sequence"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11072"
FT                   /protein_id="ACA11072.1"
FT                   /translation="MSIASKKAVAGVSLIEVLISVFILAVGMLGVAAMQVMALRNNDSA
FT                   LQRSHAVIQSYAILEAMRANRSEAIKGSYNTNGMICTAPQANNLVDVDRRDWISNLKAA
FT                   LGDSEHTCGSIFCDDANTCTIQVQWDETRASDKRSPAGQLVSSTQTQVFEVSSKL"
FT   gene            24723..25673
FT                   /locus_tag="Xfasm12_0025"
FT   CDS_pept        24723..25673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0025"
FT                   /product="type IV pilus assembly protein PilW"
FT                   /note="KEGG: xft:PD0021 type IV pilus assembly protein
FT                   PilW"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11073"
FT                   /protein_id="ACA11073.1"
FT                   /translation="MNHQFALKRLQRGFNLIELMITLVLGLLVVLAAISMFISSRRLYT
FT                   TTENMSRLQESARVAFELMARDLREAGGNSCDNTLPVVNVLRDSATEWSRNWNVPLIGF
FT                   DGGTLTQGVRGTDAIRILSAGTSGGTVKSHNPVDNTMTLYTQAADLHTNGIMMVCDPQQ
FT                   LSIFQASNVTGTTVSYGNGALNSCTHFGRLPSVCNANPPNYQHQANSIITELRAVQWYV
FT                   RTNERGGTSLFQEIRGPNGAIALGEVAESISAMQITYLLRGAISYVSAAQVSEWKNVIA
FT                   VRVALTIQTTDRVGVDNNVVSRTLTSVTSLRNRNL"
FT   sig_peptide     24723..24860
FT                   /locus_tag="Xfasm12_0025"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.801) with cleavage site probability 0.360 at
FT                   residue 46"
FT   gene            25670..26257
FT                   /locus_tag="Xfasm12_0026"
FT   CDS_pept        25670..26257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0026"
FT                   /product="PilX protein"
FT                   /note="KEGG: xft:PD0022 PilX protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11074"
FT                   /protein_id="ACA11074.1"
FT                   /translation="MRMTHLGPYRQRGISLIVILMLLLVMTLIGLAVLRTTLLQERMSA
FT                   NLRDRSLSFQTAEAALRDAEEFINTENAKGNVVGFNCTAAGSQCPAIPENTYTGNISSG
FT                   CSSGAENCWVNATGSQAVTRMIGQYYIQYLGERAGVNQESLGAGSSASQSQYGAAEEIS
FT                   AEKYYRIIARSSDPSRNDERAFVVLQTAVIIN"
FT   sig_peptide     25670..25768
FT                   /locus_tag="Xfasm12_0026"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.923) with cleavage site probability 0.823 at
FT                   residue 33"
FT   gene            26281..29928
FT                   /locus_tag="Xfasm12_0027"
FT   CDS_pept        26281..29928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0027"
FT                   /product="PilY1-like protein"
FT                   /note="KEGG: xft:PD0023 PilY1 protein homolog"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11075"
FT                   /protein_id="ACA11075.1"
FT                   /translation="MKKTVFNAALNRVAAILIGTLVGISGAVHASVDISSSPLHGGKDV
FT                   PGNLAILASVEFPTLISVANLADTYTPGVRYVGYFDSNKCYKYHYSSQESDRYFYPVAS
FT                   PRPQANYGCNTTGGVWAGNFLNWAATQTIDPFRSALTGGYRVRDTVSETILEKAVMDRD
FT                   SQENFPRRNVAGRNVLATLLPTQWNNFRIRIDGLGNRMRFTQFSSLWTDPLNTEGQPYD
FT                   SSRHPLNSNDRGVYEVSVRVKVCDPSAGLESNCVAYPRGSYKPEGLIQEYSKRIRYSVF
FT                   GYKNDHSYLIDGGVLRARQKFVGPQTHYPEQGKKTNPHAEWDPQTGILYDNPDPEDAAA
FT                   TTRRVGRTIANSGVINYLNKSGQMDTGRISKIYDPVSELYYTAYRYFKRLGNVPEYSVL
FT                   TGSVNEKYQQSDAFPVITDWDDPIRYACQSNVVLGIGDTHTNQDKNLPGNTNTMEEPSK
FT                   PQAVRNDRSIDVVKRMAQIFQMEGMRQQDAMTSAVAPKFNFHRYNSAYIAALAYDAHTK
FT                   DMRPDLEGDQLFTTHWVDVVEAGDYKKPVSTNQYWLAAKYGGFQVPAGYDPDKTVNPLS
FT                   EATWWTNGEYVNGDPNAKRADNFYVAADAEKMVASLKQAFSRIVAEIKGAGTGLSSNSA
FT                   RLETGAVTYQAQFFSGTWRGDLIAYHVDKVTGALTPFWNANFPAWEQRVIKFANATTLQ
FT                   DFTKKNLGQTALASASAQQINYLRGDRSQEGNVPGKLRIRSGIMGDIVNSQPLYVGAPN
FT                   GRLYTTANFTGASAYAAFAAQQANRVPVVYVGANDGMLHAFDANTGKEIFAFVPRAAMP
FT                   KLLEYTDQNYVHQYYVDGELTAADIYDTKLGWRSVLVGTLGRGGKGLFALDVTDPSNIR
FT                   LLWDKTSADIGGLGNTLSKPMIVQTSDGTWSVLLGNGPNSTADNAQLIVMNLLTGHAAQ
FT                   VPVSKTSNNGLSGVFPWSSQSNGITDRVYAGDLLGTLWRFTFSDNAWKVVPLFTATYQG
FT                   KAQPISATPLGAIERSTGRMWIFFGTGRVLSSHDMDNKEVQSWYGLIDQGTTISGRTGL
FT                   SQVQIVDEGVVNGYAVRTVSDPKNIGTDGWYMDLISPKSGKQGERMIVSNMFRGAALIG
FT                   TTRIPDNSDICKLSGSGFVMAINPFTGGRLGQWFFDLNTGGGSGGSGGALNGNPVSGVG
FT                   VSSAPNSPVFTGNIMQIGADDGTVTSLKTPSSGGLNINRVSWREILRTE"
FT   sig_peptide     26281..26373
FT                   /locus_tag="Xfasm12_0027"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 31"
FT   gene            29928..30350
FT                   /locus_tag="Xfasm12_0028"
FT   CDS_pept        29928..30350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0028"
FT                   /product="PilE protein"
FT                   /note="KEGG: xfa:XF0033 PilE protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11076"
FT                   /protein_id="ACA11076.1"
FT                   /translation="MMFVNDVTSMIKNKKQNGFTLIEVMIVVVIVAILAAVAMTSYQGS
FT                   ILRTRRSAAQACLQQQAQFIERYYTTHMTYLGVENSAPTCDPSANLDNFYRFTVAAQAS
FT                   TFMLTADPQGAQAGDHCGRLTLSNTGERTPRVDGCW"
FT   gene            complement(30789..31523)
FT                   /locus_tag="Xfasm12_0029"
FT   CDS_pept        complement(30789..31523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0029"
FT                   /product="Orotidine-5'-phosphate decarboxylase"
FT                   /EC_number="4.1.1.23"
FT                   /note="KEGG: xft:PD0025 orotidine 5'-phosphate
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11077"
FT                   /db_xref="GOA:B0U1D6"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U1D6"
FT                   /protein_id="ACA11077.1"
FT                   /translation="MMNHTPLLLGIRERLIFALDVPSRTQALEWIDQLGDAISFYKIGM
FT                   ELLASGEYFQVLDDLASRGKRVFVDLKFFDIPATVAGVIRRLSQWPISYCTIHGWHAPM
FT                   MQAATEANTSNMHLLAVTVLTSMTREDLAKMGINREPVDVVVERALAAHMAGMSGVIAS
FT                   GQEAAAIRRAVGSGFSIVCPGIRTNHVPHNDQQRTIGIKAAFANGADAIVVGRPIRMAQ
FT                   DPQAAAEAMQTEIMTALTEPST"
FT   gene            32648..33850
FT                   /locus_tag="Xfasm12_0030"
FT   CDS_pept        32648..33850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0030"
FT                   /product="aspartate aminotranferase"
FT                   /note="KEGG: xft:PD0026 aspartate aminotranferase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11078"
FT                   /protein_id="ACA11078.1"
FT                   /translation="MPLFTDVELVPGDPILSLNDAYNADTRTNKVNLGIGIYCDESGCI
FT                   PLLRAVQQVEEQLAKHPKPRGYLPIDGLPAYIKATQQLLFGVDSLLLTAGRVATSQTVG
FT                   GSGALRVAAEVLKQVLPHATVAISRPSWENHRALFTAAGFKIEDYTYFDTLGHAVDFTG
FT                   MVADLAKLQPKTVVLLHGCCHNPTGADLSRDQWKQLVALFQERQLLPCIDLAYQGFNQG
FT                   IDADAYAIRLLAEEGISNYVVANSYSKSFSLYGERVGGLSIVASNTEQAQAIQSQVKRI
FT                   IRTIYSSPPAHGAYLVAGVLNSHELRTLWEQELTQMRERIHGLRAGLVARLKALGAPEF
FT                   DFIQRQAGMFSYSGLSKIQVDRLRDEFGIYAVSSGRICVAALSQHKLEYVAQAVVKVHQ
FT                   G"
FT   gene            33879..34064
FT                   /locus_tag="Xfasm12_0031"
FT   CDS_pept        33879..34064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0031"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF0037 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11079"
FT                   /protein_id="ACA11079.1"
FT                   /translation="MPASSRIRVRHRRATSWMVSGEAPLSVGVSINVVVLYCWQHRSFD
FT                   FAAKVPLSDDYVVRRT"
FT   gene            complement(34385..34540)
FT                   /locus_tag="Xfasm12_0032"
FT   CDS_pept        complement(34385..34540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0032"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF0038 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11080"
FT                   /protein_id="ACA11080.1"
FT                   /translation="MMLSGTCTATSSRITPLPLQRNRTHQHITDAIDWKHTAAQRKAIS
FT                   PHFIVT"
FT   gene            complement(34733..35137)
FT                   /locus_tag="Xfasm12_0033"
FT   CDS_pept        complement(34733..35137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0033"
FT                   /product="large-conductance mechanosensitive channel"
FT                   /note="KEGG: xft:PD0027 large-conductance mechanosensitive
FT                   channel"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11081"
FT                   /db_xref="GOA:B0U1E0"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR019823"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U1E0"
FT                   /protein_id="ACA11081.1"
FT                   /translation="MSFIREFKEFVMRGNVIDLAVAVVIGAAFGKIVTALVDKIISPLI
FT                   GVMVGGIDFSKLSLTLKAATVDTAGKEVPAVVIGYGDFLNTILQFIIIAFAIFIIVKMI
FT                   NKVTNKQPLPPETPSEDVLLLREIRDSLKK"
FT   gene            complement(35457..35678)
FT                   /locus_tag="Xfasm12_0034"
FT   CDS_pept        complement(35457..35678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0034"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF0040 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11082"
FT                   /protein_id="ACA11082.1"
FT                   /translation="MFRRCRAATHHVVLKELNERTFLNTWLQNITKIPMTARCQNTHGN
FT                   KQTILSQNSNGKIKNYQRAYYSDNRAEK"
FT   gene            35820..36080
FT                   /locus_tag="Xfasm12_0035"
FT   CDS_pept        35820..36080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0035"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF0041 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11083"
FT                   /protein_id="ACA11083.1"
FT                   /translation="MQRCWDRSWQRYGQFYATVWFLCVVAVNVPKRGAVIELIGQVDCS
FT                   NRVALAIGLFESGNARSFFLDGLGLLPMAEYGIVWFADDVL"
FT   gene            36102..37361
FT                   /locus_tag="Xfasm12_0036"
FT   CDS_pept        36102..37361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0036"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0030 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11084"
FT                   /protein_id="ACA11084.1"
FT                   /translation="MTLTAIQLIGALLFAVAILHTFATKFFERLSHTHPTHAGLWHLLG
FT                   EVEVVFGFWALVLIVAMCVTDGAQAAIQYIDSRNFTEPMFVFAIIVVAGTRPILHTVLA
FT                   GVHLLARWVPLPGRMGFYFTVLTFIPLLGSFITEPAAMTLAALMLSQGVFANKIPPYLK
FT                   YATLGVLLVNISIGGTLTAFGAPPVLMVAAKWQWDNSFMLQTFGWKAVLAIFSNALGVT
FT                   LLLRNVLRHLPETQGDAVGEVVPVILRVIHLLLLIGIIWFAHYPVVFIGLFLFFLGVAH
FT                   AYEGYQDRLILREGLLVALFLAGLVILGGQQQWWLQPVLLGMTSDQVFFGAAILTAFTD
FT                   NAALTYLGSLVAGLSDEFKYALVAGAVTGGGLTIMANAPNPAGIAILRVHFKEASVHPL
FT                   GLLLAAVPPTVIAALAFRYL"
FT   gene            37545..38426
FT                   /locus_tag="Xfasm12_0037"
FT   CDS_pept        37545..38426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0037"
FT                   /product="transformation competence-related protein"
FT                   /note="KEGG: xft:PD0031 transformation competence-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11085"
FT                   /protein_id="ACA11085.1"
FT                   /translation="MNYSHAFHAGNHADVLKHIVLLALLDGLVRKETPFFVLDSHAGRG
FT                   RYLLSARESRNTSEAESGVMRLIARPQRLEVIKRYVDVVQADNVSQTRAASTPMHISRY
FT                   PGSSLLAAQVCRAQDRMVFCELHPKEAAALNALFVHDPRVRVHAGDGYAAVRAFLPPKV
FT                   GTQRIGRGLVFIDPPYEAQDAEYPLVLGALRETLTRWPQAICAVWYPIKQRRRLQPFFR
FT                   KAGGLPVRSVLIAELLVRPDDSPLRLNGSGMLLLNAPWQFDQLLAPALPVLKTQLGESG
FT                   ARTRLEWLKVPQ"
FT   gene            39023..39562
FT                   /locus_tag="Xfasm12_0038"
FT   CDS_pept        39023..39562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0038"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF0044 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11086"
FT                   /protein_id="ACA11086.1"
FT                   /translation="MSVRNRMPPWHENFKLPNGHVLLLRPVRPEDVEPLQGVFALMGPQ
FT                   EIRERFAPSATGSSERFQQLTNPNAKREIVLVAAEQLPPGEAMIAALARAAIVPNSRHA
FT                   EYIILVSSFVSGQGLGRQLLRKLVKWARGKYLDHLYGDILERNRPMLELAESLGFQRES
FT                   HPESPDLVRMTLKLYG"
FT   gene            39630..43211
FT                   /locus_tag="Xfasm12_0039"
FT   CDS_pept        39630..43211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0039"
FT                   /product="transcription-repair coupling factor"
FT                   /note="KEGG: xft:PD0033 transcription-repair coupling
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11087"
FT                   /protein_id="ACA11087.1"
FT                   /translation="MSPFSFPSPLLPRAGQLRAFWRAPVSPTALAWHIACAAEAHRGPL
FT                   LLVTHDNHSAHQVEVDLQTLLAHCPGLPVIGFPDWETLPYDQFSPDPNIVSQRLATLHR
FT                   LPSLARGIVVVPVQTLMQQLAPLSYIVGGSFDFKVGQRLILDAEKQRLERAGYRNVPQV
FT                   MDPGDFTVRGGLLDVYPMGTDVPLRIELLDEEIDSIRTFDPESQCSLNQVDVVHMLPGR
FT                   EVPLDPAVLERVLVRLRERFDLDTRRSALYQDLKAGLAPSGIEYYLPLFFESGRGGKHA
FT                   TATLFDYLSADLLVLTAPGVSNAADTFWGQTMQRYEQRRHDIERPLLPPQELYQSPDAL
FT                   RERLNRLPRIEVWSAEHAHIDKAEVLDEQPLPVATKDVSVGQALRTFLADYAGRVLIAA
FT                   TSPGRREVLLELLATADLQPEVLPDFRSFFLSVPEVSDLGEANRDSGNGVSGSNDAAAF
FT                   HVIASQGGSLPTFAITVAPLEDGFSLSVPPIAVLTERQLFPERVNLVRRSRRVGREPEA
FT                   IIRDLGELSEGAPIVHEDHGVGRYRKLITMNVSGMPGEFVEIEYAKGDRLYVPVAQLHL
FT                   ISRYSGASPETAPLHSLGGEQWSKAKRKAAEKVRDVAAELLEIQARRQARAGLALRIDR
FT                   TMYEPFAAGFPFEETPDQLAAIETTLRDLQSSQPMDRVVCGDVGFGKTEVAVRAAFAAA
FT                   SAGKQVAVLVPTTLLAEQHYRNFRDRFADYPIRVEVLSRFKSTKEIKAELQKVSEGTMD
FT                   VIVGTHRLLQPDVKFKDLGLVIVDEEQRFGVRQKEALKSLRANVHLLTLTATPIPRTLN
FT                   MAMAGLRDLSIIATPPLNRLAVQTFITPWDNALLHEAFQRELARGGQLYFLHNDVESIG
FT                   RMQRDLAQLVPEARIGIAHGQMPERELERVMLDFQKQHFNVLLSTTIIESGIDIPNANT
FT                   IIINRADRFGLAQLHQLRGRVGRSHHRAYAYLVVPDRRSMTADAEKRLEAIASMDELGA
FT                   GFTLATHDLEIRGAGELLGEDQSGQMAEVGFSLYTELLERAVRSIKQGKLPDLDAGQEE
FT                   RGAEVDLHIPTLIPEDYLPDVHTRLTLYKRISTARDSNALRELNVEMIDRFGVLPETAK
FT                   HLFAIAELKLQATALGISKLELGENGGRIIFGAKPIIDPMAVIQLVQKQSKLYSMEGPS
FT                   KLKLKLPLPEPADRFNAVRGLLAALTP"
FT   gene            43545..44279
FT                   /locus_tag="Xfasm12_0040"
FT   CDS_pept        43545..44279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0040"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /EC_number="4.2.1.10"
FT                   /note="KEGG: xft:PD0034 catabolic dehydroquinase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11088"
FT                   /protein_id="ACA11088.1"
FT                   /translation="MHAILPCFGEIPESINDYREYDCEGHRKHSRWIDTIGASFCSEDS
FT                   VSDASLEGSTASSISGFRTYIPWPIWTLSLSSRRLAALRLLGYRVPLDSNSMAHLLLLH
FT                   GPNLNLLGTREPEIYGRITLPQIDAALAERAAAAGHGLSSLQSNAEHVLIERIHATRED
FT                   GTAFILINPGAFTHTSVALRDALLAVALPFVEIHLSNPHTREPFRHHSYLADKALGVVC
FT                   GFGVDSYRIALEGVIARLGSDV"
FT   gene            44343..44828
FT                   /locus_tag="Xfasm12_0041"
FT   CDS_pept        44343..44828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0041"
FT                   /product="biotin carboxyl carrier protein"
FT                   /note="KEGG: xft:PD0035 biotin carboxyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11089"
FT                   /protein_id="ACA11089.1"
FT                   /translation="MDLRKIKKLIDLLEESNLSEIEIKEGEESVRLARTSNAGMNIMAP
FT                   TMPWVASVANVPAAPAMPMISPTDASTGGIHKDDGALPEGHVLRAPMVGTFYTSPAPDK
FT                   PVFVSVGQTIKQGDTLAIIEAMKMFNPIEADVAGTVVAILGENGQPVEFDQPLFVIR"
FT   gene            44886..46253
FT                   /locus_tag="Xfasm12_0042"
FT   CDS_pept        44886..46253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0042"
FT                   /product="biotin carboxylase"
FT                   /note="KEGG: xft:PD0036 biotin carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11090"
FT                   /protein_id="ACA11090.1"
FT                   /translation="MLDKVVIANRGEIALRILRACHTLGIRTVAVHSTVDRNLKHVAMA
FT                   DESVCIGPAPSAESYLNIPALIAAAEVTDAQAIHPGYGFLSENASFAERVEQSGFIFIG
FT                   PRAETIRLMGDKVQAIHAMKAAGVPCVPGSDGPLGDDIVANVKIAREIGYPVIIKAAGG
FT                   GGGRGMRVVHTEVGLKAAIETTQCEAKAAFGNGQVYMEKFLENPRHVEIQVLADGQGNA
FT                   IHLGERDCSMQRRHQKVVEEAPAPGITEALRNEIGQVCVDACIRIGYRGAGTFEFLFEN
FT                   GRFYFIEMNTRIQVEHPVTERITGIDLVCEQLRIAAGQPLSIKQSDVVLRGHAIECRIN
FT                   AEDAETFLPNPGLITAFHPPGGPGVRMDTHIYSGYKVPPNYDSMIGKLIVHGPDRETAI
FT                   ARMHLALSEMVVDGIKTNIPLQQRIMCDKGFQSGGQNIHYLEKCLAERKNQTIGRT"
FT   gene            complement(46435..48606)
FT                   /locus_tag="Xfasm12_0043"
FT   CDS_pept        complement(46435..48606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0043"
FT                   /product="DNA helicase II"
FT                   /note="KEGG: xft:PD0037 DNA helicase II"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11091"
FT                   /protein_id="ACA11091.1"
FT                   /translation="MLDHLNQNQREAVAAAPGHYLILAGAGSGKTRVLTHRIVWLNEVN
FT                   GVPTHSMMAVTFTNKAAGEIQQRIDLQLRHGKRGMWIGTFHSLAHRLLRLHWNDATLPE
FT                   NFQVIDSDDQLRLVKRVIQSLGLNDTLFPPKQAMWWINTQKDEGRRPEHIQPESHDDWI
FT                   ETQRRIYTEYQERCNRAGLVDFSELLLRAHELLRDTPALLTHYRSRFREILIDEFQDTN
FT                   AIQYAFVRVLANDTGHIFAVGDDDQAIYGWRGAKVEHVQHFLKDFPNVQTIRLEQNYRS
FT                   SANILDAANAIIAHNPDRIGKRLWTESGVGESIDLYAAYNEIDEARYIVERARQWVRDG
FT                   GSYGEIAVLYRSNAQSRAFEEVLQSEHIPYRVYGGMRFFERAEIKDALAYLRLLANRSD
FT                   DAAFERVVNTPVRGIGERTLDEVRHLARTQGLALWDAAMACTQSTTLTARARNALASFL
FT                   NLLQQLAVETNQMGLAERIDHMLQRSELRQHWKKEARGSLDAESRQENLDELVSVASRF
FT                   VLPQNDEDTPIMTELDAFLSYACLESGDGQVQAGEEGVQLMTLHSAKGLEFPLVFLVGL
FT                   ENGLFPSARSLDEHDRLEEERRLAYVGITRARHKLILSYAQARRIHGKDNYNVPSRFLR
FT                   EIPQNLLHEVRPTIQVSHQTPLGAVQRPAHDERDAAPIKLGVNVMHPTFGCGVVVDYEG
FT                   SGAHTRVQIKFDDAGTKWLVMAYAKLSVV"
FT   gene            49832..51025
FT                   /locus_tag="Xfasm12_0044"
FT   CDS_pept        49832..51025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0044"
FT                   /product="flavohemoprotein"
FT                   /note="KEGG: xft:PD0038 flavohemoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11092"
FT                   /protein_id="ACA11092.1"
FT                   /translation="MSASFSPHTITLIKSTVPLLAEHGTTIIEAMYHRLFEDPQIEALF
FT                   NQANQKNGTQIHALAGAILAYARNIDNPGVLASAIERISQKHVGYAIHPEHYPHVATAL
FT                   LGAIKQVLGDVATSEVLEAWGEAYWFIANLLKDREAVIREGIMTKNGGWIHWRRFVISK
FT                   RIPESETITSFMLHPEDGGPVVPHQAGQYLTFRFDAAGMPGMKRNYSISCGPNSDYYRI
FT                   TVKREHGTGASAFLHDQAKVGTIIECTPPVGDFFLPSVIERPIVLLSGGVGLTPMVSMM
FT                   EQIAEAHPDAQVWYVHGTQNRETHAMDAHIRALVSRHKHMKATTFYTQRSEADDAEAGF
FT                   ITIDWLRANTPFQKADFYLCGPRPFLRTFVRDLIGAGVPAAQVHYEFFGPMDEEMAA"
FT   gene            52753..53064
FT                   /locus_tag="Xfasm12_0045"
FT   CDS_pept        52753..53064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0045"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF0059 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11093"
FT                   /protein_id="ACA11093.1"
FT                   /translation="MATLCRFDREIAMHWVLLLLAIAAMGVAFFIPQMWLLLVTLFGAL
FT                   GLLLFWMCVQYSKEYRRRNHDIRSMVDEVELQRLQELAAVRRLSPVVGGNDDVGGINK"
FT   gene            53061..53843
FT                   /locus_tag="Xfasm12_0046"
FT   CDS_pept        53061..53843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0046"
FT                   /product="pyridoxal phosphate biosynthetic protein"
FT                   /note="KEGG: xft:PD0040 pyridoxal phosphate biosynthetic
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11094"
FT                   /db_xref="GOA:B0U2A9"
FT                   /db_xref="InterPro:IPR004569"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036130"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U2A9"
FT                   /protein_id="ACA11094.1"
FT                   /translation="MSQRTRLSVNVNKIAVLRNSRGHGAPDVIRAASACIDAGAHGITV
FT                   HPRPDARHIRHDDVIGLSTLTRARGVEFNIEGNPFAEPRAGYCGLLALCRETRPHQVTL
FT                   VPDGDQQITSDHGFDFAREGPGLRPLIDEIKQWGCRVSLFVDVNVTGLADAAIWGVDRI
FT                   ELYTGPYAEMHHAGCSDAVLREFATTARLAQDVGLGVNAGHDLSQTNLGVFLGAVPDVL
FT                   EVSIGHALISEALYEGLIPTVRRYLDILDSVNPAVSMR"
FT   gene            complement(54338..55417)
FT                   /locus_tag="Xfasm12_0047"
FT   CDS_pept        complement(54338..55417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0047"
FT                   /product="transcriptional repressor"
FT                   /note="KEGG: xft:PD0041 transcriptional repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11095"
FT                   /protein_id="ACA11095.1"
FT                   /translation="MLLLHTLFELDRATTMSLFGNKIKPTQEHNQLATVAFSGERIEEI
FT                   DPELIDLEKQMRSKDNPGFTVESLMELGNDMKRDGQHEPVILRKNSKKPGRYLMVAGER
FT                   RWLACKAVDIKLKAVIRELTDDQVRRVQRAENIQRENLTQLEIAVALRDDKERLGTLEK
FT                   VAAEWNKGINWVSERINFLEVVETNSLTSQAVTEGITADITAINDLYRLEKVNQTAAKT
FT                   IIDQAKVDPGINMRKTVREKLQNAKSTTNEKNAATDSRMQESKTDFQEGETHLTNISNQ
FT                   EKPTTVASAPLPPDAAQLVALAAKQMETLCTEVSALSKILHQRQDVISALGDVLQNVVQ
FT                   AQAALFRTRHVLASLANLK"
FT   gene            complement(55422..55718)
FT                   /pseudo
FT                   /locus_tag="Xfasm12_0048"
FT   gene            complement(56488..57213)
FT                   /locus_tag="Xfasm12_0049"
FT   CDS_pept        complement(56488..57213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0049"
FT                   /product="competence protein F"
FT                   /note="KEGG: xfa:XF0063 competence protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11096"
FT                   /protein_id="ACA11096.1"
FT                   /translation="MKDTVNSNHILTDTWCDRLLRWLLPSYCLACNEPGHQGKTLCATC
FT                   QLLLPRMENACLRCAAPLKELEGIHPTCGPCLYDPPPLETAHAAFLYHWPINKLISRFK
FT                   FHQDLACGHLLADNMAMAAQHWPRPQALVPVSLHHGRLRTRGYDQALELARHVGNRLQL
FT                   PCLPALRRVRATLPQSQLNANKRRSNLHNAFIPIHPLPTHVALVDDVMTTGTTLHAAAR
FT                   ALRHTGVTRIDAWICARVP"
FT   gene            57263..58288
FT                   /locus_tag="Xfasm12_0050"
FT   CDS_pept        57263..58288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0050"
FT                   /product="Biotin synthase"
FT                   /EC_number="2.8.1.6"
FT                   /note="KEGG: xfa:XF0064 biotin synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11097"
FT                   /db_xref="GOA:B0U2A0"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U2A0"
FT                   /protein_id="ACA11097.1"
FT                   /translation="MSSVIRYDWTAEELHALFDLSLPELLYRAASVHRQHFDPAEIQVS
FT                   TLLSVKTGGCPEDCSYCPQAQRYDTGVTAQKLMDVDAVVAKARQAKLAGASRFCMGAAW
FT                   RSPKDRDIPKIASMIREVKALGLETCATLGMLNTCQAQALKDAGLDYYNHNVDTSPDFY
FT                   DSVIHTRQYQDRLDTLAHVRDVGLKTCCGGIVGMGETRQHRVGLLLTLATLPAHPDSVP
FT                   VNLLVQVAGTPLHGTQTLDPFEFVRMIAVARITMPRSMVRLSAGRESMSDELQLLCFMA
FT                   GANSIFYGEKLLTTANPETERDQALFQRLGLRPMHLMENVSNQDQHHGNVHADIACKHV
FT                   V"
FT   gene            58663..59703
FT                   /locus_tag="Xfasm12_0051"
FT   CDS_pept        58663..59703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0051"
FT                   /product="lipoprotein"
FT                   /note="KEGG: xft:PD0044 lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11098"
FT                   /protein_id="ACA11098.1"
FT                   /translation="MCFTFRCSFLATIVVALLTACSSAPRSASRLSSVSQSSDISLPPL
FT                   RIGIALGGGAAKGFAHIGVLKMLEANGLAPSVVAGTSAGSVVGALYASGMDSFKIQTKA
FT                   VAMDESNIRDLRFFSGGLVQGQKLQNYVNELVGKRPIEKLNMPFGAIATRLEDGQRTMF
FT                   VRGNVGEAVRASCSIPGVFEPVTIGAYHYVDGGITSPVPVDAVRQLGADFVIAVDISSK
FT                   ATGKNPGGLVGTVNQSISIMGQHLGEAELKRANIVIHPKVLDIGSTDFDQRNAAILEGE
FT                   RATIAVIPEIREKLAQLQQQRIQAARKTANQSAIEAVESYRRCQNTRTRWEKLRGKEKD
FT                   CTKSSL"
FT   sig_peptide     58663..58749
FT                   /locus_tag="Xfasm12_0051"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.756 at
FT                   residue 29"
FT   gene            60249..60468
FT                   /pseudo
FT                   /locus_tag="Xfasm12_0052"
FT   gene            complement(60599..61498)
FT                   /locus_tag="Xfasm12_0053"
FT   CDS_pept        complement(60599..61498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0053"
FT                   /product="hydroxybenzoate octaprenyltransferase"
FT                   /note="KEGG: xft:PD0046 hydroxybenzoate
FT                   octaprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11099"
FT                   /db_xref="GOA:B0U2A2"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U2A2"
FT                   /protein_id="ACA11099.1"
FT                   /translation="MAYERFTSAITLLLHWRNRLDPYWKLARGDRPVGFLLLLWPTWWA
FT                   LWLAADGVPPWWTLCVFTTGIWLTRSAGCVINDYTDRWLDPHVERTCTRPLVTGTVSPR
FT                   NALLMFATLMLIAFGLVLTMNQLTVLLSVAGLFLAMTYPYLKRYTHLPQVYLGLAFGWG
FT                   IPMAFAAIQGKVPTLAWLLYIANILWTTAYDTWYAMVDRDDDIKMGAKSIAILFAELDL
FT                   VVQGVLYTLMLLTLCLVGLRATLSHTYWISLISAVALIGYQFIIARRREPTACFRAFMH
FT                   NNWVGMTIFAGIALATTH"
FT   gene            61610..61686
FT                   /locus_tag="Xfasm12_R0002"
FT                   /note="tRNA-Arg1"
FT   tRNA            61610..61686
FT                   /locus_tag="Xfasm12_R0002"
FT                   /product="tRNA-Arg"
FT   gene            complement(61718..61948)
FT                   /pseudo
FT                   /locus_tag="Xfasm12_0054"
FT   gene            65758..67295
FT                   /locus_tag="Xfasm12_R0003"
FT   rRNA            65758..67295
FT                   /locus_tag="Xfasm12_R0003"
FT                   /product="16S ribosomal RNA"
FT   gene            67402..67477
FT                   /locus_tag="Xfasm12_R0004"
FT                   /note="tRNA-Ala1"
FT   tRNA            67402..67477
FT                   /locus_tag="Xfasm12_R0004"
FT                   /product="tRNA-Ala"
FT   gene            67491..67567
FT                   /locus_tag="Xfasm12_R0005"
FT                   /note="tRNA-Ile1"
FT   tRNA            67491..67567
FT                   /locus_tag="Xfasm12_R0005"
FT                   /product="tRNA-Ile"
FT   gene            67761..70642
FT                   /locus_tag="Xfasm12_R0006"
FT   rRNA            67761..70642
FT                   /locus_tag="Xfasm12_R0006"
FT                   /product="23S ribosomal RNA"
FT   gene            70778..70891
FT                   /locus_tag="Xfasm12_R0007"
FT   rRNA            70778..70891
FT                   /locus_tag="Xfasm12_R0007"
FT                   /product="5S ribosomal RNA"
FT   gene            70998..71813
FT                   /locus_tag="Xfasm12_0055"
FT   CDS_pept        70998..71813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0055"
FT                   /product="DNA-formamidopyrimidine glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /note="KEGG: xft:PD0138 formamidopyrimidine DNA
FT                   glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11100"
FT                   /protein_id="ACA11100.1"
FT                   /translation="MPELPEVETTLRGLLPYLTNQLIYSLTLRRRTLRWDIPSHIESRL
FT                   PGHRITTVCRRAKYLLIDTNAGGSLIIHLGMSGTLRLLAPETPLRPHDHVDIMLNNRRV
FT                   LRFNDPRRFGCLLWQEDGQIHPLLQRLGCEPLSDSFNGDYLYQCSRARNVSVKTFLMDQ
FT                   RIVVGVGNIYAAESLFRAGISPLCEADKISLQRYRRLAEVVKDILLYAINRGGTTLRDF
FT                   LSPDGRPGYFKQELFVYGRQQQPCKQCGSLLRQTTIRQRTTVWCGHCQG"
FT   gene            complement(71948..72745)
FT                   /locus_tag="Xfasm12_0056"
FT   CDS_pept        complement(71948..72745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0056"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF0171 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11101"
FT                   /protein_id="ACA11101.1"
FT                   /translation="MLFCELLFNDISRRGEWRIPGLVGLLAHGGYHFLVVLGNAGAVDM
FT                   HFFSVLSMTFFVMSGLTILFSTHVGMGTVGVVVFPLAGLLLAVYHGYGHSPSPELGWRV
FT                   ELHACLALLGYATLGIAALLAMMLWFRERALRRRNVHHWRGALPPLTELEKLLFRTITF
FT                   GFILLTFTVFTGFLFVRDFLEQKLLHKSVLSVLSWVIFGGLLIGRWRYGWRGIKAVHWT
FT                   LTAMMFLVLAFFGSKLMIELMLRHQSSSVSPVRHASYGEQGLR"
FT   gene            72885..74252
FT                   /locus_tag="Xfasm12_0057"
FT   CDS_pept        72885..74252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0057"
FT                   /product="signal recognition particle protein"
FT                   /note="KEGG: xft:PD0055 signal recognition particle
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11102"
FT                   /protein_id="ACA11102.1"
FT                   /translation="MFESLTQRLSGTIERLRGRGRLTEENIREATREVRIALLEADVAL
FT                   SVVQALIERIKIRALGQEVLKSLTPGQALIKVVRDELAAVMGDSASELNLNVPAPAVIL
FT                   LAGLQGAGKTSMVGKLAKYLKEKRKKKVLVVSADVYRPAAIEQLRILSEQVNVLCFPSS
FT                   VGQNPVDIVRAAIADAKKSFVDVLLVDTAGRLAIDQGMMDEIKALHDTLVPVETLFVVD
FT                   SMTGQDAANTAKAFSEALPLTGVILTKTDGDARGGGALSVRYITGRPIKFVGTGEKVDD
FT                   LDVFHPDRAAKRILDMGDVLSLVEQVEQAVDQEKTAKLAAKVAKGKKFNLNDMKEQLEQ
FT                   MQNMGGINSLMDKLPGMGQIPDHLKQQVTGKEVPRMIAIINSMTQKERRNPALLNGSRR
FT                   VRIAKGSGLQPSDVNKLMKQYQQMEKMMSKLSGGGMKGLMRGMMGAMGGRGRLPFR"
FT   gene            74500..74901
FT                   /locus_tag="Xfasm12_0058"
FT   CDS_pept        74500..74901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0058"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xft:PD0056 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11103"
FT                   /protein_id="ACA11103.1"
FT                   /translation="MLHEAFAVEISDINTPAMLDYKVTDCSHSTFTTDVVKYQVISLYV
FT                   LLSELADYLSVSIMATLLLLLAGGNYMAVSSQSGIVDRLDRELLFDLPSNICKMAITHV
FT                   LPLESVPGAMWFHHGDSPAQHIYRLNPWP"
FT   gene            74985..75781
FT                   /pseudo
FT                   /locus_tag="Xfasm12_0059"
FT   gene            complement(76093..77157)
FT                   /locus_tag="Xfasm12_0060"
FT   CDS_pept        complement(76093..77157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0060"
FT                   /product="fimbrial adhesin precursor"
FT                   /note="KEGG: xft:PD0058 fimbrial adhesin precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11104"
FT                   /protein_id="ACA11104.1"
FT                   /translation="MSIVNTIGVTHISTYQQRTLKIIAACLTMLIAPHVQATCTIKQGI
FT                   VAQNIDFGAGRILIQPSLAIGDRIALLTHNINRVNKYATCVNNGIMYGTFTRSMTPVSG
FT                   MNKVYATDVAGVGIRLYRQAAQASNTYPHTLNINTRVGEQTILDLNEGYFQVELIKTAT
FT                   TTGSGPIASAGPFTTYYADGSGISRPILTSSLSGIGITIVTSTCQVDAGSKNIAVNFGS
FT                   VSSNTFKGLGSKGPERDFTINLICHGGNVAEADQGQVSVRIDGTQDSSGQSGVLAITSA
FT                   SDAASNVGIELVDLLTGSERQVVFGQAITLGRTTINASSTLSLPMRARYIQTQTGKVGP
FT                   GAAKGTATFTIEYQ"
FT   gene            77241..77446
FT                   /pseudo
FT                   /locus_tag="Xfasm12_0061"
FT   gene            complement(77728..78774)
FT                   /locus_tag="Xfasm12_0062"
FT   CDS_pept        complement(77728..78774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0062"
FT                   /product="fimbrial adhesin precursor"
FT                   /note="KEGG: xfa:XF0080 fimbrial adhesin precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11105"
FT                   /protein_id="ACA11105.1"
FT                   /translation="MSINNGFSATRTKKYQKRIWKVAAVCMGMLLVSNVQATCYMNADA
FT                   PSDNIQINLGRILIKPSLAIGDRITLWNYNVPAGPVFAICSFGGITYTSFARSMTAVSG
FT                   MDHTYQTDVPGVGIRVYTLRDNKVFYTPSQTNYNNRLTYVYQPAEIFEVELIKTATTTG
FT                   SGTIFSSGLLTSNYTDGTGPGRPRTTSTISGFVVTSTCEVDNGSRNIAVNFGTVPSNTF
FT                   NGLGSKGPEHDFSINLICQGGNVAEADQGLISVRIDATQDKSMLPGVLAITPATDTASN
FT                   VGIELVDVLNGNEHKIVFGQAIVLGRTPVNASSTLQLPMRGRYIQTQTGKVGPGTANGT
FT                   ATFTIEYQ"
FT   sig_peptide     complement(78661..78774)
FT                   /locus_tag="Xfasm12_0062"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.921 at
FT                   residue 38"
FT   gene            complement(78765..81470)
FT                   /locus_tag="Xfasm12_0063"
FT   CDS_pept        complement(78765..81470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0063"
FT                   /product="outer membrane usher protein precursor"
FT                   /note="KEGG: xfa:XF0081 outer membrane usher protein
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11106"
FT                   /protein_id="ACA11106.1"
FT                   /translation="MKKQEISQRRKVGSLQLSSVKFVTESEIDSNRKLMAPELDLTQIR
FT                   GRYFKQRVLVAAIASTCTLMMSRLACAETEPDNLGQRMLVAKADNTAPQRVAQTANFNN
FT                   SFLVGQARSVDLGMFSRGNPVIAGLYRADLYVNGQWKGRRDMEFRNTKDDKEAVTCMTL
FT                   AMLDELGIDTSALTDSAADMQACKTIDQWLPDAYARFDVATQRLDVSIPQAAMRRSARG
FT                   YVSPSLWDHGVNAGFIGYAFNWYGGRNANAINSRRRSDSAYLGINSGLNLGDWQFRHNS
FT                   SYSWHSNEGSLWQNISTYAQRAFPNTSSMLTVGDAYTSGELFDSIGFRGINLATDDRML
FT                   PDSLRGYAPIVRGIAQSNARVEIRQNGQLIYSTTVAPGAFVIDDLYPTGYGGDLQVTVY
FT                   ETDGRQQQFSVPYGSVPQMLRAGSQRYSLTAGKIRNNNLSHTPYLLEGTYQRGISNALT
FT                   AYAGSTISQRYIAAIAGAGVSTPVGAFSLDGTVARTKLRNDTFSGTSLRLSYSKLLSPT
FT                   NTNITLAAYRYSTSGFYGLQEAIMAMDYERRGLSTASIYRQRSQLQLTVSQQLGQYGSL
FT                   YLTGSARQYWNQRGNTIQYQGGYNVSYKGVSYGLSALRSQIPSMPSDTQMLFTVSVPLG
FT                   KANPVIVTSQIGSRDGRYDNSRVSLVGASGKDSALTYGIAASDARNSATMIDGNVQYRS
FT                   RYAALSGSYSHNRNYNQMSLGASGSIVLHSGVATLAPQRGDTMVIIEAPAAKGARVSNI
FT                   SGVRIDSRGYAVVPYVSPYRMNTITLDPEGTDPDVELETSSQLIAPYAGAISKVTFGTR
FT                   KGRALIVNARTPTGKALPFGAQVIDAEGQSVGLVAQGSLIYIRAKDPQGRLTIKWGDQA
FT                   AQQCRLEYQLPANEASTRPSSFTTLEAICR"
FT   gene            complement(81497..82297)
FT                   /locus_tag="Xfasm12_0064"
FT   CDS_pept        complement(81497..82297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0064"
FT                   /product="chaperone protein precursor"
FT                   /note="KEGG: xft:PD0061 chaperone protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11107"
FT                   /protein_id="ACA11107.1"
FT                   /translation="MVPPIMRTQQSKSIWVLALSTCLCAQSAFAGIIIAGTRVVYPAQS
FT                   RDVTVQVTNTGENPALLQTWMDDGDSKQTPDESKAPFLVTPPISRVEPGSGQALRLFFT
FT                   GTTTLPEDRESLFWLNVLEIPPTPLEHSDKNAPTSADKSDGQNYLQLAFRSRIKVFYRP
FT                   SKLKGTANEAPASLSWKVNSNGQLLVSNPTPYHVTLTRTEALDDKGRKETIDKIGVLLT
FT                   PGQEYTFKANKSDGLSSRWKSVSFTYINDYGGIKTLSSNLGSMP"
FT   sig_peptide     complement(82205..82297)
FT                   /locus_tag="Xfasm12_0064"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 31"
FT   gene            complement(82369..82923)
FT                   /locus_tag="Xfasm12_0065"
FT   CDS_pept        complement(82369..82923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0065"
FT                   /product="fimbrial subunit precursor"
FT                   /note="KEGG: xfa:XF0083 fimbrial subunit precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11108"
FT                   /protein_id="ACA11108.1"
FT                   /translation="MKIMKNFALSSIASAAILFCGAALAADGTITVNGRVTDRTCTING
FT                   GTPNFSVTLPTVSFGSLKAPGNTAARTPFTIELTNCTAGSTVATYFEPGPAVDINTSRL
FT                   INQAPTASAATNVQVQLLGSNGSVIPIKALGTTGAQDNSQWVAVNASGAASMHYYTEYY
FT                   ATGVSTAGNVVTNIQYTIIYQ"
FT   sig_peptide     complement(82846..82923)
FT                   /locus_tag="Xfasm12_0065"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 26"
FT   gene            83594..83758
FT                   /pseudo
FT                   /locus_tag="Xfasm12_0066"
FT   gene            complement(84543..85031)
FT                   /locus_tag="Xfasm12_0067"
FT   CDS_pept        complement(84543..85031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0067"
FT                   /product="competence/damage-inducible protein CinA
FT                   C-terminal domain"
FT                   /note="KEGG: xft:PD0063 competence/damage-inducible protein
FT                   CinA C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11109"
FT                   /protein_id="ACA11109.1"
FT                   /translation="MPTDQQIRNLSETLGKQLCMTHERLVTAESCTGGWIAKAITDVPG
FT                   SSAWFECGIVAYSYEAKQALLGVRPETLEIHGAVSRETVVEMVSGALVQSGASIAIAVT
FT                   GIAGPEGGSTGKPIGSVWISWKRRGGYANPQFFKFDGDRDAVRRETVLTALLGLSTLL"
FT   gene            complement(85118..86419)
FT                   /locus_tag="Xfasm12_0068"
FT   CDS_pept        complement(85118..86419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0068"
FT                   /product="alpha-ketoglutarate permease symporter"
FT                   /note="KEGG: xft:PD0064 alpha-ketoglutarate permease
FT                   symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11110"
FT                   /protein_id="ACA11110.1"
FT                   /translation="MSDSLSPALSHYTAEEKHHRIFAIIAVSSGNLVEWFDFYVYAFTA
FT                   LYFSSQFFPESNQTAQLLNTAAIFGAGFLMRPIGGWLFGRIADCYGRKRSLLISVMMMC
FT                   GGSMVIATLPTHHMIGAWAAFLLLLACLIQGLSVGGEYGSTATYMSEIALRGRRGFYSS
FT                   FQYVTLIGGQLLAVLTLVVLEALFTEVQMRTWGWRIPFMIGAIAAAVALLLRRTLNETQ
FT                   SEDNRHDTHAGSLSTLFREHHTAFLTVFGYTAGGSLIFYTFTTYIQKFLVNSSGLSKQT
FT                   ASLVMSGALFVYMCIQPLFGLLSDYIGRRNNMLLFGGLGVVCTVPILATLQRIHSPLPA
FT                   FILIVGALSIISFYTSISAIVKAEMFPAKVRALGVGFAYAVGNAIFGGSAEYIALGLKE
FT                   LRSRNGVLLVRGSDDGGRILGQFVPTTASHVPAS"
FT   gene            complement(86468..87820)
FT                   /locus_tag="Xfasm12_0069"
FT   CDS_pept        complement(86468..87820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0069"
FT                   /product="GTP-binding protein"
FT                   /note="KEGG: xft:PD0065 GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11111"
FT                   /protein_id="ACA11111.1"
FT                   /translation="MFDRSRKGEYALLIQPLTDHSAEDGALEEFADLTRSAGATVAGSL
FT                   AVRIHRPNPSTLISSGKLKEIKETADATGADLILINHSLSPVQERNLEKSLERRVIDRT
FT                   GLILDIFAQRACSHEGKLQVELAQLRHLATRLVRGWTHLERQRGGAIGLRGPGETQLET
FT                   DRRLLQKRVEQLQKRLSKVEVQRTQMRRARVRSEVPRIALVGYTNSGKSTLFNALTGAS
FT                   AYTADQLFATLDPKVRRIVLPGSSAMLADTVGFVRHLPHELVAAFRSTLSEAREADLLL
FT                   HVIDAADPLREERIDQVDEVLQAIGAGELPQLLVFNKIDCIEGAEVRQDAQDGIPDQAR
FT                   RERVWLSARHGHGVELLQQVLDHRLKMQNVQSELRLLPSEGRLRARLHELKGVREEQTD
FT                   EHGWLLKIDLSLAEIERLAASDYGIPLRALLQDHRDAWTPTLHSKYVSTEY"
FT   gene            complement(87835..88113)
FT                   /locus_tag="Xfasm12_0070"
FT   CDS_pept        complement(87835..88113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0070"
FT                   /product="host factor-I protein"
FT                   /note="KEGG: xft:PD0066 host factor-I protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11112"
FT                   /db_xref="GOA:B0U1E7"
FT                   /db_xref="InterPro:IPR005001"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U1E7"
FT                   /protein_id="ACA11112.1"
FT                   /translation="MAKGQSLQDPFLNALRRERVPVSVYLVNGIKLQGTIESFDQFVVL
FT                   LRNTVSQMVYKHAISTVVPARNVRVGPGGGYVHSGSDTLQINDDEVE"
FT   gene            complement(88217..89170)
FT                   /locus_tag="Xfasm12_0071"
FT   CDS_pept        complement(88217..89170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0071"
FT                   /product="tRNA isopentenyltransferase"
FT                   /EC_number="2.5.1.75"
FT                   /note="KEGG: xft:PD0067 tRNA
FT                   delta(2)-isopentenylpyrophosphate transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11113"
FT                   /db_xref="GOA:B0U1E8"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U1E8"
FT                   /protein_id="ACA11113.1"
FT                   /translation="MPADTRPAAIVLMGPTASGKSQLAIDIAKRWGGEVISVDSVLVYR
FT                   GLDIGTAKPNAAMRASVPHHLIDICEPWETYSAADFAHDARAAIDMIVRRGALPILTGG
FT                   TGLYFRALLAGLSDMPPAHPEIRAMIAAEAKRDSWATLHTRLAEVDAITAARIHATDPQ
FT                   RIQRALEVYLVSGRSMSDWQNQPPKQRLPLRVLKLVLAPTHRKVLHFRIAQRFKAMLDN
FT                   GLLAEVNALRTHPSIHAMARPLDLPAMRAVGYRQCWEHLDGMYTAEMLYQRSVAATRQL
FT                   AKRQLTWLRGELDALWFDPEHDQSRIEKVMEAFLNR"
FT   gene            complement(89170..90066)
FT                   /locus_tag="Xfasm12_0072"
FT   CDS_pept        complement(89170..90066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0072"
FT                   /product="Dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="KEGG: xft:PD0068 dihydropteroate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11114"
FT                   /protein_id="ACA11114.1"
FT                   /translation="MFDTIPTLHCAGRTLRLDSPLVMGILNVTPDSFSDGGLHDSVDAA
FT                   VAHGLRLIAEGADIIDIGGESTRPGAAPVPLEEELLRVVPVIKALTAYDKAVISVDTFK
FT                   PEVMRAAVAAGAGLINDIYALRTPGALEAAAELAVPVILMHMKGEPHSTQTPQYDHVVD
FT                   EVYRFLAERIFAAEIAGIERHRLLIDPGFSFNKTTEHNIALLAALERFTNLGIPLLAGL
FT                   SRKRSLGELTGRQLPIERVYASVAAHLIAVQRGALIVRVHDVAAMIDALKVWQAVSAAA
FT                   APATHTKTTVARSPNDD"
FT   gene            90167..90373
FT                   /locus_tag="Xfasm12_0073"
FT   CDS_pept        90167..90373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0073"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF0092 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11115"
FT                   /protein_id="ACA11115.1"
FT                   /translation="MAITVFNILVVCYATGEWIMAQQATGLESNTTVIAGAICGVTVYC
FT                   VSKTQPAQDDSRAGGYDGAVITV"
FT   gene            complement(90375..92312)
FT                   /locus_tag="Xfasm12_0074"
FT   CDS_pept        complement(90375..92312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0074"
FT                   /product="cell division protein"
FT                   /note="KEGG: xfa:XF0093 cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11116"
FT                   /protein_id="ACA11116.1"
FT                   /translation="MRMNDLTKNVLLWVVVAVVLMVVFQSFSPRIGGVIGNEPITYTQF
FT                   LNEVDSGRIKSVNYTDESGLTVNAIRFKRTDGSEGLVYGPRDDKLVDVLYTKNIEMTRQ
FT                   KPSSGPGFWSLVLNFLPVILIIGFWVFIMRQMQGGGAKGAMSFGKSRAKLQGDDQIKIT
FT                   FADVAGCDEAKEEVGELVDFLRDPTKFTKLGGKIPRGVLMVGPPGTGKTLLAKAIAGEA
FT                   KVPFFSISGSDFVEMFVGVGASRVRDMFEQAKKHAPCIIFIDEIDAVGRHRGAGLGGGH
FT                   DEREQTLNQLLVEMDGFEGGEGVIVIAATNRPDVLDPALLRPGRFDRQVVVALPDVKGR
FT                   EQILGVHMRKLLLANDVEPLVIARGTPGFSGADLANLCNEAALFAARSNEKEVRMNHFD
FT                   AARDKILMGTERRSMAMSEEEKTLTAYHEAGHAIVGRLVPEHDPVYKVTIIPRGRALGV
FT                   TMYLPEGDKYSINKVAIQSQLCSLYGGRVAEELIFGEDKVTTGASNDIERVTKMARNMV
FT                   TKWGLSDELGPVAYGEEEDEVFLGRSVTQHKNVSDETARKIDEVVRSILDKAYARTKRI
FT                   LADNLDKLHAMSQLLLQYETIDAPQIDAIMEGREPPPPVGWGKPSDNGSDDDMSKPRPL
FT                   TTIVVPAEQV"
FT   gene            complement(92359..93000)
FT                   /locus_tag="Xfasm12_0075"
FT   CDS_pept        complement(92359..93000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0075"
FT                   /product="cell division protein"
FT                   /note="KEGG: xfa:XF0094 cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11117"
FT                   /db_xref="GOA:B0U1F2"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U1F2"
FT                   /protein_id="ACA11117.1"
FT                   /translation="MSHSKSSQRWLKEHFSDPFVKKAQAEGMRSRAAYKLEEILKRDRI
FT                   LRPNMVVIDLGAAPGGWSQQIRKQMGDRGRVIALDIVKMAPLVGIEFLQGDFRDKAVLS
FT                   QLEIMLKGQPVDLVLSDMAPNKSGMDAMDQPRMMYLAELAMDFADIHVKPGGSFLIKLF
FT                   HGVGSDDYIRQLRHRYKKVAIRKPLASRKRSPEVYILGDGKLTQNEVSCS"
FT   gene            93070..93375
FT                   /locus_tag="Xfasm12_0076"
FT   CDS_pept        93070..93375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0076"
FT                   /product="putative RNA-binding protein containing KH
FT                   domain"
FT                   /note="KEGG: xft:PD0072 putative RNA-binding protein
FT                   containing KH domain"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11118"
FT                   /protein_id="ACA11118.1"
FT                   /translation="MTIALTSAQNRFLRGQAHHLKILLQTGDKGLTSAFLSELNDLLER
FT                   HELIKVKVVNEDREMRDMLIATLTAQSGSVLVQRIGHIAILYRCSKGRSQIVLSRA"
FT   gene            93394..93774
FT                   /locus_tag="Xfasm12_0077"
FT   CDS_pept        93394..93774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0077"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0073 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11119"
FT                   /protein_id="ACA11119.1"
FT                   /translation="MLFTQEQPDYIYVLRLADAHHARINDRVLYSSFILMPDTLVEDWS
FT                   VAKPEQLQATDLEPVLALAPTLVILSTGNRHIFPPAVVLATCLTRGIGIEIMTNDASAR
FT                   TYNVLASEGRRVALAMILSGER"
FT   gene            complement(94167..94361)
FT                   /pseudo
FT                   /locus_tag="Xfasm12_0078"
FT   gene            complement(94358..96190)
FT                   /locus_tag="Xfasm12_0079"
FT   CDS_pept        complement(94358..96190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0079"
FT                   /product="Dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="KEGG: xft:PD0074 dihydroxy-acid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11120"
FT                   /db_xref="GOA:B0U281"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U281"
FT                   /protein_id="ACA11120.1"
FT                   /translation="MPEYRSKTSTYGRNMAGARALWRATGMKDDDFQKPIIAIANSFTQ
FT                   FVPGHVHLKDLGQLVAREIERLGGVAKEFNTIAVDDGIAMGHDGMLYSLPSREIIADSV
FT                   EYMANAHCADALVCISNCDKITPGMLMASLRLNIPTVFVSGGPMEAGKTTLADHKLDLV
FT                   DAMVLAADPHASDEEVATVERSACPTCGSCSGMFTANSMNCLTEALGLSLPGNGTVVAT
FT                   HSDRKQLFLNAGRTVIELCHRWYGAEDATALPRGIATFAAFENAITLDIAMGGSTNTIL
FT                   HLLAAAQEAQVSFTMQDIDRLSRNVPQLCKVAPNTQKYHIEDVHRAGGIFGILAELARG
FT                   NLLHTDVATVHSKTLGEAIATWDIIGTQDEAVHTFYKAGSAGIPTQVAFSQSTRWPSLD
FT                   TDRTEGCIRDMEHAFSKEGGLAVLYGNIAQDGCVVKTAGVDASIHVFEGSALVYESQEA
FT                   AVKGILSDEVQPGMIVVIRYEGPKGGPGMQEMLYPTSYLKSKGLGKQCALFTDGRFSGG
FT                   TSGLSIGHASPEAAAGGAIGLIRDGDRIRIDIPQRAINVLISEEELASRRLEQHAIGWK
FT                   PAQSRTRKVSSALKAYSLLATSADKGAVRNKTLL"
FT   gene            complement(96457..96797)
FT                   /pseudo
FT                   /locus_tag="Xfasm12_0080"
FT   gene            97076..97360
FT                   /locus_tag="Xfasm12_0081"
FT   CDS_pept        97076..97360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0081"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0075 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11121"
FT                   /protein_id="ACA11121.1"
FT                   /translation="MTPSRAFTNRMTAVLTDKMLSHTLSMISPMSQTATAPANAQKRYT
FT                   VHRRDLPLSCPMPEMALWNSHPRVYLPIEDEPNGEVACPYCGAVYTLID"
FT   gene            97361..98491
FT                   /locus_tag="Xfasm12_0082"
FT   CDS_pept        97361..98491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0082"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF0102 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11122"
FT                   /protein_id="ACA11122.1"
FT                   /translation="MFVLPTRRLTVVQLLPALCSGGVERSTLEVAAALVQAGHRAIVVS
FT                   AGGPLVAFLLSIGAEHITLDIGRKSLLTLRHIAALRRLFAQLRPDIVHARSRLPAWLTW
FT                   YALHGLFFSPKPRFVTTVHGLNAPNPYSAVMTYGERVICVSNVVHDYVLRHYRRTDPQR
FT                   LRTIPRGVDLARFRRRPYPDRSARRWASKYVPCLDDNTRLLLMPGRGTRLKGHGDALLL
FT                   LAFLRRVSDYNVCLWLPGACQPGRESYLAELEAQARELGVTDRVVFTPPTEHIVEAYAA
FT                   SDLVLQLSRKPEAFGRTVLEALAVGRTVLGWNHGGVGELLTQLQPDGAVPTFDTAALQR
FT                   RAAMLLMHSPELPSDIPYTLQTMQSATLQVYDELCT"
FT   gene            98472..99803
FT                   /locus_tag="Xfasm12_0083"
FT   CDS_pept        98472..99803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0083"
FT                   /product="membrane protein"
FT                   /note="KEGG: xft:PD0077 membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11123"
FT                   /protein_id="ACA11123.1"
FT                   /translation="MTNSAPDIVSISKPALLLDVGRWAPVCVVLFVAFWPLPGLAATVL
FT                   TLSALLASYYLIRYRFRGGTQLLDSPAWALTSVLFMAYWLPQVVSLFGALELSESLLKV
FT                   ATDLRYLPFMWLCAIAVGGPERRERTFKGLAVIGLIWTLDALAQAVLRTSPLFWSLNQL
FT                   KQAISGYGFCSTQQMMLADRLSGIFGPCNLKLGQTLATLSPFVLFAMQRRGVALWLLVV
FT                   AVLGIVLLLAGSRASWITYGLILMLSGWRVLGIRRLLGMGALFLPLVLAVIAFSPQTRE
FT                   RIDRTAAVFADHGAGVDQALSGRSQIWQAALCMIQAHPLSGVGVRGFRDAYPACNPTPE
FT                   RIPAWGAGPALHAHQIVLEILSETGVIGLLLWIAGAAMAWRAWCYATAAARDRARPAMI
FT                   SLLATVFPFNTHLAFYSSFWGALMLMLAGLYAGALLQNGVIKKT"
FT   gene            complement(99989..100909)
FT                   /locus_tag="Xfasm12_0084"
FT   CDS_pept        complement(99989..100909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0084"
FT                   /product="lipid A biosynthesis lauroyl acyltransferase"
FT                   /note="KEGG: xft:PD0078 lipid A biosynthesis lauroyl
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11124"
FT                   /protein_id="ACA11124.1"
FT                   /translation="MSDSTNVTPRPSLLKPAHWPMYVALCGMVLAARLPWGLQRRLGRV
FT                   IGAMALRLVGTRRCAAEVNLQLCFPTHDETWRKKLLHENFDALGVGLFEFARAWWGSID
FT                   VIRAGIHVEGLEHLRQLQREGRGVLLVSGHFMTLEICGRLLCDYVPLAGMYRRHRNPVL
FT                   EWAIKRGRLRYATQMFANEELRATIKHLKCGGFLWYAPDQDMRGKETVFAPFFGMPAAT
FT                   ITATHQLARLTGCAVVPYFHRRQGGNYVLKIAPPLADFPSKDLAADTARINQVIETMID
FT                   EAPDQYLWIHRRFKRQPEGRSHFYN"
FT   gene            100952..102298
FT                   /locus_tag="Xfasm12_0085"
FT   CDS_pept        100952..102298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0085"
FT                   /product="3-deoxy-D-manno-octulosonic acid transferase"
FT                   /note="KEGG: xfa:XF0105 3-deoxy-D-manno-octulosonic acid
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11125"
FT                   /protein_id="ACA11125.1"
FT                   /translation="MQAVIRFRILGVMRKDPIEWLLRALYSALLYLLLPFTIYHLVWRG
FT                   FRVRQYFNRWNERYASYSAAYARPQVWLHAVSVGEVNAAASLVNALRQQRPDIRWVITT
FT                   ITPTGSERVRALWGDSLEHVYLPYDVPGSVERFLRYFRPQLALILETELWPNLLFGCRS
FT                   HGIPVYILNARLSVRSLRGYRLLKPLIRRALRSVVCVAAQSQEDALRFLRLGARPDQVV
FT                   ALGNLKFDIPTPQDLDVFMAAFRRCVPMARPVWIAASTHEGEEAAIIDIHARLLRRIPN
FT                   LLLLWAPRHPERFHKVEGLAYEHGWRVSTRKQHTWPDVITDVFVIDTLGELSAFYGCAQ
FT                   VAFVGGSLQPIGGHNLLEPAAVGTATVTGPYLHNFSEISRRMKGAQALEICADAEAVGA
FT                   MLEHLLADPSKRSQMAQAGLALVANGRGAVARTLVQINPHLPSTISVEK"
FT   gene            102682..104064
FT                   /locus_tag="Xfasm12_0086"
FT   CDS_pept        102682..104064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0086"
FT                   /product="alpha-L-fucosidase"
FT                   /note="KEGG: xfa:XF0106 alpha-L-fucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11126"
FT                   /protein_id="ACA11126.1"
FT                   /translation="MTQGSLFASLRVLIRFCLAVLICPVAIAQNVAAMKPSPQQIAWQD
FT                   LEFGVIVHFNPNTWLDQEWGDGSANPKVFNPTHVDPGQWARAAKAAGAKYLILVAKHHD
FT                   GFALWPTAQSEYSVKNSPWMGGKGDVVKLTAAAVRQQGMGFGIYLSPWDRHEPKYANVD
FT                   AYNQFYAAQLVELASHYGPLTEWWLDGAGSAGHEYDFDKYLEQLRTYQPNTMVFADTAL
FT                   FKYGDIRWVGNEAGVIEGENWNVIDRHGDLRWRPVEVDTPLHRLEWFWHPNNERTLKSV
FT                   DELLTIWEKSVGRGGQLVLGIAPDTRGLLPEADVKRLQAMGAAIQARYGAGKNLVPVHV
FT                   KNHQAIVAAVDSDVDTFWSAPHGSHSAMLELHFKQPITFDAALTMEWLNDGQLVQKYAI
FT                   EVWQKGKWVRVAQAQAIGKMKIDHFGSLTASRVRLNILSSVDAAHIREFQLFNIGNSRA
FT                   AH"
FT   sig_peptide     102682..102768
FT                   /locus_tag="Xfasm12_0086"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.961) with cleavage site probability 0.691 at
FT                   residue 29"
FT   gene            104280..104540
FT                   /locus_tag="Xfasm12_0087"
FT   CDS_pept        104280..104540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0087"
FT                   /product="30S ribosomal protein S16"
FT                   /note="KEGG: xft:PD0081 30S ribosomal protein S16"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11127"
FT                   /db_xref="GOA:B0U288"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR020592"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U288"
FT                   /protein_id="ACA11127.1"
FT                   /translation="MVKIRLTRGGAKKRPFYQIIVTDSRNKRDGRNIERVGHYNPVAQG
FT                   AESRVVLNVARVEHWVRNGAQLTDKVRSLLKEVSKTQATAS"
FT   gene            104584..105096
FT                   /locus_tag="Xfasm12_0088"
FT   CDS_pept        104584..105096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0088"
FT                   /product="16S rRNA processing protein"
FT                   /note="KEGG: xfa:XF0108 16S rRNA processing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11128"
FT                   /db_xref="GOA:B0U289"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U289"
FT                   /protein_id="ACA11128.1"
FT                   /translation="MKDNERRILLGRVVGGFGLRGEIKMESWTEPRDAIFRYQPWLLRS
FT                   PTGTESMLNGARGYDTGKRLIATFPGINDRNAVEAICGTEIYVPRSALPPPHPDEYYWV
FT                   DLEGLQVHTLEGVVLGSVSHLFSNGANDVVVIHGERERLIPFVQPDYVKSVDFEAERIV
FT                   VDWDPEF"
FT   gene            105119..105985
FT                   /locus_tag="Xfasm12_0089"
FT   CDS_pept        105119..105985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0089"
FT                   /product="tRNA (guanine-N(1)-)-methyltransferase"
FT                   /EC_number="2.1.1.31"
FT                   /note="KEGG: xfa:XF0109 tRNA
FT                   (guanine-N1-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11129"
FT                   /protein_id="ACA11129.1"
FT                   /translation="MIRPVLSRLAGYCFTTASLIQSGFRYPACMRIDVISLFPEFITQC
FT                   VGFGVIGRAQERGLLDLHNWNPRDYAQGNYRRVDDRPFGGGPGMVMLIEPLRACLEAVR
FT                   AADPQPAPLIYLSPQGVLLNQSRARKLAMLPRMILLCGRYEGIDERFIAHEVNMELSIG
FT                   DYVLSGGELGAAVVVDAVTRLQEGVLNDAESAKQDSFEAADSLLDYPHYTHPSNHAFGN
FT                   VPEVLRSGNHVAITRWRRQQSLLRTWLRRPDLIDEARLSKADRLLLDEIKRTHPMDTDQ
FT                   KASVSWR"
FT   gene            106156..106566
FT                   /locus_tag="Xfasm12_0090"
FT   CDS_pept        106156..106566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0090"
FT                   /product="50S ribosomal protein L19"
FT                   /note="KEGG: xft:PD0084 50S ribosomal protein L19"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11130"
FT                   /db_xref="GOA:B0U291"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U291"
FT                   /protein_id="ACA11130.1"
FT                   /translation="MSKLNKSIIAEFESAQITRQVPQFSQGDTIVVNVKVKEGNRERLQ
FT                   AYEGVVIATKNAGLNSAFTVRKISHGYGVERVFQTHSPIIESIEIKRRGKVRAAKLYYL
FT                   RGLEGKAARIKEDLAATAHEKLARKTVTAKAG"
FT   gene            106998..107777
FT                   /locus_tag="Xfasm12_0091"
FT   CDS_pept        106998..107777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0091"
FT                   /product="methionine aminopeptidase"
FT                   /note="KEGG: xft:PD0085 methionine aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11131"
FT                   /protein_id="ACA11131.1"
FT                   /translation="MVAVNLKTKEEIEQMRIAGRLAAMVLDVVAPYVKPGVTTAELDQI
FT                   CHNYIVTVQGAIPANLGYRGFPKTICTSVNNVICHGIPSDAKVLKDGDIINIDVTVIKD
FT                   GWHGDTSRMYYVGNPSVMARRLVETTYEAMWRGIRAVKPGATLGDIGHAIQTYAENERF
FT                   SVVREYCGHGIGKVYHDNPQVLHYGRPGEGLILESGMTFTIEPMINEGTRHHKVLPDGW
FT                   TVVTKDRKLSAQWEHMIAVTEDGVDVLTLSPNDIGST"
FT   gene            107861..108022
FT                   /locus_tag="Xfasm12_0092"
FT   CDS_pept        107861..108022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0092"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF0112 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11132"
FT                   /protein_id="ACA11132.1"
FT                   /translation="MISSERAVSTKAALIVYHCHVCVALPRSFVRAWLLLCTRQHCFGA
FT                   ECGTYTGC"
FT   gene            108469..109371
FT                   /locus_tag="Xfasm12_0093"
FT   CDS_pept        108469..109371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0093"
FT                   /product="2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
FT                   N-succinyltransferase"
FT                   /EC_number="2.3.1.117"
FT                   /note="KEGG: xft:PD0086
FT                   2,3,4,5-tetrahydropyridine-2-carboxylate
FT                   N-succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11133"
FT                   /protein_id="ACA11133.1"
FT                   /translation="MTTQSHLKETPLQQVDNKAPPPVVDKALVSAIEDAFARYSTLTVE
FT                   EIEDSIRPTVNRVIDGLETGAFRVAEPDNHGGWKVNEWLKKAVLLYFRVHDTTIVDAQP
FT                   APFWDKVESRFSGYDAVKFRAAGVRVVPGAIARRGSYFGKDVVLMPSFTNIGAYVGEGT
FT                   MIDTWATVGSCAQLGAHCHLSGGAAIGGVLEPLQASPAIIEDHCFIGARSEVVEGVIVG
FT                   HHSVIGMGVFISQSTRIYNRATGEISYGYVPPYSVVVSGQLPAKDGTHSLYCAVIVKQV
FT                   DEKTRAKTSINELLRGFAD"
FT   gene            109386..109742
FT                   /locus_tag="Xfasm12_0094"
FT   CDS_pept        109386..109742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0094"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF0115 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11134"
FT                   /protein_id="ACA11134.1"
FT                   /translation="MTTLYGLKNCDTCKKANQWLDRFGIPYVFVDYRENIPAPEMLVAW
FT                   AKEAGGFEALINKSSTTWRQLPTSRKTPGSQAEWKLLLREYPQLIRRPVLVASDGSFSQ
FT                   GFSDNGFKQRFGVD"
FT   gene            109814..110947
FT                   /locus_tag="Xfasm12_0095"
FT   CDS_pept        109814..110947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0095"
FT                   /product="succinyl-diaminopimelate desuccinylase"
FT                   /note="KEGG: xfa:XF0116 succinyl-diaminopimelate
FT                   desuccinylase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11135"
FT                   /db_xref="GOA:B0U296"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR005941"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U296"
FT                   /protein_id="ACA11135.1"
FT                   /translation="MSEVFDLTCDLISRPSVTPEDAGCQAMIAARLERVGFTCEHLHYG
FT                   SVANLWATHGQGAPVLVLLGHTDVVPPGPIEAWTSNPFIPQRREGKLYGRGAADMKGSV
FT                   AAFVIAAERFLVAHPGHPGTLAILLTSDEEGQAIDGVRKVAETLRQRGQRIDWCLTGEP
FT                   SSSERLGDLLRVGRRGSLSATLHVKGVQGHVAYPHQARNPIHLAVPALAALTGRHWDDG
FT                   DESFPSTSLQISNIHAGTGANNVIPGALEVAFNLRYNPHWSAPRLESEIVALLDQHGLD
FT                   YTLHWHRSGEPFYTPEGKLRRIAREVLERFSGAPPEESTGGGTSDARFIAPLGAQCIEV
FT                   GPVNASIHQVDEHVCLADLEALPDLYQLLIERLLAEH"
FT   gene            111348..113039
FT                   /locus_tag="Xfasm12_0096"
FT   CDS_pept        111348..113039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0096"
FT                   /product="asparagine synthase B"
FT                   /note="KEGG: xft:PD0089 asparagine synthase B"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11136"
FT                   /protein_id="ACA11136.1"
FT                   /translation="MCSIFGIFNLQPSDNLQILRHQALECSQRQRHRGPDWSGVYVDVG
FT                   AILVHERLAIVDPAGGAQPLLSEDGTLALAVNGEIYNHAVLKGTLQQPYAFQTHSDCEV
FT                   INALYREETPTSFLNRLNGIFAFVLWDKTTGRGLIARDPMGVVPLYWGHDQDGRLRVAS
FT                   EMKALVEHCSDVAQFPPGHWYDTTTGTLVKYYERPWKNYSAVEGVQVSLQELREAFERA
FT                   VHRQLMTDVPYGVLLSGGLDSSLVAAVAARYARHRIETNDQSEAWWPRLHSFAIGLKDS
FT                   PDLSAANVAAEALNTVHHRFEYTFQEGLDVLPEVIRHIETYDVTTIRASTPMFLLARRI
FT                   KAMGVKMVLSGEGSDEIFGGYLYFHKAPNAREFHEELVRKLNALYYYDCLRANKAMMAW
FT                   GVEPRVPFLDREFLDVAMRMDAQHKMVDKTSNGPQRMEKGILRAAFDGYLPPSILWRQK
FT                   EQFSDGVGYGWIDGLKAHAETQVSDHALATAETRFQVNPPQTKEAYYYRSIFERFFPSP
FT                   AAAETVPGGKSIACSSPAAIAWDASFATMADPSGRAVSGVHQQALL"
FT   gene            complement(113097..114125)
FT                   /locus_tag="Xfasm12_0097"
FT   CDS_pept        complement(113097..114125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0097"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF0119 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11137"
FT                   /protein_id="ACA11137.1"
FT                   /translation="MSQRILSICTLILALLLIATHAKANMQPPCSEWVAPGQDLQQAID
FT                   TLRSDAHPAVLCLNKGEYRVDKLLHIGRDGVHIRGSGARTVIRLNKDVQQPLIVIGDYQ
FT                   NQQPAKQIGDVVIERMHLIGTTNVEHEFMPERPYLSNSVVVLRAAHNVSLLDLKVSQCR
FT                   SACLLSEYDSHRLNIERNDVSGATWDGVSFNRSTHVRLVNNVIHDNVAAGITTEHLEDS
FT                   EIRGNRLERNGSQGLYLADARRNVFKHNQFISNKKSGVLLTCSIRYRTPEVLCWDNSMS
FT                   QANVFEYNIFQKSPYIYTIGVDHAANCKGSDFEPNMWRNNKADTSGFNPPPDVYGTCVQ
FT                   TQ"
FT   sig_peptide     complement(114051..114125)
FT                   /locus_tag="Xfasm12_0097"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.861 at
FT                   residue 25"
FT   gene            114895..115926
FT                   /locus_tag="Xfasm12_0098"
FT   CDS_pept        114895..115926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0098"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0091 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11138"
FT                   /protein_id="ACA11138.1"
FT                   /translation="MKINSNLFDCLLPIVAAPMAGGPTTVALAQAVSGVGGFPFLAGGY
FT                   KSVEALATEIAVLRASGGDFGVNLFVPSPDMVDAEAFSIYAAKLQSEALPYGLRLDPLP
FT                   VMGDDDGWPDKLALLLNDPVPVVSFTFGLPAVRDIAALRCAGSRVLASVTLPAEAQAAM
FT                   EAGVDGLVVQGPDAGGHSATYDPGRPFTPLKTVSLVRRVCAVSSLPVIAAGGVDGPVMV
FT                   RALLQAGAAAVAIGTLLLRTKESGATQVHKDALANPAYTETAITHAFTGRPARTLRNGF
FT                   VNRYHASAPLGYPAIHHLTRPLRQAAASAGDADVLHLWAGTGYRQAMDGSAVDVIRYLA
FT                   AGL"
FT   sig_peptide     114895..114984
FT                   /locus_tag="Xfasm12_0098"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.887 at
FT                   residue 30"
FT   gene            116399..117034
FT                   /locus_tag="Xfasm12_0099"
FT   CDS_pept        116399..117034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0099"
FT                   /product="Repressor lexA"
FT                   /EC_number="3.4.21.88"
FT                   /note="KEGG: xfa:XF0122 LexA repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11139"
FT                   /db_xref="GOA:B0U1K7"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR006199"
FT                   /db_xref="InterPro:IPR006200"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U1K7"
FT                   /protein_id="ACA11139.1"
FT                   /translation="MSLSDIQQAILSLITNHINADGVSPSQTEIARAFGFKGVRAVQHH
FT                   LDVLEQQGMIRRVPGQARGIRLKHLTQVDEAALALQSEDVLRLPVLGRVAAGQPIGADI
FT                   GEDRVVLLDRVFFSPAPDYLLRVQGDSMRDEGIFDGDLIGVHRTHDAHSGQIVVARIDD
FT                   EITVKLLKISKDRIRLLPRNPDFAPIEVRSDQDFAIEGLYCGLLRPNR"
FT   gene            117216..118259
FT                   /locus_tag="Xfasm12_0100"
FT   CDS_pept        117216..118259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0100"
FT                   /product="recombination protein RecA"
FT                   /note="KEGG: xfa:XF0123 recombination protein RecA"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11140"
FT                   /db_xref="GOA:B0U1K8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U1K8"
FT                   /protein_id="ACA11140.1"
FT                   /translation="MDENKKRALSVALSQIEKQFGKGSVMRMGDRVIEAVEAIPTGSLM
FT                   LDLALGIGGLPKGRVVEIYGPESSGKTTLTLQAIAQCQKKGGTAAFIDAEHALDPIYAG
FT                   KLGVNVDDLLLSQPDTGEQALEIADMLVRSGSIDIMVIDSVAALTPKAEIEGEMGDQLP
FT                   GLQARLMSQALRKLTGNIKRSNTLVIFINQLRMKIGIMMPGQSPETTTGGNALKFYASV
FT                   RLDIRRIGAIKKGDEIIGNQTKIKVVKNKLAPPFKQVVTEILYGEGISREGELIEMGVE
FT                   AKLVEKAGAWYSYGGERIGQGKDNARGYLRENPHLAAKLEADLREKFEPTELSREEGDE
FT                   DTLEDAM"
FT   gene            118748..121402
FT                   /locus_tag="Xfasm12_0101"
FT   CDS_pept        118748..121402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0101"
FT                   /product="Alanine--tRNA ligase"
FT                   /EC_number="6.1.1.7"
FT                   /note="KEGG: xft:PD0094 alanyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11141"
FT                   /db_xref="GOA:B0U1K9"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U1K9"
FT                   /protein_id="ACA11141.1"
FT                   /translation="MNIPTKFTTSKIRSDFLEFFKNKGHKIVPSAPLVPGNDPTLLFTN
FT                   SGMVQFKDVFLGAEKRSEVRVADVQCCLRAGGKHNDLDSVGYTARHHTFFEMLGNWSFG
FT                   DYFKKEAITWAWELLTHVWELPPERLLVTVYRTDDESYALWRDMVGVPEDRIVRIGDNK
FT                   GAPFASDNFWQMADTGPCGPCTEIFYDHGEHIPGGPPGSPGEDGDRFIEIWNLVFMQFD
FT                   RQSDGTLVPLPTPCVDTGMGLERLAAILQHVHTNYEIDLFQTLILKAAELTAVADVQNK
FT                   SLCVIADHSRACAFLIVDGVLPSNEGRGYVLRRIIRRALRHGWMLGVRQPFFNNMVPTL
FT                   VAVMGDAYPKLQAAAESVMRTLLAEEERFAETLDVGMKIFNEVAAKVANGVIPGSDAFR
FT                   LYDTYGFPVDLTADIARERGMRVDMAGFEAAMTQQRKTARAAGKFGRGVQLSAERAAML
FT                   SPTVFLGYEQLQADGLRVVALLSDGGLTDSASVGDEVIVLTDRTPFYAESGGQVGDIGT
FT                   LMASDGVRLEVTDTQKLMGQFHGHVTRIVQGGVKVGDVLSGSVAVARRKMVALNHSATH
FT                   LLHCALRSVFGTHVAQKGSLVAPDRLRFDFSHFEPISAAQMTLIERMVNDEVRANHLVM
FT                   IEQMGMQAALDAGAMALFGEKYGEHVRVVKMGTSVELCGGTHITRTGDIGLFKIISECG
FT                   VSSGVRRIEAVTGESALNHVLAEEHRLYEVAGLIGSNANDVVNHIRQLTDRQKTLEREL
FT                   EKLKGKLISGTITDLLSTAVNVADVKVVAARLDGLDGKALREALDRLKLQLSDAVIVLA
FT                   GVTGGKVALVTAVNGPRAMGKVKADTLLSHVATQINGRGGGRVDFAQGGGEDGPSLRSA
FT                   LDGVATWVKQHLD"
FT   gene            121541..121756
FT                   /locus_tag="Xfasm12_0102"
FT   CDS_pept        121541..121756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0102"
FT                   /product="carbon storage regulator"
FT                   /note="KEGG: xft:PD0095 carbon storage regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11142"
FT                   /db_xref="GOA:B0U1L0"
FT                   /db_xref="InterPro:IPR003751"
FT                   /db_xref="InterPro:IPR036107"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U1L0"
FT                   /protein_id="ACA11142.1"
FT                   /translation="MLILTRRSGETLMIGDQVTVTVLGVKGNQVRVGINAPKHVAVHRE
FT                   EIYHRIQRGDELACSSGTRGDSGSSI"
FT   gene            121836..121928
FT                   /locus_tag="Xfasm12_R0008"
FT                   /note="tRNA-Ser1"
FT   tRNA            121836..121928
FT                   /locus_tag="Xfasm12_R0008"
FT                   /product="tRNA-Ser"
FT   gene            122261..122440
FT                   /pseudo
FT                   /locus_tag="Xfasm12_0103"
FT   gene            complement(122867..124891)
FT                   /locus_tag="Xfasm12_0104"
FT   CDS_pept        complement(122867..124891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0104"
FT                   /product="Oligopeptidase A"
FT                   /EC_number="3.4.24.70"
FT                   /note="KEGG: xft:PD0097 oligopeptidase A"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11143"
FT                   /protein_id="ACA11143.1"
FT                   /translation="MSNPLLDFSDLPRFDAILPEHVGPAIEQLLAEAEAAVAHAEQVTP
FT                   VTWENFVVPLDDTTERLYRAWGQVAHLEAVVNTPALREAYNVTLPKVTRFSSTLGQNLA
FT                   LYAQYKALACAPEWDRDNAVRCKVVDNALRDFRLGGAELDAAGKVRLAEIKQELSALSA
FT                   TFSQNVLDATEAWSYTTEAAAVLSGLPTETVATARAAAEKKGVSGWTFTLQMPCYLSVQ
FT                   SDADNRALRERSYHASAIRASEFGDAALDNSPHIHQILTLRSELAALLGFSCYAAYSVA
FT                   TKMAEDPAEVLSFLHDLAGRAKPHAQRDRRELETFACEALGLETLEAWDIAYASEKLKQ
FT                   ARYSFSEQEVKQYFTEPKVLAGLFEVIHSLYGLWIEEDAAPVWHPDVRFYRLIDMNGQR
FT                   VGQFYLDLYAREGKRGGAWMDDCRNRRDKSDGVQTPVVYLVCNFGRGNDGVLPTFRHQE
FT                   VITLFHEMGHGLHQLLTRIGELGVAGINGVEWDAVELPSQFMENFCWEWERVQTMTAHV
FT                   ETGAPLPRSLFDRMVCARNFQSGMFTVRQLEFALFDMLLHSDFDPAQDSVLGLLERVRD
FT                   EVAVNRLPDWNRFPHQFRHIFAGGYAAGYYSYKWAEVLSADAYAAFEEAPDQFAEIGAR
FT                   FLDEILSRGGSRSAADNFQAFRKRAPRIDALLKRNGMTE"
FT   gene            complement(124951..126108)
FT                   /locus_tag="Xfasm12_0105"
FT   CDS_pept        complement(124951..126108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0105"
FT                   /product="cysteine synthase"
FT                   /note="KEGG: xfa:XF0128 cysteine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11144"
FT                   /protein_id="ACA11144.1"
FT                   /translation="MQGGYGRIDAFYHCCSFMSQREWVASSICKIEADFNRSVDTHLIP
FT                   LQLPGFPDIDFYLKDESIHPTGSLKHRLARSLFLYALVNGWLSPGRPVIEASSGSTAVS
FT                   EAYFARLLGLPFIAVIPTSTSPEKVAAIEFHGGRCHAVERACDLHDAAHQLARETGGHF
FT                   MDQFTYAERATDWRANNNIAESIFKQMADEPHPIPAWIVCSPGTGGTAATLGRYVRYRR
FT                   HVNRILCADPEISVFFDHYRAACKGSDHRNNVTDTGGSRVEGIGRPRLEPSFIHNCIDA
FT                   MIKVPDALSLAAMRYISARLGRRVGGSTGTNMVGVLQTAARMRAEGMKGSIVTILCDGG
FT                   ERYAHSYYSPAWYAAHGIDVSDSDAVIAAVVAGDTLPLLPCAALE"
FT   gene            126155..126382
FT                   /locus_tag="Xfasm12_0106"
FT   CDS_pept        126155..126382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0106"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xfa:XF0129 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11145"
FT                   /protein_id="ACA11145.1"
FT                   /translation="MTHPFASAGQRVPPCTIRLTTLRHAKNERIPTALQAVQNRVISSP
FT                   MLAMSYFRTPDQKPLLLAFHPQPDARPLPE"
FT   gene            126412..126954
FT                   /locus_tag="Xfasm12_0107"
FT   CDS_pept        126412..126954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0107"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xft:PD0099 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11146"
FT                   /protein_id="ACA11146.1"
FT                   /translation="MPLRWQHRLIEQAPRVLGIATWRTCKNGLRVASAGINLGVSSPYT
FT                   DATSRLRCAPLPSLLLRLLISLCLIAQQFVSAWASVTMSPRIALPSMPVAVVDRPCHHT
FT                   GVSGVQSAAHLSHAIPTPSTPCSKIGHCDCLQHSNALPVTLLILPVVLLERMPPLAGIL
FT                   TSQGLPAPYRPMRPPIA"
FT   gene            127054..128874
FT                   /locus_tag="Xfasm12_0108"
FT   CDS_pept        127054..128874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0108"
FT                   /product="copper resistance protein A precursor"
FT                   /note="KEGG: xft:PD0100 copper resistance protein A
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11147"
FT                   /protein_id="ACA11147.1"
FT                   /translation="MNTVTFPSQGGIDRRRFLKGLALGGVVAGTGLWRLPVHAANPELP
FT                   LLQRHTTPLELRIGQSSVNFTGRMRPAITVNNSLPGPVLRWRQGDTVQIHVTNTLPDVM
FT                   TSIHWHGIVLPSNMDGVPGMSFDGIAPGEHYLYRFQLHQSGTYWYHSHAMFQEQAGLYG
FT                   ALIIDPLEPPPYRADREHILLFSDWTDLDPAALFRRLKKMSSYDNTYQRTVRDFFHDIR
FT                   RDGLRTTLADRRMWGRMRMTPTDLSDVNAHTYTYLLNGTTPAGDWTGLFRPGEKVLLRL
FT                   INGSAMTYFDVRIPGLKLTVVAVDGQYVHPVTVDELRIALAETYDVLIQPHGQDAFAIF
FT                   AQDMGRTGYACGTLAVRPGLHAPLPALDPRPRLTMQDMGHRMTHGQHESRASEMADMPG
FT                   MTHPGRLGDHASHANQPPAQTPHGSHSLPADRTAPRHPASEQNNPLVDMHVDAPQPRLN
FT                   DPGIGLRDNGRHVLTYADLHSLFDDPDGREPGREIELHLTGHMEKFAWSFDGIPFASAQ
FT                   PLRLNYGERVRIVLVNDTMMAHPIHLHGLWSDLEDANAAFQVRKHTIDMPPGTRRSYRV
FT                   RADALGRWAYHCHMLYHMESGMMREVQVRP"
FT   sig_peptide     127054..127173
FT                   /locus_tag="Xfasm12_0108"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.950) with cleavage site probability 0.950 at
FT                   residue 40"
FT   gene            128871..129740
FT                   /locus_tag="Xfasm12_0109"
FT   CDS_pept        128871..129740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0109"
FT                   /product="copper resistance protein B precursor"
FT                   /note="KEGG: xft:PD0101 copper resistance protein B
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11148"
FT                   /protein_id="ACA11148.1"
FT                   /translation="MNTRTWFVLFCVALPLVPLQAQPHPQTEQTSPALSEHTQMDHTGM
FT                   DHAIHGATTRSAGDVALPPPTTAALAAAFPPLRHRAAHAPPLVSLVRIDRLETWNADPG
FT                   RGHAWATQAWIGSDIQRLWLRSQGECYGGRCQSVAVDMLYGHDISPWWDALIGARRDEQ
FT                   PDGRTWAALGVQGVTPYKFESAAFLYLSGAAMRLMVETKYDLLLSQRLILQPSLQATAG
FT                   LTRDRDLGAGPQTLQVGVRMRYQITRRVAPYVGWEREYGYGGSGRQARGRGTSDDEKRW
FT                   VAGIRCWF"
FT   sig_peptide     128871..128936
FT                   /locus_tag="Xfasm12_0109"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.979 at
FT                   residue 22"
FT   gene            complement(129997..132972)
FT                   /locus_tag="Xfasm12_0110"
FT   CDS_pept        complement(129997..132972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0110"
FT                   /product="valyl-tRNA synthetase"
FT                   /note="KEGG: xft:PD0102 valyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11149"
FT                   /db_xref="GOA:B0U1L1"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR019499"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U1L1"
FT                   /protein_id="ACA11149.1"
FT                   /translation="MSQFTSSYDPTSFEARLYAEWEAAGHFKPSGTGQPYTILLPPPNV
FT                   TGTLHMGHAFQQTLMDALVRYHRMCGDDTLWQVGTDHAGIATEMVVSRNVMLEGRGETR
FT                   DSLGRDGFINKVWEWKQQSGDTIERQMRRLGVSADWSRSTFTMDPQPSAAVTEAFVRWY
FT                   EEGLIYRGQRLVNWDPVLKTAISDLEVENVAEEGMLWSIRYPLSDGVTYEHIEHDAAGN
FT                   EILRETRDSLIVATTRPETLLGDTAVMVHPEDRRYTALIGKTVTLPLTGRQVEVISDTC
FT                   VDPTFGSGVVKVTPAHDFNDFEVGVRHQLPMIKVLDDAACILSETYAQGWMTPLNNPKG
FT                   DSRWINIIDIPESEFVIPAHLAGLDRYEARKQILADLDTQGLLVAAIPHTLQVPRGDRT
FT                   GQVIEPYLTAQWFVRMDRLAARGLELVERGAVRFVPPNWINTYRHWMNNIRDWCISRQL
FT                   WWGHRIPAWFDEYDGSFYVGRSEAEVRAKHALGPEVTLTQDSNVLETWFSSQLWPFSTL
FT                   GWPDPTAMAERGFERYLPSSVLVTGFDIIFFWVARMIMATDHFTGNVPFHDVYITGLIR
FT                   DAQGQKMSKSKGNVLDPLDIIDGITLDDLVAKRTTGLMQPKLAEKIAKATRKEFPDGIA
FT                   PHGADALRFTIAALATHGRDIKFDLGRAEGYKNFCNKLWNATRFVLMNTADDTAHSPAQ
FT                   HQAGQDGQDAPRTPQPRTDAEQWILSRLAAVTAEAHAQFAAYRFDLLAQALYEFAWNEF
FT                   CDWFVELAKPALNGNDTQAAASTRHTLLYVLETLLRLLHPLIPFITEELWRQVAPRLGI
FT                   QATTLMLRPYPQPQQLETAAFANAAADVEWLKIMVSALRRIRSTLNVPPSRRISLLLQG
FT                   GQEVDRHRITHFAIALHFLLKLEHIDWLSAATAAPPSAIAIVGSLKLLVPLEGLIDVDA
FT                   ERARLDKEIKRVESEIDKSNGKLSNAVFVQNAPTAVVEQERSRLTEWTTQLNGLRERRT
FT                   TL"
FT   gene            complement(133024..133218)
FT                   /locus_tag="Xfasm12_0111"
FT   CDS_pept        complement(133024..133218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0111"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0103 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11150"
FT                   /protein_id="ACA11150.1"
FT                   /translation="MRLLIALLLPCLLFFTIGRPLAGVTCLILQITLIGWAPAAIWAVY
FT                   ALNQYETDQKIQNLTRRQD"
FT   sig_peptide     complement(133150..133218)
FT                   /locus_tag="Xfasm12_0111"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.797 at
FT                   residue 23"
FT   gene            complement(133271..133696)
FT                   /locus_tag="Xfasm12_0112"
FT   CDS_pept        complement(133271..133696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0112"
FT                   /product="DNA polymerase III holoenzyme chi subunit"
FT                   /note="KEGG: xft:PD0104 DNA polymerase III holoenzyme chi
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11151"
FT                   /protein_id="ACA11151.1"
FT                   /translation="MARADFYLISKPRFLEKPLQLVCELVRKAYDTHQPALILARDQAQ
FT                   AEALDDLLWAFDPDAYIPHQIAGSDEDDDITPVLIATPDSDTPSRPLVINLRDAPWDGP
FT                   CERVLEVVPADPAAREPLRERWKHYKTRGLHMNKHDM"
FT   gene            complement(133696..134163)
FT                   /locus_tag="Xfasm12_0113"
FT   CDS_pept        complement(133696..134163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0113"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF0137 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11152"
FT                   /protein_id="ACA11152.1"
FT                   /translation="MNFFTAGGFILSLLSFILTLLVLFRSRILAWLTFRKAKKKQAIKK
FT                   ALDEIESITSQPFDPLRFAKEAFEWLRLLLCNVAFLVFSVTLMGRAMTDVSFTTPWMKT
FT                   FNTLLYSIASVFLGFSIVSLSELRRKLNIKLDPQKAQKAIERLRTTLEKLD"
FT   sig_peptide     complement(134071..134163)
FT                   /locus_tag="Xfasm12_0113"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.846) with cleavage site probability 0.750 at
FT                   residue 31"
FT   gene            complement(134178..135653)
FT                   /locus_tag="Xfasm12_0114"
FT   CDS_pept        complement(134178..135653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0114"
FT                   /product="Leucyl aminopeptidase"
FT                   /EC_number="3.4.11.1"
FT                   /note="KEGG: xft:PD0106 aminopeptidase A/I"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11153"
FT                   /db_xref="GOA:B0U1L5"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR008283"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="InterPro:IPR023042"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U1L5"
FT                   /protein_id="ACA11153.1"
FT                   /translation="MALQFQLNQTTPQTVTTDCVIVGIYADKTLSPTAKTLDAASGGRI
FT                   TALTARGDLTGKSGTSALLHDLNGVTAPRVLVVGLGEADKFGAGQYIKAVGDAVRALKD
FT                   APVTHALLTLSELPVKDRNAAWNIHQAVIAADHAAYRYTATLGTSRKKAEESGLITLAI
FT                   HGQETSGLTLGQAIAEGVEYARALGNLPPNICTPAYLAETTAHFAATHPGATCEILDES
FT                   NMEALGMGALLAVARGSANRPHLIVLKWNGGGDARPYVLVGKGITFDTGGVNLKTQGGI
FT                   EEMKYDMCGGAAVIGTFVAAVKVRLPLNLIVIVPAVENAIDGNAYRPSDVITSMSGKTI
FT                   EVGNTDAEGRLILCDALTYAERFKPEALIDVATLTGACMIALGRAATGLMTHHDDLANE
FT                   LLTAGEHVHDRAWRLPLWDEYQNLLDSTFADVYNIGGRWGGAITAGCFLSRFTEGQRWA
FT                   HLDIAGSASNEGKRGMATGRPVGLLTQWLVDRC"
FT   gene            135763..136848
FT                   /locus_tag="Xfasm12_0115"
FT   CDS_pept        135763..136848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0115"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0107 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11154"
FT                   /protein_id="ACA11154.1"
FT                   /translation="MPKLDRYLLSDFTQSFIATLIVLMLVGVGGVLVDILGSIADGHFP
FT                   AKLLLSQLGLRFISYLPLLLPLALMLGLLLSLGRLYRDSEMAVITSIGVGPGRMLPSIL
FT                   GLVLPVVVLIGVCSLWLAPWANRTANDLLEQANRSIIMAGLEAGTFTPMPDGGVVYLSS
FT                   LSSDGTKLNAVFMQSQKDDRIAVVTAKRGEMYVQGDKGRYLRLEDGQRVDGPADGAALN
FT                   YRVLTFARNDALLPELSVVYDSNHPDILPTFNLIGDPRREAQAQLHARLAPPLLALAFA
FT                   LLVLPLSRSAPRQQRYGAVMMCFLVYMVGTNLMIVGTQWIANGKISPVWGLWWLTLPLL
FT                   LVAVWLYARGGCWMPWPRRSR"
FT   gene            136845..137951
FT                   /locus_tag="Xfasm12_0116"
FT   CDS_pept        136845..137951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0116"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF0140 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11155"
FT                   /protein_id="ACA11155.1"
FT                   /translation="MKLFPCLHDRYVARAVVATVLLTWLVLLGLDVVNGFASEVRDIGK
FT                   GSYSFGHAIAYIAYTVPRRAYTLFPTAAVIGMLLGLGQLAATSELTALRALGVSRKRLS
FT                   LSVMMVIGMGTGLMALTGETLGPWAQAQADILKASAKYKSDMTGARYSGFWAREGEVFL
FT                   NARSGEEKRLDSGGIMLILHDVRLYQLAADGRLQSMTRAARVEHHQDVWILQQVQRDTF
FT                   SERGVQRETFHSLPWRSRLDPAALAAGLAKPRNLSVHELVQSIEYRRRNHLDARDFEGQ
FT                   YWSRWFYPINVLALCLAAIPFSFGLLRSGGMGKRTFLGILFALSFWMLQMFFERIASVL
FT                   KLNYQIFYLLPPMVMLCGSYWLFRRQHR"
FT   gene            complement(137869..138708)
FT                   /locus_tag="Xfasm12_0117"
FT   CDS_pept        complement(137869..138708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0117"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xft:PD0109 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11156"
FT                   /protein_id="ACA11156.1"
FT                   /translation="MPPAPPSPGGANTSNQKDKNKYPANITGPTATATDLRWPFTQHKA
FT                   THRPPYTANKPTALPQLTAIRFSIASIPTWHSALHTPAQTTVLQPCCKPTVPITHRTSP
FT                   LIGRRLLALSYDLLPILALWLLVALLFTLAYTLSGHRLHENIAPFSPWQWLLWLCCWCT
FT                   TGLYATVSWRYGGQTLGMRPWQLRVVATTGHTPPDWCRLWCRYAVASVSLATLGCGFWW
FT                   GWLDPDGRTWHDRASRTRLERLPRHSPTQPLNDAAAGTTNTTRTTSPLEAINKKSGN"
FT   gene            138892..140721
FT                   /locus_tag="Xfasm12_0118"
FT   CDS_pept        138892..140721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0118"
FT                   /product="glucosamine--fructose-6-phosphate
FT                   aminotransferase"
FT                   /note="KEGG: xft:PD0110 glucosamine--fructose-6-phosphate
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11157"
FT                   /protein_id="ACA11157.1"
FT                   /translation="MCGIVGAIAGRDVVPVLIEGLKRLEYRGYDSSGIAVLESGSIRRV
FT                   RRTGRVAEMAVAATQEGFTASLGIGHTRWATHGGVTEANAHPHVSHGVVLVHNGIIENY
FT                   EVQRERLSAFGYVFQSQTDTEVIAHLIHYYMQQGGDLLGALQCAVKALTGIYALAVMSQ
FT                   AEPERFVCARMGCPLLIGIGDGESFVASDISALIQATRQVIFLEDGDTAEIRRDGISIF
FT                   NAEQCLVERPLHLSNVSLSSLELGEFRHFMQKEIHEQPRVLADTMEAAIDAAGFPPMLF
FT                   GAQAESVFRGITGIQILACGTSYYAGLTARYWIEAIAGLPCHVEIASEYRYRKAYVNPQ
FT                   HLVVTISQSGETLDTLEALKYAKALGHRHTLSICNAPDSAIPRISELICYTRAGPEIGV
FT                   ASTKAFTTQLVVLFQLAVALGVLRGAVDAEDEAAYLEQLRQLPCSVQQALNLEPQIAGW
FT                   AECFASRHHALFLGRGLHYPIALEGALKLKEISYIHAEAYPAGELKHGPLALVDADMPV
FT                   VVIAPNDSLLEKVKSNMQEVRARGGELFVFADQDSHFSESEGLHVIRTLRHTGVLSPLV
FT                   HTIPVQLLAYHTALVRGTDVDKPRNLAKSVTVE"
FT   gene            140995..142146
FT                   /locus_tag="Xfasm12_0119"
FT   CDS_pept        140995..142146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0119"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0111 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11158"
FT                   /protein_id="ACA11158.1"
FT                   /translation="MFMKNRSVDGLRGIAAFNVAVSHFVAAFLPSMLHKNYPSTFGKNQ
FT                   HPSGLFDVLTSPMVSIFYNGHFAVLIFFVLSGYVLTMPYYNQDESSGVLSKRLWGRYLR
FT                   LNIPICFAISISYVVYVLGLYLNVHAADMSGSTEWLKNFFPSGISLSDAVKESVFQSII
FT                   FGNSALIPPLWTLKIEFIGSLYVLLFYISKPKRYTFVSALMVLLLIYVIHRQDSIYFYA
FT                   IFLGSFLNELKKSSKLKVVFFFIGFYFGGFQFENSIYNFLPRFMVGHLEVWDKKTFYNL
FT                   IGACFITASVVQGFGEKILQWRITQFLGGISFSLYLLHFVILCSLSSYVYVSLPVGKAS
FT                   LLVNFSCYVLVCVLVSFIFEKYIDKPSINISYKFSKKIFSKQV"
FT   gene            complement(142447..143304)
FT                   /locus_tag="Xfasm12_0120"
FT   CDS_pept        complement(142447..143304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0120"
FT                   /product="spermidine synthase"
FT                   /note="KEGG: xft:PD0112 spermidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11159"
FT                   /db_xref="GOA:B0U1H5"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030373"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="InterPro:IPR035246"
FT                   /db_xref="InterPro:IPR037163"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U1H5"
FT                   /protein_id="ACA11159.1"
FT                   /translation="MTTKDTWFTEHFQATGSAIGFRVTGKLDEVQSPFQKIEIYNSTDW
FT                   GKLMVIDGALMLTSRDNFIYHEMISHPALFTHTAPKCVVIIGGGDCGTLREVLKHPDIE
FT                   QVTQCDIDEQVTRMAEKHFPELCTSNNDPRATLLFSDGVAYMADCPTNSVDVIIVDSTD
FT                   PIGPAKGLFNRTFYESCFRALKNDGLLIQQSESPLALLELIKEMRHEMSKAGFKAFKTL
FT                   PFPQPCYPTGWWSVTLSSKQPNANFAFRQTDAQTKPFDTLYYNAHLHHGVLAPPPFIAH
FT                   ALGE"
FT   gene            143527..145413
FT                   /locus_tag="Xfasm12_0121"
FT   CDS_pept        143527..145413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0121"
FT                   /product="biosynthetic arginine decarboxylase"
FT                   /note="KEGG: xft:PD0113 biosynthetic arginine
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11160"
FT                   /db_xref="GOA:B0U1H6"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002985"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="InterPro:IPR040634"
FT                   /db_xref="InterPro:IPR041128"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U1H6"
FT                   /protein_id="ACA11160.1"
FT                   /translation="MTWSQDLAHKTYSIRHWADGYFEVNDAGHMVVMPLGGDGVRISLP
FT                   EVVDAARAAGAKLPLLLRFPDILRHRLGKLQAAFVQAQSEWEYAGGYTAVYPIKVNQHR
FT                   GVAGVLASHQGDGFGLEAGSKPELMAVLALSRQGGLIVCNGYKDREYIRLALIGRKLGL
FT                   KTFIVIEKPSELRMVLEEAKTLGVLPGLGVRVRLASLGAGKWQNSGGDKAKFGLSPRQV
FT                   LDVWKVLRGTEYADCLNVMHFHMGSQISNVRDIAKGMREATRYFVELSRLGAKITHVDV
FT                   GGGLGIDYEGTRSRSDCSINYGLQAYASHIVQPLASACEDYDLVPPRIVTECGRAMTAH
FT                   HAVLIANVTEVEAVPEGRVPGLCDDEPAVVRHMREIYGELDARPAIELFYEAQHFHAEG
FT                   LAAYTLGQIDLVHRARIDDLFYAISHGVRERLSHEEKSHRPVLDELNERLVDKYFVNFS
FT                   VFESIPDVWAINQIFPIVPIERLNEAPTRRGVVCDLTCDSDGTVKQYVENESLDSALPL
FT                   HVLRHGEAYRIGFFLVGAYQEILGDIHNLFGDTDAVEVAVDGRGYRIAQQRCGDTTDVM
FT                   LDYVGYALDEVRRVYAQRITAAGMSAAESKALSDMLEAGLTGYPYLSDVPLE"
FT   gene            complement(145440..146201)
FT                   /locus_tag="Xfasm12_0122"
FT   CDS_pept        complement(145440..146201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0122"
FT                   /product="oxidoreductase"
FT                   /note="KEGG: xft:PD0114 oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11161"
FT                   /protein_id="ACA11161.1"
FT                   /translation="MTKTILITGATSGFGRAAVHRFANAGWRVIATGRRIERLEALAAE
FT                   WPPGHIHITAFDMRDSATLHTAIQTLPADFADIDVLVNNAGLALGTAPAQHADLAQWRE
FT                   MIDTNITSLVTLTHHVLPTLIERKGTIINISSVAATYPYIGGNVYAGTKAFMKQFSLGL
FT                   RSDLHGTGVRVTSIEPGMAETEFTLVRTGGNQAASDALYRGANPITAEDIAEQIFYVAT
FT                   LPPHLNINRLEIMPVNQSFAGFQVARQPQSQ"
FT   sig_peptide     complement(146124..146201)
FT                   /locus_tag="Xfasm12_0122"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.745) with cleavage site probability 0.380 at
FT                   residue 26"
FT   gene            complement(146329..147075)
FT                   /locus_tag="Xfasm12_0123"
FT   CDS_pept        complement(146329..147075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0123"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0115 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11162"
FT                   /protein_id="ACA11162.1"
FT                   /translation="MATPRARNQARRNTNNAPPGWVWLIAGAAITAIVFLAAPKLFKKN
FT                   DGSLLHIGANSNPNAQPAPVADHNTPIAQPSKPTTKDKPTPKQQEYDFYTLLPGKEVPT
FT                   SNGDRIEKANTVPSNTPPKITSTPAQTTTNDPKPLPELLSPSPAPIPVTPKKPTPAPTS
FT                   PPPAAIADTTRYILQAGSFGTSNEAESTKARLAMLGLSARIESTNIGGKQLYRVRMGPY
FT                   SNANELAEARKKIDSNGLQAITIKTH"
FT   gene            complement(147118..148806)
FT                   /locus_tag="Xfasm12_0124"
FT   CDS_pept        complement(147118..148806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0124"
FT                   /product="Arginine--tRNA ligase"
FT                   /EC_number="6.1.1.19"
FT                   /note="KEGG: xfa:XF0147 arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11163"
FT                   /db_xref="GOA:B0U1H9"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U1H9"
FT                   /protein_id="ACA11163.1"
FT                   /translation="MKAPLRALICQGIEALRSNGTLPTNTLPPDFVVERPKTRKHGDFA
FT                   TNVAMLLSKATGSNPRLLAQTLVAALPTSADIARIEIAGPGFINFHMHPVAYQHETINV
FT                   LKQDNDYGRNLSGQSRTVGVEYVSANPTGPLHVGHGRAAAIGDCLARLLEANGWNVKRE
FT                   FYYNDAGVQIDNLVRSVQARARGLKPGDALWPTDAYNGEYIADIAKAYLAGDSINMVDT
FT                   IITSTKNVDDTAAIHHFAVNYLRNEQNHDLAAFNVDFDIYFLESSLYKDGKVEETVQKL
FT                   INSGHTYEEGGALWLKSTHFGDDKDRVMRKSDGSYTYFVPDIAYHLSKWQRGYERAITE
FT                   LGADHHGSLARVHAGLQALEIGIPPGWPEYVLHQMVTVMRGGEEVKLSKRSGGYVTLRD
FT                   LIEETSTDATRWFLIARKPDSQLTFDIDLARQKSNDNPVFYVQYAYARVCSLMHQAHEK
FT                   NLNYDQTSGMASLDQLSDNTSLCLMIEISRYPEIVQIACELLEPHLIAQYLRELAHAFH
FT                   TWYHNTPVLVENAVERNAKLTLACATRQVLANGLNLLGVGTPEKM"
FT   gene            complement(148933..149661)
FT                   /locus_tag="Xfasm12_0125"
FT   CDS_pept        complement(148933..149661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0125"
FT                   /product="DNA repair protein"
FT                   /note="KEGG: xfa:XF0148 DNA repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11164"
FT                   /protein_id="ACA11164.1"
FT                   /translation="MIHSSLISEKHETRHPTQMHINNWPTHERPREKLLAHGAATLSDA
FT                   ELLAIFLGSGLRGHDAVQTARNLLHTHGPLRELLDRPPGDLMRLPGLGLARACKLTAAL
FT                   ELSTRHLAAALQRGASIHDPISAGRYFAQRLRANPNEVFAVLFLDNRHRAISFEELFHG
FT                   TINGAEVHPREVVRRALTLNAAAVIVGHNHPSGNREPSPADQMITQRLKNALDLIDVRL
FT                   VDHFVIGDGAPVSFAEHGWL"
FT   gene            149705..150934
FT                   /locus_tag="Xfasm12_0126"
FT   CDS_pept        149705..150934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0126"
FT                   /product="DNA/pantothenate metabolism flavoprotein"
FT                   /note="KEGG: xft:PD0118 DNA/pantothenate metabolism
FT                   flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11165"
FT                   /protein_id="ACA11165.1"
FT                   /translation="MTGSHQPRSLNGQRLLLCVSGGIAAYKSLELVRCLCGAGAQVQVA
FT                   MTASAQQFVTPLSFQALSGQSTRTTLWDGNAEQAMGHIELARWAERVLIAPASADVIAR
FT                   LAHGLADDLVTTLCLATTAPLIICPAMNHNMWLHPATQANVAMLLGRGVQVIGPENGPL
FT                   AEGVSGLGRMSEPEAIVVALVQGVSPAPVHGGLFHGQRIVISAGPTFEDLDPVRYLGNR
FT                   SSGKMGFALASAAVSHGAEVVLVAGPVYQPTPPGVTRVDVRSAAQMRDAVLSAFPADVY
FT                   IGAAAVADYAPKSVLPQKIKKSGQTLILELVRTQDILSEVAAQTANLKFVVGFAAETHD
FT                   VACYARGKLAAKHLDLIIANQVGIVGNGFESDDNAVTAYWQGGERVFASCSKVELAERL
FT                   LALIAERMQT"
FT   gene            150931..151398
FT                   /locus_tag="Xfasm12_0127"
FT   CDS_pept        150931..151398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0127"
FT                   /product="dUTP diphosphatase"
FT                   /EC_number="3.6.1.23"
FT                   /note="KEGG: xft:PD0119 dUTPase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11166"
FT                   /db_xref="GOA:B0U1I2"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U1I2"
FT                   /protein_id="ACA11166.1"
FT                   /translation="MSAAVKPLQIKILDPRLGTVWPLPTYATEASAGLDLRAALDAPMT
FT                   LVPGDAELLSTGIAIHLVDPSLCAVVLPRSGLGHRHGIVLGNGTGLIDSDYQGPLLVSL
FT                   WNRGREAFTIEPGDRIAQLVVLPIVRVVLQVVDTFVESGRGAGGFGHTGVR"
FT   gene            152288..153775
FT                   /locus_tag="Xfasm12_0128"
FT   CDS_pept        152288..153775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0128"
FT                   /product="phosphomannomutase"
FT                   /note="KEGG: xft:PD0120 phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11167"
FT                   /protein_id="ACA11167.1"
FT                   /translation="MQEAPERAIVLNEENNVALSSSLHLQFNLEALVQPSLFHEDDIHG
FT                   VVPGELNPGVAKLIGQAIGSAMQAKGLSDIVIGRDGRVSSSELSAALSDGLRHAGCNVV
FT                   DIGLVPIPVVYFAACHLGVGSCVAVTGGHHPHDYNGFKIVLGGESLSSEAMSDLYQCIT
FT                   NGRLYASVDSGSLSERDVVDDYIQRIADDVQLNRPLKIVADPGHGAAEEILSRLFKAIG
FT                   ADLVSLYGDIDGVSLIVHPDSDEPGNLQKLIQRVEQADADLGLAFDGDAASLRVVTREG
FT                   EVILSDSVLMLFATDVLQRNPGALVIYDAECTSKLSDYVLRNGGSPLMWKTGHSSIKAK
FT                   MRETGAELAGEMSGYFFFKEGWYGFEDALYAAARLLEILAQREDNPSQVFAALPHAYFT
FT                   AQMEQSVEGDAQACVQSFIEEVQRSVEGGVFDGARLFAFDGLRADFTDGWGLVRVSDTA
FT                   SALVLRFEADTQAGLERIQSAFRTHLQALLPGQVLVF"
FT   gene            complement(153788..154465)
FT                   /locus_tag="Xfasm12_0129"
FT   CDS_pept        complement(153788..154465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0129"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF0152 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11168"
FT                   /protein_id="ACA11168.1"
FT                   /translation="MSIKKHHIYWNTILFVAVAVAAWPWPGNTQTSAKKLYCWHQNGQR
FT                   VCSDTLPAEAVNAAREEFNAKNGMLKGEVQRALNENERAATASEEAQRRAGQDAQETRK
FT                   RADQIMLASFQTEDDLRQVFLKRIATIDNDLKTARYNATNLRQGLVNLLRNANERELAG
FT                   QKVPEKLAADIEQRRQDLQSQQRLQTSFEQERATLSGEIEETLQRYRALKSSEANPSPL
FT                   TEP"
FT   sig_peptide     complement(154376..154465)
FT                   /locus_tag="Xfasm12_0129"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.935) with cleavage site probability 0.596 at
FT                   residue 30"
FT   gene            complement(154488..155147)
FT                   /locus_tag="Xfasm12_0130"
FT   CDS_pept        complement(154488..155147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0130"
FT                   /product="Orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="KEGG: xfa:XF0153 orotate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11169"
FT                   /db_xref="GOA:B0U1J0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U1J0"
FT                   /protein_id="ACA11169.1"
FT                   /translation="MSHYRQRFLQLALDSNALCFGEFTLKSGRISPYFFNAGHFNSGAK
FT                   TAALAQCYADAIDAANMNFDLVFGPAYKGIPLATALACEYARRERDLLLTFNRKEVKNH
FT                   GEGGTLIGAPLNGRKILIIDDVITAGTAIREALRIIRNAGGTPTGIAVALNRQEIASET
FT                   NRQSSVQALMAETGIPVVAIATLSDLLAFVEENASLAKFYEPLLAYKTHYGTEASD"
FT   gene            complement(155396..155864)
FT                   /pseudo
FT                   /locus_tag="Xfasm12_0131"
FT   gene            155980..156795
FT                   /locus_tag="Xfasm12_0132"
FT   CDS_pept        155980..156795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0132"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0124 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11170"
FT                   /protein_id="ACA11170.1"
FT                   /translation="MTTASLDFPFVAFRSELPMNDYSASDMKCGDLTKEKLIYDYGLSF
FT                   ISFCVDPFNNEEKFITRKNKVISDEEAIVILFDEFRFWARVLSFCRYSSLMQSLISNFQ
FT                   DNKGTPFSDPLLDKAFKDLILNKRSKNSSVARIKSVFDNYIDWERGIFPSENKDYLIEA
FT                   LNSAVYPEFTRVKDIFNGLGLAVHNINSMNIKIDSLHIYNDHYSASVQYQGQDHFGLDD
FT                   GDIIDIRFRYFNIFRTWFVLQRWNKYAFKPFMTNMQANIEISGVRPVNK"
FT   gene            complement(157056..157871)
FT                   /locus_tag="Xfasm12_0133"
FT   CDS_pept        complement(157056..157871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0133"
FT                   /product="cysteine protease"
FT                   /note="KEGG: xfa:XF0156 cysteine protease"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11171"
FT                   /protein_id="ACA11171.1"
FT                   /translation="MHTVLKRRKKSGYGYIPDMADIRDFSYTPEKSVIAALPPKVDLTP
FT                   PFQVYDQGRIGSCTANALAAAIQFERIHDKQSPEFIPSRLFIYYNERKIEGHVNYDSGA
FT                   MIRDGIKVLHKLGVCPEKEWPYGDTPADPRTEEFPPGAPASKKPSDQCYKDAQNYKITE
FT                   YSRVAQHIDHLKACLAAGSPFVFGFSVYNSWVGNNSLPVRIPLPTKNDTLEGGHAVLCV
FT                   GYDDEIRHFRIRNSWGNNVGENGYFWMPYEYISNTQLADDFWVIKTVRK"
FT   gene            complement(158381..158601)
FT                   /pseudo
FT                   /locus_tag="Xfasm12_0134"
FT   gene            159033..160046
FT                   /locus_tag="Xfasm12_0135"
FT   CDS_pept        159033..160046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0135"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0126 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11172"
FT                   /protein_id="ACA11172.1"
FT                   /translation="MERINLNYANLGPDQFERLIVSLCMKILGVGVQGFAKGPDGGCDA
FT                   KFIGTAQHYPSDKNRWSGTMIIQAKHTNGFYSSCSDKKFYSEKSSHTVIGEEIPRIKKL
FT                   RAAKQLDYYMLFTNRRLSATANTKITEYISKQCEIPVESISLCGLEKLDMYFNHFPEAV
FT                   HHAGLDPVDSPLIVRTQELAEIIEALAQFKEKGCQVLRDHSPVIRVPYKEKNEINQLSQ
FT                   EYEKEWRRIYLKEEVFIRNFLAAPENTRFVEIYTSTTEHFRFKIIAKRKDHQSFDALVE
FT                   YLMDLLFNRASVLAQSGHQSLTRALLFYMYWNCDIGKKVDNTEEAEDAASNETLTS"
FT   gene            160015..160263
FT                   /locus_tag="Xfasm12_0136"
FT   CDS_pept        160015..160263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0136"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hch:HCH_10032 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11173"
FT                   /protein_id="ACA11173.1"
FT                   /translation="MLRPTKHSHPDLTVIHLSLLLLKRLRKDRFSRYDVLRALAKQRIA
FT                   GGDVLFLPTLNFLYLLGLIEYRGATDTVEYVGNNEVI"
FT   gene            160320..162047
FT                   /locus_tag="Xfasm12_0137"
FT   CDS_pept        160320..162047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0137"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0127 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11174"
FT                   /protein_id="ACA11174.1"
FT                   /translation="MWSWRKFACQRIGRKIPIILGKLHWDGYSIFAFYRRGTAIYFCLN
FT                   MKSYSIILFFFLEVECEDASFITVRRSVRSATKISFKRHKTGDKDFSTLLPIEWDYWDV
FT                   TFDEARQLLHGMLGWRMLNKWSYRKVLGYLLRSQENFSKVFELSHSVVKHADWKPFLAH
FT                   LLGFDGNCAAEYYKKIQELESKKKEAELLRKAWGRSLDSLEEIETTELRKQDEVNKKQA
FT                   LLDTFDFHAQDPALTEELVDTVDERIAALNARRYSMRSHWKRVKTSLQEGQILFCPDEA
FT                   QVLFDEVGVLFQGQIKKDFEHLIAFNRAITAERHDYLQEELAEIEGALKEINAELDDLG
FT                   KRRAEGLAFLTNRGVFTKYQTLCNEIIALRGEVAFLEYQREPLRKLQALDQYIGTLKHE
FT                   CIDLEERINTDVRQQCSEKENLFASICRYFKEMIREVIDCYGSLRVTTNKHGHLEFHAE
FT                   ITDAAGKPTSADLGNTYRRLMCIAFDLAVLRAYLNDPFPRFVYHDGVFESLDDRKKENL
FT                   LRVIRQYASFGIQSVITLIDSDLPERSVNDLPVFSPDEIVLTLHDEGELGRLFKMQSW"
FT   gene            162857..163657
FT                   /locus_tag="Xfasm12_0138"
FT   CDS_pept        162857..163657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0138"
FT                   /product="DNA-(apurinic or apyrimidinic site) lyase"
FT                   /EC_number="4.2.99.18"
FT                   /note="KEGG: xft:PD0128 exodeoxyribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11175"
FT                   /protein_id="ACA11175.1"
FT                   /translation="MRISSFNANGLRSALSKGFFGWFSTQDIDVLCVQETKAQRHQLVG
FT                   PDFFPAGYHVCFRDATIKKGYSGVAIYSRCEPDELRTTLGWAEFDEEGRYVEARFGNLS
FT                   VVSFYIPSGSSGEKRQHYKFEVMRWLRPILCEWLLSGRDYVLCGDWNIVRSALDIRNWK
FT                   SNQKNSGCLPLERDWLNGLCADSLHDVNSAQGRGWVDTYRVLHPQGEDYTWWSNRGAAR
FT                   VNNVGWRIDYQFVSPGLRERVSRCAIYCEQRFSDHSPYTVEYVL"
FT   gene            163654..165183
FT                   /locus_tag="Xfasm12_0139"
FT   CDS_pept        163654..165183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0139"
FT                   /product="beta-lactamase induction signal transducer
FT                   protein"
FT                   /note="KEGG: xfa:XF0165 beta-lactamase induction signal
FT                   transducer protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11176"
FT                   /protein_id="ACA11176.1"
FT                   /translation="MSDYSERFDVPAVLQNGRRFLTVLLLGFASGLPLALTGGAMQAWL
FT                   TVEGLDLVTLGFLVLVAAPYTFKMLWAPLIDRFDVPWLGRRRGWIVFIQWMLGGALFLM
FT                   GSVSPVHALPLFAVVAVCVAALSATLDVVIDGYRTDLLEPHQRGLGGSLAVLGYRLAMV
FT                   LSGGIALIWAEQWHSWPQVYRVMGGFMFGGGLLSLLLMPRLSGRFVAPVTHGGRELLGF
FT                   LALLVGVVVGALLTRHFFMMFGLDPESRESWVRLLFVIGEIAGGVLLGLLCIRFVRFET
FT                   LNRSLETYFEMPGAWAFLGLVVLYKFGDAFALSLSTPFLINGAHFSQTEVGIANKTVGL
FT                   LMTIVGAVIGGFFLLRVRLSRALFWFGGMQLVSNLGFYALARVGAGFWGSSVIPSFNAL
FT                   IVHLEMPTEMDRLLLFVLSLENFSGGMGTAAFVALLSNLCNVRFSATHYALLSAFASLG
FT                   RVFVGPFAGVLADACGWQAFFLVSLLVGVPGLVIAWCMRTEIDAMSYRFSG"
FT   gene            complement(165344..166489)
FT                   /locus_tag="Xfasm12_0140"
FT   CDS_pept        complement(165344..166489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0140"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0130 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11177"
FT                   /protein_id="ACA11177.1"
FT                   /translation="MPVHDDHCNPNPAPLYLGLMSGTSIDGIDAALVRINANPITHCEL
FT                   IAAQTSAWDPNLRTTLLELSQGQNTASLDQLGWLDAQVGLAFATAANTLIAKTGIKHTQ
FT                   IRAIGCHGQTIRHRPHGDLPFTWQLGDAHRIAELTGITTVADFRRRDVAAGGQGAPLMP
FT                   AFHLAILGSANENRAVLNLGGIANLTLIPMTGPVLGFDTGPANALLDSWYQRHHHETFD
FT                   QSGNFAASGKINQKLLACLLDDPWFTLPPPKSTGREQFHLDWMTKQLEPTPPSPADVQA
FT                   TLLELTAVTVADALLRQQPKTTRLLICGGGAHNPVLMARLAAHLPNVTVESIQTYGLNP
FT                   DYLEAMGFAWLAAQTLDGQPSNLPSVTGARGLRLLGAIHPA"
FT   gene            complement(166553..167968)
FT                   /locus_tag="Xfasm12_0141"
FT   CDS_pept        complement(166553..167968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0141"
FT                   /product="metallopeptidase"
FT                   /note="KEGG: xft:PD0131 metallopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11178"
FT                   /protein_id="ACA11178.1"
FT                   /translation="MQNAEHRHTHKQRIRERLHVLHVSTLHHKLKHTFPAAFNQRWTPR
FT                   HWIHTALFAMIGALIATIIPGLSNNSPPTQLSSLATLALPLPPQYTSTANTWRMVTIKP
FT                   GQTLSSIFNELKLSSNDMERVLNYADLRKVLTRLSPGDEISFDIPNDGQLRGMRFNRDE
FT                   KHRVELTLDDNTIHQQVSERQTSTRTVIASGEIKSSLWIAAREAGLSPVDVITLTDEIF
FT                   KYDIDFDKDLQTGDRFSVVMDETWREGERLPDAKILAATFNTGGKIYSGIRFMRDGKVE
FT                   YFDKEGRPLKKSFIRMPISYARLSSTFGLRRHPILGTMRMHKGVDYAAATGTPIMAAGN
FT                   ARVQFIGQQRGYGNVVILNHGKGYRTLYGHMSRFGKIKAGQKINQGTVIGYVGMTGLAT
FT                   GPHLHYEFQVNGQHRNPLSITMPPPEPLRGKDLIAFRTQTAPLIAQIQQYEKRFYAITN
FT                   KHDSKSTEKSTRG"
FT   gene            168168..169424
FT                   /locus_tag="Xfasm12_0142"
FT   CDS_pept        168168..169424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0142"
FT                   /product="Tyrosine--tRNA ligase"
FT                   /EC_number="6.1.1.1"
FT                   /note="KEGG: xft:PD0132 tyrosyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11179"
FT                   /protein_id="ACA11179.1"
FT                   /translation="MSLVSNSIALIERGANEILKFDELERRLRSGRPLRIKAGFDPTSP
FT                   DLHLGHTVLLNKMRQFQDLGHQVVFLIGDFTGMIGDPTGKNVTRKPLSREDVLANASTY
FT                   EDQVFKVLDRTLTEVRFNSEWFGKMSAVDMIKLAAQHTVARMLERDDFAKRFASQHPIV
FT                   IHEFLYPLIQGYDSIALRADVELGGTDQKFNLLMGRALQEHHGQPPQIVLTMPLLEGLD
FT                   GVAKMSKSLGNYIGIKEPPIDIVTKTMKIGDDLMWRWIELLSFKISAAEAVALREAVAK
FT                   SELNPREVKLRLAHELVSRFYDNAAAEKAIAGWQAVVTGQGNNNLLPLQKINVPADGVR
FT                   LVALLTKSGLAPSNSEAMRKLKERAVRVDGIVVDDAHLHFVPGFEGLIQIGKRNFIKVR
FT                   LVTSSESHEFPESNRIDKS"
FT   gene            170017..171554
FT                   /locus_tag="Xfasm12_R0009"
FT   rRNA            170017..171554
FT                   /locus_tag="Xfasm12_R0009"
FT                   /product="16S ribosomal RNA"
FT   gene            171661..171736
FT                   /locus_tag="Xfasm12_R0010"
FT                   /note="tRNA-Ala2"
FT   tRNA            171661..171736
FT                   /locus_tag="Xfasm12_R0010"
FT                   /product="tRNA-Ala"
FT   gene            171750..171826
FT                   /locus_tag="Xfasm12_R0011"
FT                   /note="tRNA-Ile2"
FT   tRNA            171750..171826
FT                   /locus_tag="Xfasm12_R0011"
FT                   /product="tRNA-Ile"
FT   gene            172020..174901
FT                   /locus_tag="Xfasm12_R0012"
FT   rRNA            172020..174901
FT                   /locus_tag="Xfasm12_R0012"
FT                   /product="23S ribosomal RNA"
FT   gene            175037..175150
FT                   /locus_tag="Xfasm12_R0013"
FT   rRNA            175037..175150
FT                   /locus_tag="Xfasm12_R0013"
FT                   /product="5S ribosomal RNA"
FT   gene            175257..176072
FT                   /locus_tag="Xfasm12_0143"
FT   CDS_pept        175257..176072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0143"
FT                   /product="DNA-formamidopyrimidine glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /note="KEGG: xft:PD0138 formamidopyrimidine DNA
FT                   glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11180"
FT                   /protein_id="ACA11180.1"
FT                   /translation="MPELPEVETTLRGLLPYLTNQLIYSLTLRRRTLRWDIPSHIESRL
FT                   PGHRITTVCRRAKYLLIDTNAGGSLIIHLGMSGTLRLLAPETPLRPHDHVDIMLNNRRV
FT                   LRFNDPRRFGCLLWQEDGQIHPLLQRLGCEPLSDSFNGDYLYQCSRARNVSVKTFLMDQ
FT                   RIVVGVGNIYAAESLFRAGISPLCEADKISLQRYRRLAEVVKDILLYAINRGGTTLRDF
FT                   LSPDGRPGYFKQELFVYGRQQQPCKQCGSLLRQTTIRQRTTVWCGHCQG"
FT   gene            complement(176207..177004)
FT                   /locus_tag="Xfasm12_0144"
FT   CDS_pept        complement(176207..177004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0144"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF0171 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11181"
FT                   /protein_id="ACA11181.1"
FT                   /translation="MLFCELLFNDISRRGEWRIPGLVGLLAHGGYHFLVVLGNAGAVDM
FT                   HFFSVLSMTFFVMSGLTILFSTHVGMGTVGVVVFPLAGLLLAVYHGYGHSPSPELGWRV
FT                   ELHACLALLGYATLGIAALLAMMLWFRERALRRRNVHHWRGALPPLTELEKLLFRTITF
FT                   GFILLTFTVFTGFLFVRDFLEQKLLHKSVLSVLSWVIFGGLLIGRWRYGWRGIKAVHWT
FT                   LTAMMFLVLAFFGSKLMIELMLRHQSSSVSPVRHASYGEQGLR"
FT   gene            177502..179415
FT                   /locus_tag="Xfasm12_0145"
FT   CDS_pept        177502..179415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0145"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0140 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11182"
FT                   /protein_id="ACA11182.1"
FT                   /translation="MSSFLIRLLTLFIVTTLNLFLCLPAPAKAATHKSSKLQTMQTHSK
FT                   SKNQMSVLLGKAEQLNLLYDKYWDDSMRLNPLQATLQGDAYHGDRMPNFLSAEFRKQHH
FT                   DFIEKWLKMVEMVGADGLDGQAFISYQIFVRDARNSLQAERYPNWMLPINQFYNIANVA
FT                   VVLGSGNGAQPFNTVQDYDNWAHRSLGIPALFNQAIVNMRLGMKSGVVQPKVLMEKVIP
FT                   QLDSIIKPTAEETLFWVPIRNMSVSFSKENRQRITAEYKSIIEYRLLPAYRALRNFIAT
FT                   EYLPVCRDSVGLSALPGGASWYAYTVRQSTTTNMTPEQIHQLGLKEVARLQAEIQSVMR
FT                   QLNFNGSMQKFFSFMQNNEYFTFGSEKEMLAYYRDLRTRVEARVPALFSLVPKAGFEIL
FT                   PVEAFRAPSAAAGSYMPPSSNRRHNGVFYANTNDLSSRRTWNAEKLFLHQGIPGYHFQL
FT                   GLQQELRNLPKFRRLGGETAFIEGWGLYAESLGKELGLYQDAYNYFGYLQDALSRAIRL
FT                   VVDTGLHTKGWTRAQVVDYIVENSATSPIEAEAEVDRYIAIPGQALAYKVGELKIHQLR
FT                   QYAQLALGPMFDLREFHAEILKDGSVPLDILQQKIERWIAVKRVNMPSISHQKSRDQRR
FT                   KS"
FT   sig_peptide     177502..177591
FT                   /locus_tag="Xfasm12_0145"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.996 at
FT                   residue 30"
FT   gene            complement(179815..180555)
FT                   /locus_tag="Xfasm12_0146"
FT   CDS_pept        complement(179815..180555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0146"
FT                   /product="3-oxoacyl-(ACP) reductase"
FT                   /note="KEGG: xft:PD0141 3-oxoacyl-[ACP] reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11183"
FT                   /protein_id="ACA11183.1"
FT                   /translation="MITDDSPRFRALVTGGSGHLGTAICRQLIADGAHVIVHANHHRSR
FT                   ADTLVECLCAEGGSAEVIVFDVTAAQASKTALENLLQAGPIQIIINNAGIHDDAPMAGM
FT                   SSTQWHRVIDVSLHGFFNVTQPLLLPMARTRWGRIVCISSVTAVLGNRGQSNYAAAKAG
FT                   LHGAARSLAREMANRGITVNVVAPGVIESEMVGKTFTPEMIKQLVPTGRPGRPEEVAAL
FT                   IGFLCSEKAGYINGQVIGINGGMV"
FT   gene            181102..182706
FT                   /locus_tag="Xfasm12_0147"
FT   CDS_pept        181102..182706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0147"
FT                   /product="peptide chain release factor RF-3"
FT                   /note="KEGG: xfa:XF0174 peptide chain release factor RF-3"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11184"
FT                   /db_xref="GOA:B0U262"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR032090"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038467"
FT                   /db_xref="InterPro:IPR041732"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U262"
FT                   /protein_id="ACA11184.1"
FT                   /translation="MSEVVAETARRRTFAIISHPDAGKTTLTEKLLLFGGAIQMAGSVK
FT                   SRKAVRHATSDWMTLEKERGISVTSSVMQFPYEGKIINLLDTPGHADFGEDTYRVLTAV
FT                   DSALMVIDVAKGVEERTIKLMEVCRLRDTPIMTFINKLDREGKNPIELLDEVERVLGIQ
FT                   CAPVTWPIGMGKRLRGVVNLLTNEVHLYEPGRNFTRQDSTIFTSLEAPGLAERIGEQML
FT                   ADLHEELELIQGASACFDPTEYLGGRQTPVFFGSGVNNFGVQPLLDFFVEHAPSPQQRD
FT                   TTSRVVLPTEEKLTGFVFKIQANMDPQHRDRVAFMRVCSGRFTAGMKAFHVRSSKDLKL
FT                   ANALTFMASDRESVAEAFPGDVIGIHNHGRVSIGDTFTEGEVLSFTGIPSFAPELFRRA
FT                   CLGDPLKLKQLQKGLTQLSEEGATQFFRPLMSNDLILGAVGMLQFDVVAYRLKNEYGVD
FT                   ATFEPVSITTARWVYCDNSKTLEEFREKNVTNLAVDASGELVYLAPTRVNLQLAQERAP
FT                   EIHFFATREHAYAVGVD"
FT   gene            182789..183433
FT                   /locus_tag="Xfasm12_0148"
FT   CDS_pept        182789..183433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0148"
FT                   /product="hemolysin III protein"
FT                   /note="KEGG: xfa:XF0175 hemolysin III protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11185"
FT                   /protein_id="ACA11185.1"
FT                   /translation="MNANAHSSIDSRDELASAIIHGLGALATLAAGSVLITLVSIYGDR
FT                   WQLVTSIVFSTTLFLLYVASTLYHAIPHPGAKARLRVFDHCAIYLLIAGTYTPFTLITL
FT                   RGPWGWGLFATIWTLALSGVVFKLFFTERFRLLSTIVYVVMGWLVVIALGPLQRLLDGW
FT                   TLRWLLAGGVLYTLGTYFYHRDEVRYFHAIWHVFVLAGSVCHFIAVTAQVL"
FT   gene            complement(183658..184671)
FT                   /locus_tag="Xfasm12_0149"
FT   CDS_pept        complement(183658..184671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0149"
FT                   /product="glycosyl transferase"
FT                   /note="KEGG: xft:PD0144 glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11186"
FT                   /protein_id="ACA11186.1"
FT                   /translation="MNRECLTVVIPAYNEAQTLPLLHLRIVAALNTLPELDGRLLYVDD
FT                   GSNDRTWDIIEALVVNDPRVGGIKLSRNFGKEIAITAGLDNTPFGAVLLLDADGQDPPE
FT                   LIPQFVARWRAGYDNVYGTRLERQGEGLIKRFLAASFYRMIGRLSPTPIPTDTGDFRLL
FT                   SPRALQALRQIRERHRFMKGLFGWVGFRQIALPYRREPRLSGRSKFTFWRLWNFALEGI
FT                   TSFSTAPLRVTTYLGLITAVFAFGYGVWIVLKALILGDRVPGWPTMMTVILLLGGVQLI
FT                   ALGLIGEYLGRLYDESKRRPLYFIDTAAGVAECHPQQIIDGKIPQNTASIVDCEQQ"
FT   gene            complement(184960..185742)
FT                   /locus_tag="Xfasm12_0150"
FT   CDS_pept        complement(184960..185742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0150"
FT                   /product="putative deoxyribonuclease"
FT                   /note="KEGG: xfa:XF0177 putative deoxyribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11187"
FT                   /protein_id="ACA11187.1"
FT                   /translation="MNVVLIDSHCHLDADAFDGDRAEIIARAQATGVIAQVIPAVTAAK
FT                   WPKLRTICTQTSGLYPAYGLHPMFLSEHHPTHLHVLREWLERERPCAIGECGLDFYVEG
FT                   LNREIQHTYFISQLMLAREYALPVIVHARHAVEQVIAMIKTVGTLRGVVHSFSGSLEQA
FT                   RQLWKLGFMISFGGALTYPRAHRLHRLAMETPLDCLLLETDAPYQPDSEIRGKRNEPGR
FT                   LLTILEYIATLRKQDRTEISKVTRANTEQLFGLKVTPT"
FT   gene            186091..186864
FT                   /locus_tag="Xfasm12_0151"
FT   CDS_pept        186091..186864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0151"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF0178 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11188"
FT                   /protein_id="ACA11188.1"
FT                   /translation="MNNQMRIVLIALGALLLGGVATAAFMNNRGHDVGYMANGHSDSHT
FT                   AFEYADIIRVDTITEKKMLYAQVVSVDPIRDTARMMAPREICRDVLVQHRLPERDGNVG
FT                   GTAIGALIGGLVGNQFGHGNGRKALTAAGAVAGGFIGNEVDREHVGGRVVERIERRCHS
FT                   ENSMVQSSHVSGYTVIYRKDDGTTGTLHMSNRPGDHVELGQTDNVVGYDVTYLYNGQEK
FT                   TVRLNEKPLGNQLPLVDGHLVNHTTATADHSVNIQ"
FT   sig_peptide     186091..186162
FT                   /locus_tag="Xfasm12_0151"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.939 at
FT                   residue 24"
FT   gene            186874..186966
FT                   /locus_tag="Xfasm12_0152"
FT   CDS_pept        186874..186966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0152"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF0179 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11189"
FT                   /protein_id="ACA11189.1"
FT                   /translation="MVVLSVVFGLGALPPKSRRTNMAAHQRVVS"
FT   gene            187687..188124
FT                   /locus_tag="Xfasm12_0153"
FT   CDS_pept        187687..188124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0153"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0147 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11190"
FT                   /protein_id="ACA11190.1"
FT                   /translation="MAQMSGAGVIGNATREDFFLRATGFFLATVFVDFLAIVFFIAFLV
FT                   TFFNTGLLVLFTAFFAVTVFTTFLAFFTAAFLTATAFFTTAVFFTIAFFNAGFLALFIA
FT                   FFAAIFFIAGFLVFFTTFSAFFVVVFLFVVVFLAATFFVAM"
FT   gene            complement(189486..189881)
FT                   /locus_tag="Xfasm12_0154"
FT   CDS_pept        complement(189486..189881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0154"
FT                   /product="glycine cleavage H protein"
FT                   /note="KEGG: xft:PD0148 glycine cleavage H protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11191"
FT                   /db_xref="GOA:B0U269"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U269"
FT                   /protein_id="ACA11191.1"
FT                   /translation="MSDIPGDLKFLKSHEWVRIEDNNRAIVGISDHAQNLLGDLVYVEL
FT                   PNIGDHLDAGATAAVIESVKAASDIYSPVTGKVIEVNTTLSDKPETINEDPYGEGWIMV
FT                   IEMQAPEEISDLLSPDDYTEVLESDEH"
FT   gene            complement(190412..191518)
FT                   /locus_tag="Xfasm12_0155"
FT   CDS_pept        complement(190412..191518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0155"
FT                   /product="Aminomethyltransferase"
FT                   /EC_number="2.1.2.10"
FT                   /note="KEGG: xfa:XF0183 glycine cleavage T protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11192"
FT                   /db_xref="GOA:B0U270"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR022903"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U270"
FT                   /protein_id="ACA11192.1"
FT                   /translation="MIKKTILNDTHRALGAKMVDFSGWEMPIHYGSQIDEHHHVRRNAG
FT                   IFDVSHMTVIDLHGTQVRPLLRRLLANSVDKLKVPGKALYSCMLNPQGGVIDDLIVYYL
FT                   REDYFRFIVNAATREKDLAWINTQASAFNVRVEERADLAMLAVQGPAARAQVTNLLAET
FT                   HRDAVEKLGRFAALEVASHSKKTLFISRTGYTGEDGFEILLPQEETITLWNALLKTGVK
FT                   PIGLGARDTLRLEAGMNLYGQDMDEQVSPYEAALGWTVMLDEGRNFIGRNVLEQQKTNG
FT                   VSRQMIGLLMDEKGVLRHGQKVLTAQGEGHILSGTFSPTLNKAIGFARVPAGKPSEVRV
FT                   NIRDRAIPVRVVKFPFVREGQTQPNIFD"
FT   gene            complement(191670..192086)
FT                   /locus_tag="Xfasm12_0156"
FT   CDS_pept        complement(191670..192086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0156"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF0184 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11193"
FT                   /protein_id="ACA11193.1"
FT                   /translation="MGWAAAALLLLAAETLIPGAFMLWMGIAAAAMFVGVLLLPDTSLL
FT                   LQMFAFVVLSFVSIYLYRTWFRSVDHDSDHPLLNRRADQLVGRIIILDHAIVDGNARIK
FT                   IDDTFWDITGPDLPIGTQIRIVALDGATLKVHPT"
FT   sig_peptide     complement(191994..192086)
FT                   /locus_tag="Xfasm12_0156"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.886) with cleavage site probability 0.849 at
FT                   residue 31"
FT   gene            complement(192105..193061)
FT                   /locus_tag="Xfasm12_0157"
FT   CDS_pept        complement(192105..193061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0157"
FT                   /product="inner membrane protein"
FT                   /note="KEGG: xft:PD0151 inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11194"
FT                   /protein_id="ACA11194.1"
FT                   /translation="MLPSNVLAFIVLVAGVILLFKSVIMVPQGYEWTVEKFGRYTHTMK
FT                   PGLHFLIPLIYSVGRKVSMMEQVLAVPSQEVITKDNAGVRVDGVVFFQVLDAAKAAYEV
FT                   ANLEIAMIALVQTNIRTVVGSIDFDESLSQRETINAKLLSVVEHATSPWGVKVTRIDIK
FT                   DIQPPHNLAESMQQQKMAEQTRRATILEAEGVRQSAILRADGEKQAAVMEAEGRKEAAF
FT                   RDAEARERLAEAEAKATRILSEAISQGNVQAVNYFVAQKYVEAFKELATAPNQKFILMP
FT                   METSGIIGSIAGIADLTREALGKSDHSATPSQRPHRG"
FT   gene            complement(193396..194229)
FT                   /locus_tag="Xfasm12_0158"
FT   CDS_pept        complement(193396..194229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0158"
FT                   /product="MazG protein"
FT                   /note="KEGG: xft:PD0152 MazG protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11195"
FT                   /protein_id="ACA11195.1"
FT                   /translation="MSDLPDASPHIETLLSIMARLRDPIRGCPWNLEQDFATIAPYTIE
FT                   EAYEVVDAIDRNDLNALKDELGDLLLQIIFHSHMAAEQGAFEFTDVITAITDKMVRRHP
FT                   HVFGDITVDGAETVSTHWEAIKRQEREAVNEQDHSALAGISSGLPEWLRALKLQERATR
FT                   AGFKQAAPIPAIVEMQKTLEQIRQTFLMDTVTHNKAQIEETFGNLLFICIQLAHHAKVD
FT                   PSNALRHTNIQFEKQFRAMEKTAQAAGATLAQMSLSEQQALWKAVNRQETDLSAP"
FT   gene            complement(194263..195081)
FT                   /locus_tag="Xfasm12_0159"
FT   CDS_pept        complement(194263..195081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0159"
FT                   /product="sulfite synthesis pathway protein"
FT                   /note="KEGG: xft:PD0153 sulfite synthesis pathway protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11196"
FT                   /protein_id="ACA11196.1"
FT                   /translation="MAGTSAVITIPSDLHESVIAIATDSGRAIMEIYQDHFQVQIKADM
FT                   SPLTQADLISHQIIVHGLKQLTPSLPVLSEESTGITWEERRHWTSYWLVDPLDGTREFV
FT                   KRNGEFCINIALIHEGIPVYGMILAPVEGTIWHAMHGGQAFRRDGHRDTTLHVRAPAGT
FT                   ALQVAASRSHIDVHTSALLAQMKEITLVSQGSALKFCRLAEGTLDVYPRLGATYEWDTA
FT                   AGQCLLLAAGGTLLNIETGKQFRYNKRETLLNSGFIALGDATLPWRDWLP"
FT   gene            complement(195060..195608)
FT                   /locus_tag="Xfasm12_0160"
FT   CDS_pept        complement(195060..195608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0160"
FT                   /product="ADP compounds hydrolase"
FT                   /note="KEGG: xfa:XF0188 ADP compounds hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11197"
FT                   /protein_id="ACA11197.1"
FT                   /translation="MNRPLPMIHRIEEIGDSQFRRQQLDLEFSNGERRLYQRHVARGYG
FT                   AVVVVPLLDPQTVLLVREYAAGIHRYELGLVKGRIDANETPEQAADRELKEEAGYGARD
FT                   LRVLRAITLVPGYMNHQSWLVMASDLYPERLVGDEPEEIEVIPWKLSKLHDLMLREDFS
FT                   EGRSLAALFIVREWLEHQQ"
FT   gene            195650..197107
FT                   /locus_tag="Xfasm12_0161"
FT   CDS_pept        195650..197107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0161"
FT                   /product="adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase"
FT                   /note="KEGG: xft:PD0155
FT                   adenosylmethionine-8-amino-7-oxononanoate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11198"
FT                   /protein_id="ACA11198.1"
FT                   /translation="MHHNVHQSEILADPCDLQRAERWRQRDLRVLWHPCTQMREHPDTL
FT                   PLVPIVRGEGAWLVGHDGRRYLDAVSSWWTNLFGHADPRISAAIAAQARTLEHVMLAGF
FT                   SHEPAVRLAEALLRLAPRQDGREPLSKVFYADNGSAGVEVALKMAFHYFRNRGEEQRTR
FT                   FIALHNGYHGETIGALAVGDIPLYRRVYAPLLTEVLFAPSPDAYLAEPGQSAAEYALQA
FT                   AEALEALFKRYSGQICALILEPLLQCAGGMRMHHPVYLHRVRELCDAHGALLICDEIAT
FT                   GFGRTGTLFACEQACPAISTDTDDKELGIMPDLLCLSKGLTGGFLPLAAVLTTQQLYEE
FT                   FLDDSRERAFLHSHSYTGNPLACIAALTTLDIFENDCIIERNQVTAARMTQLAASLSGH
FT                   PHVADVRQTGMVVAFELTRDGNKRTPFPPQARLGLHVYRAALARGVILRPLGDVVYWMP
FT                   PYCVDEEQLHLLAETTRVAIDEAIACV"
FT   gene            197098..197832
FT                   /locus_tag="Xfasm12_0162"
FT   CDS_pept        197098..197832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0162"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF0190 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11199"
FT                   /protein_id="ACA11199.1"
FT                   /translation="MRLSRCHVNVPLILGNEIILPELVANHLLRVLRLCEGDTCVLFNG
FT                   DGHDYLARLIATGRREAWARIEGVSEVCNESPLAITLVQAIARGEKMDLIVQKATELGV
FT                   VAIVPVDTERSGVRLDSERVAKRLAHWNNVVVSACEQCGRTRVPEVQMPRALQALPEIL
FT                   DPDTLRLILDPKSEHRLSTLSRLTPVAVTIAIGPEGGWSPRDLEILKDAGFIGFSLGPR
FT                   ILRTETAGLTAIAVLQAQLGDL"
FT   gene            199427..200767
FT                   /locus_tag="Xfasm12_0163"
FT   CDS_pept        199427..200767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0163"
FT                   /product="ATP-dependent RNA helicase"
FT                   /note="KEGG: xft:PD0157 ATP-dependent RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11200"
FT                   /protein_id="ACA11200.1"
FT                   /translation="MNFETLGLLPSLLRALSEQGYEIPTPIQQQAIPLALAGHDLLAAA
FT                   QTGTGKTAAFGLPVLQRLMAASSNVGAGKPRALVLTPTRELATQVHDSLRGYAKYQRVS
FT                   SAVIYGGVGMGNQLDVLRRGVDLLIACPGRLIDHIERRSVDLSGVGILVLDEADRMLDM
FT                   GFLHSIKRILGKLPRQNRQTLLFSATFAEPIKQLALEFMCRPREVMVASHNTVAETITH
FT                   RVHPVDVSRKRELLLYLLAQDSREQTLVFVRTKHGSDKLATFLEKYGIKTAAIHGNKTQ
FT                   GQRLRALNSFKAGRVTVLVATDIAARGIDIDQLPKVINYDLPMVAEDYVHRIGRTGRNG
FT                   VQGEAISLVTQEDAKLLRQIVRLLDRDMDIRDVPDFEPQVPIRWGNSAPGKSKQPAGQH
FT                   PPRKSQHRRAFGKASVHTTPALTKQSGVQHSNGSRNRDGMLPVHQRG"
FT   gene            200848..201204
FT                   /locus_tag="Xfasm12_0164"
FT   CDS_pept        200848..201204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0164"
FT                   /product="6-pyruvoyltetrahydropterin synthase"
FT                   /note="KEGG: xfa:XF0193 6-pyruvoyltetrahydropterin
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11201"
FT                   /protein_id="ACA11201.1"
FT                   /translation="MDIFKVFIIEAAHRLPHVPPGHKCTRLHGHSFRIEVHVSGALESD
FT                   TGWIMDFSDLKRAFQPIYDQLDHHYLNEIEGLENPTSERLAMWVWDRLKPVLPALTEIV
FT                   VHETCTSGCRYRGG"
FT   gene            201760..201897
FT                   /pseudo
FT                   /locus_tag="Xfasm12_0165"
FT   gene            complement(201910..202155)
FT                   /locus_tag="Xfasm12_0166"
FT   CDS_pept        complement(201910..202155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0166"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11202"
FT                   /protein_id="ACA11202.1"
FT                   /translation="MTNPGRYLDRTWQAHQQSVQAQASMAQQLCQALSKHGLCKQAEES
FT                   YLAPSVCRQFRAQRGLRKHDAVFHEPTCRKGQGPDR"
FT   gene            complement(202303..202827)
FT                   /locus_tag="Xfasm12_0167"
FT   CDS_pept        complement(202303..202827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0167"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0159 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11203"
FT                   /protein_id="ACA11203.1"
FT                   /translation="MTTLQRLRCLALFIAMTIAMPLVSTATPPSDADVNRLLSVSRTQA
FT                   IHDSMIPQLEAMEEKQFDKMAAKHTLSTEEKAKMVQILERSKQRIRKAMSWSELEPVYI
FT                   DLYKHSFSREDVLAMTKFYESSAGQSLLDKTPVLMQNLMVAIQKKMAPLTDDLLQDLEK
FT                   IDNAPKQDHKK"
FT   sig_peptide     complement(202747..202827)
FT                   /locus_tag="Xfasm12_0167"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.719 at
FT                   residue 27"
FT   gene            203352..203981
FT                   /locus_tag="Xfasm12_0168"
FT   CDS_pept        203352..203981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0168"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0160 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11204"
FT                   /protein_id="ACA11204.1"
FT                   /translation="MIQTEPTLPPVTQIDPLREAFPENMPCMHGPLVRWLGRTVLKVGG
FT                   WRLIGRLPNQGKVVIIVAPHTSYWDGFFGFACKFAVGVEMRSLIKSSLFWWPLGALLRW
FT                   VGCIPLDRRLPQGTVSQAVRAFRDSERMWYMLAPEGTRKRVERWKHGFWKIAKYADVPV
FT                   LPVYMDYPSKTIGIGDLFWPSDDMEADIAAIRAWYSPCRAKHSNRL"
FT   gene            204249..204413
FT                   /locus_tag="Xfasm12_0169"
FT   CDS_pept        204249..204413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0169"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF0198 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11205"
FT                   /protein_id="ACA11205.1"
FT                   /translation="MNGTEADFFIEKILILGWHEVSRIMDMGRLFEHVWFTFDGLMQVP
FT                   KVFGDPAWL"
FT   gene            complement(204593..205300)
FT                   /locus_tag="Xfasm12_0170"
FT   CDS_pept        complement(204593..205300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0170"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF0199 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11206"
FT                   /protein_id="ACA11206.1"
FT                   /translation="MSADPSSLPQRPSLQRIFLTGLLTLLPVWLTWVVVKFVFSLLSGV
FT                   SSPWVVPLSERIAASFPGYLGWIQALWVQNTIALGVTLLAILFVGTLSRRMIGQRLLRW
FT                   FEAIMRRIPFASVIYDSARKLLDILQTQPGSTQRVVLIDFPHRDMKAVGLVTRVIRDRD
FT                   TGQELAAVYVPTTPNPTSGYLEIVPVEQLTPTNWSVDQAMSFIISGGAVSPDSIPFRRT
FT                   TDQHEDAAKSPRL"
FT   gene            complement(205591..206190)
FT                   /locus_tag="Xfasm12_0171"
FT   CDS_pept        complement(205591..206190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0171"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0162 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11207"
FT                   /protein_id="ACA11207.1"
FT                   /translation="MSNTGKSYDDRYFDQWYRQTKLSSPARLRRKAALAVSQAEYYLER
FT                   PIRSVLDIGYGEGAWRKRLLRLRRHIHYLGFDSSHYAVNRYGLQRNLHLAQIGDFSWLR
FT                   PCAPVDLLVCADVLHYVATRELTRALPGLVELCNGVAFLEIFTAEDAFEGDTTGFQSRQ
FT                   ARWYRRRFTAAGFTALGSHCWLSPVLAGHTTALEHN"
FT   gene            206255..206707
FT                   /locus_tag="Xfasm12_0172"
FT   CDS_pept        206255..206707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0172"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF0202 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11208"
FT                   /protein_id="ACA11208.1"
FT                   /translation="MALYFWVKTFHLLFVIAWMAAVFYLPRILVNVAETDGQPAVQARL
FT                   RQMGRRLYIFGHIMFGLSGLLGVLLWLGYRVIPAFPTMVGDGSGWLHAKVGLVVLILVH
FT                   YIVAGYWLKRAECGGVLPGAGALRVFNEIPVLVLVGILWLVFAKPF"
FT   gene            complement(206873..207832)
FT                   /locus_tag="Xfasm12_0173"
FT   CDS_pept        complement(206873..207832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0173"
FT                   /product="Acetyl-CoA carboxylase"
FT                   /EC_number="6.4.1.2"
FT                   /note="KEGG: xft:PD0164 acetyl-coenzyme A carboxylase
FT                   carboxyl transferase subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11209"
FT                   /db_xref="GOA:B0U1N1"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U1N1"
FT                   /protein_id="ACA11209.1"
FT                   /translation="MNPNYLDFEQPIADLEAKIQELRTASAGPSVNVDTEVRALENKLR
FT                   LRTAQIFRNLSAWQISQLARHPRRPYTLDYISVVCDEFQELAGDRTLADDKAIVGGLAR
FT                   IGHRPVMLIGHQKGRDNKERLMRNFGMPKPEGYRKALRLMKLAERFGLPLLTFIDTMGA
FT                   WPGIDAEERNQSEAIATNLIEMAELKIPVICTVIGEGGSGGALAIGIGDRTLMLEYSTY
FT                   SVITPEGCASILWKDAAKASDAAEQLNLTARRLKEFGLIDKVIREPIGGAHRNPQQMAN
FT                   RLKAVLLNELEALDKVPLVTLLNQRHKRLRTYGAYENH"
FT   gene            complement(207927..211508)
FT                   /locus_tag="Xfasm12_0174"
FT   CDS_pept        complement(207927..211508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0174"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: xft:PD0165 DNA polymerase III alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11210"
FT                   /protein_id="ACA11210.1"
FT                   /translation="MSTSSFVHLHIHTEFSLADSTIRVPEKPEQAHPKKAKQANLLSRA
FT                   VELGLPALAVTDLNNLFALIKFYKAAETVGIKPISGADLLIAEPEHTPWGMTLLCRDHA
FT                   GYLNLSQLISRGWLEGHRPEGGVAVHPDWVRDHHKNLFALIGRHSLVGQLFAKGRADLA
FT                   EQQLADWQRVFGDGLHLELTRTGRDGEEPFNQFALQVAGIRGIPVIASNDVRFLVPSDF
FT                   LAHEARVCIASGRMLDDPKRPRTYSEQQYLRSSEEMAALFTDIPDALDNTRTLAQRCNI
FT                   EMRLGTYFLPNYPVPNDETLDSWIRKQSHEGLEARLLKHPLAPGQTREDYVTRLEFELD
FT                   TIIKMGFSGYFLIVADFIQWGKQQGIPIGPGRGSGAGSLVAWALLITDLDPLPYNLLFE
FT                   RFLNPERVSMPDFDIDFCMERRDEVISYVARKYGRERVSQIITYGTMAAKAVVRDVGRV
FT                   LGFPYGLVDSVAKLIPSTLGITLKDAMGEGETNDNASAELIQRYQAEEDVQELLNLARQ
FT                   LEDLTRNAGKHAGGVVIAPNPLTEFCPLFAEHDENGRGKNPVTQFDKNDVEEVGLVKFD
FT                   FLGLRTLTIIDWAVKAINKRHARACIDPVDITALPLDDLPTYKDIFASGNTSAVFQFES
FT                   SGMRRLLKDARPDRFEDLIALVSLYRPGPMDLIPEFTARKHGVQETIYPDPRTKNILKD
FT                   TYGIMVYQEQVMQMAQIVGGYSLGSADLLRRAMGKKVPAEMAKHREIFREGAAKGGMDA
FT                   VKADEIFDLMEKFAGYGFNKSHAAAYALVSYQTAWLKRHYPAEFMAATLSSDMDNTDKV
FT                   VGFLDEARNLNLKVLRPNINHSAYMFEATHADTIQYGLGAIKGVGQSVCEAIVKERLHY
FT                   GPYTSLLDFCTRVTSAKLNRRALEAMIHAGALDELGKNRASVMLQLPEVIKATEQMSRE
FT                   RESGQNSLFGNADPGTPAIQLDLPECEEWPLTRMLNGERETLGLYFSGHPFDPYRKQVK
FT                   ELVGCDLNTSALERILSSQQRGNGEKRTWQPEVNTILAGLVVSMRRKGDSQVFVQLEDG
FT                   RGRIECSAFSDALAEFGHLLTRDRILIVKGGLREDEFNGGYSLRIRQCWDYAQLCTDYA
FT                   QRLLLRVDLRTSHAWERIDAILARYRPGNTPLRLDLLLNSTHGPVAGTLDLSGGQSVRI
FT                   EQSLLDKLQKDPAVSTLKVKYTPPWVQ"
FT   gene            complement(211797..212723)
FT                   /locus_tag="Xfasm12_0175"
FT   CDS_pept        complement(211797..212723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0175"
FT                   /product="Phosphoribosylaminoimidazolesuccinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /note="KEGG: xft:PD0166
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11211"
FT                   /db_xref="GOA:B0U1N3"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U1N3"
FT                   /protein_id="ACA11211.1"
FT                   /translation="MLTTLLQSDLPGLPLRHCGKVRDVFDIPRKRLPVDTRSGEYLLIV
FT                   ATDRLSAFDVVLPDPIPGKGEILCQISNFWFQKTEHLMPNHLTGINVASVLPDGIDKTL
FT                   YTQRAVVTKKLKPVGIEAIARGYLIGSGWKDYQRTGKVSGIQLPDGLQEAEKLPDPIFT
FT                   PSTKAAVGHHDENIDFDTTVKMIGAELAERVRDATLRIYHFAAKYAAECGILLADTKFE
FT                   FGTDIDGRLYVMDEMLTPDSSRYWPIDEYQVGTSPPSYDKQFVRNYLETLDWDKTAPGP
FT                   TLPQDIIDRTRAKYTEALQRLAGINID"
FT   gene            213261..213590
FT                   /locus_tag="Xfasm12_0176"
FT   CDS_pept        213261..213590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0176"
FT                   /product="DnaJ related chaperone"
FT                   /note="KEGG: xft:PD0167 DnaJ related chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11212"
FT                   /protein_id="ACA11212.1"
FT                   /translation="MHWYGKLFGFIIGALLFRPNPVFGVLIGVLIGHAVDKRRLRHPED
FT                   DPYRVMGLGVGATNAEIELAYRRLMSRYHPDKLAQASPQLREQAEQKVRQINAAYDRIQ
FT                   RRCRR"
FT   gene            213635..214306
FT                   /locus_tag="Xfasm12_0177"
FT   CDS_pept        213635..214306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0177"
FT                   /product="Ribulose-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /note="KEGG: xft:PD0168 D-ribulose-5-phosphate 3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11213"
FT                   /protein_id="ACA11213.1"
FT                   /translation="MSNCLIAPSILSADFARLGAEVDAVLAAGADWIHFDVMDNHYVPN
FT                   LTFGPMVCKALRSYGITAPIDVHLMVEPVDRIVPDFAQAGASMISFHIEASRHVHRTIQ
FT                   LIKSHGCMAGLVFNPATPVDMLDWVLPELDLVLLMSVNPGFGGQRFIPGTLDKLRLVRK
FT                   KIDLLGRPVRLEVDGGVGIDNIGAIAEAGADTFVAGSAIFHARDYGDVIAQMRAVVAAV
FT                   R"
FT   gene            complement(214664..215107)
FT                   /locus_tag="Xfasm12_0178"
FT   CDS_pept        complement(214664..215107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0178"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF0209 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11214"
FT                   /protein_id="ACA11214.1"
FT                   /translation="MKTGSLYQNRTSRAVITGLRILTTNHEDRSPEPTSLRHHIGTSMC
FT                   RHNSTHQIQNTVAISGFQNLNSNLTQAKRYTRLIRKIPATAKHPKFKYAEIHSITGTTA
FT                   NHNSNSNNNKQHTNFSSLLSLYLHQSPIQTHPHTPPPLPGSTS"
FT   gene            215179..216684
FT                   /locus_tag="Xfasm12_0179"
FT   CDS_pept        215179..216684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0179"
FT                   /product="Anthranilate synthase"
FT                   /EC_number="4.1.3.27"
FT                   /note="KEGG: xft:PD0170 anthranilate synthase component I"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11215"
FT                   /protein_id="ACA11215.1"
FT                   /translation="MLSVSGRKVALITAMQFQRQVAEGCTRIPVVREVQSDLDTPLSVY
FT                   LKFADAPYTYLFESVEGGEHFARYSIIGLPARRVYTFHGHTLVVSEFGKVLETRQVADP
FT                   LAEVELLRAQYVVPQLEGLPGFTGGLVGWFGFECIQYIEPRFMGGKKRDELGTPDILLM
FT                   LSEELAVFDSLKGRLYLIVHADPARPHSYVRAMERLDALIHRLRQGGMDYPHSHISEVI
FT                   NEEDFHSSLTREQYHAVVRKAQEYVRSGDIFQVVPSQRLCTQFHARPIDVYRALRTLNP
FT                   SPYMYFIDIGATQVVGSSPEILARLQGDVVTVRPIAGTRPRGATPEHDKRLEMELLADP
FT                   KERAEHVMLIDLGRNDIGRVVEAGSVQVKESFVIELYSHVMHIVSEVTGILKPGLNYVD
FT                   VLRATFPAGTVSGAPKIRALEIIRELEPVCRNVYSGAVGYIGWHGDADTAIAIRTAVIQ
FT                   NGYLYVQAGGGVVYDSDPDLEWQETMNKARALFRAVTQAARGL"
FT   gene            216838..217422
FT                   /locus_tag="Xfasm12_0180"
FT   CDS_pept        216838..217422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0180"
FT                   /product="anthranilate synthase component II"
FT                   /note="KEGG: xft:PD0171 anthranilate synthase component II"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11216"
FT                   /protein_id="ACA11216.1"
FT                   /translation="MLLMLDNYDSFTYNLVQYLQTLGAEVMVIRNDAMTVEQIAALKPE
FT                   RIVISPGPCTPNEAGVSLKLIEQLGFSTPILGICLGHQSIGQAYGGDVVRATNIMHGKT
FT                   SAIYHNGKGVFVGLPNGYDATRYHSLVVDKTTLPDVLEVTAWTENQDGTIEEIMGLRHR
FT                   EYFVEGVQFHPESILTEHGHALLKNFLECPL"
FT   gene            217491..218525
FT                   /locus_tag="Xfasm12_0181"
FT   CDS_pept        217491..218525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0181"
FT                   /product="Anthranilate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.18"
FT                   /note="KEGG: xfa:XF0212 anthranilate
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11217"
FT                   /db_xref="GOA:B0U1N9"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR005940"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U1N9"
FT                   /protein_id="ACA11217.1"
FT                   /translation="MSMTAQKALQRIIEHREILQDEMVQLMRQIMNGEVSGIMVAAILA
FT                   GLRVKKETVGEIAGAATVMREFSRKVNVQDRTHLVDIVGTGGDGWHTFNISTCAMFVAA
FT                   AAGAKVAKHGNRSVSSKSGSADVLEVLGASIELQPLEVAEAIGCIGVGFMFAPIHHPVM
FT                   QVVSPVRREMGVRTIFNILGPLTNPADAPNILMGVFDPDLVCIQAHVLHKLGAERALVV
FT                   CGRDGMDELSLGTTTLVGELRGGRVREYEVSPEDYGMAVSPISNLQVESPAESREMLLN
FT                   VLAGKPGPALDVVALNAGAALYVAGVAQDIGHGVVLASEVLFDGRARDILDQYVAFTRR
FT                   AHYV"
FT   gene            218610..219404
FT                   /locus_tag="Xfasm12_0182"
FT   CDS_pept        218610..219404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0182"
FT                   /product="Indole-3-glycerol-phosphate synthase"
FT                   /EC_number="4.1.1.48"
FT                   /note="KEGG: xft:PD0173 indole-3-glycerol phosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11218"
FT                   /db_xref="GOA:B0U1P0"
FT                   /db_xref="InterPro:IPR001468"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U1P0"
FT                   /protein_id="ACA11218.1"
FT                   /translation="MSNILTKILARKVEEIAERLLHVSQAELVARCADLPTPRGFAAAL
FT                   QATIVHGDPAVIAEIKKASPSKGVLREDFRPAEIAISYELGGASCLSVLTDVHFFKGHD
FT                   NYLSQARDACTLPVLRKDFTIDPYQVYEARVLGADCILLIVAALDDAQLVDLSGLALQL
FT                   GMDVLVEVHDIDELERAIQISAPLIGINNRNLSTFNVSLETTLTMKGLVPRDRLLVSES
FT                   GILTSADVQRLRAAGVNAFLVGEAFMRAAEPGESLREMFFIT"
FT   gene            219401..220123
FT                   /locus_tag="Xfasm12_0183"
FT   CDS_pept        219401..220123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0183"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0174 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11219"
FT                   /protein_id="ACA11219.1"
FT                   /translation="MSALSPSLREDAPLVVFDFDHTLYDGDSGSDLFAWLMLRNPLRLL
FT                   LALLVTPLLGPLVAMLATRRRSLSCYVWIATFGMRYKHEFNKVIRAYVRVHASQIRKRL
FT                   LPKALEVFASHRIAGDCVVVATGAPPELVREILALVADQQEVVPVIGSSIVPRLGAIIV
FT                   ARHCHHEEKMRMLREQGYGDVAVAYSDSTADLPLLMAAKVPVVVNPKPKREKLFRRVLQ
FT                   PGTSIIHWGCPRRGGACD"
FT   gene            221108..221614
FT                   /locus_tag="Xfasm12_0184"
FT   CDS_pept        221108..221614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0184"
FT                   /product="transcriptional regulator (MarR family)"
FT                   /note="KEGG: xfa:XF0216 transcriptional regulator (MarR
FT                   family)"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11220"
FT                   /protein_id="ACA11220.1"
FT                   /translation="MESLETTDLRIAVTCQRFPTYSRNQAVLLGLVKHIYKRIHTDCNR
FT                   FLRRFGLSYPEYDILMIIYGTEDFSLTPTEVAESSGEKPANVTRLTNSLCEKGLIRRSI
FT                   HHNDRRKVTLTLEPAALELLDKALPEACVQMEAQVCNLSEQENQELEHLLKKMLSMIDN
FT                   STDKQ"
FT   gene            complement(222096..222171)
FT                   /locus_tag="Xfasm12_R0014"
FT                   /note="tRNA-Ala4"
FT   tRNA            complement(222096..222171)
FT                   /locus_tag="Xfasm12_R0014"
FT                   /product="tRNA-Ala"
FT   gene            222727..222825
FT                   /locus_tag="Xfasm12_0186"
FT   CDS_pept        222727..222825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0186"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF0218 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11221"
FT                   /protein_id="ACA11221.1"
FT                   /translation="MCMAIWMKEIEKLKRFTCVADDQGVCVLLWFL"
FT   gene            complement(222989..223193)
FT                   /pseudo
FT                   /locus_tag="Xfasm12_0187"
FT   gene            223349..224551
FT                   /locus_tag="Xfasm12_0188"
FT   CDS_pept        223349..224551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0188"
FT                   /product="proline dipeptidase"
FT                   /note="KEGG: xft:PD0177 proline dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11222"
FT                   /protein_id="ACA11222.1"
FT                   /translation="MSIQIGHLTFEQARAQLAPWAQRAPAITVNEYAQRIEQARVLMRI
FT                   QGVDALLVGAGASLRYFTGVPWHASERLVALLILLSGDPLLICPVFEEESLDAVLLLSV
FT                   GKRLWEEHEDPYALVAQAMREHGARTLALDSGATFAVHTGLCRHVDAGAITDATAIVDG
FT                   CRLCKSPAELALMQQACDMTLQVQRLAAGIAHEGIGTDAMVRFIDEAHRALGADNGSTF
FT                   CIVQFGEATAFPHGIPGVQHLVEGQLVLIDTGCTVQGYHSDITRTWIYGKPSDHQRRIW
FT                   DLEQAAQAAAFAVVRPGVACEVVDRAARQVLELGGLGPDYRLPGLPHRTGHGCGLAIHE
FT                   PPYLVRGNRTVLCPGMCASDEPMIVVPGHFGVRLEDHFHVTEDGAHWFTLPSPEIDRPF
FT                   I"
FT   gene            224739..226565
FT                   /locus_tag="Xfasm12_0189"
FT   CDS_pept        224739..226565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0189"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0178 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11223"
FT                   /protein_id="ACA11223.1"
FT                   /translation="MPSICTLAVSLLSVVLLSACSSSSSLSRSDTRDRRVIPSEQAARA
FT                   FDQLLNEQWQYELAHSPEFASIIGDKRYNDRWSDYSSAAVAADRQATVGFLAKFQKVNA
FT                   AALDGQRQLSLILMQRQLQDHLEAIRLRLHEMLLEPVGGVHLELASDADMFPFDDIKDY
FT                   RDYIKRLQRVPALIDQVIEISRQGAQDGLTQPRYLLKTLPAQIRKIAEAAGADSPFASP
FT                   LKTLDQVVTDAAQRAQLRAALITAIDQQVRPAYETLAAFVQNEYAAKGREHEGLWSLPD
FT                   GEARYRFAIHTQTTTDHSPEDIHRIGLREVARIEGEMTAIAISIGYKDLASFRKAVASD
FT                   KAHFAEDDEQILGLYRGYIAGMHVALPKLFEDGDLPKTLLEVRAMPAFRREAPGAEYLQ
FT                   GTPEGSKPAIVMVNTNDAIERTLVNVETTAYHEGVPGHHLQISLAQRLPLPPFRQHAGY
FT                   NAYVEGWALYAERLGKEAGFFKDPYSDYGRLAGELLRANRLVLDTGVHYKRWTRQQMVD
FT                   FFHAHPSDDEPSIQAETDRYIVWPGQALGYKLGEMQILRLRAKAEKVLGARFDLRAFHD
FT                   VVLGGGAMPLDVLAQRIDAWIAQVQGVSQAKR"
FT   sig_peptide     224739..224822
FT                   /locus_tag="Xfasm12_0189"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.620 at
FT                   residue 28"
FT   gene            226604..228368
FT                   /pseudo
FT                   /locus_tag="Xfasm12_0190"
FT   gene            228858..230012
FT                   /locus_tag="Xfasm12_0191"
FT   CDS_pept        228858..230012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0191"
FT                   /product="Queuine tRNA-ribosyltransferase"
FT                   /EC_number="2.4.2.29"
FT                   /note="KEGG: xfa:XF0223 queuine tRNA-ribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11224"
FT                   /db_xref="GOA:B0U1P6"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U1P6"
FT                   /protein_id="ACA11224.1"
FT                   /translation="MSRLQFQLQATDGAARRGQLSFPCGTVQTPAFMPVGTYGAVKAVL
FT                   PGQLCDLGAEIILGNTFHLFLRPGLEVIADHGGLHGFMRWNGPILTDSGGFQVFSLAHR
FT                   RKISEQGVTFAAPTDGAQVFLGPEESMKIQKVLNSDVVMIFDECTPYPATEDVARDSME
FT                   LSLRWAQRSRDAHDALDNDAALFGIIQGGVHPDLRGRSLDGLQAIGFDGYAIGGLAVGE
FT                   SESERNVILEYLHPRLPVDRPRYLMGVGRPEDLVESVARGVDMFDCVMPTRHARNGQYF
FT                   TGFGTVKIRNACYARDVDPIEPGCGCPACVGGYTRAYLRHLDRCNEMLASMLGSLHNLW
FT                   YYETLMANMRAAITAGTFFTFRHSFYLARGLDPPPLPEVASCAG"
FT   gene            230123..230485
FT                   /locus_tag="Xfasm12_0192"
FT   CDS_pept        230123..230485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0192"
FT                   /product="preprotein translocase YajC subunit"
FT                   /note="KEGG: xfa:XF0224 preprotein translocase YajC
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11225"
FT                   /protein_id="ACA11225.1"
FT                   /translation="MEITMNLFDFFIPVAQAQSAAPAGVSPGGGLQMFFLPVILIAVMY
FT                   FSIIRPQMKRQKEYKTMMDHLGCGDEVITAGGIAGVVSVIGDEFVTVEIAENVRVRVQK
FT                   SAIAKALPKGSLPSAK"
FT   gene            230552..232396
FT                   /locus_tag="Xfasm12_0193"
FT   CDS_pept        230552..232396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0193"
FT                   /product="protein-export membrane protein SecD"
FT                   /note="KEGG: xft:PD0182 protein-export membrane protein
FT                   SecD"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11226"
FT                   /protein_id="ACA11226.1"
FT                   /translation="MLELPRWKYVLIFVVLVLSTLYALPNVYQKDPSVQITANRGGHID
FT                   DAFRQQVMSDLQASGIVPKAVTKDGESLMVRLMSLEMQTRASDVLRAKVGENYTVALNL
FT                   ASTVPDWLAKLGGRPMVLGLDLVGGVHFALQVDQKAALNKRMDAFVEEVRSTLGSNRIG
FT                   FRMVERRPDNTIRVTFDDDAHLNEARMVLFKEQVGLSYSVSGNTLIARVSENELRQIAS
FT                   GAVEQNLTTLRNRINELGVAEPIIQRQGDDRIVVELPGVQDTAEAKRLIGATATLEFRG
FT                   VVDGDAYEAVRTGNVPPEARVYYIRGTNQPVLLNKRVIVSGDEMVNATVGVDENGMPAV
FT                   NVTLSNVAGQRMLDYTQRNLYKLMSVVYIERIPTVSMVDGKEVRGVRLKEEALSPTRIA
FT                   GVFGKNFRTTGLEKTEAENLSKLLRAGSLAAPMDFVEEYVIGPSLGAENVERGVTAVVF
FT                   SFLFTLVFFTIYYRMFGVITSLALLFNLLIVVAVMSLFGATMTLPGFAGLALSVGLSVD
FT                   ANVLINERIREELRHGMPPRSAIVAGYDKAGSTILDANLTGLIVGVALYAFGTGPLKGF
FT                   ALTMIIGIFASMFTAITVSRSLSALIYGTRNNLKSLAI"
FT   gene            232416..233381
FT                   /locus_tag="Xfasm12_0194"
FT   CDS_pept        232416..233381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0194"
FT                   /product="protein-export membrane protein SecF"
FT                   /note="KEGG: xft:PD0183 protein-export membrane protein
FT                   SecF"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11227"
FT                   /protein_id="ACA11227.1"
FT                   /translation="MKLFPLHLIPNDTKIDFMRWRKPTLSLMSILFAIAVLVVVFKGFN
FT                   YALEFTGGTLVRTQFAKPVDADQVRQRLEVGGLGNAQVQSVGGGNELLIRLQPYGEHNN
FT                   DDVAKNAAEAVRKVITLPDNPATVQPGEFVGPQVGKDLAMNGVYATIFMLLGFLIYIGF
FT                   RFEWKFAVAASLTAFFDLILTIAYMSLLGREFDLTVLAGLLSVMGFAINDIIVVFDRVR
FT                   ENFRSLRVEPLEVLNRSINQTLSRTVITAVMFFLSAFALYLYGGRSMEGLAETHMAGAV
FT                   IVVVSSVVMAVPLLTIGPLKVSKQDLLPKAKDLESLERRP"
FT   gene            complement(233562..233636)
FT                   /locus_tag="Xfasm12_R0015"
FT                   /note="tRNA-Glu2"
FT   tRNA            complement(233562..233636)
FT                   /locus_tag="Xfasm12_R0015"
FT                   /product="tRNA-Glu"
FT   gene            233717..234982
FT                   /locus_tag="Xfasm12_0195"
FT   CDS_pept        233717..234982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0195"
FT                   /product="polynucleotide adenyltransferase"
FT                   /note="KEGG: xfa:XF0227 polynucleotide adenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11228"
FT                   /protein_id="ACA11228.1"
FT                   /translation="MLCIVPRGHHTISRKDISPNALRVLYRLREAGFGAYLVGGAVRDL
FT                   LVGGHPKDFDLATDATPEQIKQLFRSCRLIGRRFRLAHVVFGREIIEVATFRANSDDGS
FT                   GDRELENGRLVCDNVYGTIEDDATRRDFTCNALYYTIEDFSVRDYVGGFEDVQSRLMRL
FT                   IGDPVRRYQEDPVRMLRAVRLAAKLGFEIEAGTAEPISRMAGLLADVAPARLFEEVLKL
FT                   FLSGHAVVSFEALEDFGLIDVLFPESAKALRANRSGALRRVLIEGLHSTDKRVIKDEPV
FT                   SPAFLFALLLWPGFCHALVTLQLQGVQPEEAQRRAADRVTLHHLERVALPRRFSLPMQE
FT                   IWLLQNRFISRQPKRVLRLLEHPRFRAAFDFLVVRLAASAEHAADVEFWRVAQQQPSED
FT                   SLASAIDAVRFESEEVGVSRQR"
FT   gene            234982..235500
FT                   /locus_tag="Xfasm12_0196"
FT   CDS_pept        234982..235500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0196"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   diphosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /note="KEGG: xfa:XF0228
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11229"
FT                   /protein_id="ACA11229.1"
FT                   /translation="MPRWSSRVTSGNVVAYVGLGANLGPAEMTLRAAIAALDQLPLTRL
FT                   RIASSLYRTPPWGRQDQAEFVNAVAALETGLAPLALLDALLEVECLHGRVRLHGDRWGP
FT                   RTLDLDLLLYGEHVLDLPRLRVPHPHLHERTFVVVPLAEIAAELVLPRHGMVCELLEHM
FT                   DTLGLVPIR"
FT   gene            235533..236351
FT                   /locus_tag="Xfasm12_0197"
FT   CDS_pept        235533..236351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0197"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /EC_number="2.1.2.11"
FT                   /note="KEGG: xft:PD0187 3-methyl-2-oxobutanoate
FT                   hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11230"
FT                   /db_xref="GOA:B0U1Q2"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U1Q2"
FT                   /protein_id="ACA11230.1"
FT                   /translation="MSIYTNSKPWTVPALAEAKRNGSKIVMLTAYDAGFARILDANGVD
FT                   LVLVGDSLGMVVQGHDSTLPVSVHDMVYHTACVARGVRQAMLVVDLPFQADASPERALE
FT                   AATALLRVGAQMIKIEGAGHKLEVISYLVEREIPVCSHLGLTPQSVLRLGGYKVQGRGE
FT                   EAGGRLRAEARAAVEAGATLLLLECVPSQLAAQITTDVSVPTIGIGAGAGCDGQVLVLH
FT                   DLLGLDSGHPRPKFVKDFLAHGGSVAGAVRAYANAVRDGSFPDVEHTYTS"
FT   gene            236348..237193
FT                   /locus_tag="Xfasm12_0198"
FT   CDS_pept        236348..237193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0198"
FT                   /product="Pantoate--beta-alanine ligase"
FT                   /EC_number="6.3.2.1"
FT                   /note="KEGG: xfa:XF0230 pantoate--beta-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11231"
FT                   /db_xref="GOA:B0U1Q3"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U1Q3"
FT                   /protein_id="ACA11231.1"
FT                   /translation="MIDTVTDLSRLRGIVADWRRQGLRVALVPTMGNLHAGHFSLVMLA
FT                   RHYADRVVSSVFVNPTQFGPHEDFQRYPRTPEADMRGLENVGCDVLWLPSVETMYPLGT
FT                   ERTVRLFVPCVSDVLEGTFRPGHFEGVCTVVARLFNQVLPDVAVFGKKDYQQLVVIRQM
FT                   VVDLAFPIEILGGCIVRESDGLAMSSRNQYLSMQQRPQAAEIHRTLIAMRDAVMSGGVH
FT                   ADVEAEAVRRLEAAGFQVDYAVIRLSDLGEPIDGIVISPGIALVAARLGNTRLIDNLEF
FT                   "
FT   gene            237276..237656
FT                   /locus_tag="Xfasm12_0199"
FT   CDS_pept        237276..237656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0199"
FT                   /product="Aspartate 1-decarboxylase"
FT                   /EC_number="4.1.1.11"
FT                   /note="KEGG: xft:PD0189 aspartate 1-decarboxylase
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11232"
FT                   /db_xref="GOA:B0U1Q4"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U1Q4"
FT                   /protein_id="ACA11232.1"
FT                   /translation="MQLSLLKAKIHRATVSHSELNYEGSIAIDGLLLEAAGLYEFEKVH
FT                   IWNVTNGARFTTYAIRAEHGSGIISVNGGAARYVQVGDLVIVAAFAQMSEDEAAVFRPN
FT                   LVYVDAANAMTHTNHSIPTQVA"
FT   gene            237660..239168
FT                   /locus_tag="Xfasm12_0200"
FT   CDS_pept        237660..239168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0200"
FT                   /product="Glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /note="KEGG: xfa:XF0232 glucose-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11233"
FT                   /db_xref="GOA:B0U1Q5"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U1Q5"
FT                   /protein_id="ACA11233.1"
FT                   /translation="MHNGFDALQLHANRLRGVTIPDLLAAELKRPEQYARQVGPLYFNF
FT                   ARQKYDCVALEALFALARNHNVTGAFQRMFCGEQVNVTEGRAVLHTALRGDLSGTSVAV
FT                   AAYTAAAKVRERMYALIAGLDASEVTDIVSVGIGGSDLGPRLVVDALRPISQGRFRVHF
FT                   VSNVDGAAMRRTLDMLDPSRTAGILISKTFGTQETLLNGRILYDWLGGSERLYAVSANP
FT                   ERAVHAFDIVPTQVLPIWDWVGGRYSLWSAVGFPIALAIGSQRFEELLAGAAEFDAYAL
FT                   RVPLEENVAVLHGLTAVWNRNFLGCATYAVMAYDQRLALLPAYLQQLVMESLGKRVKCD
FT                   GTPVDRDTVPVWWGGVGTDVQHSFFQALHQGTNIVPADFIGTIRNDDLYTENHFALNAN
FT                   LLAQIEVLANGQLSDDPHRVYPGGNPSTLILLDALTPQALGGLIAMYEHSVYVQSVIWG
FT                   INAFDQFGVELGKHLAVQLLPALKGESVEVVDPVTRAVLVRLRG"
FT   gene            240237..240313
FT                   /locus_tag="Xfasm12_R0016"
FT                   /note="tRNA-Met1"
FT   tRNA            240237..240313
FT                   /locus_tag="Xfasm12_R0016"
FT                   /product="tRNA-Met"
FT   gene            240874..241521
FT                   /locus_tag="Xfasm12_0201"
FT   CDS_pept        240874..241521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0201"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0192 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11234"
FT                   /db_xref="GOA:B0U1Q6"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U1Q6"
FT                   /protein_id="ACA11234.1"
FT                   /translation="MHHFSAGRNSIGLRQSVSDKGIEIVNLLAPKVEMLGFDLLGAEYV
FT                   LVPSGAILRLYIDIPFAMQPECMVSIDDCERVSREVSAYLDLEEPISGNYTLEVSSPGL
FT                   DRRLFTLEQFARHHNHLVKVGLKLQQHGSRRLQGKIVRVEQVGGFVVLLVNGVELAVDF
FT                   NNIDKARIVPDWSALGLAPLEKSKHDTKKMSQGNKKPSNESAARQAVRGVIR"
FT   gene            241518..243029
FT                   /locus_tag="Xfasm12_0202"
FT   CDS_pept        241518..243029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0202"
FT                   /product="N utilization substance protein A"
FT                   /note="KEGG: xft:PD0193 N utilization substance protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11235"
FT                   /protein_id="ACA11235.1"
FT                   /translation="MSKELLLVVDVVANEKGVPRQIIFDAIEVALASAAKKRYQDRDIL
FT                   TRVTIDQKNGNYETYRRWEVVADDVVMESPERQIRLMDALDEADGVEVGDYIEEQIENP
FT                   DFGRISAQAAKQVIVQRVREAERQQVVDAWKNRVGELVTGVVKRVERGNIYVDLGGGTE
FT                   AFIPKDKGIPRDVIRPGDRVRGYLAEVRSESRGPQLFISRSAPEFMIELFKLEVPEVGQ
FT                   GLVEIKGCARDPGDRAKIAVIAHDNRTDPIGACIGMRGSRVQAVSNELNGERVDIVLWN
FT                   ENPANFVINAMAPAEVQSIIVDEERHSMDLAVAEDRLAQAIGKGGQNVRLASRLTGWQL
FT                   NVMTAEQVAAKSEAEQVAARRLFMDRLEVDEEIASILVMEGFNTIEEIAYVPVGELLAV
FT                   EGFDEDIVEELRARARDALLNAALAEEEVLEHSGPAPDLLELNGMDEITAHALAAHGVR
FT                   TSEDLSDLAADEIVEFDIQGMTVQRAAVLILAARAEEIARLERGE"
FT   gene            243125..245803
FT                   /locus_tag="Xfasm12_0203"
FT   CDS_pept        243125..245803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0203"
FT                   /product="translation initiation factor IF-2"
FT                   /note="KEGG: xft:PD0194 translation initiation factor IF-2"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11236"
FT                   /db_xref="GOA:B0U1Q8"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR013575"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U1Q8"
FT                   /protein_id="ACA11236.1"
FT                   /translation="MSQQTTIRKLAELVNTPVEKLLEQLAGAGMKFSGPDQVVTSTEKM
FT                   KLLGFLRRTHGKSDVSVGTVREAPKKITLNRRRLQEVTVNAGRNKTTVNVEVRQKRTYV
FT                   KTPESEYHTPTKPPIELADAERVEILRKLEESRQRNLAEQQRLAEVDRQRVEEQERKRR
FT                   EEEQAELERQKTESRVVEEILVKTDSNSVKPVSKPISEERTRALPRTVRPTPAARPSVS
FT                   RSDDRNSNGGVRHKPRGSHVIVSDEDDSARRFVGQMHLTAAERARRGSNTRGKGGGSHR
FT                   GATHRGNENSIRSSGAHGFERPTVAVVREVAVGDTITVADLAQKLALKSGDMVKALFKM
FT                   GVMVTITQTIDHDTAVLVSEELGHKVTRASSSDFEDALLAHTEEVHGEPVPRPPVVTIM
FT                   GHVDHGKTSLLDYIRRTKIAVGEAGGITQHIGAYHVETPRGVISFLDTPGHAAFTSMRA
FT                   RGAKITDIVVLVVAADDGVMPQTKEAVQHARAAGVPLIVAVSKIDKSTADPQRVKNELL
FT                   TESVVAEEFGGDTQFVELSAKTGVGVDALLDAISIQAEVLELKAVIEGRATGTVIESSL
FT                   DKGRGPVATVLVQQGRLKKGDYLVCGTHYGRVRALFDEVGHQPLAASPSIPVQVLGLSG
FT                   VPDAGDDFVVVDDERLAKDVAQQREAKRRESRLVTSAGNRMEDILAQMGKGENQQVLNL
FT                   LIKADVQGSLEALKQALVALSNDDIRINVIHVGVGGITESDANSAVTSKATVIGFNVRA
FT                   DASARKIIEANGVDLRYFSIIYDVIDQVKQVASGLLGVEIREEIIGVAEVRDVFRSSKF
FT                   GAVAGCMIIEGVVKRSKPIRVLRDNTVVFEGELESLRRFKENVDEVRNSTECGIGVKAY
FT                   NDVRVGDSIECFERIEVARTL"
FT   gene            245914..246291
FT                   /locus_tag="Xfasm12_0204"
FT   CDS_pept        245914..246291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0204"
FT                   /product="ribosomal-binding factor A"
FT                   /note="KEGG: xft:PD0195 ribosomal-binding factor A"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11237"
FT                   /db_xref="GOA:B0U1Q9"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U1Q9"
FT                   /protein_id="ACA11237.1"
FT                   /translation="MPKKSFQRTERISVQIRRDLGAFVQAAVRDHGLPSMSVSDVEVTR
FT                   DMAHAKVFVTVLQAERSFEAVAGLKALARELRMQLAQTMRLRFVPELHFHYDDSLDRGE
FT                   RINTLLRDLIPPADAEKDESG"
FT   gene            246388..247290
FT                   /locus_tag="Xfasm12_0205"
FT   CDS_pept        246388..247290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0205"
FT                   /product="Pseudouridylate synthase"
FT                   /EC_number="4.2.1.70"
FT                   /note="KEGG: xft:PD0196 tRNA pseudouridine synthase B"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11238"
FT                   /protein_id="ACA11238.1"
FT                   /translation="MSRIAYRRLDGILLLDKPAGISSNSALQVARRLLRAKKGGHTGSL
FT                   DPLATGLLPLCFGEATKIAGLLLDSTKAYDADVLLGTTTTTDDAEGAVLLTRPVPTLDA
FT                   EMVDALIPQLIGRIRQRAPIYSALKQGGEPLYVKARRGEVVNAPVREVEVHAIELLVLA
FT                   TPRLQLRVTCGSGTYIRSLVRDLGEILGCGAHITALRRRWVAPFHIPKMLTLDSLEQAL
FT                   SAGRDPDSLLLPLVEGLAGFPALELDAQRLACFRLGQRLRDHSFQTGRVAVFSRDGIPA
FT                   GLGEVDSEGLLVPQRLFNL"
FT   gene            247469..247729
FT                   /locus_tag="Xfasm12_0206"
FT   CDS_pept        247469..247729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0206"
FT                   /product="30S ribosomal protein S15"
FT                   /note="KEGG: xfa:XF0238 30S ribosomal protein S15"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11239"
FT                   /db_xref="GOA:B0U1R1"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U1R1"
FT                   /protein_id="ACA11239.1"
FT                   /translation="MSIDTQSIIENNKRSAHDTGSPEVQVALLTARIELLTKHFKIHKK
FT                   DHHSRRGLLQMVNRRRSLLDYLNKKDNERYKLLIEKLGLRR"
FT   gene            247884..249986
FT                   /locus_tag="Xfasm12_0207"
FT   CDS_pept        247884..249986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0207"
FT                   /product="Polyribonucleotide nucleotidyltransferase"
FT                   /EC_number="2.7.7.8"
FT                   /note="KEGG: xfa:XF0239 polynucleotide phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11240"
FT                   /db_xref="GOA:B0U1R2"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036456"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U1R2"
FT                   /protein_id="ACA11240.1"
FT                   /translation="MAKITKTFQYGKHTVTLETGEVARQASGAVIVKMDDTVLLVTVVA
FT                   AKTAREGQDFFPLTVDYQEKFYAGGRIPGSFFKREGRATEKETLISRLIDRPIRPLFPE
FT                   DYKNEVQIIAMVMSLDPEIDGDIPAMIGASAALSLAGIPFKGPIGAAKVGYNDGQYILN
FT                   PTVSELKKSQLELVVAGTANAVLMVESEAALLSEEVMLGAVIFGHREMQKVIQVIDSLT
FT                   AEAGTEPSDWVPPAKNDALVIALKEVIGGRLSDAFHIREKLQRRDAIAAVKDDVIQQLA
FT                   GRLEVEGWNLAELLKEFGELEYRTMRDALLDTKVRIDGRSLEAVRPITVKVGVLPRVHG
FT                   SGLFTRGETQAIVVTTLGTARDGQVIDAVTGEYKENFLFHYNFPPYSVGECGRFGVQKR
FT                   REIGHGRLARRGVLAVMPSLDEFPYTIRVVSEITESNGSSSMASVCGSSLALMDAGVPV
FT                   KAPVAGIAMGLVKEGERFVVLSDILGDEDHLGDMDFKVAGTSEGVSALQMDIKIEGITE
FT                   EIMRQALQQAKVGRLHILGEMDKALAAPRAELSDYAPRLLTIKIHPDKIRDVIGKGGST
FT                   IQAITKDTGTQIDIQDDGTIVIASVNNAAAREAKRRIEQITSDVEPGRIYEGKVAKIMD
FT                   FGAFVTILPGKDGLVHVSQISSERVERVGDKLKEGDVVRVKVLEVDKQGRIRLSIKAVE
FT                   EEVASI"
FT   gene            complement(250150..250584)
FT                   /locus_tag="Xfasm12_0208"
FT   CDS_pept        complement(250150..250584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0208"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0199 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11241"
FT                   /protein_id="ACA11241.1"
FT                   /translation="MNMFASIASSAPPPGWENLPFDATKCPVRDVLDHIGDKWSLLILL
FT                   TLVPGPTRFSAIQRAVPDISKRMLTQTLRHLERNGMIGRTVYPTKPPRVKYALTPLGES
FT                   LLVPVMHLLKWASTHYDEVLSARDRFDHAQQGGLAIACRI"
FT   gene            250693..251574
FT                   /locus_tag="Xfasm12_0209"
FT   CDS_pept        250693..251574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0209"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0200 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11242"
FT                   /protein_id="ACA11242.1"
FT                   /translation="MTRTISRILVTGTSGQLGALVIEELLKKIHASHLIAAARDPKALM
FT                   AFSRRGVETRLLDYTDQISIDAAFQGVERLLLVSSNAIDQRLVQHRNVIEAAARAGVGL
FT                   FAYTSLLHADNSSLLLAKDHVQTEALLKGSGIPYVLLRNGWYTENYTDSIGAALVHGAV
FT                   LGSAGTGRIAAATRADYAAAAAAILASDVDQAGRTYELAGDEAFTMPEYAAEIAQQSGK
FT                   PVIYRDLPEAEYAAILMQVGLPESFAAILAQSDIGASQGALFDDSHQLSTLIGRPTTPL
FT                   REVVAKALSAVR"
FT   gene            complement(251886..252233)
FT                   /locus_tag="Xfasm12_0210"
FT   CDS_pept        complement(251886..252233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11243"
FT                   /protein_id="ACA11243.1"
FT                   /translation="MFGDVSHLKTQGKYNDGTIQKDQGNISPAMALRNLTLLHRRWSAI
FT                   KPLGYRYQTNQQHAQFFCALRIQEEQSDGAQSQVKWCIYSIHAMPFRYSTWQSSDPFMQ
FT                   CSAISELTLRL"
FT   gene            complement(252843..253954)
FT                   /pseudo
FT                   /locus_tag="Xfasm12_0211"
FT   gene            complement(254025..254915)
FT                   /locus_tag="Xfasm12_0212"
FT   CDS_pept        complement(254025..254915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0212"
FT                   /product="acriflavin resistance protein"
FT                   /note="KEGG: xft:PD0201 acriflavin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11244"
FT                   /protein_id="ACA11244.1"
FT                   /translation="MKITHVAMSANRLTLFTAVLLLIAGIATFLNFPSQEEPSVTVRNT
FT                   LISVAYPGMPSEQVETLLAKPIEERLREIVGIKKIVSTVRPGSVLIQLTAYDNVKNLET
FT                   LWLRVRAKVAEAGTGLPAGTLGPFLNDDFGRVAVASIAITAPGFSMSEMREPLRQMREQ
FT                   LYTVPGVERITLHGLQEDQVYVTFDRARLVEAGLTPGAVIQQLQAQNVVAPGGLVSASG
FT                   MALTVATSGEVRSVDELRRFLVSVPGSASAREVPLSQIAQVQVMPADPPQTAAVYQGQS
FT                   AVVLAVSMTRGRNIS"
FT   sig_peptide     complement(254805..254915)
FT                   /locus_tag="Xfasm12_0212"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.915) with cleavage site probability 0.752 at
FT                   residue 37"
FT   gene            complement(254912..256022)
FT                   /pseudo
FT                   /locus_tag="Xfasm12_0213"
FT   gene            complement(256075..256233)
FT                   /pseudo
FT                   /locus_tag="Xfasm12_0214"
FT   gene            complement(256484..256786)
FT                   /locus_tag="Xfasm12_0215"
FT   CDS_pept        complement(256484..256786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0215"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF0247 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11245"
FT                   /protein_id="ACA11245.1"
FT                   /translation="MQQQYQEHRTRFLRHALIQRMHTIMLRLIASIHAPPTLPIQHNML
FT                   SAHFTPAPSACILTPHNLIFVTLFLRNPKQIAAQGPLLAGLTHLNNTGNIQTLAS"
FT   gene            256809..257327
FT                   /pseudo
FT                   /locus_tag="Xfasm12_0216"
FT   gene            complement(257309..257797)
FT                   /locus_tag="Xfasm12_0217"
FT   CDS_pept        complement(257309..257797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0217"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0203 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11246"
FT                   /protein_id="ACA11246.1"
FT                   /translation="MPMSSHATLNNRHIYSESPEHNWPYCAEYCKNPTIAGALDGKRHV
FT                   MVLTINEINVPPKRMNNAHARCLLQCTRNRRQHNGFNNNHGQQQLKSTSNRKSKQPLPI
FT                   QAVPASTNKVSRNGCYAQKPHYSTRHSEILEAHRCASHVTTLDVTPPSAFIAHQIPHK"
FT   gene            257830..258792
FT                   /locus_tag="Xfasm12_0218"
FT   CDS_pept        257830..258792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0218"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0204 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11247"
FT                   /protein_id="ACA11247.1"
FT                   /translation="MLISSKVRTAQLQIHVCVLLWGFTAIFGRLITLEALPLVWWRMTM
FT                   VVVSLVLLPRVWRGLRALHPRVMLAYAGIGALVALHWLAFYSAVKLANASVAATCIALA
FT                   PVFTAVVEPCVVGRPFRARELLLGLMVLPGVALVVGGVPDGMRIGIFIGVVSALLAALF
FT                   GSLNKRMVVHADPLTVTALELGSGILTLTGLMLLLSLVFPTLHEMPWQIPSAHDIFLLL
FT                   ILSFACTLLPFALSLVALRYLSAYSLQLVTNLEPVYSIALAIVLLGEQRELTGLFYLGV
FT                   AVVLGVVLLHPMLERRGRASSPQRSSSIAQLINSKEGMQ"
FT   gene            258898..259068
FT                   /pseudo
FT                   /locus_tag="Xfasm12_0219"
FT   gene            complement(259085..260914)
FT                   /locus_tag="Xfasm12_0220"
FT   CDS_pept        complement(259085..260914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0220"
FT                   /product="ATP-dependent RNA helicase"
FT                   /note="KEGG: xft:PD0205 ATP-dependent RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11248"
FT                   /protein_id="ACA11248.1"
FT                   /translation="MSNPSSTPLLFADLGLSDAVMQAVTKIGYETPSPIQAATIPALLA
FT                   GRDVLGQAQTGTGKTAAFALPLLTRTVLNQVKPQVLVLAPTRELAIQVAEAFQRYAASI
FT                   SGFRVLPVYGGQSYGQQLAALKRGVHVIVGTPGRVIDHLERGTLDLSELKTLVLDEADE
FT                   MLRMGFIEDVEEVLRKLPASRQVALFSATMPPQIRRIAQTYLQDPIEVTIATKTTTAAN
FT                   IRQRYWWVSGLHKLDALTRILEVETFDAMIIFVRTKAATEELAEKLQARGLTAAAINGD
FT                   MQQAQRERTIHQLKDGKLDILVATDVAARGLDVERISHVLNYDIPYDVESYVHRIGRTG
FT                   RAGRSGEAILFVTPREKGMLRQIERATHQPIEAMQLPSVDAVNDTRVTKFFGRISNALV
FT                   VGAEIDFYRKLLQRFESEHNVPAIEIAAALARLLQGDSPFLLSVPTRPQRERSELASEH
FT                   HVKRPSSFKQTERPNNTEHPKRPQRNAPARNVPEFGMESYRIEVGRMHGVKPANIVGAI
FT                   ANEAGLESRYIGRIDIRDDHSVLDLPAEMPHEILQHLKKVWVSGQQLQMHRIDTTETTA
FT                   PAREFKSKPGGAGKFPPKPHHNKSTKPKPPYSG"
FT   gene            260963..261229
FT                   /pseudo
FT                   /locus_tag="Xfasm12_0221"
FT   gene            complement(261231..262181)
FT                   /locus_tag="Xfasm12_0222"
FT   CDS_pept        complement(261231..262181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0222"
FT                   /product="electron transfer flavoprotein alpha subunit"
FT                   /note="KEGG: xft:PD0206 electron transfer flavoprotein
FT                   alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11249"
FT                   /protein_id="ACA11249.1"
FT                   /translation="MTKLLIIAEHLDGQLNAATAKTVSAALALSPEAIDIAVLAAIPDS
FT                   VAAQAQHIAGVTRVLTIANPANKHPIAQILAPQIAALVQTNSYTHVFGPSTTFGKDLMP
FT                   VVAALLNVNQISDLMGLQDAYTFTRPIYAGNAIITVKAPTDQIVVATIRTASWPEAAKG
FT                   GNATIETVTVSAHLPNHTRFLSLDVHTCDRPDLQNAKRVVAGGRGLGSPENFKLIYTLA
FT                   DTLGAAVGASRAAVDAGYVPNELQIGQTGKIIAPDLYIAIGISGAIQHLTGIKDAGTIV
FT                   AINQDADAPIFEIADIGLVGDLFQLIPELDMALNK"
FT   gene            complement(262178..262927)
FT                   /locus_tag="Xfasm12_0223"
FT   CDS_pept        complement(262178..262927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0223"
FT                   /product="electron transfer flavoprotein beta subunit"
FT                   /note="KEGG: xft:PD0207 electron transfer flavoprotein beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11250"
FT                   /protein_id="ACA11250.1"
FT                   /translation="MKILVAYKRVVDYNVRIQVKPDGSGVMTEGVKVSANPFDEIALEE
FT                   ALRLRDAGIASEVVIATLAPNDVTAHLRNGLAMGANRAIHIVTHTTVQPLTAARALLKL
FT                   VEKEHPALVILGKQAIDDDANQTGQMLATLWGRPQATFASKVTIADGKATVTREVDAGL
FT                   ETLHIDLPAVITADLRLNAPRFIKLPDIMKAKSKPLETIAFADLGVTAHDSLQTTHYAP
FT                   PKKRNQGVMVKNVTELVTLLKNQGALS"
FT   gene            263143..264204
FT                   /locus_tag="Xfasm12_0224"
FT   CDS_pept        263143..264204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0224"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /note="KEGG: xft:PD0208 dTDP-glucose 4,6-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11251"
FT                   /protein_id="ACA11251.1"
FT                   /translation="MGLATWLVTGGAGFIGGNFVLQAISLGHRVINLDALTYAGHLETL
FT                   AALDGCAEHLFVHGDIGDRALVSCLLDTHRPDAVLNFAAESHVDRSIDAPAAFIQTNVV
FT                   GALLLLEAVCGYWKALPEAARATFRFLHVSTDEVYGSLGETGAFTERTAYAPNSPYSAS
FT                   KAASDHLVRAFHHTYGLPVLTTHCSNNYGPYHFPEKLIPLVITKALAGEPLPVYGDGRH
FT                   VRDWLFVGDHCTALCAVLAGGRVGETYNIGGQAERENLEVVRMICCLLDERRPRADGLS
FT                   YQSQIVHVADRPGHDRRYAIDTSKLVNQLGWAPVYRFEQGLALTVDWYLQHQDWVRAVL
FT                   QGRDRVEGLLTAV"
FT   gene            264267..265154
FT                   /locus_tag="Xfasm12_0225"
FT   CDS_pept        264267..265154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0225"
FT                   /product="glucose-1-phosphate thymidylyltransferase"
FT                   /note="KEGG: xfa:XF0256 glucose-1-phosphate
FT                   thymidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11252"
FT                   /protein_id="ACA11252.1"
FT                   /translation="MTQRKGIILAGGAGTRLYPITQGIGKQLLPVYDKPMIYYPLSVLM
FT                   LAGIRQVLVITMLHEQPLFQRLLGDGTQWGMEICYAVQASPDGVAQSYLIGRAFVDDKP
FT                   SCLILGDNIFYGHGLTDTLCHADARTVGATVFGYWVSDPERYGVAEFDGDGRVINIEEK
FT                   PAQPRSNYAVTGLYFYDGRAPAFAAELTPSARGELEITDLNRRYLAEGALYLEALGRGF
FT                   AWLDTGTHQSLQDASNFIGTIQTRQGLQVCCPEEVAFWKGWIDATHLERLAAPLAKNAY
FT                   GQYLLNLAQRGRSL"
FT   gene            265151..265708
FT                   /locus_tag="Xfasm12_0226"
FT   CDS_pept        265151..265708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0226"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /EC_number="5.1.3.13"
FT                   /note="KEGG: xfa:XF0257 dTDP-4-dehydrorhamnose
FT                   3,5-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11253"
FT                   /protein_id="ACA11253.1"
FT                   /translation="MKVIDTALPGCLVIEPRVFDDARGEFFEAWNAECFERQGMSSRFV
FT                   QSNVSISMYGVLRGLHYQWPRPQGKLVGVLEGEVYDVAVDIRLGSPHYGRWVAVLLSAK
FT                   NKRQLWIPEGFAHGFVVLSERAVFNYLCTDVYVKEADAGIRWNDAVLGVDWPIATPLLS
FT                   AKDQKAPFMEEVPIDRLPIYVP"
FT   gene            265705..266613
FT                   /locus_tag="Xfasm12_0227"
FT   CDS_pept        265705..266613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0227"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number="1.1.1.133"
FT                   /note="KEGG: xft:PD0211 dTDP-4-dehydrorhamnose reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11254"
FT                   /protein_id="ACA11254.1"
FT                   /translation="MTVLVFGAGGQIGQELLRSLSGRVVCAVTRSGRLPNGRGCVQADF
FT                   DRPETLRPLLDAQRPVQVVNAAAYTAVDRAESEPDVVFRINAQAPGVIAHWCAEHGVPL
FT                   VHYSTDYVFDGQGTSPYGVDDPVAPLNIYGASKLAGECAVRAAGGCSLILRTSWVYAAH
FT                   GHNFLRTMLRLGATSECLRVVADQIGTPTAAGLIADVTAQLLVEQVQSRHAGIWHLTAA
FT                   GQTSWHGFAEEIFAQAQACGLMMRVPQVQAIGSVVYPTAARRPGYSCLDTTALVEAFGI
FT                   VLPDWRQGVRGVLDEIVNRSR"
FT   gene            complement(266781..268184)
FT                   /locus_tag="Xfasm12_0228"
FT   CDS_pept        complement(266781..268184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0228"
FT                   /product="Mannose-1-phosphate guanylyltransferase (GDP)"
FT                   /EC_number="2.7.7.22"
FT                   /note="KEGG: xft:PD0212 phosphomannose
FT                   isomerase-GDP-mannose pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11255"
FT                   /protein_id="ACA11255.1"
FT                   /translation="MNDILPVILSGGSGTRLWPLSREAYPKQFLPLVGHHSMLQATWLR
FT                   AAPVTTHSPIVVANEEHRFIAAEQLQHLGVYPSAILLEPTGRNTAPAIAVAALEATRTG
FT                   NDPLLLVLPSDHVIRDETAFQTAVHVATEAAAQGKLVTFGITPNTPEIGYGYIKATGND
FT                   TIRPVERFIEKPDLATAQSYLSSGDYFWNSGMFLFRASRYLAELSTFQPAIAEACQRAW
FT                   SAAKRDTDFIRLDKEAFESSPADSIDYAVMEHTADAVAVPLDAGWNDVGSWSALHEVSK
FT                   QDNDGNAHQGDVIQIDCRNTYAYGSRLIAMVGLENVVVVETDDALLVGHRDSIQTVKEI
FT                   VGKIKANGRPEATRHRKVYRPWGAYDSIDTGQRFQVKRITVKPGGTLSLQMHHHRAEHW
FT                   IVVSGTAEVTRGSEILLLTENQSTYIPLGVTHRLRNPGKLPLELIEVQSGSYLGEDDIV
FT                   RFEDTYGRT"
FT   gene            complement(268242..269591)
FT                   /locus_tag="Xfasm12_0229"
FT   CDS_pept        complement(268242..269591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0229"
FT                   /product="Phosphomannomutase"
FT                   /EC_number="5.4.2.8"
FT                   /note="KEGG: xft:PD0213 phosphoglucomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11256"
FT                   /protein_id="ACA11256.1"
FT                   /translation="MSLPAFKAYDIRGRVPDELNEDLARRIGVALAAQLDRAAPVVLGH
FT                   DVRLTSPSLQEALSAGLRASGREVIDIGLCGTEEVYFQTQYRNAAGGVMVTASHNPMDY
FT                   NGMKLVREQARPISSDTGLFTIRDAVAADIATITPPTAAEHQYLDKSAYIAHLLSYVDS
FT                   NALKPLKLVVNAGNGSAGLIVDLLAPHLPFEFVRIFHEPDGHFPNGIPNPLLPENRDAT
FT                   AQAVKHHGADLGIAWDGDFDRCFFFDHTGRFIEGYYLVGLLASVILSKHPGGKIVHDPR
FT                   FIWNTVEMVEAAGGIPVLSKSGHAFIKEKMRKENAVYGGEMSAHHYFREFSYADSGMIP
FT                   WLLIAELISRSGRSLADLVENRMQQFPCSGEINFKITDTKTATARIMDHYTAQSPTIDH
FT                   TDGISADFGDWRFNLRSSNTEPLLRLNVETRNNAALLKQRTDEISALLRA"
FT   gene            269798..269998
FT                   /locus_tag="Xfasm12_0230"
FT   CDS_pept        269798..269998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0230"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0214 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11257"
FT                   /protein_id="ACA11257.1"
FT                   /translation="MCSLFGQVFNTNPSDVNEDTVSASLADLWFKLSSRIERVFSSLGR
FT                   QFAGQWSLWERTDGAQNFELK"
FT   gene            complement(270185..270493)
FT                   /locus_tag="Xfasm12_0231"
FT   CDS_pept        complement(270185..270493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0231"
FT                   /product="colicin V precursor"
FT                   /note="KEGG: xfa:XF0262 colicin V precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11258"
FT                   /protein_id="ACA11258.1"
FT                   /translation="MRELTLTEIDNVSGADLGSRLSAAIVGSVAAFFAGSIWGGTHGGD
FT                   GGGILGVGSIGQGVGMIYGGIAGAIGGAIAGFVLDKNVTYSYTNGFMASIFNGTFAK"
FT   gene            270830..271138
FT                   /locus_tag="Xfasm12_0232"
FT   CDS_pept        270830..271138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0232"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0217 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11259"
FT                   /protein_id="ACA11259.1"
FT                   /translation="MRELTLIEIGNVSGGDFASRLEASIVGSVAAFFAGSIWGGTRGGD
FT                   GGGVIGIGSIGQGVGMIYGGIAGAIGGLIAGFVIDKDLTYTYTTGFMNSLFSGTFAK"
FT   gene            271444..271548
FT                   /locus_tag="Xfasm12_0233"
FT   CDS_pept        271444..271548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0233"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF0265 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11260"
FT                   /protein_id="ACA11260.1"
FT                   /translation="MLTANTFYLTAVYCPQPSMIQKTFGYQVPAENRR"
FT   gene            272989..275985
FT                   /locus_tag="Xfasm12_0234"
FT   CDS_pept        272989..275985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0234"
FT                   /product="serine protease"
FT                   /note="KEGG: xft:PD0218 serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11261"
FT                   /protein_id="ACA11261.1"
FT                   /translation="MKNMKTTFFPGSILVLTLVAFLSACGGSGLVRPPTPTPTPTPTPT
FT                   PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPLPDLDPALAAKFRVHL
FT                   DVTNTEPAHTLGFTGKGYMIGVVDSGVNRNHVTLHDQVIHNNVYVDYQDPASPDDVSGH
FT                   GTNVAQLIAGQPVEYWPGGIAPGATIFSARVFSSAAESAKEGPIGGNFFEGEAAQLKRV
FT                   NADMIAAGVRIQNNSWGYENQNTGDKQVWIDPAVTDGFVNVYRDLVLNNNVLVIFASGN
FT                   YSQQQPGRLSRLPSLPTVEGGASPADLERGWLVVAALDSFDHPDQLTSYSNHCGIAMHY
FT                   CLAAPGDLIEIDTNVTTSPVDGDKGYLNGYLIQNGTSFAAPLVSGAAALVWEAFPYFSN
FT                   DLVRQTLLGTATDLGAPGVDEVFGYGALNVGKAVLGPAKFDWGDVQVSFDDRRSTWGND
FT                   ITGSGGLIKRGTGTLMLGGSNNQYTGATQVLGGTLQASSLGASAVSVANTATLIGSGRF
FT                   GGAVSNAGTLELGKDGLKVQGDYTQLETGRLALYVGDQLSVAGNATLKGGELQVLGKRD
FT                   YVTFNTSYSVLQADGSLTGTFSQLTWGPAVLLGEGRLTYGANNAYVTLQRLNVSAAAQA
FT                   LGIVDRVAQASAQRVEQAFRAIDAQQAQGRGALPTSFIGAAAALQQSSSAAVAAGSLQS
FT                   LSGQSHVAAAAASLDAIDLGRRSLATRLDVLRSGERIVTWHQALGGPGQNGAASGTFSL
FT                   SGWLVGHDAQLASGDIVGVAFGQADSSPSGSASGLRGIDRQVQGRVYLQRTQGPLYVLG
FT                   QLGFGSFQRRLDRQLQLGDWNDWTSSRYSGQFWSGSVEAGYHWRQGSLALTPYLGLDQT
FT                   QLRTDGFREQSGSGFGLQVQSAQATRSQLLAGVRTEWRWGGVQWRGYGEWQQTLRQSGL
FT                   NPQASFTATSSWTPLVASSWPGRSGGVLGLSMVLPVGVTAGLWTMGLEHYFGTRSRGES
FT                   LGLRYQLGF"
FT   sig_peptide     272989..273069
FT                   /locus_tag="Xfasm12_0234"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.608 at
FT                   residue 27"
FT   gene            complement(276445..277632)
FT                   /locus_tag="Xfasm12_0235"
FT   CDS_pept        complement(276445..277632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0235"
FT                   /product="sugar transporter"
FT                   /note="KEGG: xft:PD0219 sugar transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11262"
FT                   /protein_id="ACA11262.1"
FT                   /translation="MKILEEKKSASNLNHLKTAFFGMIILSLGIGIGRFLHTPILPVML
FT                   HEGQFTFSQLSYIASANYAGYLLGSLFFSFGKLGNTSRTTMMLYGAAIVTNVMIFAMAC
FT                   TSHFFLVMLIRFTAGISSAAMMIFGSITVMRHTFNVRVIASLYAGVGIGILLGNEYVVI
FT                   GLRHGLNASALWYGASLLSFIFLLLLFVLTPHVEDKPREASASFPVQQNPFLWWQLAAL
FT                   YGCAGFGYIIIATYLPLIAKTFNVPFIAEHLWSLVGLTIIPSCFAWLWAAQRWGTRRCL
FT                   TINLLIQGCCVLLTLLSQAPFLLVISCIGFGATFMGTTSLVMPLTRQIRAPHRINLLGL
FT                   VTLTYGIGQILGPLLTSLLHSRLNTVTPAIMCGAVALFVAAGICQYCLDKKAVNV"
FT   gene            complement(277932..278090)
FT                   /locus_tag="Xfasm12_0236"
FT   CDS_pept        complement(277932..278090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0236"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF0270 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11263"
FT                   /protein_id="ACA11263.1"
FT                   /translation="MHHATQAQQHDNLNTLQFKYQWIDVTSCINTGYAHVQRADQSMHA
FT                   LNTASQT"
FT   gene            complement(278515..279090)
FT                   /locus_tag="Xfasm12_0237"
FT   CDS_pept        complement(278515..279090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0237"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0220 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11264"
FT                   /protein_id="ACA11264.1"
FT                   /translation="MRRHTLLGLLLFLSITTTAVNAAPQIHGREIIIPAEDIQPFVSNH
FT                   FPQTKTLLGGLIELSTSQPHIAIPPGHRMTLSFDLAISSGGGQPSPLGRVGLSSAMYYD
FT                   TARQAFFLDQPTLEHFKPAHSGIELDEQIREFINTWLQNYARREPVYQLSPALTAMLGN
FT                   VHLQSSTITNGHFSLTFDRDISPLIPDN"
FT   sig_peptide     complement(279022..279090)
FT                   /locus_tag="Xfasm12_0237"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 23"
FT   gene            complement(279137..279247)
FT                   /locus_tag="Xfasm12_0238"
FT   CDS_pept        complement(279137..279247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0238"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF0273 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11265"
FT                   /protein_id="ACA11265.1"
FT                   /translation="MNRLIEHRNKQQHADTKRPDDLCLHQEALQSQTARL"
FT   gene            complement(279504..280787)
FT                   /locus_tag="Xfasm12_0239"
FT   CDS_pept        complement(279504..280787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0239"
FT                   /product="6-phosphofructokinase"
FT                   /note="KEGG: xft:PD0221 6-phosphofructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11266"
FT                   /protein_id="ACA11266.1"
FT                   /translation="MSSPYKSSSHMAKETLLYAQSGGVTAVINATAAAVITEARSHRVK
FT                   VLAARNGILGALREDLIDTSKESITAIRALTHTPGGAFGSCRFKLKSLEADHDKYERLL
FT                   EVFKAHNVRWFLYNGGNDSADTALKVSQLAKTFDYPLHCIGVPKTIDNDLAITDASPGF
FT                   GSAAKYTAVSICEAARDVAAMAETSTKVFIYEAMGRHAGWLAAAAGLAGQGQEEAPHII
FT                   LLPERTYDETAFLAKVQQVVDRVGWCVVVASEGIRSNDGRFVADAGGTTDAFGHTQLGG
FT                   VAAYLASRVKQALGLKVHWTLPDYLQRSARHIASKTDWEQAQAVGKAAVRYALEGMNAV
FT                   MPVIVRTSDTPYRWKIEPAALTKIANHEKTLPASFLRRDGFGISERARTYFEPLIRGEA
FT                   PMPYERNGLPRHVHLKNQSVQKRLPAWE"
FT   gene            280901..281464
FT                   /locus_tag="Xfasm12_0240"
FT   CDS_pept        280901..281464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0240"
FT                   /product="adenylate kinase"
FT                   /note="KEGG: xft:PD0222 adenylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11267"
FT                   /db_xref="GOA:B0U1U0"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U1U0"
FT                   /protein_id="ACA11267.1"
FT                   /translation="MRLVLLGPPGSGKGTQAAQMKETLQIPHISTGDLLRSEVVAGTPL
FT                   GLQAKQVMAQGDLVSDAILIGMLESRLSHTDVVKGFILDGYPRNLSQAAALDGLLAKFG
FT                   HPLNAVVQLEVPTDVLVERIAGRAQAEGREDDTPDAVRKRLQVYNDSTAPVIGFYQQRG
FT                   ILLRVDGVGRLDEVSQRIAVALGC"
FT   gene            281764..283185
FT                   /locus_tag="Xfasm12_0241"
FT   CDS_pept        281764..283185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0241"
FT                   /product="UDP-N-acetylmuramate-L-alanine ligase"
FT                   /note="KEGG: xfa:XF0276 UDP-N-acetylmuramate-L-alanine
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11268"
FT                   /protein_id="ACA11268.1"
FT                   /translation="MNKLHILGIAGTFMGGIAALARELGWHVAGSDQAIYPPMSVQLER
FT                   LGITLMQGYLPEHIAADCAEVVVGNALSRGNAAVEALLDSGCRYISGPQWLAERVLPGR
FT                   DTLAVAGTHGKTTTTTILAWLLEAAGRAPGFLIGGVPENFGVSARLGGVLSQGSMDPLV
FT                   AGEVSAAVRPLFVVEADEYDTAFFDKRSKFVHYRPRVAILNNLEYDHADIFPDVAAIQR
FT                   QFHHLVRTIPGRGRLIVNGEDQRLAEVLAMGCWTPVERFGFDPEFHWSARLIAADGSRF
FT                   SVWHEGCEVGQVRWSLLGRHNVLNVLAALAAAHAVGVAPAAVIPSLTQFRSVKRRLECL
FT                   GERGAVTVYDDFAHHPTAIATTLEGLRANVGDARIVVAIEMRSHSMRLGAHAQALAPSL
FT                   QAADTVVFLDHPGLVWNAAGVVAQMHVHGQVHVVHDTEGLLSMLNEVVHASDHVVFMSN
FT                   GGFDGAPRRFLAQLR"
FT   sig_peptide     281764..281829
FT                   /locus_tag="Xfasm12_0241"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.983 at
FT                   residue 22"
FT   gene            complement(283354..285408)
FT                   /locus_tag="Xfasm12_0242"
FT   CDS_pept        complement(283354..285408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0242"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0224 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11269"
FT                   /protein_id="ACA11269.1"
FT                   /translation="MNTPWITATLAWIEQHPALAGFVIFAIAFSDAVIILGAIVPALPL
FT                   LFAVGLLIGLDKINGLYAVACASLGAFAGDALSFWIGYRWGHRLREIWPFNRYPQLLHR
FT                   GESLFRGNAFKSILVARYVGAVRPFVPAIAGMLRMPLKHYAFASGLACLSWGALFLAPG
FT                   WLLGEAYDAVAAVAGRLLLVIGLLLLVLGVVWAVVLYSYRWAARNLDQSIARLLTWSHR
FT                   HPTLGRWSISVFDPQRRESVPLAVLAVMLLLLGWGWFALLMIVLVHGEPLPMDLAVNNM
FT                   MLALRNPLADYPMTALASLGDWQILLPAITVAMAYLAWHKRWMAVLHWLAALGFGLAFT
FT                   WLLGKTMHVVQPPAASSGFGFPSVAVTIVTITLGFFAVLIARELPGRNRVWPYMVTGAL
FT                   ASLIGFARLYLGAHWLSDVLGGMLFGIFWLLVLGIAYRRRLTHELQVKPLSWLFYGTFS
FT                   IAAMVMAHRHLEQKLTKFEPPPPSPRTIAAEGWWKNDWRELPARRNEFDDAERWPLNVQ
FT                   VAGSLVPLQQHLETQGWRRQPQAGWKEALHLLDVNSQPNTVPVLPATLDTRVEALLMVR
FT                   NSPHADECYVLRLWPTATQLQPEQQPLWLGSVQTLHYDRHFSLMGLWYPLRGVDLALKE
FT                   LQSSLSALHHREEHHPDTNTPILLIDNRAPTVPTGAPTIPQEPNGLPTR"
FT   gene            285498..286157
FT                   /locus_tag="Xfasm12_0243"
FT   CDS_pept        285498..286157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0243"
FT                   /product="serine/threonine protein kinase"
FT                   /note="KEGG: xft:PD0225 serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11270"
FT                   /protein_id="ACA11270.1"
FT                   /translation="MSRPFYVSETLKADCFGRILLVNGKGEKFIRRDLGAVSWWLRGLA
FT                   GWLARREVAALRQLNTLPAVPRFLNWDGVCLDRSFLSGQMMYQCPPRGDLAYFRAACRL
FT                   LQQMHRCGVVHNDLAKEANWLVLEDGSPGVIDFQLAVRGDPRAPWMRLLAREDLRHLLK
FT                   HKRMYCPEALTPVERRLLKRPSWIRRLWFATGKPVYRFVTRRVLHWEDNEGRGAKP"
FT   gene            286308..286478
FT                   /locus_tag="Xfasm12_0244"
FT   CDS_pept        286308..286478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0244"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF0279 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11271"
FT                   /protein_id="ACA11271.1"
FT                   /translation="MSALVGVSQQQIRTLCIGDCGASVSWAVAGCSRILMNERWLAPFG
FT                   AVWLGPSVAYL"
FT   gene            complement(286469..287836)
FT                   /locus_tag="Xfasm12_0245"
FT   CDS_pept        complement(286469..287836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0245"
FT                   /product="Leucyl aminopeptidase"
FT                   /EC_number="3.4.11.1"
FT                   /note="KEGG: xfa:XF0280 leucine aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11272"
FT                   /protein_id="ACA11272.1"
FT                   /translation="MPIPFGFTVATTNTLPLHVLDRARFANWLTAQSPAIQSWVQAQGF
FT                   AAAAGSVLLLPGEHGLSGAVLGTGDYADPYAYAHGPFALPAGTHWQPTGTWDPIKQATL
FT                   TLGWGLGSYRFTRYRLPDRAPAELAVTPTPETLALIQACLRVRDWVNTPTQDMGPEELQ
FT                   TITRDLAQTHGGTFESIIGEALLTQNFPTIHAVGRASHRAPRLLQLNWGQHTHPHLVLI
FT                   GKAVCFDTGGLDLKPADGMRHMKKDMGGAAHALALAGLVMEQQLPVRLTVLIPAVENAI
FT                   GPDAFRPGEVIVTRAGVSVEIDNTDAEGRLILCDTLAYANELKPHTILDFATLTGAARI
FT                   ALGPDLPALFSNNEVLAQAWLDAGKQTRDPVWRMPLWRPYLHYLNSHVADLANAGSRMA
FT                   GAVTAALYLERFVAQDLPWAHLDVYAWNDLNRPGRPAGGEALGLRSAWAMLKERYR"
FT   gene            complement(287960..289069)
FT                   /locus_tag="Xfasm12_0246"
FT   CDS_pept        complement(287960..289069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0246"
FT                   /product="transport protein"
FT                   /note="KEGG: xft:PD0227 transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11273"
FT                   /protein_id="ACA11273.1"
FT                   /translation="MTDQPTHNNCNNDAIKRRRSPLTARPQAPLSLVVLATLAVGYTLW
FT                   ATQAVILPVLLAVFFALVGNPILRALGHIRIPRAIGALLLLCLGISGTVVLSVELAGPA
FT                   SEWIQQAPDKIRQVARQVRHLTRPMQQANQAVESLARAADGETERQSQTVRTRLYNPYT
FT                   LLMDTHKLVISVLGVILLTFFFMVFGEKLQRKAIALLPNHHQQRFTASILRNLEHEISR
FT                   YVLTISVINALVGLIFSVLLLLLSIPLQEALLWGTVVALLNFAPYVGPLIGVLLMLLIG
FT                   LVQFHESSRALLPALLYLMLHTLEGQLITPIILGHRMAISPLMLIVALLLFGSLWGLIG
FT                   LLLAVPMLVCIKMVLSRIEDLQRWSRLLE"
FT   gene            complement(289143..289523)
FT                   /locus_tag="Xfasm12_0247"
FT   CDS_pept        complement(289143..289523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0247"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0228 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11274"
FT                   /protein_id="ACA11274.1"
FT                   /translation="MSFRTLCHRVERAERLVEERSKQTCNHWQELQHSWQATWTPLRIV
FT                   ITGLGLGFIAGRVKPSITLKTFTDKFGSAKHLIQILGAMSTFFTTTCADNASKRDKPST
FT                   EESHTSTTSQPTADIINLSEHA"
FT   gene            complement(289520..289996)
FT                   /locus_tag="Xfasm12_0248"
FT   CDS_pept        complement(289520..289996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0248"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF0283 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11275"
FT                   /protein_id="ACA11275.1"
FT                   /translation="MNNQDTADRVSQSTAADVNPSDIQDSVETVTGAGRASLASSKATV
FT                   RAFYLLLLSDLKMAWSALGHAFIWACIMIVLGVSSWLLLIGITISLLERMGLPWLESLI
FT                   LTALGNLIMTGLAVWRMLHYLRHTGLHATRRQLLRLALLHGTDESQLTTEKDRS"
FT   gene            complement(290002..290367)
FT                   /locus_tag="Xfasm12_0249"
FT   CDS_pept        complement(290002..290367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0249"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0230 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11276"
FT                   /protein_id="ACA11276.1"
FT                   /translation="MMNPTNTEHLKDNLSQAGARLKSAALAASEAVKDAAGAASEELKQ
FT                   GRSNVKVQLSDSAQAGLAAAEFSTAAAKEQVDALMDKGRNLLDSAAELIRERPLTSLGV
FT                   ALAAGWVIAKLSNNHDK"
FT   gene            complement(290621..292066)
FT                   /locus_tag="Xfasm12_0250"
FT   CDS_pept        complement(290621..292066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0250"
FT                   /product="heat shock protein"
FT                   /note="KEGG: xft:PD0231 heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11277"
FT                   /protein_id="ACA11277.1"
FT                   /translation="MRPLPTLLTLSIAAAFGGFAATGMNAWLDNRAEAASNTNAISPIS
FT                   SLPTGTVPQTTAANQPLPSLAPMLQQVMPAVVSINSKQVVRVRNPFFDDPILRRLFPEI
FT                   PQERINESLGSGVIIDARNGYVLTNHHVIENADAVQVTLADGRSFKAEFLGSDADTDIA
FT                   LIRIKANKLTEIKLADSNKLRVGDFVVAIGNPFGFTQTVTSGIVSAVGRSGILGLGYQN
FT                   FIQTDASINPGNSGGALVNLHGQLVGINTASFNPQGSMAGNIGLGLAIPSNLARNVVEQ
FT                   LVTKGVVVRGTIGVQTQNIDARMAQSLGLSNPHGALVTRVLPNSAGAAAGLQPGDVILA
FT                   ANDQRVDNAETLHNYEGLQPVGSSVTLEVHRGGKPLKIRLTLKELPRTIAGETLDSRLS
FT                   GAIFVDLPEFLRQSGIGGVMVNKVKHGSRAAANGLVAGDVIIAAPIGEFSDLASWQASF
FT                   SRPPQRLILRVLRGNAQYDALMR"
FT   sig_peptide     complement(292004..292066)
FT                   /locus_tag="Xfasm12_0250"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.642 at
FT                   residue 21"
FT   gene            complement(292349..293245)
FT                   /locus_tag="Xfasm12_0251"
FT   CDS_pept        complement(292349..293245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0251"
FT                   /product="cell division inhibitor"
FT                   /note="KEGG: xft:PD0232 cell division inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11278"
FT                   /protein_id="ACA11278.1"
FT                   /translation="MHLLITGGTGFIGTPLCAMLIGGGHQVTVLSRDPTRHSARLPQVQ
FT                   LVNTLENVVTPIDAIINLAGKSLLEGRWNKHIKEEIRSSRLQTTRRLYDWIATLAVEQR
FT                   PRRLISASAIGYYGECGDTPLKESAPPGNDFAAQLCRDWENEALRISALGSQVSLIRIG
FT                   IVLERDGGALGQMLPAFRFGVGGRFGNGQHWMSWIHREDLINMIIWLIEHGQPGAYNLT
FT                   APHPVINAAFVRALGAILHRPTLFTLPPQLLRLCFGEIADLLTLSQRVKPGRALEEGYR
FT                   FKHTDINAALASILRKN"
FT   gene            complement(293950..295659)
FT                   /locus_tag="Xfasm12_0252"
FT   CDS_pept        complement(293950..295659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0252"
FT                   /product="long-chain fatty-acid-CoA ligase"
FT                   /note="KEGG: xfa:XF0287 long-chain fatty-acid-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11279"
FT                   /protein_id="ACA11279.1"
FT                   /translation="MSQTRPWLQHYPSGISTEIDTDAFRTIADVFNTSVIKYRHCPAYT
FT                   NFGKTLTYGEVDLLTKQFASYLLNVLKLKKSDRIALMMLNCLQYPVATFGALCAGLAVV
FT                   NVNPLYTACELKHQLVDAGSTVLVVMDNFCTTVQHIIADTPIKQVITTELGDLLDFPKR
FT                   SLINFAVKHIKKLVPEYQLPRSIRFREALALGSKHSMPPIHIASDDLAFLQYTGGTTGT
FT                   PKGAMLTHRNMVANMQQVSQWLQTSNSLKEGCETVLTALPLYHIFALTANNLVFMKIGG
FT                   CNHLISNPRNMRAFVKELQRVRFTVITGVNTLFNKLLNTPGFDKLDFSSLKIALGGGMV
FT                   IQRSVAEQWKQVTHVPLIEAYGLTEASPAACINPLNLQEHNGSIGMPIPSTDVCIKDDT
FT                   NTVLPIGEIGELCIKGPQVMKGYWQRPEETSEVLDADGWLHTGDIVKMDKQGFLYIIDR
FT                   KKEIILVSGFNVYPKEIEEVIAMIPGVAEVAAVGVPDEQSGEVVKVVIVKKDPMLTAEE
FT                   VKAHAATNLTRYKLPRIIEFRATLPKTDVGKILRRELRDAAPASTTFTAQPK"
FT   gene            complement(295678..295845)
FT                   /pseudo
FT                   /locus_tag="Xfasm12_0253"
FT   gene            complement(297151..299877)
FT                   /locus_tag="Xfasm12_0254"
FT   CDS_pept        complement(297151..299877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0254"
FT                   /product="aconitase"
FT                   /note="KEGG: xft:PD0234 aconitase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11280"
FT                   /protein_id="ACA11280.1"
FT                   /translation="MRDSFSTHRQLHVGNQSYHYYSLTKLGEHFDISHLPYSMKILLEN
FT                   LLRHEDGGVTVSTAHIEAVAKWNPKAEPDTEIAFMPARVLLQDFTGVPCLVDLAAMRDA
FT                   AIRLGGTAEQINPHIPSELVIDHSVQVDVFGKPEALERNGNIEFQRNKERYGFLRWGQK
FT                   AFNNFKVVPPNTGIVHQVNLEHLARVVMTTEKEGATWAYPDTVFGTDSHTTMINGIGVL
FT                   GWGVGGIEAEAAMLGQPSSMLIPQVVGFKLTGTLPEGATATDLVLTVTQMLRKHGVVGK
FT                   FVEFYGDGLAHLPLADRATIGNMAPEYGATCGIFPIDTESLNYLRLSGRSESQIALVQA
FT                   YAKAQGLWYAPNTPPPSYSTTLELNMDDIKPSLAGPKRPQDRVLLQDMQNNYREHVRAL
FT                   TAHRTTKANDHDTHPIKGQVDLDINGQTLQLKDGAVVIAAITSCTNTSNPAVMFGAGLL
FT                   ARNAVAKGLQRQPWVKTSLAPGSRVVTDYLEKAGLLNDLETLGFYVVGYGCTTCIGNSG
FT                   PLPPEVSAGIAKGDLVAAAVLSGNRNFEGRIHPEVKMNYLASPALVVAYAIAGTVNSDL
FT                   TSEPLGNGNDGQPVYLRDIWPSNKQIGDAIAATIGPEMFQQNYADVFKGDTRWNTIASP
FT                   NGALYAWDAHSTYIKNPPYFDGMTMQTEPVKDVRGARVLGLFADSITTDHISPAGNIKQ
FT                   DSPAGRFLQEHGVQPTDFNSYGSRRGHDDVMVRGTFANIRLKNLMLNGEEGGNTWYRPK
FT                   AGGPPEKMSIYDAAMKYNTDGVPLVVIAGKEYGTGSSRDWAAKGTKLLGVKAVIAENFE
FT                   RIHRSNLVGMGVLPLQFLDGQNAQTLGLDGSEIFDVTGLEGTISKHATVSAKQSDGSIK
FT                   QFQVKVLLLTPKEVDYFTHGGLLQYVLRHLINTGKPA"
FT   gene            300147..300374
FT                   /locus_tag="Xfasm12_0255"
FT   CDS_pept        300147..300374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0255"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xcb:XC_2328 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11281"
FT                   /protein_id="ACA11281.1"
FT                   /translation="MDATVAERGQITLPKRVRDALGLTKGTVLKVELEGGRIILRKSVD
FT                   DAIARARGRFILDDLDDFGCSATATKTDKQ"
FT   gene            300379..300777
FT                   /locus_tag="Xfasm12_0256"
FT   CDS_pept        300379..300777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0256"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF0291 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11282"
FT                   /protein_id="ACA11282.1"
FT                   /translation="MIAVDFPVLVELLTDRPQADAVEAALRQCLVSGRVVVCDVVLAEM
FT                   SAVLRGGAEVLGVLEEMGVHFDPLEAKSALRAGEMYRRYRQRNATESDMKYFLVGAHAL
FT                   LQCDGLMTWNDAFYRDYFKGMKLIVPGA"
FT   gene            300831..303434
FT                   /locus_tag="Xfasm12_0257"
FT   CDS_pept        300831..303434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0257"
FT                   /product="Aconitate hydratase"
FT                   /EC_number="4.2.1.3"
FT                   /note="KEGG: xft:PD0236 aconitate hydratase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11283"
FT                   /protein_id="ACA11283.1"
FT                   /translation="MLEAYRHHVAERAALGIPPLPLSAQQTADVIELFKAPPAGEEDFL
FT                   LDLITHRVPGGVDDAAKVKASYLAAVAFGTEVTPLLTSQRATELLATMLGGYNIQPLID
FT                   LLDHAALGQVAAEGLKHTLLVFDAFHDVQEKAEQGNGNARAVLESWAAAEWFTSKPEVP
FT                   QCLTVTVFKVPGETNTDDLSPAPDATTRPDIPMHALAMLKNKREGAPFVPEEDGKRGPI
FT                   QEMLSLKEKGHLVAYVGDVVGTGSSRKSATNSVLWWTGKDIPYIPNKRFGGVCLGSKIA
FT                   PIFYNTMEDAGALPIELDVSKMEHGDVIELYPYEGKARKNGVVIAEFSLKSDVLLDEVR
FT                   AGGRIPLIIGRGLTSKAREALKLEPTSLFRLPVNPPETGRGFSLAQKIVGRACGLPEVN
FT                   GKQQGMRPGTYCEPKMTSVGSQDTTGPMTRDELKDLACLGFSADLVMQSFCHTAAYPKP
FT                   VDVKTHHTLPEFISTRGGVSLRPGDGVIHSWLNRMLLPDTVGTGGDSHTRFPIGISFPA
FT                   GSGLVAFAAATGVMPLDMPESVLVRFKGHMQPGVTLRDLVNAIPLYAIKQGLLTVAKQG
FT                   KKNIFSGRILEIEGLPNLKVEQAFELSDASAERSAAGCTVRLNKEPIIEYLNSNITLLK
FT                   WMIAEGYADARSLARRIKKMEAWLADPQLIEPDTDVEYAAVIEIDLADIHEPIVACPND
FT                   PDDVKTLSEVAGAKIDEVFIGSCMTNIGHFRAAAKLLEGKRDIPTRLWVAPPTKMDASE
FT                   LTKEGHYGTFGNAGARMEMPGCSLCMGNQAQAREGATVFSTSTRNFPNRLGRNTNVYLG
FT                   SAELAAICSRLGKIPTKDEYMADIGVIDTQRTEIYRYMNFDQIQEYLNVDHTAVA"
FT   gene            303586..303753
FT                   /locus_tag="Xfasm12_0258"
FT   CDS_pept        303586..303753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0258"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF0293 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11284"
FT                   /protein_id="ACA11284.1"
FT                   /translation="MRRIPLHLMGLSRCFMVTPGQRDRRVHHTSTFSCLRTCCSSAGFV
FT                   AGYVRAARKT"
FT   gene            303821..303896
FT                   /locus_tag="Xfasm12_R0017"
FT                   /note="tRNA-Phe1"
FT   tRNA            303821..303896
FT                   /locus_tag="Xfasm12_R0017"
FT                   /product="tRNA-Phe"
FT   gene            complement(304176..304625)
FT                   /locus_tag="Xfasm12_0259"
FT   CDS_pept        complement(304176..304625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0259"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0238 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11285"
FT                   /protein_id="ACA11285.1"
FT                   /translation="MKSSQYPAQDLKRRVLSWAVKLKVNPRAVRVQEMRKKWGSCSSTG
FT                   TITLASDLLDQEQRFQDYIIVHELLHLRLATHGRMFKALMSAYVPGWRAMEGTGQHRFA
FT                   ESTDRQEARCDAGGIDEHTVRHRTRKKGNSATQHGTVAVHVESSV"
FT   gene            complement(304622..307547)
FT                   /pseudo
FT                   /locus_tag="Xfasm12_0260"
FT   gene            complement(307544..307654)
FT                   /locus_tag="Xfasm12_0261"
FT   CDS_pept        complement(307544..307654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0261"
FT                   /product="type I restriction-modification system
FT                   specificity determinant"
FT                   /note="KEGG: xfa:XF0296 type I restriction-modification
FT                   system specificity determinant"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11286"
FT                   /protein_id="ACA11286.1"
FT                   /translation="MFKSLLHKLMTGEISLSDLDLSALSPASTQHEGITA"
FT   gene            complement(307827..308909)
FT                   /locus_tag="Xfasm12_0262"
FT   CDS_pept        complement(307827..308909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0262"
FT                   /product="type I restriction-modification system
FT                   specificity determinant"
FT                   /note="KEGG: xfa:XF0296 type I restriction-modification
FT                   system specificity determinant"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11287"
FT                   /protein_id="ACA11287.1"
FT                   /translation="MKSVPLNDTSNFELISGLWKEARGPLKSTRVLRSTNFAGDGMLDF
FT                   DDVVELEVENRHFASRQLQPGDIIIECSGGGPKQPVGRAALFVPFDDHMYFSSNFTTTI
FT                   RIQDQPLFNPGYIALYLHALYLDGATETLQRATTGIRNLDWREYLRIEVPAHPLQEQQS
FT                   LARLIIGVRTAYRNEQHLSQTFMALKRSALSSIFTHGLRGEAQKDTEIGPMPIDWTVER
FT                   LDACARVVSTRMSYTELEVAENTTETPENAVRVIGIKVSDMNHAGNETVLVRTALEKAL
FT                   DATQATHQCAPPGTIVFPKRGAAIATNKKRLTDTWSVFDPNVIGVVPGGSINPRFLFQW
FT                   FQFFDLKGITESGPTPQLNK"
FT   gene            complement(309009..310204)
FT                   /pseudo
FT                   /locus_tag="Xfasm12_0263"
FT   gene            complement(310221..310959)
FT                   /pseudo
FT                   /locus_tag="Xfasm12_0264"
FT   gene            311632..312054
FT                   /locus_tag="Xfasm12_0265"
FT   CDS_pept        311632..312054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0265"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xfa:XF0300 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11288"
FT                   /protein_id="ACA11288.1"
FT                   /translation="MNNSKFSKLLNELRIEQDQRANDCRGKGRWMAIVVSIAVIHLMVA
FT                   VVWWRTQRVILVQRVTAISSRSSAATPLLQGTGYVTARRQATVSAQVTGVLVQLLIEEG
FT                   DTVKAGQVIVRLDDSALRTELNTSLVSVEAAAAQLG"
FT   gene            312082..312720
FT                   /locus_tag="Xfasm12_0266"
FT   CDS_pept        312082..312720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0266"
FT                   /product="acriflavin resistance protein"
FT                   /note="KEGG: xcb:XC_3999 acriflavin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11289"
FT                   /protein_id="ACA11289.1"
FT                   /translation="MDARRASDLSSVCVLSKQATEQSRIAVTTLKAQLEASRKAADVAR
FT                   AQVAQVKINLGFTVVRAPLAGVVIEKAAQVGEIVWPLSAGSDFIRSGIGTILDMDLLEI
FT                   DVDVNEVYICHVKVNMPIEVVLTAYPDWRIPGHVVAIVPTEDKGKAAVKVRIALEQKDP
FT                   RITSSMGTRVSFLKAEFAVASEAVSPSGVLLPSSTVVQGGQHRVVYRVQ"
FT   gene            313011..313760
FT                   /locus_tag="Xfasm12_0267"
FT   CDS_pept        313011..313760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0267"
FT                   /product="Triose-phosphate isomerase"
FT                   /EC_number="5.3.1.1"
FT                   /note="KEGG: xft:PD0245 triosephosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11290"
FT                   /db_xref="GOA:B0U1W3"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U1W3"
FT                   /protein_id="ACA11290.1"
FT                   /translation="MRPKIVVGNWKLHGSHAFAQALVAQVAAGLPLPGVSVIILPPLLY
FT                   LSDLTQRFKGEGLAFGAQNVSHHDKGAYTGEVSAAMVADVGAHYTLVGHSERREYHHED
FT                   SELVARKFAAALSAGLRPILCVGESLPQREAGQAEVAIAMQLAPVLALVGPQGVARGLI
FT                   AYEPVWAIGTGRHADPSQVQAMHAFIRGEIARQDARIGDSLLILYGGGIKPCNAAELFS
FT                   QQDVDGGLIGGASLVADDFLAIARATV"
FT   gene            313802..314200
FT                   /locus_tag="Xfasm12_0268"
FT   CDS_pept        313802..314200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0268"
FT                   /product="protein-export membrane protein SecG"
FT                   /note="KEGG: xft:PD0246 protein-export membrane protein
FT                   SecG"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11291"
FT                   /protein_id="ACA11291.1"
FT                   /translation="MLLLNVIYVLVAIAMIVLILMQRGTGAAAGSGFGAGASGTVFGAR
FT                   GASNFLSKSTKWLAVVFFGISLFMAWYASRGHHSVAQQNSLMTEVPAAPAAGADQAVSP
FT                   VLQVPAVPTSTNTPVGDKEKASDHSQKR"
FT   sig_peptide     313802..313885
FT                   /locus_tag="Xfasm12_0268"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.925) with cleavage site probability 0.383 at
FT                   residue 28"
FT   gene            314248..314332
FT                   /locus_tag="Xfasm12_R0018"
FT                   /note="tRNA-Leu1"
FT   tRNA            314248..314332
FT                   /locus_tag="Xfasm12_R0018"
FT                   /product="tRNA-Leu"
FT   gene            314404..314811
FT                   /locus_tag="Xfasm12_0269"
FT   CDS_pept        314404..314811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0269"
FT                   /product="NADH-ubiquinone oxidoreductase, NQO7 subunit"
FT                   /note="KEGG: xfa:XF0305 NADH-ubiquinone oxidoreductase,
FT                   NQO7 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11292"
FT                   /protein_id="ACA11292.1"
FT                   /translation="MPMSSYFMGASVRKRIAVLAEYLPILIFLVVATGIGLALILIGRF
FT                   LGPHRPDSEKLSSYECGFSAFEDARMKFDVRYYLIAIQFIVFDLEIIFIVPWTQVFMDI
FT                   GARSLVTMGLFVGMLFLGFIYVWKKGALEWE"
FT   gene            314802..315356
FT                   /locus_tag="Xfasm12_0270"
FT   CDS_pept        314802..315356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0270"
FT                   /product="NADH dehydrogenase"
FT                   /EC_number="1.6.99.3"
FT                   /note="KEGG: xft:PD0249 NADH-ubiquinone oxidoreductase NQO6
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11293"
FT                   /db_xref="GOA:B0U1W6"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U1W6"
FT                   /protein_id="ACA11293.1"
FT                   /translation="MGVIQAIDRLMTNPIPDGQVDDILRPQGESPLLQKGYVTTSVDAL
FT                   LNWARTGSMWPMTFGLACCAVEMMHAGAARLDLDRYGIVFRPSPRQSDVMIVAGTLVNK
FT                   MAPALRKVYDQMPDPKWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDVYVPGCPPTAE
FT                   ALVYGILQLQKKIWRTQTIAG"
FT   gene            315474..316157
FT                   /locus_tag="Xfasm12_0271"
FT   CDS_pept        315474..316157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0271"
FT                   /product="NADH dehydrogenase"
FT                   /EC_number="1.6.99.3"
FT                   /note="KEGG: xft:PD0250 NADH-ubiquinone oxidoreductase NQO5
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11294"
FT                   /db_xref="GOA:B0U1W7"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR010218"
FT                   /db_xref="InterPro:IPR020396"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U1W7"
FT                   /protein_id="ACA11294.1"
FT                   /translation="MAQPRGEITLDVPVVEWCAVCKGLRDEFDFEQLSDLCGVDYLGYG
FT                   NAEWDTTGVSAQGFSRGVAGKAVGRFAWGEFPSAGTNDGTQPWDVPQERFAVLAHLISY
FT                   RHNRRLRVRCFASNDALPIVASLTDVWPGVNWFEREAFDLFGIVFEGHLDLRRILTDYG
FT                   FIGHPFRKDFPLTGNVEVRYDEEKKRVVYVPVTSVEPRVSVPRVIRDDARFGAAAGEST
FT                   HSETV"
FT   gene            316158..317465
FT                   /locus_tag="Xfasm12_0272"
FT   CDS_pept        316158..317465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0272"
FT                   /product="NADH dehydrogenase"
FT                   /EC_number="1.6.99.3"
FT                   /note="KEGG: xfa:XF0308 NADH-ubiquinone oxidoreductase,
FT                   NQO4 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11295"
FT                   /db_xref="GOA:B0U1W8"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR014029"
FT                   /db_xref="InterPro:IPR022885"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U1W8"
FT                   /protein_id="ACA11295.1"
FT                   /translation="MNQIRQAPAASASNATESKQEIRNYTMNFGPQHPAAHGVLRLILE
FT                   MDGETVVRADPHIGLLHRGTEKLAESKPFNQSIGYMDRLDYVSMMCNEHAYVRAIETLI
FT                   GIQAPERAQYIRTMFDEITRILNHLMWLGSNALDLGAMAVMLYAFREREELMDVYEAIS
FT                   GARMHAAYYRPGGVYRDLPDTMPKYKQSRWHKGKALKRLNAAREGSMLDFLEHFTDTFP
FT                   QRIDEYETLLTDNRIWKQRTVGVGVIEPDVAKAWGMTGVMLRGSGIAWDLRKKQPYAKY
FT                   DAVDFDIPLGTCGDCYDRYLCRVAEMRESNRIIKQCVQWLKVNPGQVMVENFKVAPPKR
FT                   ESMKDDMEALIHHFKLFSEGYCVPAGETYSAVEAPKGEFGCYLISDGANKPFRVHLRAP
FT                   GFAHLSSMDAVVRGYMLADVVAMIGTYDLVFGEVDR"
FT   gene            317462..317989
FT                   /locus_tag="Xfasm12_0273"
FT   CDS_pept        317462..317989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0273"
FT                   /product="NADH-ubiquinone oxidoreductase NQO2 subunit"
FT                   /note="KEGG: xft:PD0252 NADH-ubiquinone oxidoreductase NQO2
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11296"
FT                   /protein_id="ACA11296.1"
FT                   /translation="MKATKSFERVRDVDPQVVLGDRTRAHIDHWLAKFPADQKRSALLQ
FT                   GLYAAQEQNQGWLTDELIAAVAKYLDIPSVWAYEVATFYSMFETRKVGRHNVAFCTNVS
FT                   CWLNGAEDLVSYAEEKLGCKLGQSTADGRVYLKCEEECLAACAGAPMMVINGHYHERLT
FT                   KEKVDQLLDGLE"
FT   gene            317994..319328
FT                   /locus_tag="Xfasm12_0274"
FT   CDS_pept        317994..319328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0274"
FT                   /product="NADH dehydrogenase (quinone)"
FT                   /EC_number="1.6.99.5"
FT                   /note="KEGG: xft:PD0253 NADH-ubiquinone oxidoreductase NQO1
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11297"
FT                   /protein_id="ACA11297.1"
FT                   /translation="MGHPHVSKGPVGPAPQPHQVIYTTLHYEIPWSYESYLKTGGYTAL
FT                   RKIFEEKIPPEQVIDMVKQSNLRGRGGAGFPTGLKWSFMPKGTMQKYILCNSDESEPGT
FT                   CKDRDILRYNPHSVVEGMAIACYATGSTVAYNYLRGEFHHEPFEHFEQALADAYTHGWL
FT                   GKNVLGSGVDIDIYAVLGAGAYICGEETALMESLEGKKGQPRYKPPFPANFGLYGKPST
FT                   INNTETYAAVPAIIRNGPEWFLSLSKTKNGGSKIFSVSGCVQQGGNFEVPLGTTFDELL
FT                   EMAGGLRPGRALKAAIPGGVSMPVLKAEQLQGLQMDYDTLRVLGSGLGSGGIVVLDDSV
FT                   CCVRFACRISQFFHKESCGQCTPCREGTGWMHRVLERIVAGQATMEDLHQLKVVAGQIE
FT                   GHTICAFGEAAAWPIQGFLRQFWDEFEYYIVHGRSIVDDKARVAA"
FT   gene            319325..321559
FT                   /locus_tag="Xfasm12_0275"
FT   CDS_pept        319325..321559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0275"
FT                   /product="NADH-ubiquinone oxidoreductase NQO3 subunit"
FT                   /note="KEGG: xft:PD0254 NADH-ubiquinone oxidoreductase NQO3
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11298"
FT                   /protein_id="ACA11298.1"
FT                   /translation="MSDQSVNPEVRPDRVTIEIDGQNLVVPKGSMIIQAADNAGIPIPR
FT                   FCYHEKLPIAANCRMCLVDVEKVPKPLPACATPVMEGMKVRTRSEKALQYQRSVMEFLL
FT                   INHPLDCPICDQGGECELQDVSMGYGRSISRFHERKRVVPDEDIGPLVATEMTRCIQCT
FT                   RCVRFTADIAGTYELGCMYRGENLQIGTYDGKPLITELSGNVVDVCPVGALTNKVFQFR
FT                   ARPWELMAYQSLGYHDAMGSNLFLHVRQGEVLRTVPRGNEYVNECWLSDRDRYSHQGLY
FT                   AADRAVKPLKKVGDQWLEVSWAEGVSAAAEILSAHRGDALGVLVHPATSNEEGALLARL
FT                   AAGLGTGHLDHRIFNRDFSDVAVAEPFALPLAEIGNADLVVLFGSNIRQELPLLHARLR
FT                   KAVTCNGAKVYAVNPVDFDFTFSLTGKSIVPPSQLANVLTDTALLNAAKAAARVVIVVG
FT                   ALAENHPQGATLRAAARQFAEVTGAALCRIPQGANAIGLTQHGVLPTGRDAAAMLVEPC
FT                   QAYVLYGIEPGLDFADTATARQALHGAKVVAFSHFACASTRDVADVILPIGLLPEIDGT
FT                   LTNLDGRTQAAKPGGKLPLEAREGWRVLRALGGELGLSGFDFLDLAALRAQLRPHPVVP
FT                   STSAQPITAQEGLEVAVTPAIYRTDAVVRRAAALQAHPLNVAPALALHPEQAKQLQVVA
FT                   GQIVKVGTAAGKATLPVVLDTRVALGTVWIETGHGATVPIGAGRVTMVAV"
FT   gene            321556..322647
FT                   /locus_tag="Xfasm12_0276"
FT   CDS_pept        321556..322647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0276"
FT                   /product="NADH-ubiquinone oxidoreductase NQO8 subunit"
FT                   /note="KEGG: xft:PD0255 NADH-ubiquinone oxidoreductase NQO8
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11299"
FT                   /db_xref="GOA:B0U1X2"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="InterPro:IPR018086"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U1X2"
FT                   /protein_id="ACA11299.1"
FT                   /translation="MNTWFLNVVDPLHQWFLGFGDIGVVLWTVLKILMIAIPLIVSVAF
FT                   YVVWERKLIGWMHVRHGPMYVGMGLFQAFADVFKLLFKEVLYPSKAHKVIFVIAPLLTL
FT                   APSFAAWAVVPFDTKLVLSNANVGLLYLLAMTSLGVYGIILAGWASNSKYAFLGAMRSA
FT                   AQVVSYEIAMGFALVGVMIAAGSLNLSQIVMAQAGSSGFFDWFLIPLFPLFIVYWVSGV
FT                   AETNRSPFDVVEGESEIVAGHMVEYSGSVFALFFLAEYANMILVSFLISIFFLGGWLSP
FT                   IQGWVSGQVSPLIDWVWNGGWPWLLLKVLFFASAYIWFRASFPRYRYDQIMRLGWKVFI
FT                   PLTIVWIAVTALMVFSGVIQKGV"
FT   gene            322651..323139
FT                   /locus_tag="Xfasm12_0277"
FT   CDS_pept        322651..323139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0277"
FT                   /product="NADH dehydrogenase"
FT                   /EC_number="1.6.99.3"
FT                   /note="KEGG: xft:PD0256 NADH-ubiquinone oxidoreductase NQO9
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11300"
FT                   /protein_id="ACA11300.1"
FT                   /translation="MNRVMHYFKSLLLLELLAGLWLTLKYTFRPKYTVLYPMEKFPQSP
FT                   RFRGLHALRRYPNGEERCIACKLCEAVCPALAITIDSAKREDGTRRTTRYDIDLFKCIF
FT                   CGFCEESCPVDSIVETHILEYHFEKRGENIVTKPQLLAIGDRFEAEIAERRAADAAFR"
FT   gene            323147..323812
FT                   /locus_tag="Xfasm12_0278"
FT   CDS_pept        323147..323812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0278"
FT                   /product="NADH-ubiquinone oxidoreductase NQO10 subunit"
FT                   /note="KEGG: xft:PD0257 NADH-ubiquinone oxidoreductase
FT                   NQO10 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11301"
FT                   /protein_id="ACA11301.1"
FT                   /translation="MDWVNIAFYLFSAVVVAAAGAVISVRHPVYAVLCLILTFFSMACI
FT                   WLLVGAEFLGVTLVLVYVGAVMVLFLFVVMMLDIDTSRLREGWVRYLPVGLLVAGVMLV
FT                   QMVVLIGVKMRMATPFPVDNAAAQAADTSNLIWLAHSLFTDFLFPFEFAAVILTVAVIA
FT                   AVMLTLRKREGVKTQDPSQQTRVKSADRLRIVSMPTEKPIAVVPIRSDTNNDAQEITP"
FT   sig_peptide     323147..323212
FT                   /locus_tag="Xfasm12_0278"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.601) with cleavage site probability 0.218 at
FT                   residue 22"
FT   gene            323809..324114
FT                   /locus_tag="Xfasm12_0279"
FT   CDS_pept        323809..324114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0279"
FT                   /product="NADH-ubiquinone oxidoreductase NQO11 subunit"
FT                   /note="KEGG: xft:PD0258 NADH-ubiquinone oxidoreductase
FT                   NQO11 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11302"
FT                   /protein_id="ACA11302.1"
FT                   /translation="MISLGHLLALGAVLFCISLAGIFLNRKNVIVLLMSIELMLLAVNV
FT                   NFIAFSRQLGDTAGQLFVFFILTVAAAEAAIGLAILVTLFRTHHTINVAEVDALKG"
FT   sig_peptide     323809..323871
FT                   /locus_tag="Xfasm12_0279"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.844) with cleavage site probability 0.828 at
FT                   residue 21"
FT   gene            324122..326263
FT                   /locus_tag="Xfasm12_0280"
FT   CDS_pept        324122..326263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0280"
FT                   /product="NADH dehydrogenase (quinone)"
FT                   /EC_number="1.6.99.5"
FT                   /note="KEGG: xft:PD0259 NADH-ubiquinone oxidoreductase
FT                   NQO12 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11303"
FT                   /protein_id="ACA11303.1"
FT                   /translation="MDITLSKNMLIAVVLAPLFGSIIAGLLGRQVGRKGAHCVTLLGVA
FT                   VSCAMSCWTLYQLVGQGAAPFNQNLYTFFQVGEYSAHVGFMIDRLTAVMMVVVTFVSLL
FT                   VHLYTIGYMEEDPGYQRFFSYISLFTFSMLTLVMSNNFLQLFFGWEAVGLVSYLLIGFW
FT                   FKRPSAIFANMKAFLVNRVGDFGFLLGISLVLYTFGTLDYSVVFANVGSLVGQTTNVWS
FT                   GNVDVFGSIIHVMGPLSWSTATLVCICLFIGAMGKSAQVPLHVWLPDSMEGPTPISALI
FT                   HAATMVTAGIFMVARMSPLFQLSEVALQFVLFVGATTAFFMGLIGMVQNDIKRVVAYST
FT                   LSQLGYMTVALGVSAYSAAVFHLMTHAFFKALLFLAAGSVIIGMHHEQDMRKMGGLRKY
FT                   MPITYITSVIGTLALVGTPFFSGFYSKDIIIEAAAYHAEHAHSWVATYGYWAVLGGVLV
FT                   TSFYSFRLLFLTFHGEERFRRVGGGHDADDHVNTHTSNDDHAHGVHEPQESPWVVTLPL
FT                   IFLAIPSIALGFFTIGPMLFGTDWAGHHAVEVIWGQTASFFTGIIDFYDPAQDTVAVLG
FT                   EEFRGPVVFALHGMMSAPFFLTVAGFLLAVLLYLWKPQWPVKISETFSLPVRILENKYG
FT                   FDALWIGGFSGWGLKLGNVSRAIDTHVVDGVLVNGSARLIDVVANVLRRTQSGFVYHYA
FT                   FAMIIGLIALLAVLMCFWR"
FT   sig_peptide     324122..324196
FT                   /locus_tag="Xfasm12_0280"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.672) with cleavage site probability 0.552 at
FT                   residue 25"
FT   gene            326285..327790
FT                   /locus_tag="Xfasm12_0281"
FT   CDS_pept        326285..327790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0281"
FT                   /product="NADH dehydrogenase (quinone)"
FT                   /EC_number="1.6.99.5"
FT                   /note="KEGG: xfa:XF0317 NADH-ubiquinone oxidoreductase,
FT                   NQO13 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11304"
FT                   /protein_id="ACA11304.1"
FT                   /translation="MSNWPLLSVLIWLPIIGGLLIMGLRNAHVARWAALAVALATFGFS
FT                   LHLLGGYDIAKDALQFVEQHVWIQTYSIGYNLGVDGIAVALVLLTTLVTVLVLIGSWGA
FT                   INQRVPQYVAAFLILEGVTIGIFAATDAMLFYVFFEAMLIPMFLIIGVWGGPRRIYAAI
FT                   KFFLYTFLGSVLMLVGLIYLYLKGGSFQLADLYAMQLSAKEQTWLFFAFLIAFAVKVPM
FT                   FPVHTWLPDAHVEAPTAGSVILAAIALKIGGYGFLRFNLPIVPDASHEFAWVVIALSLI
FT                   AVIYVGLVALVQEDMKKLIAYSSIAHMGFVTLGIFISFTLARDFGNTDAARLGLQGAMV
FT                   QMISHGFVSGAMFTCIGVLYDRLHTRRIADYGGVVNVMPWFATFAMLFYMANAGLPGTS
FT                   GFVGEFMVILASFQKHPLVAFGAGATLVITAAYTLWLYKRVFFGEVANTHVAALKDINI
FT                   REASILVLFAIGVLVLGLYPKPLIDLMDSSIAKLTTQIAVSKL"
FT   sig_peptide     326285..326368
FT                   /locus_tag="Xfasm12_0281"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.791) with cleavage site probability 0.738 at
FT                   residue 28"
FT   gene            327825..329282
FT                   /locus_tag="Xfasm12_0282"
FT   CDS_pept        327825..329282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0282"
FT                   /product="NADH dehydrogenase (quinone)"
FT                   /EC_number="1.6.99.5"
FT                   /note="KEGG: xft:PD0261 NADH-ubiquinone oxidoreductase
FT                   NQO14 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11305"
FT                   /protein_id="ACA11305.1"
FT                   /translation="MTMPTSGLNIADLAPLLPELVLLASTFALLMIDLFIGQVRKVWTH
FT                   FLSVAILVVVLSMLVAGVGGQGAAFHGMFVRDSAADMMKVVIVLVSALSLVYGWSYLRE
FT                   RNLFQGEIPVLVLFATLGMMVLVSAGHLLMVYLGLELLALCSYALVGVNRDSKISTEAA
FT                   MKYIVLGSLASGLLLYGMSLIYGATGTLSLPGISDVIHGSSEKTLLLTGTVFLIAGVAF
FT                   KLGAVPFHMWLPDVYQGAPTPIVLFISSAPKLAAFGMAYRLLEVGVGPLSPQWHLIFGG
FT                   LAALSLVIGNLMAIVQTNLKRMLAYSTVSHVGFLMMGMSGGGIRGYSSSMFYVLSYAIM
FT                   STASFGAIIAMSRCGSEAENIDDFKGLSTRHPWMACLLLCVMASLAGIPPFLGFWTKFA
FT                   VLGAAVQGGMLWLAILGVICAVIGAYYYLRVIKVMYFDEPVGEPLPVNDGRVLRVILSI
FT                   NVFALLALGILWNPIIDWCQKAFAHLA"
FT   gene            complement(329985..330725)
FT                   /locus_tag="Xfasm12_0283"
FT   CDS_pept        complement(329985..330725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0283"
FT                   /product="3-oxoacyl-(ACP) reductase"
FT                   /note="KEGG: xft:PD0262 3-oxoacyl-[ACP] reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11306"
FT                   /protein_id="ACA11306.1"
FT                   /translation="MTLRIAYVTSGMGSIGTAICQKLARNGHTVVAGCGPNSPRKANWL
FT                   REQRELGFDFIASEGNAADWDSTVSAFAKVKAEVGEIDVLVNNAGNNRDMLFRQMGRED
FT                   WNSVISSNLNSLFNITKQVIDAMTARNWGRIVNIGSVSAHKGQIGQVNYATAKAAMHGF
FT                   TRALAQEVATRNVTVNTISPGYIASAAISSFPPDVLDRLANSVPMRRLGKAEEVAGLCA
FT                   WLVSDEAAYVTGADYAVNGGLRME"
FT   gene            complement(330784..332115)
FT                   /locus_tag="Xfasm12_0284"
FT   CDS_pept        complement(330784..332115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0284"
FT                   /product="Mg++/citrate complex transporter"
FT                   /note="KEGG: xft:PD0263 Mg++/citrate complex transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11307"
FT                   /protein_id="ACA11307.1"
FT                   /translation="MLTVLGFGMVITFMYLIMSKRLSPLVSLIIVPIVFALAGGFGSSM
FT                   SEMMLEGIKKIAPTGVMLMFAILYFGVMIDAGLFDPLVRRILRIVKGDPMKIVMGTAIL
FT                   ALLISLDGDGSTTYMITVSAMLPLYQRLGLNALNLTCVTILAGGVMNLTPWGGPTARAA
FT                   TALRVDPADVFIPLIPAMGIAIIGILTLAWWLGMKERKRLGVAKLPDSGAWNGYAMHDD
FT                   EDALPTMEGDAEDIKRPKLLWVNFALTIALMAGLVVGILPMPILFMIGFALALLINYPN
FT                   LAEQRRRVVNHAGNVLSVVSLIFAAGIFTGILSNTGMVDAMSRSFLALIPDSFGPYLAV
FT                   ITAIASMPFTFFMSNDAFYFGVLPILSEAASHYGITPVEMARASLAGQPVHLLSPLVPS
FT                   TYLLVGLAKVDFGDHQRFSLKWAVLISMVLLLSSLLFLIYPLAA"
FT   gene            complement(332248..333444)
FT                   /locus_tag="Xfasm12_0285"
FT   CDS_pept        complement(332248..333444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0285"
FT                   /product="porin O precursor"
FT                   /note="KEGG: xft:PD0264 porin O precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11308"
FT                   /protein_id="ACA11308.1"
FT                   /translation="MAIRRLRTIFVSLLLGLAASATQATDRSDRNVTAKLEGRFEWDFA
FT                   LFDNDTRGTPNRSNNEIRRFWLDVTGKVFAFDYTIEGNFTNLQDKFKGKSIEMGDVYLR
FT                   HHFGDTGTLTIGQFKQHFSLDDRTSPDYGQFLERSGGANTLAPEYHKGVSWKATRQNTT
FT                   WWVSAYSLDSISLSNVNGRGLGGRGTWSPDTPEGDVLHLGLSLAHQRYDHPGSDGMTAL
FT                   SIRPLPAGHLSDNSGITLAHFANGRDTKVNRWALEYAQVRGPLSWQSEYIGGAFNDGMQ
FT                   RATVQSAYGFVSWFVTGESRTYDRKTGRFTRIKTLHNPRGALELALRYDRMWGNQHHNN
FT                   QPNFLNASTASCTLGVNWYIKPNLRLMLNLIDSRNRDRLAGTILDHTRALTGRLHYDF"
FT   sig_peptide     complement(333370..333444)
FT                   /locus_tag="Xfasm12_0285"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.888 at
FT                   residue 25"
FT   gene            333665..334360
FT                   /locus_tag="Xfasm12_0286"
FT   CDS_pept        333665..334360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0286"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: xft:PD0265 two-component system, regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11309"
FT                   /protein_id="ACA11309.1"
FT                   /translation="MRLLLIEDNADLADAIIRRMRRHGHAVDWQSDGLAAAGVLRYQRF
FT                   DLVVLDIGLPSLDGLQLLSELRQRGDTTPVLILTARDAIEDRVYTLNVGADDYLSKPFD
FT                   FREFEARCRVLLRRNRGNASEVVRIGGFEFDNASHRIRLHGEPIKLPNREYRLLEILIA
FT                   RLGQIVGKDEIGNSLFNFDDNAGPNAIELYVARLRRKLEAAPLRIVTVRRAGYLLEPIV
FT                   EGRGHEACD"
FT   gene            334344..335717
FT                   /locus_tag="Xfasm12_0287"
FT   CDS_pept        334344..335717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0287"
FT                   /product="two-component system, sensor protein"
FT                   /note="KEGG: xft:PD0266 two-component system, sensor
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11310"
FT                   /protein_id="ACA11310.1"
FT                   /translation="MKRAINGGSIRRTLWLYLGAFSMMSTVFLFFAARDYGQRAADGSY
FT                   DHLLVSSALSILGSVSLVDGQWQVDLPYVALDVLAMAPEDRVFYRVYDAHGHMMTGYGD
FT                   LPSPPRVPLPGEAPLLFDADYSGERVRFVAVARTLASVATLTEVYVQVGQTRQARDALA
FT                   HEMVVNALLVIAVLTLLSLALVALGVYRALWPLRRIERDLAQRQPWDLKPLTTAPPQEM
FT                   AQMVGALNHFMERLSNSNETLRAFMGEAAHQMRTPLAALRAQAQLALEEGDAFQLRCSL
FT                   TAIERNASHMSRLLNQLLSDASAIHRTQIQHFEVVNLLELIHQAVSEVVPYREEMLCVQ
FT                   WTNDPQSAWIRGDALLLREALKNLVDNACKYGGGSLQLTLTSDAHECVLTLADQGPGIA
FT                   PSEAERVFERFVRGVHASPGGAGLGLAIVKRIIDNHRGRIDLSNRIGGGLMITLGFPR"
FT   gene            335726..336766
FT                   /locus_tag="Xfasm12_0288"
FT   CDS_pept        335726..336766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0288"
FT                   /product="periplasmic iron-binding protein"
FT                   /note="KEGG: xft:PD0267 periplasmic iron-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11311"
FT                   /protein_id="ACA11311.1"
FT                   /translation="MIRVAVLLLLLTCHFMVWAHPGEIRHFSTKGPVTSQLRIQGANDV
FT                   ERFAVVIADYQRLHPGSEVIYEERIASQIYHRYLHPASSQPPPDLLISASMDLQIKLAN
FT                   DGHALAYRSSRTRALPAWAQWRYEVFGIGYEPAVIVYNTRRLPSPQVPRTRHQLLALLR
FT                   APEAPLRGQIGTYDVERSAVGYLLSTQDAQLGSIAGALWEAMGEDRVQLEAGTGALLDR
FT                   VASGELLLAYNVLGSYAQARVDAGVPLGIVQPEDYTLLALRTAVIPRGGVHVSEAQRFL
FT                   DYLLSERGQRVLSHELRLMPVLPASDRIVSMFRPIALGPGLLVYLDTLKRRQFLYTWRS
FT                   SMLPPR"
FT   sig_peptide     335726..335785
FT                   /locus_tag="Xfasm12_0288"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT   gene            336793..336993
FT                   /locus_tag="Xfasm12_0289"
FT   CDS_pept        336793..336993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0289"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF0970 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11312"
FT                   /protein_id="ACA11312.1"
FT                   /translation="MACVLRFNQVLAAHGTDLGTQASVGSCLHGDRMCPLGILASCRRA
FT                   RGVIWLHSVALAGLSVAVLRC"
FT   gene            337320..337952
FT                   /locus_tag="Xfasm12_0290"
FT   CDS_pept        337320..337952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0290"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: xfa:XF0972 transcriptional regulator
FT                   (LuxR/UhpA family)"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11313"
FT                   /protein_id="ACA11313.1"
FT                   /translation="MSEMLILVADDHPLFRNAVIQVLRENFQDAQVLDASSAVTLRSAL
FT                   QAYPQTELVLLDLAMPGARGFSALLHVRGEHPDIPVVVISSNDHPRVIRRAQQFGAAGF
FT                   IPKSSPPETITEVVAAVLDGGTWFPPMLVECSEADAQLAVKLARLTPQQFRVLLCLADG
FT                   LLNKQIAYELGLAENTVKVHVTAILKKLECYSRTQAAVLVKSLEPEA"
FT   gene            complement(337999..339636)
FT                   /locus_tag="Xfasm12_0291"
FT   CDS_pept        complement(337999..339636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0291"
FT                   /product="sensor histidine kinase"
FT                   /note="KEGG: xft:PD0269 sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11314"
FT                   /protein_id="ACA11314.1"
FT                   /translation="MPLKQQSQTPPTVQSAILQTTQDSNTTLHCSLEHLPQGVVIIDAE
FT                   LRLAAWNTRYVELFHFPPELMQVGQPIEDLFRYNAERGLLGHGSIEEAIQRRLNHLRSG
FT                   KPHIRESEKEDGTVLEIRGNSLPQGGFVTSYTDITSYKNATRELRLLADTLEHRVAERT
FT                   RDLDQARLDAENANRYKTRFIASAVHDLLQPLNAARMFVAMLRKQLHDTDALRIANNID
FT                   GALIAEDAILSSLLDISRLESGTLKTQVHHFALGTLLETLAGEFGILAQSRGITLKWVP
FT                   SRAIVGSDETLLRRILQNFLSNAIRYTPRGRVLIGCRRHGNWLRIEVHDQGPGIPESLQ
FT                   SEIFEEFRRLDDGVVNDCGAGLGLAIVERIGRLLNHPIGLRSTLGHGSMFSVSVPLEQI
FT                   TTTHPVFTRTPMPTRELDDDPMLHGRQVWCIDNDPSVCQTIHTLLERWHCAVGFTGSLD
FT                   EALITAATAPPPELILMDTSINEHGDTPLIPLLMTHWGHTPRVILMTSEEDPTLRDRAL
FT                   NRGWGFLGKPIRPPALRALMTQTLLRQD"
FT   gene            complement(339969..340343)
FT                   /locus_tag="Xfasm12_0292"
FT   CDS_pept        complement(339969..340343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0292"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11315"
FT                   /protein_id="ACA11315.1"
FT                   /translation="MMWHLAHFQVPTLNHHDSGTGRVQLLFSIIMRNDMTATGHIVQSA
FT                   HPIQTMQPTALTHAVHTTTATIHNHCLENIIALAGGAATGHRSANRRIKTIQRQTNSPT
FT                   LERTQHTPHTSTMTPLTAAA"
FT   gene            complement(340374..341543)
FT                   /locus_tag="Xfasm12_0293"
FT   CDS_pept        complement(340374..341543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0293"
FT                   /product="polyphosphate-selective porin O"
FT                   /note="KEGG: xft:PD0270 polyphosphate-selective porin O"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11316"
FT                   /protein_id="ACA11316.1"
FT                   /translation="MRPIKFLFTLCLTSTASAAVAGDFNHWPLQYTFGNATEASLTGNF
FT                   AYDYNNFSGDDRLKDRSFMRRKELGISIKKKDVYDAAVAFDFQSKLWLDVFFRIETKAL
FT                   FDQDYGRIRLGYMKTPVGMEALASSRAGSFMETALPVQSIYEGRRTGVEWVLERPQYLL
FT                   QTGAYGGKDLQGDNPGTTQAIRAIWTPFKTTGDVLHLGVSYSQENPRGYHNGSNVSFSP
FT                   RTRVRARPESGLTDVRLIDSGTLVDVDKIQRNGLEQLWIHGPLLVQSEALHIKVTRNNG
FT                   LPTYNGNGQYIYGSWVLTGESRPYTAGTIGNVTPKHDYGAVELLARYSRLNLDNGSILG
FT                   GRQHDWTIGANWYLTNYFKFQANYVKVNATRLGTRTTPDIVELRAQVHF"
FT   sig_peptide     complement(341478..341543)
FT                   /locus_tag="Xfasm12_0293"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.980 at
FT                   residue 22"
FT   gene            341839..343188
FT                   /locus_tag="Xfasm12_0294"
FT   CDS_pept        341839..343188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0294"
FT                   /product="C4-dicarboxylate transport protein"
FT                   /note="KEGG: xft:PD0271 C4-dicarboxylate transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11317"
FT                   /db_xref="GOA:B0U1Z0"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR023954"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U1Z0"
FT                   /protein_id="ACA11317.1"
FT                   /translation="MHPSSRANGPAPHKPYNPFYLQLYFWVIIAIILGALLGHCYPAVG
FT                   QQLKPLGDAFIKLVKMIISPVIFLTIVTGIASVAHVGTVARVFGKAMVYFLFFSTLALL
FT                   LGLVVAHVVHPGAGMNINPVDLHQGEIANYVEKSHDLTLVGFLMDIIPKTLLSPFVGDN
FT                   ILQVLFVAVLFGIALALAGERGKPVLNLLDALTVPVFKLVQMLMKMAPIGAFGAIAFTI
FT                   GKYGVDSLVNLGWLVGSFYLTSLLFVLVILGAVSWLCGFSILKLIRYLKAELLLVLGTS
FT                   SSESALPSLMEKMVQAGCRKSVVGLVVPTGYSFNLDGTNIYMTLAALFIAQATNTELTP
FT                   AHQLALFLVAMLSSKGAAGVSGAGFITLAATLAVVPEVPIAGMALILGVDRFMSECRSL
FT                   TNFIGNAVATLVVSRWENALNHEQLKIALDGNEAAYQSLHAKDAEPSLSR"
FT   gene            343356..345650
FT                   /locus_tag="Xfasm12_0295"
FT   CDS_pept        343356..345650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0295"
FT                   /product="Malate dehydrogenase
FT                   (oxaloacetate-decarboxylating) (NADP(+)), Phosphate
FT                   acetyltransferase"
FT                   /EC_number="1.1.1.40"
FT                   /EC_number="2.3.1.8"
FT                   /note="KEGG: xft:PD0272 malate oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11318"
FT                   /protein_id="ACA11318.1"
FT                   /translation="MSNDTFKQAAIDYHRTQPAGKIKVVATKPMLTQRDLSLAYSPGVA
FT                   FACQAIVENPQQASELTARGNLVAVISNGTAVLGLGNIGPLAGKPVMEGKGVLFQKFAG
FT                   IDVFDIEIDESDPDKLVDIIASLEPTFGGVNLEDIKAPECFIVERKLRERMSIPVFHDD
FT                   QHGTAIIVGAAVLNAMVITGKKIGEVKLATTGMGAAGVSCVNMLVSLGLNPDNILAYDR
FT                   EGVIHTGRTDLDPEKQRYARDTDKRTLAEIVEGADIFLGLSAAGILTPEMVATMAPDPV
FT                   IFALANPIPEIMPEAVCAVRTDAIIGTGRSDYPNQINNVLCFPYLFRGALDVGATTINE
FT                   EMKIACVKAIAALARCEASDLGAAYGGETPSFGREYLIPRPLDPRLLVELSSAVAQAAM
FT                   DSGVATRPITDMSAYHDKLSQFVYRTSLMMKPVYDRARADKQRVVYAEGEEEVILRAVQ
FT                   NVIDEGLAFPILIGRPDVIESRIQRMGLRMKVGVDFEVTNIHDDPRFNDYWQYYHGVTE
FT                   RRGVTVSAAKELMRSRPTLIASVMVARGEADALLTGAVGRFHKRLGYARSVIPLEPRVS
FT                   STAAMTGVINQHGAFFFVDTHVQEDPSAEQIAEATLQACYRLKLFGIEPSVALLSHSNF
FT                   GSHDSRDALKMRQVRELLLKRSPRLNIDGEMQADTAWDEVLRERIMPNTTLKGRANLFV
FT                   FPNLEAANIAYNLVRVFTDGVAIGPILMGISKAVHILTSSTTSRRVMNMTAIAAVDAQI
FT                   RKQFEGGKRGG"
FT   gene            complement(345878..347788)
FT                   /locus_tag="Xfasm12_0296"
FT   CDS_pept        complement(345878..347788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0296"
FT                   /product="heat shock protein G"
FT                   /note="KEGG: xft:PD0273 heat shock protein G"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11319"
FT                   /protein_id="ACA11319.1"
FT                   /translation="MTLEADKQTHGFQTEVKQLLQLMIHSLYSNKEIFLRELISNAADA
FT                   ADKLRFEALSAPSLLEEDPNLRIRVEFDKQAHTITIDDNGIGMSRDEAIAHLGTIAKSG
FT                   TADFLKTLSGDQRKDANLIGQFGVGFYSAFIVADHVDVYSRRAGLTAAEGVHWSSKGEG
FT                   NFEVATIDKPQRGTRVVLHLKENEQHFAEGWTLRSTLKKYSDHIGLPIEMLKEHHGKEE
FT                   EKDTPKEAEWEAVNKASALWTRPKNDIKDEEYQEFYKHISHDMTNPLAWSHNKVEGKLE
FT                   YTSLLYVPTRAPFDLYHRNAAKGLKLYVQRVFIMDQAEQFLPLYLRFIKGVVDSADLSL
FT                   NVSREILQSGPVVDSMKAALSKRALDMLEKLAKDAPEDYKTFWKNFGQVLKEGPAEDYS
FT                   NREKVASLLRFASTYDTSGDPSVALTDYIARMKEGQDKLYYLTGESYAQIKDSPYLEVF
FT                   RKKGIEVLLLVDRIDEWLMNYLHEFDGKSFVDIARGDLDLGNLDSEADKKAQEEIAKTK
FT                   EALASRIKATLGEDVAEVRVSHRLTDSPAVLAIGEGDLGLQMRQLLEASGQKVPETKPV
FT                   FEFNPSHPLIEKLDAEQDMDRFADLSHILFDQAALAAGDSLKDPANYVRRLNKLLLELS
FT                   A"
FT   gene            347963..348589
FT                   /locus_tag="Xfasm12_0297"
FT   CDS_pept        347963..348589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0297"
FT                   /product="putative methylase"
FT                   /note="KEGG: xft:PD0274 putative methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11320"
FT                   /protein_id="ACA11320.1"
FT                   /translation="MNHRRVLPVRVCGEGHVRIIGGRWRNTRLRVPELPGLRPTSSRVR
FT                   ETLFNWLMPVLPGAHVLDLFAGSGALGLEAVSRGAARAVLVERHAELVVLLREQVARLG
FT                   AQDQVEIVQADALQWLQRPAAARFDIIFLDPPFAAGVWETVVVRLALHVAAAAWLYMES
FT                   PVDLEPVMLPGWELHRDGRTREVCYALYRYPAVTLPVGSKSVSSV"
FT   gene            348586..349074
FT                   /locus_tag="Xfasm12_0298"
FT   CDS_pept        348586..349074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0298"
FT                   /product="Pantetheine-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /note="KEGG: xft:PD0275 phosphopantetheine
FT                   adenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11321"
FT                   /db_xref="GOA:B0U1Z4"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U1Z4"
FT                   /protein_id="ACA11321.1"
FT                   /translation="MSVVNRRIAVYPGTFDPITNGHIDLVSRAAPLFESIVVGVAQSPS
FT                   KGPSLPLQQRVTLAREALCQHENVQVIGFDTLLAHFVRHVGAGVLLRGLRAVSDFEYEF
FT                   QMASMNRHLIPEVETLFLTPAEQHSFISSSLVREIARLGGDVSGFAPAAVVAALRQNL"
FT   gene            349124..349618
FT                   /locus_tag="Xfasm12_0299"
FT   CDS_pept        349124..349618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0299"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0276 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11322"
FT                   /protein_id="ACA11322.1"
FT                   /translation="MNNMLRVVVVASFVFILAACGQKAAQTVADVASSVPTVPAKDDNA
FT                   AWKTYLGQVVSNHLGNSTGSPFLYYLPPASDPDFKGKYDRQLENVTSALGRGVQPGTLV
FT                   VFGSSASAKMADLIVAAFNKVQAGSMKGVHVLFIGMSADNARVQKVVQPSGAEYVFVEA
FT                   K"
FT   sig_peptide     349124..349198
FT                   /locus_tag="Xfasm12_0299"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.979) with cleavage site probability 0.774 at
FT                   residue 25"
FT   gene            349736..350074
FT                   /locus_tag="Xfasm12_0300"
FT   CDS_pept        349736..350074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0300"
FT                   /product="ferredoxin"
FT                   /note="KEGG: xft:PD0277 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11323"
FT                   /protein_id="ACA11323.1"
FT                   /translation="MRDVAVHDVVGLFFETSVMSLRINALCVNCDVCEPVCPNRAISMG
FT                   ETIYIIDPLRCTECVGHYDEPQCVVVCPVECIDPHPGLLETREQLLSKLQQLQRNDPEL
FT                   YEKESPDL"
FT   gene            350071..351882
FT                   /locus_tag="Xfasm12_0301"
FT   CDS_pept        350071..351882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0301"
FT                   /product="Gamma-glutamyltransferase"
FT                   /EC_number="2.3.2.2"
FT                   /note="KEGG: xft:PD0278 gamma-glutamyltranspeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11324"
FT                   /protein_id="ACA11324.1"
FT                   /translation="MSLFPRCFLLLCVFFSHVSAEQREVGLLREGVARVPPGAVIASSH
FT                   YLATDAGLQILKQGGNAFDAAVAVSSTLSVVEPISSGLGGGGFFLLHDAKTGRDVMLDA
FT                   REYAPASVNLGTFLNKDGQLDHDRSINGPWSAGIPGLPAALVELAEHYGKLPLRQTLAP
FT                   AIRIASAGFPVYRRMVEGYQSRREVMERYPGTREVYLRGGKPMDEGDIFKQPELARTLL
FT                   LLANKGFDGFYKGETAQRLLAGVNRAGGRWTAEDLAGYRVKSRVPITFDYRGWKITTAP
FT                   PPSSGGIALAEMLQILEGWDLNRLDDVHRVHLVVEAMRRAYRDRTFFLGDPDFVSIPQR
FT                   VLTSKDYACGLRAGINPEKATPSVLLSGHPTPLEDEETTHFSIIDAEGNRVGATQTVNL
FT                   LYGSGLIPKGTGVLLNNEMDDFALQPGVPNVFGVMGYEANAPKPGKRMLSSMTPTFLES
FT                   ADKVAVIGTPGGSRIITMVLLGILGYDAGLDAQQVAALPRYHHQWLPDVIETEAATFPA
FT                   EVIKGLETMGHTIKQPSDTVAGGRGSSHVWGNVQTVEWDRRSNVLIGGHDPRHVVGKAV
FT                   VWLTDKAVVLPPMDHLPTPCLQDCHAQ"
FT   sig_peptide     350071..350133
FT                   /locus_tag="Xfasm12_0301"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.975) with cleavage site probability 0.839 at
FT                   residue 21"
FT   gene            complement(352368..352529)
FT                   /locus_tag="Xfasm12_0302"
FT   CDS_pept        complement(352368..352529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0302"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF0985 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11325"
FT                   /protein_id="ACA11325.1"
FT                   /translation="MILFEEHVNSSPDLLDNTGLRYKPIAPPHPVSVLINQLLENSVLE
FT                   IAGIGENA"
FT   gene            352750..354414
FT                   /locus_tag="Xfasm12_0303"
FT   CDS_pept        352750..354414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0303"
FT                   /product="GGDEF family protein"
FT                   /note="KEGG: xft:PD0279 GGDEF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11326"
FT                   /protein_id="ACA11326.1"
FT                   /translation="MKRQLGYFLLRGVLLWLCLAAPAVAQSLMLERLDDDPPAHEVLAG
FT                   VYDAMLRPNDTGGASIYETARHPVWWRIRADRQISAAGQPKLQIEFPYLNWVEAWVPGR
FT                   SVPSRHAIYGAAADRRYATRALVIDLPEGLPQGRAVWLRVHAQSTISMPVSIVSNDVVH
FT                   RRDLDHVAWYSFILGLTTVLAVLSASLWVRLREPVYGYFTVNLVCVLLYLIGFDGEARG
FT                   FPVLGELFGSSPVPIRVVATFGGFVIVNFQRHYLNTAFRIPRVDLALKGSSGWLLVMAV
FT                   LNVVPQIQPYPVLTYLSLMVASLLLLFSCVWLGGVRGHRDAWSLLVAWTPLLLFSMLRS
FT                   LELIGWNRLSGNGAWIGYGLSMSLGLSCLLVTLVLADHMLELRRDRDRARLLANVDGLT
FT                   GALTRVAIERRLERDIDDARQMGTPLSVVFIDIDHFKRINDEYGHAAGDACLRQVVQRV
FT                   RGWLRASDALGRHGGDELIAILPGADLAAARRVAEGIRVAVSSQPFQFECTRLRCTLSL
FT                   GVASWLPDESIEALLQRADNGLYASKAAGRDRVSTEM"
FT   sig_peptide     352750..352827
FT                   /locus_tag="Xfasm12_0303"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.987 at
FT                   residue 26"
FT   gene            complement(354514..355332)
FT                   /locus_tag="Xfasm12_0304"
FT   CDS_pept        complement(354514..355332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0304"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0280 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11327"
FT                   /protein_id="ACA11327.1"
FT                   /translation="MLVTLTLPPITYAQNKTNTQETRSEFPTNVSQGALVIGTVPAGSR
FT                   VEYSGQVLRVDDKGQVVFGVGRNETGPLILRIQTPKGTVKQVNINVTTRQWPLEVVNGV
FT                   PPKTVNPPPAIAARITREQAQITDARQRNDARSDFAQAFIWPVQGRISGRFGSARIYNG
FT                   QTAGNGHSGMDIATATGTPVKAPAAGVITFAAPDLYLTGGTVLLDHGAGVSSNFLHLSR
FT                   IDVKAGDHVGQGQVIGAVGATGRATGPHLHWGMNWFNVRIDPLLILERTR"
FT   gene            complement(355371..356720)
FT                   /locus_tag="Xfasm12_0305"
FT   CDS_pept        complement(355371..356720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0305"
FT                   /product="Allantoinase"
FT                   /EC_number="3.5.2.5"
FT                   /note="KEGG: xft:PD0281 dihydroorotase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11328"
FT                   /protein_id="ACA11328.1"
FT                   /translation="MNPTLIVNARLVNEGREFDSDLRIENGRIARIDTGLSAQSKDIVI
FT                   DAAGRRLLPGMIDDQVHFREPGLTHKGDIASESAAAVAGGLTSFMDMPNTNPPTLGAAA
FT                   LQAKYDAARGRAWGNYGFYLGASNDNLAAIQALDPKTSPGIKVFMGASTGNMLVDNETT
FT                   LEGIFRHAPTPIITHCEDTPTINATLAKYHSRYGNTLSAEQHPDIRSRQACLKSSQLAV
FT                   SLAKKNSTRLHVLHISTADELRLFEAGPLVDAAGKRRKQITAETCIHFLHFDRMDYARL
FT                   GNLIKCNPAIKEASDREALIAALAKDVIDVLATDHAPHTWEEKQQPYAQAPSGLPLVQY
FT                   ALVAALELVHAGRLSVTEIVRKFAHAPAQLFDVTERGFLREGYWADLVLVEDTPFTVKR
FT                   QEILSKCGWSPFEGTTFRSRIASTWVNGNHVWDGNRLVGVPNGQRLEFDR"
FT   gene            complement(356717..356980)
FT                   /locus_tag="Xfasm12_0306"
FT   CDS_pept        complement(356717..356980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0306"
FT                   /product="alpha-hemolysin"
FT                   /note="KEGG: xft:PD0282 alpha-hemolysin"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11329"
FT                   /protein_id="ACA11329.1"
FT                   /translation="MHPLILLLKIYKRLISPLLGPHCRFEPSCSEYAMVAIARFGTLRG
FT                   IWLAARRLARCNPLQLGGHDPVPDNTSTQVNPRSHRCTGHHQ"
FT   gene            357088..358029
FT                   /locus_tag="Xfasm12_0307"
FT   CDS_pept        357088..358029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0307"
FT                   /product="transcriptional regulator, TraR/DksA family"
FT                   /note="KEGG: xft:PD0283 DnaK suppressor"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11330"
FT                   /protein_id="ACA11330.1"
FT                   /translation="MAAKKIVKKIVPVVSSTAKPIGKNAAVAADKELPAKSPSPSAGKK
FT                   RPATTKKAPVNKTVANKDAQVKLLSGHATNKVAKSVLKSASKPLTAESVPIHNNAVPAV
FT                   ATIPMDPKSTSAANHALISKSSAKTPAKFDSSSKPSASRPAGKVAVAVTGETLPRVSKT
FT                   KYKVVKYNVDEATGRPILPLGYKPSSEEEYMNPLHQEYFRQRLEQWRKDLVEESKQTIE
FT                   NLRDEVRDIGDEAERATRETENSLELRTRDRYRKLIAKIDSTLNRLEINDYGYCVDTGE
FT                   EIGLERLDARLTAERTIDAQERWEHLQKQQGD"
FT   gene            358169..359241
FT                   /pseudo
FT                   /locus_tag="Xfasm12_0308"
FT   gene            complement(359426..360670)
FT                   /locus_tag="Xfasm12_0309"
FT   CDS_pept        complement(359426..360670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0309"
FT                   /product="drug:proton antiporter"
FT                   /note="KEGG: xfa:XF0993 drug:proton antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11331"
FT                   /protein_id="ACA11331.1"
FT                   /translation="MSTSPASSATLRTLLCHPGFTAVLAYRIAATLSYQIVSVTIGWHI
FT                   YEITRNPLLLGLVALAEILPFFCIAPFAGYLVDHLPRRRLGMFASLGLAMTPTILLIAA
FT                   FNTAPVQTTWPIYVAASLSGMVRSFIVPVYNALFARVLPREDYARGAGLGTVTFQASLV
FT                   LSPMLGGILIALGGKGLAYAAGVVAAIIALLALALLRVEEPAVDKPRAPVLDSIAEGLR
FT                   FVFSNQILLGAMALDMFSVLLGGAVSMLPAFIQDIFHYGPEGLGILRGTPALGSVLTGL
FT                   WLARYPLQRHAGRTLLLAVAGFGICTIAFGLSQHFWVSAGILLVYGACDGISVVLRASI
FT                   LQLVTPDEMRGRVSSINSIFIGSSNELGAFYDGVMARFIGLVHAVVLGGFMTLVVVGIT
FT                   ALKAPRLRRLDLRDL"
FT   gene            complement(360667..361107)
FT                   /locus_tag="Xfasm12_0310"
FT   CDS_pept        complement(360667..361107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0310"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0286 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11332"
FT                   /protein_id="ACA11332.1"
FT                   /translation="MTDDPFPLESTAAAAQAAIAEEFSFFGNWSERYQYLIDLGRKLPV
FT                   FPESWKTEEHRLHGCQSMVWIMSEGNSDDLKFYGASDSAIVSGLIYLALRVYSGRSASE
FT                   ILKTSPSYIADIGLAKHLSPTRNNGLAAMLELIRNTAQTLNA"
FT   gene            complement(361192..362595)
FT                   /locus_tag="Xfasm12_0311"
FT   CDS_pept        complement(361192..362595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0311"
FT                   /product="Cysteine--tRNA ligase"
FT                   /EC_number="6.1.1.16"
FT                   /note="KEGG: xft:PD0287 cysteinyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11333"
FT                   /protein_id="ACA11333.1"
FT                   /translation="MSLHLYNTLHRRVEPFEPLDPACPTMYVCGPTVYNYVHIGNARGP
FT                   VVFGVLAALLRRRYGALRYARNITDVDDKINTAAQEQGVPISAITERFCAAYREDMKKL
FT                   GVEPPDIEPEATAHMPQIIAMIEQLIERQHAYVAMEHVLFAVNSFADYGQLSRRDPEEM
FT                   LAGARVEIAPYKRDPSDFVLWKPSSDQLPGWDSPWGRGRPGWHIECSAMAAAHLGETID
FT                   IHAGGIDLQFPHHENEIAQSRCAHGSSTFARIWMHNGMLNFEGAKMSKSLGNIETVHGL
FT                   VTKHPPEALRYALLSAHYRKPLDWSEALIAQSVRTLNRLYGTLRELAAYPARAIIPGNI
FT                   EAALDDDLNTPQALAELATLANEARIQLADTTHHAAAEVTTALTRLKAKLLGAGLALGL
FT                   LQQTPEAWFSQGTNESDETHIQALIDARSAAKQARDFVRADAIRAQLAAEGIVLEDTPQ
FT                   GVRWMKQHT"
FT   gene            362754..363290
FT                   /locus_tag="Xfasm12_0312"
FT   CDS_pept        362754..363290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0312"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0288 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11334"
FT                   /protein_id="ACA11334.1"
FT                   /translation="MGLMRLPSLFFTCCVLASFVMPSWAAHPRKADLKNVGIVGNVKFD
FT                   YAQVMKVAPVYQTWHASHVEEQCDPLPLTEVAPELDPGHDKHRKISRVMELVKGFFSNH
FT                   HTEQALPGASTNSQRNCRIVEVPRQFRRPIAYDVDYIYKGTKYRSRLPEDPGNRLPVRV
FT                   LVTPYLSEHNFPPPR"
FT   sig_peptide     362754..362831
FT                   /locus_tag="Xfasm12_0312"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 26"
FT   gene            363296..363487
FT                   /pseudo
FT                   /locus_tag="Xfasm12_0313"
FT   gene            363687..364697
FT                   /locus_tag="Xfasm12_0314"
FT   CDS_pept        363687..364697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0314"
FT                   /product="ornithine carbamoyltransferase"
FT                   /note="KEGG: xft:PD0290 ornithine carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11335"
FT                   /protein_id="ACA11335.1"
FT                   /translation="MALKNFLNTQDWSCSELNALLTQARAFKHNKLGNALKGKSIALVF
FT                   FNPSMRTRSSFELGAFQLGGHAIVLQPGKDAWPIEFDTGTVMEAETEEHICEVARVLGH
FT                   YVDLIGVRAFPKFLDWTYDRQDIVLNSFAKYSPVPVINMETITHPCQELAHIMALQEHF
FT                   GTTDLRGKKYVLTWTYHPKPLNTAVANSALTIATRLGMDVTLLCPTPDYVLDERYIDWA
FT                   RQNIADTGSTFQVSHDIDNAYRGADVIYAKSWGALPFFGNWAMEKPIRDQYRHFIVDEA
FT                   KMALTNNAVFSHCLPLRRNVKATDAVMDGSNCIAIHEAGNRLHVQKAVMAALASQ"
FT   gene            364728..365933
FT                   /locus_tag="Xfasm12_0315"
FT   CDS_pept        364728..365933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0315"
FT                   /product="Argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="KEGG: xft:PD0291 argininosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11336"
FT                   /protein_id="ACA11336.1"
FT                   /translation="MSKKNIVLAFSGGLDTSFCIPYLKEQGYAVHTVFADTGGVDEDER
FT                   DFIEKRAAELGVASHLTVDGGPAIWDGFVKQLVWAGEAYQGQYPLLVSDRYLIVDAVLQ
FT                   RADALGTCAVAHGCTGMGNDQVRFDLAIKAQGDYTIIAPIREIQKEHTQTRLYEQKYLE
FT                   ERGFGVRAKQKNYTINENLLGITLSGGEIDKWEAPGEGARGWCAPRSAWPTDPLTVAIK
FT                   FVEGEAVAVDGKPLSGPQILMKLNKLFASYGVGRGIYTGDTVIGLKGRIVYEAPGLTAL
FT                   LTAHRALEDAVLTKQQNRFKPHIARKWVELVYEGFFHDPLKTDLETFLKSSQANVNGEI
FT                   VLETRGGRVDAVAVRSPHILTSKGVTYAQTADWGIEEAEGFIKLFGMSSTLYAHVNRSL
FT                   RS"
FT   gene            366004..367098
FT                   /locus_tag="Xfasm12_0316"
FT   CDS_pept        366004..367098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0316"
FT                   /product="acetylornithine deacetylase"
FT                   /note="KEGG: xft:PD0292 acetylornithine deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11337"
FT                   /protein_id="ACA11337.1"
FT                   /translation="MSALLDSTLDHLEQLVSFDTRNPPRSITTDGIFSYVKAHLPGFQI
FT                   EMTDHGAGAVSLYAVRGTPNVLFNVHLDTVPDSPAWSADPHVMRRAVDRVIGLGVCDIK
FT                   GAAAALLAAVQATDGPAALLFTSDEEANDPRGVAAFLKRNIPYHAVLVAEPTMSQAVLA
FT                   HRGISAVLMKFTGRAGHASAEQQPQASALHQAMRWGVRALDYTASLAHTRFGGLTGLRF
FT                   NIGRLEGGIKANIIAPTAELRFGLRPLPSMDVDQLLAALAALAVPAPASFEETFRGPSL
FT                   PWGGIATAEIRRLSARDIADALHLPIGNAVDFWTEASLFSACGYTALVYGPGDIAQAHT
FT                   ADEFVTLQQLQRYAESVYRIINAT"
FT   gene            367163..368479
FT                   /locus_tag="Xfasm12_0317"
FT   CDS_pept        367163..368479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0317"
FT                   /product="acetylglutamate kinase"
FT                   /note="KEGG: xft:PD0293 acetylglutamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11338"
FT                   /protein_id="ACA11338.1"
FT                   /translation="MHANLQTRQIIIRLLSSMASAKEISQYLKRFSQLDAKRFAVVKVG
FT                   GAVLRDDVDALTSSLSFLQEVGLTPIVLHGAGPQLDEELTAVGIQKKTVNGFRVTLPET
FT                   MAIVRKVFHATNLQLIEALQRNGARATSITGGVFEAHYLDQETYGLVGGISAVNIAPIE
FT                   ASLRAASIPVIASLGETPSGQILNINADVAANELVHVLQPYKIIFLTGTGGLLDADGKI
FT                   INSINLSTEYEQLIQQPWVYGGMKLKIEQIKHLLDRLPLESSVSITRPADLAKELFTHK
FT                   GSGTLVRRGERVIRATTWKDLDLPRLQHLIQSSFRRTLIPHYFETTPLLRAYVSENYRA
FT                   AVILTKLGNVPYLDKFAVLDDAQGEGLGRAVWSIMREETPQLFWRSRHNNQANAFYYAE
FT                   SDGYYKQDHWKIFWNGLHHFQQIQQCVAHCAQHPPTLID"
FT   gene            368482..369483
FT                   /locus_tag="Xfasm12_0318"
FT   CDS_pept        368482..369483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0318"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="KEGG: xft:PD0294 N-acetyl-gamma-glutamyl-phosphate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11339"
FT                   /protein_id="ACA11339.1"
FT                   /translation="MSTATFTLGIVGARGYTGAALISLLTAHPAIELIFVSSREYHGQP
FT                   VAAHSPTYCGDLRFETLDPAAVAAKRADVVILALPNGNAAPYVHAIDATAPPTIIIDLS
FT                   ADTRFDPDWYYGLPELTRHTYTGHKRISNPGCYATAMQLAIAPLRDQLAGPPQCFGVSG
FT                   YSGAGTTPSDKNNQALLRDNLMPYALTDHLHEREVSAQLGIPVEFMPHVAPHFRGITLT
FT                   ANLWLQRPLTREHIKTLYATRYANDPLIDIIDPPPWVNQIAARHTVQIGAFTMAPGNKR
FT                   VVIVATLDNLLKGAATQALQNLNRALGLDELTAIPYQPNPPATPLPSSPLAS"
FT   gene            369480..370838
FT                   /locus_tag="Xfasm12_0319"
FT   CDS_pept        369480..370838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0319"
FT                   /product="argininosuccinate lyase"
FT                   /note="KEGG: xft:PD0295 argininosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11340"
FT                   /protein_id="ACA11340.1"
FT                   /translation="MTTPASPMDTTPMPTLLWNKPGVAIDASIQTFLAADDVLLDREFF
FT                   LYDITASTAHAQALQRIGLLTPDELDNILRELQHLTDEYRNGTFLLDTQYEDGHSAIES
FT                   RLTERLGDTGRKIHTGRSRNDQILVATRLWLKDRLTQLSTLNRDIAHHALQRAAAEQHL
FT                   PMPGYTHLQRAVVSSVGMWWAGWAESFIDNALRAADTLALIDCNPLGTAAGYGVNLPLD
FT                   RPHTTTALGFARLQVNPICAQLSRGKFELAALEALGSATLDLRRIAWDLSLFTTSEFAF
FT                   ITLPPEYSTGSSIMPNKRNPDVIELMRATHASVAAARTEIEQLLSLPSGYHRDLQNSKG
FT                   AIVRGFNRGLAALELLPALLSRLQWRPDTLRAAIDPGMYATDAAIEAAITGIPFRDAYQ
FT                   MAAKTADTAAQGRTPETSLTARRSPGAAADLCLETLRARWRTLTQPTSDPDPR"
FT   gene            370974..372128
FT                   /locus_tag="Xfasm12_0320"
FT   CDS_pept        370974..372128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0320"
FT                   /product="Glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /note="KEGG: xft:PD0296 glutamate 5-kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11341"
FT                   /db_xref="GOA:B0U207"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U207"
FT                   /protein_id="ACA11341.1"
FT                   /translation="MTGIPPPSRFPEQPIPPWRRAVLKVGSSLLAADGGGLSPRFALDL
FT                   AHFVSANITAGRQLVIVSSGAVAAGRALIPPLPESGGALAARQALAALGQAQLIALWQR
FT                   FFDRPVAQVLLTHDDLRNRRRYLNARATLRELLHLGTLPVVNENDTVSVDELKLGDNDN
FT                   LAAIVAALIDAQALFIATDIDGLYTTDPRHHPDAQPLHEVRTLTPEHLAMAGDSSSTGG
FT                   TGGMRTKLEAALKAGAAGIDTYLFNGRSSDVVRGLAQHRLRGTRIHPTCTPIAARKYWL
FT                   RHAPVEPGAILIDAGAAAALAQQGASLLPGGVLSAEGDFRRGDMIQITTRSPDHPSHPL
FT                   ARGLVQYSAADVRRIAGCHSRDIQTLLGYTYGDTIVHRDDLVLL"
FT   gene            372339..373646
FT                   /locus_tag="Xfasm12_0321"
FT   CDS_pept        372339..373646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0321"
FT                   /product="Glutamate-5-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.41"
FT                   /note="KEGG: xft:PD0297 gamma-glutamyl phosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11342"
FT                   /db_xref="GOA:B0U208"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U208"
FT                   /protein_id="ACA11342.1"
FT                   /translation="MPHIRHLAQQCRDAARILATLSTDAKRRLLETMATALNTDAATIL
FT                   AANAADLDTARTQQVGTAMLDRLALDPQRLAAMADALRDIAALPDPVGQVTRDDRRPNG
FT                   IHIQKIRVPLGVIAMIYEARPNVTADAAALCIKAGNGIILRGGSEAIRSNIAIATALQR
FT                   ALRLASLPETALILVQDMARHTMLELLQLSDLIDLVIPRGGEGLIRFVAEHARIPVIKH
FT                   YKGVCHQFVDASADIEMAIRLLIDGKTTRPAACNALETLLVHTDIAPRFLPAAAAALRP
FT                   YGVQLRGDHATCTLLPDVLLATDADYAAEYLDLILAIRIVPNLDAALEHIRRYGSDHTE
FT                   VIVTADPAHADTFVQQLHSAVVMVNASSRFSDGGALGLGAEIGISTTRLHAYGPMGLDA
FT                   LTVERFVVRGQGQVRHCPLIHLHRDVSVANMPPITS"
FT   gene            374069..374575
FT                   /locus_tag="Xfasm12_0322"
FT   CDS_pept        374069..374575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0322"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF1008 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11343"
FT                   /protein_id="ACA11343.1"
FT                   /translation="MPFINEIPSAEDIEKYGLPYKKDLDLDISLRRQWTVDRERNFHLY
FT                   GGGGTTANQAFTDVFYYRFYLYLNGTKFVVELDAGRGSLVFEENPYVVVWSKLMSIKVW
FT                   PHDQVSPLKRVPPTAWDTPDAPQPLLDNRSLNQFIAILKEALTVHGAGDSNRRIHHPIV
FT                   VRFGF"
FT   gene            374599..375072
FT                   /locus_tag="Xfasm12_0323"
FT   CDS_pept        374599..375072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0323"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0299 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11344"
FT                   /protein_id="ACA11344.1"
FT                   /translation="MTLTAEQANALLGSITTQEQLRDLINQLDIHSSGSITVLYSGYTA
FT                   NGLDNSQIIQGMLHNGDTIRVIDTTEAAKFLNISPDDPHKNNALLRSHYYVDVLLHGDD
FT                   VYSTANRSVICLIKHHDRVFYQGCDTATPSQGRSARSKQCFIYLITSSIYFTP"
FT   gene            375083..375584
FT                   /pseudo
FT                   /locus_tag="Xfasm12_0324"
FT   gene            375602..375949
FT                   /locus_tag="Xfasm12_0325"
FT   CDS_pept        375602..375949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0325"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0303 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11345"
FT                   /protein_id="ACA11345.1"
FT                   /translation="MSLTVEQANALLGSITTQEQLRDLINQLDIHSSGSITILYSGYTA
FT                   NGVSNSQILQGMLHNGDTIRVIDTTEAVRFLNITPNDPHKNNALLRSHYYVDVLLHGYR
FT                   WGFNQAMLSDV"
FT   gene            376095..376604
FT                   /locus_tag="Xfasm12_0326"
FT   CDS_pept        376095..376604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0326"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF1006 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11346"
FT                   /protein_id="ACA11346.1"
FT                   /translation="MPFINEIPSAEDIEKYGLPYKNDVNLPMRLRSQWTVDRERNFHLY
FT                   GGGATANQAYEEIFYYRFYLYLNGTKFVVELDVDPNRKPPTFKDNPYVIVWSKLMSIKV
FT                   WPHDQVSPLKRVPPAAWDTPDAPQSLLDNRSLNQFIVILKEALTVRGAGDANRNIHHPI
FT                   VVHFGF"
FT   gene            376628..382072
FT                   /locus_tag="Xfasm12_0327"
FT   CDS_pept        376628..382072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0327"
FT                   /product="hemolysin-type calcium binding protein"
FT                   /note="KEGG: xfa:XF1011 hemolysin-type calcium binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11347"
FT                   /protein_id="ACA11347.1"
FT                   /translation="MTLTAEQANALLGSITTKEQLWDLINQLDIHSSGSITVLYSGYTA
FT                   NGVSNSQILQGMLHNGDTIRVIDTTEAAKFLNIEPGDPNRNKALAEKLEQIIGDDPNER
FT                   GSRANEFLFGERAADGTRLPNGAWDTISARFVNETVGEVRTLTGGASVTGVFNQTELPR
FT                   LLNNPNITSVDGLPIADLRRLGAAGSFQAISAQSEHLSGYLKLAINADGSIMELPGGVP
FT                   RLDSQQYFALTGLEGKPPLVDAGDYGALARYIPARLDNHLEGARLVQDIKDGYQRTTQL
FT                   LGPESAAARANALRVLGKLGVAADLLSLAVMAHDANAAYASGNIEGSRQIVQDWTSQYL
FT                   GGLMGGLAEAKAVGLLLTPVYLDGPIGAAVASVLTVAAGVEGTFLGSHYIGAFLDKVFD
FT                   QLHHIGELSGSRLYDWVTQIGDLFRRLNQTLHKDNASLLDLLHDLFRNSRDERDPLVLD
FT                   LDGDGIETLAAGKHILFDHDGDGITHASGWVKSDDGLLVLDRNGNGRIDNGSELFGADT
FT                   VLSNGHTAASGFDALRDLDSNGDGLFSAADARFTDVRVWRDLNQDGQSQANELFTLSTL
FT                   GIASITLTPTDTQRVNLGNGNVMDARGSYTRTDGRSGTVGNLQLGVDQFYRDYRGAHDK
FT                   VTISEAARALPAISGSGAVRDLQEAASLSPALLAAVQVLLSGTTQGTLRAALDQVIALW
FT                   ASTSTMRSSEELLEASGEGNRTVYYHSVVMPVSVASQGKEAVQAWIQQQHARLGPIIGI
FT                   LEKFNGSRMVSEQNGQIILCGQSFTWQRVVRPDGHSETVMDLGLVPEVVSNTFDAFTEA
FT                   YAKLKESIYIRLVLEPRLTDYLSGLRLTYNNGVMGWDASGLEAKLDQTWQHNKVQALQD
FT                   VMDLYHYSSDALAPSGWNPLDALRQMVDRTAATPDGRQALADAGIPQIAGNAEGSDAAD
FT                   LLFGDAGANLLRGGGGDDVLSGGAGNDTLYGGDGNDALYGDAGNDTLYGGVGNDLLLGG
FT                   AGDDLLDGSEGSNRLEGGAGNDVLKVAYWSTDNVLNGGSGDDLLDGSAYGDTYLFNKGD
FT                   GHDTLIERDGTDTLVFGAGIVASQVRRLHEGQDVVLDLGNGQDSIRLKDWLTCYGTRND
FT                   SADIEQIVFADGTLWTPETLSSMGLTTLGTSGNDTLKGWQGKDILLGGDGDDILDGGDG
FT                   SNRLEGGAGNDVLKVSYWSADNVLNGGSGDDTLYGSGHADTYLFNKGDGHDTIVEHYGS
FT                   EKIVFGAGIVADNVRLLREGQDVVLDLGNGHDSIRFKDCFHANHNRNIFVNIEQMVFAD
FT                   GTVWTGETLSTLGFSTLGGDGDDVLDGGEGSNRLEGGAGNDVLKVASNSSDNVFSGGTG
FT                   DDMLYGSAHSDTYLFNQGDGHDTIIEPGGSFDRLVFGEGITADDVRVVRQGQDVVLDLG
FT                   NGHDSIRMKDWLTSDGEYNRTGNIEEILFADGTRWTGDTLGWREMTTFGTSGNDTLQGW
FT                   GSSDILLGGNGDDVLSGDYGDDTLYGEAGDDLLLGDNGNDVLDGGEGHNRLEGGAGKDV
FT                   LKVSTDGSSDNVFSGGTGDDMLYGSVHSDTYLFNWGDGRDTIVEQGGFDKIVFGEEIAV
FT                   SDIHVLREGQDVVLDLYNGYDSIRLKDWLTSDGTRNSNADIEQIVFADGTVWSGETLSS
FT                   IGLKTLGSADNDTLNGWNGRNILVGEDGDDVLKVSMFDSSDNVLVGCRGNDMLYGSSNS
FT                   DIYFFDQGDGHDTIIEQGGADTLEFGEGLHREEACFTRSGDDLSILFNGSEDQVTVAGW
FT                   FSAAAHQVESLVFQDGTVLSGEVERLIAAMALSPAVTTMQASVRDIKESPRLVASSIV"
FT   gene            complement(382268..382765)
FT                   /locus_tag="Xfasm12_0328"
FT   CDS_pept        complement(382268..382765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0328"
FT                   /product="cytosine deaminase"
FT                   /note="KEGG: xft:PD0306 cytosine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11348"
FT                   /protein_id="ACA11348.1"
FT                   /translation="MTAPPPVLPEHTHWMRHALTLAHRAATEFDEIPVGAVLISPEGTL
FT                   LGEGCNYNITSHDPSAHAEIMALRAAGHQLRNHRMPGCTLYVTLEPCLMCAMAIIHARI
FT                   AHLIYAAADPKTGACGSTFDILNDPRHNHHVHVYGGLLAEEASRRLTNYFRTKRGQPPL
FT                   PQ"
FT   gene            complement(382773..383267)
FT                   /locus_tag="Xfasm12_0329"
FT   CDS_pept        complement(382773..383267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0329"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF1013 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11349"
FT                   /protein_id="ACA11349.1"
FT                   /translation="MQSPMNTRHNIPKHENTQTQTAPLIDAKIHVASFRQVRQARRDEL
FT                   IKDYVELISDLLADSGQARQVDIAAHLGVAQPTVAKMLKRLARDGWIIQRPYRGTFLTP
FT                   AGKALAAASRECHQTVERFLLALGIDATTARRDAEGIEHHVSETTLAAFRAFLHRHSDT
FT                   T"
FT   gene            383269..383416
FT                   /pseudo
FT                   /locus_tag="Xfasm12_0330"
FT   gene            383455..384831
FT                   /locus_tag="Xfasm12_0331"
FT   CDS_pept        383455..384831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0331"
FT                   /product="putative manganese transport protein MntH"
FT                   /note="KEGG: xfa:XF1015 putative manganese transport
FT                   protein MntH"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11350"
FT                   /protein_id="ACA11350.1"
FT                   /translation="MFRPSLIHRSMSSLQPMSPVSDSPSLGEMHASVAVSRRGHWGFRF
FT                   LAFLGPGYMVSVGYMDPGNWATGLAGGSRFGYMLLSVILLSNVMAIVLQALAARLGIAS
FT                   DMDLAQVCRARYSRGTTLALWVVCELAIIACDLAEVIGTAIALNLLLGIPIIFGVLITA
FT                   VDVVLVLLLMHRGFRALEAFVIALLLVIFGCFVVQIVLAAPPLQEVLCGFVPRWQVVAD
FT                   PQALYLAIGIVGATVMPHNLYLHSSIVQTRAYPRTPVGRRSALRWAVADSTLALMLALF
FT                   INASILILAAAVFHAQHHFDVEEIEQAYQLLAPVLGVGVAATLFATALLASGINSTVTA
FT                   TLAGQIVMEGFLRLRLRPWLRRVLTRGLAIVPVIVVVALYGEQGTGRLLLLSQVILSMQ
FT                   LPFAVIPLLRCVADRKVMGALVAPRWLMVVAWLIAGVIVVLNVKLLGDYAVHLMVGVSN
FT                   "
FT   gene            384847..385020
FT                   /locus_tag="Xfasm12_0332"
FT   CDS_pept        384847..385020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0332"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF1016 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11351"
FT                   /protein_id="ACA11351.1"
FT                   /translation="MIRRGRCSQWSWCFVFMHRFAVFQGAFYGMPVCMVVDGVDVGSRR
FT                   HNDVLAICWVSF"
FT   gene            complement(384877..385176)
FT                   /locus_tag="Xfasm12_0333"
FT   CDS_pept        complement(384877..385176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0333"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xfa:XF1017 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11352"
FT                   /protein_id="ACA11352.1"
FT                   /translation="MNRTRKKDSTSNELFQPQPQRNVTSPHHRTSLDYPHLHPNQNKWR
FT                   HGTMPHISKRYPTNSQHIIVAPAANIDTINNHANGHSIKSPLKHSKPMHKHKTP"
FT   gene            complement(385343..386107)
FT                   /locus_tag="Xfasm12_0334"
FT   CDS_pept        complement(385343..386107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0334"
FT                   /product="Arginyltransferase"
FT                   /EC_number="2.3.2.8"
FT                   /note="KEGG: xft:PD0309 arginine-tRNA-protein transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11353"
FT                   /db_xref="GOA:B0U219"
FT                   /db_xref="InterPro:IPR007471"
FT                   /db_xref="InterPro:IPR007472"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017138"
FT                   /db_xref="InterPro:IPR030700"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U219"
FT                   /protein_id="ACA11353.1"
FT                   /translation="MAIDSKPHDDLQLFKTNLHPCGYWPDRWASDLVMDPNDPRLGAIY
FT                   PQTLAWGFRRSGNLLYRPHCEHCNACVPVRVNVNAFVPNRSQRRCLARNATLVTRIVPA
FT                   ERNAEQLSLYRRYLHQRHPDGGMDGHGAIEFDQFLIGPWGYGRFMEIREPATNGTPGQL
FT                   LAVAVTDLIHQALSAVYTFYEPNAAARGLGTLAILHQIHWAQREQRPYLYLGYWIKDHF
FT                   KMDYKRRFQKLEIYDGYCWRPFSTTYPTTHTL"
FT   gene            386291..386410
FT                   /locus_tag="Xfasm12_0335"
FT   CDS_pept        386291..386410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0335"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF1019 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11354"
FT                   /protein_id="ACA11354.1"
FT                   /translation="MLRAITNGLFALLGENAGFVVVLGQRVGCEGVLDVWMVL"
FT   gene            complement(386531..387022)
FT                   /locus_tag="Xfasm12_0336"
FT   CDS_pept        complement(386531..387022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0336"
FT                   /product="pathogenicity-related protein"
FT                   /note="KEGG: xft:PD0310 pathogenicity-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11355"
FT                   /protein_id="ACA11355.1"
FT                   /translation="MRAIFTSQRVETVEGVAALLNEADIQVKISHQRSYHSKRNGQFSY
FT                   LDTNKQDQHPTVWIVHANDQPLARDILRKARLLDTTRHNLSDTDNVFTSPINTIAPRSL
FT                   HWTWRIRLTLLLTITAIGLIITWHHFPPPTTTPQTSLQTQQRAKPQDEQPVRVQIQPMH
FT                   "
FT   gene            complement(387026..387958)
FT                   /locus_tag="Xfasm12_0337"
FT   CDS_pept        complement(387026..387958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0337"
FT                   /product="Palmitoyl-CoA hydrolase"
FT                   /EC_number="3.1.2.2"
FT                   /note="KEGG: xfa:XF1021 putative acyl-CoA thioesterase II"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11356"
FT                   /protein_id="ACA11356.1"
FT                   /translation="MNYPSHYSGHIILPTHTTSNASSEWTKMLSLERLEDNLFRGQNRD
FT                   IGTKYVFGGQILAQALAAAQNTIENSRIAHSLHAYFLRTGNIQQPIIYNVERTRDGKSF
FT                   SLRRVTAIQHGQVIFFCTASFQECEDGAEHQTNMPAVPPPEDIAPTPPLPPETLARMPP
FT                   QMQTWLNLSGQFEFRRVPPNNTLDLQKHSAFQHLWLRMNAPLGDRIELHQILLTYASDF
FT                   QLLETATSQHGINYHTPQVQMASLDHALWFHRPFRIDDWLLYTLESPTAQGARGLARGQ
FT                   FFTRNGVLIANTAQEGLMRMTNHTTPSKD"
FT   gene            complement(387986..388096)
FT                   /locus_tag="Xfasm12_0338"
FT   CDS_pept        complement(387986..388096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0338"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF1022 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11357"
FT                   /protein_id="ACA11357.1"
FT                   /translation="MISRETIPPPFQNKPTEIPKDRKNAQQIQRFSNTSL"
FT   gene            complement(388792..389121)
FT                   /locus_tag="Xfasm12_0339"
FT   CDS_pept        complement(388792..389121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0339"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0312 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11358"
FT                   /protein_id="ACA11358.1"
FT                   /translation="MSINKLLIALAMGATLAACGSKTPETPPTQDPNPASNPAANEAQA
FT                   AADQAAANPPADATPAAADTAAAAANTAANAAATTTPPADAAKQSGAAPATPATKAKNP
FT                   AEQKK"
FT   sig_peptide     complement(389059..389121)
FT                   /locus_tag="Xfasm12_0339"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.811 at
FT                   residue 21"
FT   gene            390256..393105
FT                   /locus_tag="Xfasm12_0340"
FT   CDS_pept        390256..393105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0340"
FT                   /product="serine protease"
FT                   /note="KEGG: xft:PD0313 serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11359"
FT                   /protein_id="ACA11359.1"
FT                   /translation="MKTIFAARTILASALAAALSACGDPLVRSETPTTPTTPTTPTPLP
FT                   DLDPALAAKFRAHLDVTNTEPAHTLGFTGKGYMIGVVDSGVNPDHVTLQGRVIRNNVYV
FT                   DYQDPSSPHDVDGHGTTVAQLAAGRPFGDFPGGIAPGATIFSARVFSSAAESAKEDPIG
FT                   GNFFEGEAAQLKRVNADMIAAGVRIQNNSWGYESDDSNGEPIWTSPIITGLFVNAYRDL
FT                   VLNNNGLMIFASGNGKQTQPGQLSRLPSLPTVEGGASPADLERGWLVVAALDSFDHPDQ
FT                   LASYSNHCGIAMHYCLAAPGDVITVNSSVTNSSSVSDKYYVEQGGTSFAAPLVSGAAAL
FT                   VWEAFPYFSNDLVRQTLLGTATDLGAPGVDEVFGYGALNVGKAVLGPAKFDWGDVQVSF
FT                   DDRRSTWGNDITGSGGLIKRGTGTLMLGGSNNQYTGATQVLGGTLQASSLGASAVSVAN
FT                   TATLIGSGRFGGAVSNAGTLELGKDGLKVQGDYTQLETGRLALYVGDQLSVAGNATLKG
FT                   GELQVLGKRDYVTFNTSYSVLQADGSLTGTFSQLTWGPAVLLGEGRLTYGANNAYVTLQ
FT                   RLNVSAAAQALGIVDRVAQASAQRVEQAFRAIDAQQAQGRGALPTSFIGAAAALQQSSS
FT                   AAVAAGSLQSLSGQSHVAAAAASLDAIDLGRRSLATRLDVLRSGERIVTWHQALGGPGQ
FT                   NGAASGTFSLSGWLVGHDAQLASGDIVGVAFGQADSSPSGSASGLRGIDRQVQGRVYLQ
FT                   RTQGPLYVLGQLGFGSFQRRLDRQLQLGDWNDWTSSRYSGQFWSGSVEAGYHWRQGSLA
FT                   LTPYLGLDQTQLRTDGFREQSGSGFGLQVQSAQATRSQLLAGVRTEWRWGGVQWRGYGE
FT                   WQQTLRQSGLNPQASFTATSSWTPLVASSWPGRSGGVLGLSMVLPVGVTAGLWTMGLEH
FT                   YFGTRSRGESLGLRYQLGF"
FT   sig_peptide     390256..390327
FT                   /locus_tag="Xfasm12_0340"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.894 at
FT                   residue 24"
FT   gene            393191..393451
FT                   /locus_tag="Xfasm12_0341"
FT   CDS_pept        393191..393451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0341"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11360"
FT                   /protein_id="ACA11360.1"
FT                   /translation="MMAARLQRLSIGRASFYCLLRRQSCRPLCVLFLVMYPGTILFVGY
FT                   PYRGFHLALNVPIRDFFAVLMCVYCDDWLYLLVLLWRSALG"
FT   gene            393872..393986
FT                   /gene="ffs"
FT                   /locus_tag="Xfasm12_R0019"
FT   ncRNA           393872..393986
FT                   /gene="ffs"
FT                   /locus_tag="Xfasm12_R0019"
FT                   /product="SRP RNA; RNA component of signal recognition
FT                   particle"
FT                   /ncRNA_class="SRP_RNA"
FT   gene            complement(393962..394138)
FT                   /locus_tag="Xfasm12_0342"
FT   CDS_pept        complement(393962..394138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0342"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF1028 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11361"
FT                   /protein_id="ACA11361.1"
FT                   /translation="MNAALPINIDATPYRSLSSQIEQFPKQTYRSILATQHTYQKIKNL
FT                   QEGTRTKGDGPTG"
FT   gene            complement(394405..396387)
FT                   /locus_tag="Xfasm12_0343"
FT   CDS_pept        complement(394405..396387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0343"
FT                   /product="glutaryl-7-ACA acylase precursor"
FT                   /note="KEGG: xft:PD0315 glutaryl-7-ACA acylase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11362"
FT                   /protein_id="ACA11362.1"
FT                   /translation="MRRFIAALYFILPLAAIAQTAPMTPDITGRQFIVPTEKDDYIKRE
FT                   VMIPMRDGTKLHTVIIIPKKAQHAPLLLTRTPYNANERSERILSPHMKNLLPQGDDVFA
FT                   TGDYIRVFQDVRGKYGSEGDYVVTRPLRGVLNLTNIDHATDAWDTIDWLVKNIKQSNGN
FT                   VGMIGSSYEGFTVVMALTDPHPALKVAAPESPMIDGWMGDDWFNYGAFRQVNFDYFSGQ
FT                   MTNRGKGLSIARQGYDDYSNFLQAGSAGNYAKAAGLEQLPWWHKLTEHPAYDSFWQEQA
FT                   LDKVMARTPLKVPTMWLQGLWDQEDMWGAIHSYAAMEPRDVHNDKNYLVMGPWRHSQVN
FT                   YDGSNLGTLKFDGNTALQFRHDVLKPFFDQYLIDGTSKADTPPVLIYNTGANHWDRMQH
FT                   WPRSCERGCEYTSKPLYLNAGGTLSFQTWQRKQNDYDEYISDPANPVPFMPRPINFKDN
FT                   AMWTTWLVQDQRFVDNRPDVLTYLSEPLTTPLQIAGVPRINLHASTSGTDSDWVVKLID
FT                   VYPDEIASDPKMGGNELAISLGIFRGRYRTSFQYPTPMTPNQPLLYRFDLPNANHTFLT
FT                   GHRIMVQVQSSLFPLYDRNPQRYVPNIFFAKPDDYIKATQRIWHTPRQPSFIELPVVNP
FT                   DILTQRTHWNISSSHKTTLPTPITL"
FT   sig_peptide     complement(396331..396387)
FT                   /locus_tag="Xfasm12_0343"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.832 at
FT                   residue 19"
FT   gene            396664..396828
FT                   /pseudo
FT                   /locus_tag="Xfasm12_0344"
FT   gene            complement(397042..399633)
FT                   /locus_tag="Xfasm12_0345"
FT   CDS_pept        complement(397042..399633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0345"
FT                   /product="Glycerol-3-phosphate O-acyltransferase"
FT                   /EC_number="2.3.1.15"
FT                   /note="KEGG: xfa:XF1031 glycerol-3-phosphate
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11363"
FT                   /db_xref="GOA:B0U229"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR022284"
FT                   /db_xref="InterPro:IPR028354"
FT                   /db_xref="InterPro:IPR041728"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U229"
FT                   /protein_id="ACA11363.1"
FT                   /translation="MPKKNSPLLPKETTTTQSSVDTSGSSNLTWPVSEHSIRRPLWARL
FT                   LGQMLDPWLDLSIEPEHSVQYNDGRPIIYVLEDYGLCNTLILDKACRKTKLPSPLIPLP
FT                   DNPLQRKRAYLALSRRSSSNSLIPNQRGGKTHSDSLANLLQAHRIRDTLDVHLVPVSIF
FT                   IGRTPDRQSGWFAVLFSENWALVGRFRRLLAVLLNGRNTIVCFAPPISVRQTLNEGLPP
FT                   ERTLRKLQRVLRTHFRRIRETVIGPDLSTRRLLVDNVLATEAVREAIAAQAKRDGTDLS
FT                   ETWRKAQAYAWEIAADYSSPVIRSADFLFSHVWNRIYAGVLIHHVDSFKETAPGHEVVY
FT                   VPSHRSHIDYMLLSYCLYQCGIVLPHIVAGINLNLPIVGTLLRKCGAFFIRRSIKGNML
FT                   YSIVLSEYVAQLVAGGYSLEYFIEGGRSRTGRLLQPKGGMIMMTLQAFLRQPRRPVLFQ
FT                   PIYIGYEKLIEGTSYLDELSGEPKKKESIWRLFWNIPKVLKQKYGQVVVNFGEPIALND
FT                   VLAELAPEWEGQALNENEKPAWLSSTVNHLARQIQTRINSAADVNPINLLALALLSTPK
FT                   HAMGEADLIAQITLCKKILLELPYSNRVTVTPHTPERIIAHAEQINILTRVHHPLGDVL
FT                   RVDGDNAVLLSYFRNNVLHLFTASAWVACCFKNNRRMSRIALIRLGVGMYPFLQAELFL
FT                   PWTEDQFAQHIQQVIELFVREGLLLSAGNEEEDPLTRNTSQTDEVFRLRAISHSLQQAF
FT                   ERYYITISILVKNGPGTLSASELESLCQLAAQRLSLLYASTAPEFFDKGLFRGFIQKLR
FT                   ELNLVWPDTYSKLLFDERLDTSAKDAQVILGRELRHTIERISPEATKPAPK"
FT   gene            complement(400278..400495)
FT                   /pseudo
FT                   /locus_tag="Xfasm12_0346"
FT   gene            400678..400863
FT                   /locus_tag="Xfasm12_0347"
FT   CDS_pept        400678..400863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0347"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF1033 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11364"
FT                   /protein_id="ACA11364.1"
FT                   /translation="MMGFSWLVFTALTAFHAIAVSSTASFDVYYIELDGSPCDVGAKLL
FT                   SVPDLVWWVRQLMLVY"
FT   sig_peptide     400678..400737
FT                   /locus_tag="Xfasm12_0347"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.967) with cleavage site probability 0.640 at
FT                   residue 20"
FT   gene            401555..404581
FT                   /locus_tag="Xfasm12_0348"
FT   CDS_pept        401555..404581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0348"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0318 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11365"
FT                   /protein_id="ACA11365.1"
FT                   /translation="MKKSCSSQLLQIRRLLCYALAVCLYLALPNAFAQSSNATLRGQVS
FT                   RAQAGAVVLVTNTATGLVRRSTLLSDGTYAMTGLPPGQYTISVGGVSRTVTLSVASSVT
FT                   VNLDAGVPISGDAKTLDAVQVTGQTIREVKTSEIGNTIALRQIQQLPQATRNFLEFADT
FT                   VPGMAFNIDPQGRTTLRAGASNSSASNLYIDGVGQKSYVAKGGISGQNDSQGSPFPQLA
FT                   IGEYKIITSNYKAEYGQIGGAAVTAATKSGTNEFHGETFYRYTNQNLRDRRPDEGETKV
FT                   DSQTKEYGFALGGPIIRDRMHFFFAYEGKDNVVPRSVQADARAAPYVHFLPSYLSQQYG
FT                   AVNLPFNEDLFFGKIDFEPSGDDRLELSVQYRDETQIDNIGGQNAADHGLNKTNKDKRG
FT                   SLRWQHSADAWFNELIFTRENARNNPNPMSIGNGFNYVYLDETDPNIGEYTFLSIGPDG
FT                   GSSMQRRHQDGWSLQNDLTFTSVKWHGDHTIKMGVSYKNITLQSQDAASLNPQFSYAVS
FT                   SSGVATTPYRVDFYSPYATPGQKALVETRAKQYGLYLQDDWNVNEKLTLNLGMRWDYED
FT                   NPAYTNFVTSQAFVAALYADDPENPGHPWANRLLPSGINVADYISNGHNRHNFNKGWAP
FT                   RFGFSYDIYGDEAAVMHGGAGRSYDRNLFEQMAYETSKAALSPVAVYFQDPATHTCYHS
FT                   DRLCVPWDPKYLNGIDQLNAIAGVSGSGELFIFNNKLKTPYSDQYSIGISNKIGGWLTD
FT                   VTFQRVLSNDGFVMSLVNRYPDGRYFDAEGNAPWDQSVPGHKNTILGMNGLKQRSSQVL
FT                   LSVEKPYSKESGWGVNVAYTHTSARQNRTIDEPFAFDKATIYEYPFVKSDAVAAHRLVV
FT                   SGSMDGLWGMTFGAKVVLATPTPINTIACYGQIDQDGANCQQVGVIPPSSGKFLVGGNI
FT                   WGYRTVDFQASKEFTVFNDFKLSARVNLLNAFNFKNYASYVYNSFGSDGRLQPDITINR
FT                   IGDINYVPRTVTFELGMKF"
FT   sig_peptide     401555..401656
FT                   /locus_tag="Xfasm12_0348"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.988 at
FT                   residue 34"
FT   gene            complement(404687..406129)
FT                   /locus_tag="Xfasm12_0349"
FT   CDS_pept        complement(404687..406129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0349"
FT                   /product="Adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /note="KEGG: xft:PD0319 adenosylhomocysteinase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11366"
FT                   /db_xref="GOA:B0U232"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U232"
FT                   /protein_id="ACA11366.1"
FT                   /translation="MNTHPQTSPNTHYKIADISLADWGRKEIDIAEHEMPGLMSIRRKY
FT                   ASKQPLKGVRVTGSLHMTIQTAVLIETLKDIGANVRWASCNIFSTQDHAAAAIATSGTP
FT                   VFAWKGETLEEYWDCTLQALTFTLADGTLTGPELIVDDGGDATLLIHKGYELENGSTWV
FT                   DEPSDSLEEQVIKRLLKRIAIERPGYWTRVVNDWKGVSEETTTGVHRLYQIAATGRLLV
FT                   PAINVNDSVTKSKFDNLYGCRESLADGLKRAMDVMLAGKLAVVCGYGDVGKGSAHSLRA
FT                   YGARVIVTEIDPICALQAAMEGFEVRTVEDTLGQADIYVTTTGNKDVIRIEHMTAMKDQ
FT                   VIVCNIGHFDNEIQVDALNTLTGVQKINIKPQVDKFILPNGNTLFLLAEGRLVNLGCAT
FT                   GHPSFVMSNSFANQTLAQIDLWQNKDVYEKNVYRLPKKLDEEVARLHLEKIGVKLTTLT
FT                   ANQAAYLGISVEGPFKPEHYRY"
FT   gene            407234..408586
FT                   /locus_tag="Xfasm12_0350"
FT   CDS_pept        407234..408586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0350"
FT                   /product="peptide synthase"
FT                   /note="KEGG: xfa:XF1038 peptide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11367"
FT                   /protein_id="ACA11367.1"
FT                   /translation="MSLVAFPSSGVASFPMGVGSLHRPLVWVHGKPITLGRFLAQVRGL
FT                   AAQLPSGRYVVNLCEDRYRFLLAFYACALRGQVSLLPSSRAPGVVAEIYAAYPDSYCLG
FT                   DRELSLEALRYWHLPEIFPELDGAIPSLSEDAVVAIGFTSGSTGAPTSNLKTWGSLVTS
FT                   TEQDWAAFHSLWGSQVPTVVATVPPQHMYGMEFSVLLPLLAPVAVHAGRPFFPEDVAQA
FT                   LAEVPAPRLLVTTPVHLRVLVQSGLRFPEVAGIVSATAPLAHDLAVAAEACFGCELREV
FT                   FGSTETCTFAVRRTVYEQAWTRFDGVSIEVNADVTWVYARHLPAPMAIADFVDVYEDGR
FT                   FEVLGRQADLLEIAGKRASLGELNRCLLAIPGVVDGALVQMPLEADQTVGRIAAVVVAP
FT                   TLHEVHIQKMLRTKIDPLFLPRRLRKVDALPRNETGKLPREALLALLADVC"
FT   gene            408841..409017
FT                   /locus_tag="Xfasm12_0351"
FT   CDS_pept        408841..409017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0351"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF1039 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11368"
FT                   /protein_id="ACA11368.1"
FT                   /translation="MRNTVLVNTSVCNVSWVLFVTQHCLLGLVAEMRCLLIAILAWRWI
FT                   LVFSMGCEYRGIV"
FT   gene            complement(409457..410161)
FT                   /locus_tag="Xfasm12_0352"
FT   CDS_pept        complement(409457..410161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0352"
FT                   /product="Ribonuclease H"
FT                   /EC_number="3.1.26.4"
FT                   /note="KEGG: xft:PD0321 ribonuclease HII"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11369"
FT                   /db_xref="GOA:B0U235"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U235"
FT                   /protein_id="ACA11369.1"
FT                   /translation="MVSQFDTQHLLNSNTALVAGVDEAGRGPLAGPVVVAAVVFDPSQP
FT                   RINGLNDSKQLSPACRERLYAHIVERALAYKVVMIDSTQIDTLNIYQATMLGMRLAVEG
FT                   VAHVAKSARIDGNRLPKNLPCPAEALVGGDARDPTIMAASILAKVTRDRHMVELHLQYP
FT                   HYGFDKHKGYGTPAHLAALAEHGPCLEHRQSFAPVRRMLTPKAIHARQSAHQHNDNSPT
FT                   KAAFNMLIERDD"
FT   gene            complement(410218..411375)
FT                   /locus_tag="Xfasm12_0353"
FT   CDS_pept        complement(410218..411375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0353"
FT                   /product="Lipid-A-disaccharide synthase"
FT                   /EC_number="2.4.1.182"
FT                   /note="KEGG: xft:PD0322 lipid A disaccharide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11370"
FT                   /db_xref="GOA:B0U236"
FT                   /db_xref="InterPro:IPR003835"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U236"
FT                   /protein_id="ACA11370.1"
FT                   /translation="MIQAPRIALIAGEASGDHLGAGLIQQLRLHFPTAEFIGIGGDMMR
FT                   SAGCQTWFDTTELAVMGLTEVLRHLPRLLKIRREFCKRALAWHPDVLIGIDAPDFNLTV
FT                   ERWFKQRHIRTVHYVSPSIWAWREKRAAKIGASVDRVLCLFPMEPPIYARYGIDARFVG
FT                   HPMADEIPYQTDRATARTALGLPLLSPVLAVLPGSRHSEISQLGNTFLEAAGQLSEHLP
FT                   GLHVVIPAANTQCKPLLAEQLSRSTLPVMHSHLLDSSARTAMLAADVVLVASGTATLEA
FT                   MLLKRPMVVAYKVAPLTYRIVKTLKLLKINRFALPNILAGEDLAPELIQKDCTAPALCA
FT                   ALLHWFKHPQKVTALQNRYLQLHTQLRRNASTRAAEAIAELLQQR"
FT   gene            complement(411452..412255)
FT                   /locus_tag="Xfasm12_0354"
FT   CDS_pept        complement(411452..412255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0354"
FT                   /product="Acyl-(acyl-carrier-protein)--UDP-N-acetylglucosamine
FT                   O-acyltransferase"
FT                   /EC_number="2.3.1.129"
FT                   /note="KEGG: xft:PD0323 UDP-N-acetylglucosamine
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11371"
FT                   /protein_id="ACA11371.1"
FT                   /translation="MEAVMNKHASLIHPTAVIAPSATLAPDVQIGAFTLIGNDVQIDTG
FT                   TIIGSHCTIHGPTRIGRNNRFIGQAAIGGEPQDKKFAGERTELLIGDNNTIREFVTINR
FT                   GTGGGGGVTSIGNDNWILAYTHIAHDCHVGHHCVFSNNASLAGHVTVGDWVIFSGFSGA
FT                   HQFCRIGRYAFIGMGTLINGDVPPFTLIGSDTLGRPRGINNEGLKRRNFTPERITAIKR
FT                   AYRTLYVAGLPLAEAKQQLAEQAKDNDDIKELLQFIETAQRPLLR"
FT   gene            complement(412265..412747)
FT                   /locus_tag="Xfasm12_0355"
FT   CDS_pept        complement(412265..412747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0355"
FT                   /product="(3r)-hydroxymyristoyl ACP dehydrase"
FT                   /note="KEGG: xfa:XF1044 (3r)-hydroxymyristoyl ACP
FT                   dehydrase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11372"
FT                   /db_xref="GOA:B0U238"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U238"
FT                   /protein_id="ACA11372.1"
FT                   /translation="MSDSPATAHTRLELPIDIIKIQALLPHRYPFLLVDRILELDQKQK
FT                   RIVAQKNVSINEPFFQGHFPEHPVMPGVLIIEALAQAGGVMTQLDLSHNGHSSLLFYMV
FT                   RVDNARFNKQVVPGDILILDMTMKRRIRNMGCYYGEARVNGEVVACADIMCAGVRS"
FT   gene            complement(412744..413760)
FT                   /locus_tag="Xfasm12_0356"
FT   CDS_pept        complement(412744..413760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0356"
FT                   /product="UDP-3-O-(R-3-hydroxymyristoyl)-glucosamine
FT                   N-acyltransferase"
FT                   /note="KEGG: xft:PD0325
FT                   UDP-3-O-(R-3-hydroxymyristoyl)-glucosamine
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11373"
FT                   /db_xref="GOA:B0U239"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR007691"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR020573"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U239"
FT                   /protein_id="ACA11373.1"
FT                   /translation="MPIFTAQELAERFNLQLFGDGNIRIHGVATLAQASPEQLSFLANP
FT                   RYLTQLLNSRAGVIVLHADDVKAASGTVLIAKDPYVTFAKIATLFDIKPAREAGIHPLA
FT                   TVDPSAHVSPTAHVGAFVSIGARSSIGASCIIGTGSIIGDDCTIDDGSELIARVTLISR
FT                   VRLGKRVRIHPGAVLGGEGFGLAMESGHWIKIPQLGGVVIGDDCEIGANSCIDRGALDD
FT                   TVLEEDVHIDNLVQIAHNCRIGAHTAIAGCTGIAGSAKIGRYCLLGGHVGVVGHLQICD
FT                   NVVITGKSVVRNSIHTPGEYSSGTPLTDNRTWRKNAVRFKQLDMLVRRMMAVSKEKA"
FT   gene            complement(413948..416302)
FT                   /locus_tag="Xfasm12_0357"
FT   CDS_pept        complement(413948..416302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0357"
FT                   /product="outer membrane antigen"
FT                   /note="KEGG: xft:PD0326 outer membrane antigen"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11374"
FT                   /protein_id="ACA11374.1"
FT                   /translation="MTRFYTRHLLTLTIAANFSLPVLTQAAESFVANDIRVDGLQRIAS
FT                   GTVFTYLPVNRGDTVDDAKVADAIRALYRTGFFENVRIDRQGNILVVKVKERPAINKLT
FT                   ITGNKDIKSEELLKGLSEIGLSEGGTFDRLSLDRVTQELKRQYNNRGKYNVQMTTTTTP
FT                   LDRNRVDVTIAIKEGKAAKIRHINLIGTEKFNNKDVMSAWESKEHNWASWYRRDDQYSK
FT                   EKLSGDLEKLNSWYLDRGYVDFNIDSTQVSISPEKHDMFITAGVTEGDQYKISSIKVTG
FT                   NTVLPQEKIEKLVIPKTGDIFSRVLLEYSSAAIINTLSNIGYAFSKVNPIPTANRADRT
FT                   VAVNLHVIPGPRVTVRQILFKGNTRTSDEVLRREMRQFENSWYSQAAIDRSKIRLQRLG
FT                   YFEAVDVESTPVPGSNDQVDIVYTVKETTSGSFQVGLGYSKTYGVTTSVQLSQNNFLGS
FT                   GNRVSVDASRSRYQDRYSFSYTNPFFTDNGVSLGYNLAYQKLDYSDFNAAQYNSKRMSG
FT                   QTIFGIPITENDTVSWVIGADSNQITTFPGSTPKAIIDYIDAVGQRTFRAWRTELGWAR
FT                   DTRNDYFMPNLGMYQRIGAEVTLPGSTIKYYKINYQISKYWPIIPALVLNTRLEVGYGD
FT                   DYGKSHTRILPDGTVATASGLPFFENFYAGGTNSVRGFRDNTLGPRSEVTALYNQGQPL
FT                   GGSFKTVGSTEMYFPKLFDSPSARISAFLDVGNVFNGVKNFTTNELRASSGVALLWRAP
FT                   IGPISISYAFPIKKQNDDEIERLQFTFGGQF"
FT   sig_peptide     complement(416222..416302)
FT                   /locus_tag="Xfasm12_0357"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.744 at
FT                   residue 27"
FT   gene            complement(416401..417735)
FT                   /locus_tag="Xfasm12_0358"
FT   CDS_pept        complement(416401..417735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0358"
FT                   /product="conserved hypothetical zinc metalloprotease"
FT                   /note="KEGG: xft:PD0327 hypothetical zinc metalloprotease"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11375"
FT                   /protein_id="ACA11375.1"
FT                   /translation="MGDFFASIWWMIVSFSVLVTFHEFGHYWVARRCGVKVLRFSIGFG
FT                   TPLWSRRSSSGTEFVIGAIPLGGYVKMLDEREADVTVAERNQAFNRKSVWQRIAIVAAG
FT                   PLANLLLCMLLLWVLFVIGKQDYSATVGRAEHLAAQAGIHPGDRITAIDGRQVTSWSEA
FT                   SMLLTAAAMDRQNAVLRVIGPYGERSEHTLELSKLKQPFDERHVTALVGINWQFMLQPP
FT                   IIAKIEPGSIAEGAIKPGDIVLAVDGQQTLSTEDLYNQIQKLGRDGHPGMIEIRRGEER
FT                   LALELSPRKSAQGVWLLGVKTNPGPVPAFDSQQRYGVLAAVPLAIRETGRMTADSLGMM
FT                   KRIITGQASAKNISGPISIAKIANASAKRGVGWFIYFLSLLSLSLAIINLFPIPILDGG
FT                   HLLYYAIELLKGSPLSTRAMAAGQYIGLALLAGLMGLAFYNDLLG"
FT   gene            complement(417762..418946)
FT                   /locus_tag="Xfasm12_0359"
FT   CDS_pept        complement(417762..418946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0359"
FT                   /product="1-deoxy-D-xylulose-5-phosphate reductoisomerase"
FT                   /EC_number="1.1.1.267"
FT                   /note="KEGG: xfa:XF1048 1-deoxy-D-xylulose 5-phosphate
FT                   reductoisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11376"
FT                   /db_xref="GOA:B0U242"
FT                   /db_xref="InterPro:IPR003821"
FT                   /db_xref="InterPro:IPR013512"
FT                   /db_xref="InterPro:IPR013644"
FT                   /db_xref="InterPro:IPR026877"
FT                   /db_xref="InterPro:IPR036169"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U242"
FT                   /protein_id="ACA11376.1"
FT                   /translation="MTKPIRNVAVLGATGSIGAAALDVLARHPRQFHVSLLAAGQRVDA
FT                   LLALCHTYRPDHAVIGDATLYTTLRDGLNAAGLATKAYAGEAALAELVASTTCDTVVAA
FT                   IVGAAGLHSTLAAARAGKRLLLANKESLVLAGMLLMREASISGAEIIPIDSEHNAIFQC
FT                   LRSRTTNGVHRVTLTASGGPFRGHNRTMLAKITPTQAMAHPTWSMGPKISVDSATLMNK
FT                   GLEVIEAHHLFGLPSEQIDVLVHPQSLVHSLVEFIDGSTLAQLSLPDMRTTLAVGLAWP
FT                   ERIGSGVPGLDLMKHNRLDFEHPDTETFSCLRLARDAMQTGGTAPAVLNAANEIAVSAF
FT                   LQGRIGFLTIPALIEHALTTLPRYEADTLETLLTVDTETRRITHAALTHFPLPL"
FT   sig_peptide     complement(418881..418946)
FT                   /locus_tag="Xfasm12_0359"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.967) with cleavage site probability 0.621 at
FT                   residue 22"
FT   gene            complement(418949..419803)
FT                   /locus_tag="Xfasm12_0360"
FT   CDS_pept        complement(418949..419803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0360"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /note="KEGG: xft:PD0329 phosphatidate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11377"
FT                   /protein_id="ACA11377.1"
FT                   /translation="MTRTRVIAALVMAPVAMCSILFLPTAWLASLTAIIFLWGLWEWMK
FT                   LSQVEDTLVRTVLLTLNLLLMVLLVWVSAHSLVLFQIATLIGIAWWILALLWLRFLGFC
FT                   ADPNQRTAKIVKLTAGTLAVIPAWSALVLLHSGDKPGSTFPESLHAHLWLLTAQIMVWA
FT                   ADSGAYFSGRLFGKHKLAPQISPNKTVEGLLGGILTGLAVAAGFGLLNGVTMAQFPSLL
FT                   LVSFVAILASVIGDLFESLLKRHAGIKDSGSMIPGHGGVLDRIDSTLAALPVFALGKDI
FT                   FGF"
FT   sig_peptide     complement(419717..419803)
FT                   /locus_tag="Xfasm12_0360"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.783 at
FT                   residue 29"
FT   gene            complement(419800..420567)
FT                   /locus_tag="Xfasm12_0361"
FT   CDS_pept        complement(419800..420567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0361"
FT                   /product="Di-trans,poly-cis-decaprenylcistransferase"
FT                   /EC_number="2.5.1.31"
FT                   /note="KEGG: xfa:XF1050 undecaprenyl pyrophosphate
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11378"
FT                   /protein_id="ACA11378.1"
FT                   /translation="MQINAIPVNPTLPRHIAIIMDGNGRWAERRSRPRTTGHRAGVKAA
FT                   MRTVDFCLEKGIKMLTLFAFSSENWNRPADEVNFLMEMSIKLFGRGIEELHRRGVQVRF
FT                   IGERKRFDIALVEHMTKAEHLTANNQGLILSLAVSYGGRQDITMAARALAKDVAAGRLK
FT                   PEQIDEDLLGQHMALADLPPPDMFIRTSGVIRISNFLLWQIAYTELWFTDVMWPEFNST
FT                   VLQQALDDYASRERRFGLTNAQIASRGKGSIPA"
FT   gene            complement(420570..421142)
FT                   /locus_tag="Xfasm12_0362"
FT   CDS_pept        complement(420570..421142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0362"
FT                   /product="ribosome recycling factor"
FT                   /note="KEGG: xft:PD0331 ribosome recycling factor"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11379"
FT                   /protein_id="ACA11379.1"
FT                   /translation="MNIQAMLNQIKQDAQDRMTKSIDALRNSLASVRTGRASPSLLDGI
FT                   KIKAYGTDTPLNQVASISVSEGRSLVITVFDKNMSKDVEKAIYASDLGLTPTVVGTLIR
FT                   LNLPPLTEERRKELTKVVHSEGEDTKVAIRNIRRDANQQIKDMLKSKEITEDEVRHGEE
FT                   DIQKLTDKAIKSVDEVVKSKEQELMTV"
FT   gene            complement(421297..421536)
FT                   /pseudo
FT                   /locus_tag="Xfasm12_0363"
FT   gene            complement(421920..423270)
FT                   /pseudo
FT                   /locus_tag="Xfasm12_0364"
FT   gene            423501..424181
FT                   /locus_tag="Xfasm12_0365"
FT   CDS_pept        423501..424181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0365"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF1054 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11380"
FT                   /protein_id="ACA11380.1"
FT                   /translation="MFVSIPSRNRPTWLWAVPLLFFAVLIAFLWSISRPGQERSTLWLD
FT                   WGALSGGFSHVPDMWITSQGGSALRLFTALFLHADWAHLLGNLVFLLIFGLPAERILGS
FT                   WRLLLLFLLGGALANLAAVLTIGSPNHVIIGASGAVSALIGSYLALFPGAKLGVVLPLG
FT                   LFLEFIRVPAPFLIGFWALLQVVFAYTGPTLVMVAWSAHLAGFVSGVVYGSCVRAAIVR
FT                   RLRQ"
FT   gene            424293..424613
FT                   /locus_tag="Xfasm12_0366"
FT   CDS_pept        424293..424613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0366"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF1055 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11381"
FT                   /protein_id="ACA11381.1"
FT                   /translation="MSKTLYKIIFVNHGKVYELYARCVISSHLWGFNEISELVFDVHSG
FT                   LVVDPTEEQLRHEFANTKTLHLPMQSIVRIEEVDKKGQSVIRDAETGEKVVTPFIAPFK
FT                   PR"
FT   gene            425122..425417
FT                   /locus_tag="Xfasm12_R0020"
FT   ncRNA           425122..425417
FT                   /locus_tag="Xfasm12_R0020"
FT                   /note="Bacterial RNase P class A as predicted by Rfam
FT                   (RF00010), score 351.90"
FT                   /ncRNA_class="RNase_P_RNA"
FT   gene            425517..425822
FT                   /pseudo
FT                   /locus_tag="Xfasm12_0367"
FT   gene            complement(425824..426555)
FT                   /locus_tag="Xfasm12_0368"
FT   CDS_pept        complement(425824..426555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0368"
FT                   /product="uridylate kinase"
FT                   /note="KEGG: xfa:XF1058 uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11382"
FT                   /protein_id="ACA11382.1"
FT                   /translation="MSKLAYHRVLLKLSGEALMGSADYGIDPKVINRLAGEVIEAQNAG
FT                   AELALVIGGGNIFRGAGLAAKGMDRVTGDHMGMLATIINALAMQDALEKLGTKVRVMSA
FT                   IKINNVCEDFIRRRAIRHLEKSRITIFAAGTGNPFFTTDSGAALRAIEIGADLLLKATK
FT                   VDGIYNKDPQKHCDAVKYSTLSYDEVISQNLEVMDTAAFALARDSNLPLRIFDIEQPGV
FT                   LLRILHGEEIGTLVKEPNSKS"
FT   gene            427000..427248
FT                   /locus_tag="Xfasm12_0369"
FT   CDS_pept        427000..427248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0369"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11383"
FT                   /protein_id="ACA11383.1"
FT                   /translation="MRVSPSAYVSVVTKFEANPFLEVLQYCDSLGTVCADDWKLLWVWG
FT                   DEMVIGRCAVAGHRRPFAYSVVGGDVVAKQKGQAYKG"
FT   gene            complement(427274..427360)
FT                   /locus_tag="Xfasm12_R0021"
FT                   /note="tRNA-Leu5"
FT   tRNA            complement(427274..427360)
FT                   /locus_tag="Xfasm12_R0021"
FT                   /product="tRNA-Leu"
FT   gene            complement(427490..427565)
FT                   /locus_tag="Xfasm12_R0022"
FT                   /note="tRNA-Glu1"
FT   tRNA            complement(427490..427565)
FT                   /locus_tag="Xfasm12_R0022"
FT                   /product="tRNA-Glu"
FT   gene            complement(427619..427694)
FT                   /locus_tag="Xfasm12_R0023"
FT                   /note="tRNA-Ala3"
FT   tRNA            complement(427619..427694)
FT                   /locus_tag="Xfasm12_R0023"
FT                   /product="tRNA-Ala"
FT   gene            complement(427948..428607)
FT                   /locus_tag="Xfasm12_0370"
FT   CDS_pept        complement(427948..428607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0370"
FT                   /product="4-hydroxy-2-oxoglutarate aldolase"
FT                   /EC_number="4.1.3.16"
FT                   /note="KEGG: xft:PD0342 2-dehydro-3-deoxyphosphogluconate
FT                   aldolase / 4-hydroxy-2-oxoglutarate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11384"
FT                   /protein_id="ACA11384.1"
FT                   /translation="MSITETQNKAESLLYNAGILPVVTVDTVDQARRVVSALLEGGLTT
FT                   IELTLRTPVALEALATLKREQPEITIGAGTVLNEHQLRQSIDAGADFLITPGTPPTLAQ
FT                   LLADAPIPAVPGAATATELLALMVLGFHVCKLFPANVVGGLHMLTSLAGPLTNLKLCPT
FT                   GGINETNASDYLAQPNVICIGGSWMVPKDWLAQGHWDNIKNTSSKAAAIIQQARNH"
FT   gene            complement(428704..430620)
FT                   /locus_tag="Xfasm12_0371"
FT   CDS_pept        complement(428704..430620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0371"
FT                   /product="Phosphogluconate dehydratase"
FT                   /EC_number="4.2.1.12"
FT                   /note="KEGG: xft:PD0343 6-phosphogluconate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11385"
FT                   /protein_id="ACA11385.1"
FT                   /translation="MRPHPNIQAVTDHIRQRSATTRTNYLAGIDAALRDGPSRSRLSCG
FT                   NLAHGFAACGTTDKERLREAITPNLGIITAYNDMLSAHQPFEHYPDIIRNTARALGATA
FT                   QVAGSVPAMCDGVTQGRAGMELSLFSRDNIAQSTAIGLSHDMFDAAIYLGVCDKIVPGL
FT                   LIGALAFGHLPAAFVPAGPMPSGIPNKQKAEIRERYAAGQATRAELLAVEAASYHAPGT
FT                   CTFYGTANSNQVLLEAMGVQLPGASFVSPGTPLREALTQAATERVLHITALGQDFRPIG
FT                   RLIDERAIVNAIVALMATGGSTNHTIHWIAVARAAGILLTWDDMDRISQTVPLLARVYP
FT                   NGEADVNRFHAAGGTAFVFRELMDAGLMYDDLPTIVAGGMRAYTQEPHLHHGTLGYSPS
FT                   PTTSTDASVVRPVTHPFEPQGGLRLLHGNLGRALIKLSAVKPEYRAIEAPAVVIDTPQT
FT                   LHKLHAAGALPKDFILVVRYQGPRANGMPELHSLAPLLGLLQNQGRRIALVTDGRLSGA
FT                   SGKFPTAIHLTPEAARGGPIGRIREGDLLRLDGEAGILEALVPTTEWETRTPAPNTATT
FT                   SNDLGRNLFAINRQVVGPADQGGLSISCGPAPPDNHVWSNTANDTPDDHAHPGPLTDES
FT                   QDA"
FT   gene            complement(430719..431438)
FT                   /locus_tag="Xfasm12_0372"
FT   CDS_pept        complement(430719..431438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0372"
FT                   /product="6-phosphogluconolactonase"
FT                   /EC_number="3.1.1.31"
FT                   /note="KEGG: xft:PD0344 6-phosphogluconolactonase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11386"
FT                   /protein_id="ACA11386.1"
FT                   /translation="MIPPNDAHITLMNYDDPLEWAQSVTRELENILLQEITQRGRASLL
FT                   LSGGTTPALVYETLATRPLDWSKIDIGLVDERWLSPQDKDSNAWLVRHTLLEHAKHATF
FT                   LPLIRPGKTLNQCVHDANLQITHSPPPCAVVLGMGNDGHTASLFPGSLDLQKAINTPQP
FT                   YVALDATGCPGAGVWPLRITLTPAGLSNIPHRLLLLRGKQKLKVLETALSCKDALDYPI
FT                   RTAIDLPNARLRVHWCA"
FT   gene            complement(431435..432448)
FT                   /locus_tag="Xfasm12_0373"
FT   CDS_pept        complement(431435..432448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0373"
FT                   /product="Glucokinase"
FT                   /EC_number="2.7.1.2"
FT                   /note="KEGG: xft:PD0345 glucose kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11387"
FT                   /db_xref="GOA:B0U1J8"
FT                   /db_xref="InterPro:IPR003836"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U1J8"
FT                   /protein_id="ACA11387.1"
FT                   /translation="MNAPQAPVLVADIGGTNARFALANPTLTSAPLLNDSMREFAVIEF
FT                   PSLGEAAQHYLHHIGIHTTKGVFAIAGHVDGDEARITNHPWVITRTRTATMLGFDTLHL
FT                   INDFVAQAMAISVLGPQDVIQIGSAKWEQFPLSAATRNYGIIGPGTGLGVGGLVIRNGR
FT                   CYPLETEGGHVSFPPSTPEEIRILEILSQQFGRVSNERLISGPGIVNIHRALSEIDGID
FT                   PGPLRPQDITMRAADGDIRATRTINLFCNIFGAITGDLVLIQGAWDGVFLTGGLVPKLL
FT                   NSIQHSGFRQRFEHKGRFSAIMARIPSLAVIHPHPGLLGAAVYARDTEQVPQEIKA"
FT   gene            complement(432445..433947)
FT                   /locus_tag="Xfasm12_0374"
FT   CDS_pept        complement(432445..433947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0374"
FT                   /product="Glucose-6-phosphate 1-dehydrogenase"
FT                   /EC_number="1.1.1.49"
FT                   /note="KEGG: xft:PD0346 glucose-6-phosphate
FT                   1-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11388"
FT                   /protein_id="ACA11388.1"
FT                   /translation="MLLTQTKTPPHQPTLTSESETRSMHNTLLLFGATGDLAQRYLFPS
FT                   LLQLFTDGLLPQDFRIRALALSPHNTTQFRDILRPRLEQALPIANTAHIQALLQRVDYL
FT                   SVDLNDPTSIAEAVRDLTEHPCISYLAIPPGLYTNTALGLAQGGALQTPHRLMLEKPIG
FT                   RDSINAREILNTIGTLIDEDRIFRVDHYLGKAAVQNLVALRFGNTLLEAVWNRNHIESV
FT                   HILIAETEGVDGRNAYYARAGALRDMMQSHILQLLCLVAMEPPASLEADRIRDEKVKVL
FT                   RALRPLNAQNAAMHSVRGRYSAGTINSQPVPAYQPPEGSNVETFVGVTAYIDNWRWAGV
FT                   PFHLCTGKRLAERSTQIVVTLKPVTHWLFERPDRNNAAPNRLCFKLQPQENIELNLMSS
FT                   LAGPEWGTLELQPLELELSVPTGKHRHIAYERLFLDAFNGNPALFVRHDEVTAAWAWID
FT                   SVSNAWELSDLPLQPYPAGGWGPPQAHQFLPPLGIDGHGNNA"
FT   gene            434207..435301
FT                   /locus_tag="Xfasm12_0375"
FT   CDS_pept        434207..435301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0375"
FT                   /product="sugar ABC transporter ATP-binding protein"
FT                   /note="KEGG: xft:PD0347 sugar ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11389"
FT                   /protein_id="ACA11389.1"
FT                   /translation="MAKVQLEAIRKVYDNGQVVVPGVSFEVADGELMVLVGPSGCGKST
FT                   LLRMIAGLEDISSGTLRIGERVVNNVPPKDRNVAMVFQSYALYPHMTAAENLAFGLKLR
FT                   GYSTEAIAERIKNVAEMLGLTSLLDTLPKAMSGGQRQRVALGRAMVRESAVFLLDEPLS
FT                   NLDAKLRNSVRSDITRLHRKLGTTMIYVTHDQVEAMTLGHRIVLLKDGVIQQIDTPMVL
FT                   YDHPANLFVAGFLGNPAMNMLSGRLEVVAGGMELHLVSGERVMFAGAIPKSVWFGRDVV
FT                   LGVRPEHIRPAGLGEPVALEATIEALEPVGNEVFLHLRCGALALILRVPPQELPGIGES
FT                   LPLAVQPDRLHLFDAVSGECLAGH"
FT   gene            complement(435446..436249)
FT                   /locus_tag="Xfasm12_0376"
FT   CDS_pept        complement(435446..436249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0376"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0348 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11390"
FT                   /protein_id="ACA11390.1"
FT                   /translation="MLRISGADTLSFAHAQFSSDAQGLAIGKWHWSAWLTPKGRVTALF
FT                   ALYRPAENELLLILPDGEAVMMAPQLQRYIFRRKVQIAVERNLITTATYDTPVHATGTQ
FT                   AAQFDGITELDVSGITLPRRLLLVPAAAMPPRVPAFEAQWRAADLRLGLPRLDASQRDQ
FT                   WTPQQIGLDWLNAYSIRKGCYPGQEIVARTHFLGKAKRRAQLLAINTHVQPGETVKSTE
FT                   GDIGQVASVAEGLALAVLPIDTEYGELRVAGTLATPLPFVAGLAR"
FT   gene            436562..436780
FT                   /locus_tag="Xfasm12_0377"
FT   CDS_pept        436562..436780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0377"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0349 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11391"
FT                   /protein_id="ACA11391.1"
FT                   /translation="MMSGSGLSEFQNFIGEKRMFSVCSAPDDSQEIAKNATADLKQRSN
FT                   LEEVGGRGGLDPVRYGDWEKDGRCIDF"
FT   gene            436805..437260
FT                   /locus_tag="Xfasm12_0378"
FT   CDS_pept        436805..437260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0378"
FT                   /product="succinate dehydrogenase membrane anchor subunit"
FT                   /note="KEGG: xft:PD0350 succinate dehydrogenase membrane
FT                   anchor subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11392"
FT                   /protein_id="ACA11392.1"
FT                   /translation="MCCSAGITSSTMATRERPLSSPPRERPLSPHLQIYRWQMQMVTSI
FT                   LHRATGVFLSLGVLVIAAGLLALMFGAEPWDYFRSCLNLWYGQCFLLVWTWCFGYHLCN
FT                   GIRHIAQDFGCGFAISSFLRSSWASVLGSIVITAGVWVYVVVGRGTV"
FT   gene            437257..437640
FT                   /locus_tag="Xfasm12_0379"
FT   CDS_pept        437257..437640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0379"
FT                   /product="succinate dehydrogenase hydrophobic membrane
FT                   anchor subunit"
FT                   /note="KEGG: xft:PD0351 succinate dehydrogenase hydrophobic
FT                   membrane anchor subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11393"
FT                   /protein_id="ACA11393.1"
FT                   /translation="MSRYRTPLKNARGLGAAKVGTGHFVLQRLTAIALVLLGVWFLAFL
FT                   LTLLGVDYAAAVAAVAKPWNAILLIGFLVAAFWHAQLGLQVVLEDYIHNSFLALALQTM
FT                   VRFIAVLGAVASVFAVVRIALGN"
FT   gene            437648..439438
FT                   /locus_tag="Xfasm12_0380"
FT   CDS_pept        437648..439438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0380"
FT                   /product="Succinate dehydrogenase"
FT                   /EC_number="1.3.99.1"
FT                   /note="KEGG: xfa:XF1072 succinate dehydrogenase,
FT                   flavoprotein subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11394"
FT                   /protein_id="ACA11394.1"
FT                   /translation="MSAYTITEHKYDMVVVGAGGAGLRATFGLAQKGLQTVCLTKVFPT
FT                   RSHTVAAQGGISAALGNMGEDDWRYHFYDTIKGSDWLGDQDAIEYMCREAIPAVIELEH
FT                   YGVPFSRTAQGKIYQRPFGGMTTRYGEGPRAERTCAAADRTGHAMLHTLYQQALAHDAR
FT                   FMIEYFALDLIFDNEGVCRGVLALDMAEGSLHLFRAHGVVLATGGYGRTYFSATSAHTC
FT                   TGDGGGLVMRAGLPMQDMEFVQFHPTGIYGAGCLITEGVRGEGGILRNSNGERFMERYA
FT                   PHYKDLASRDVVSRSMIIEIREGRGVGEHKDHILLDLTHLGPSMIQEKLPGIAESARIF
FT                   AGVDVAKQPIPVLPTVHYNMGGIPTNYHGEVVRKVGNDPDAVVPGLYAVGEAACVSVHG
FT                   ANRLGSNSLLDLVVFGRAVANRCAETIKQSQPHKVLPSDSCDKALGLLDKLRHADGSTP
FT                   TAVIRDRMQRTMQSDASVFRTSKTLQEGCEKMNEIFALFDDIKVSDRSLVWNSDLIETY
FT                   ELHNLLLNALATINSAEQRKESRGAHAHEDYPDRDDENWLKHTLVSVDEKGTCSFDYRP
FT                   VHMYTLSKDVDVIPPKPRVY"
FT   gene            439459..440244
FT                   /locus_tag="Xfasm12_0381"
FT   CDS_pept        439459..440244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0381"
FT                   /product="Succinate dehydrogenase (ubiquinone)"
FT                   /EC_number="1.3.5.1"
FT                   /note="KEGG: xft:PD0353 succinate dehydrogenase iron-sulfur
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11395"
FT                   /protein_id="ACA11395.1"
FT                   /translation="MAEFTLPKNSKIGKGTHFPAKSGTKNARTFKVYRWNPDDDANPRT
FT                   DTYEIDLDTCGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGTNTLACTKAI
FT                   SACTISEIPIYPLPHMNVIKDLIPDLTHFYAQYASIKPWMRTQTPPPPDRERLQSPVDR
FT                   KKLDGLYECILCACCSTSCPSYWWNGDRYLGPAILLQAYRWIIDSRDEDTGARLDDLED
FT                   PFKLYRCHTIMNCTRTCPKGLNPAHAIAEIKKLMMLRRA"
FT   gene            440365..440613
FT                   /locus_tag="Xfasm12_0382"
FT   CDS_pept        440365..440613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0382"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0354 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11396"
FT                   /protein_id="ACA11396.1"
FT                   /translation="MDKPAELNKLRWRSRRGMRELDHLFDRYLSHCWAQASEAERGVFL
FT                   RFLDCEDDKLWRWLIGYEVCQDASFAALIVTMRALPA"
FT   gene            440636..441016
FT                   /locus_tag="Xfasm12_0383"
FT   CDS_pept        440636..441016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0383"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0355 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11397"
FT                   /protein_id="ACA11397.1"
FT                   /translation="MVALFALTLLACVALLRCGLNLTLRWSGVLLAACGGAWELRRVVC
FT                   HPCCVLLIPSGDEPPLFNQMPVKELHVSWYGPLVTVSWRVPDSCRMYLLFWPDTLSVAM
FT                   RRQLRLVMQARQLSSQVPSMAP"
FT   gene            441042..442283
FT                   /locus_tag="Xfasm12_0384"
FT   CDS_pept        441042..442283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0384"
FT                   /product="lipoprotein releasing system transmembrane
FT                   protein"
FT                   /note="KEGG: xft:PD0356 lipoprotein releasing system
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11398"
FT                   /protein_id="ACA11398.1"
FT                   /translation="MFNPLSVAIGLRYLRAKRRNGFISFISMASILGIALGVTVLITTL
FT                   AVMSGFQKEIRDRLLQMAAHATVSAQGAPMHDWQHAVALAMTDPRVAGAAPYIESEALL
FT                   QGERHQPAMMRGIVPNQEAKVSVLAQKLKVGSIDSLKPGEYNILLGKELALWLGVDVGD
FT                   SVIVLLSQTQTTPVGTMPRMKRFTVSGLFEVGYNEIDRGLAVVNMEDMQKIMRMDGVTG
FT                   VRLKLHDMDHAWDVASDLAVRLNGPYLVSDWTRENANLYSSLKMEKTVMGILLSLIIAM
FT                   GAFNLVSSQVMLVTDKQADIAILRTLGLSPAGVMRVFMVQGSLIGIIGTLSGVIGGVVL
FT                   TWNLERILKLIESTFNITLLPEDVYYITGLPTDMQFPDVVVITLMALAMSFIATLYPAW
FT                   RAARIQPAEALRYE"
FT   sig_peptide     441042..441155
FT                   /locus_tag="Xfasm12_0384"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.629) with cleavage site probability 0.271 at
FT                   residue 38"
FT   gene            442276..442998
FT                   /locus_tag="Xfasm12_0385"
FT   CDS_pept        442276..442998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0385"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="KEGG: xft:PD0357 ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11399"
FT                   /protein_id="ACA11399.1"
FT                   /translation="MNERSTPQALTGPVIRAECLGKTYSEGKLLTQVFDGLDLQVMRGE
FT                   TVAIVGASGAGKSTLLHLLGGLDVPTAGEVYVAGQRMSALSDGDRGRLRNKTLGFIYQF
FT                   HHLLPEFTALENVMMPVLLSGQSVCSAQMRAQMLLEAVELGHRLNHKPSELSGGERQRA
FT                   AVARALANSPDCVFGDEPTGNLDNRTASTVFELMLELNRAQRTSLVLVTHDRGLARCLD
FT                   RVLELYQGGLRELTSAEV"
FT   gene            443346..445823
FT                   /locus_tag="Xfasm12_0386"
FT   CDS_pept        443346..445823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0386"
FT                   /product="DNA uptake protein"
FT                   /note="KEGG: xfa:XF1078 DNA uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11400"
FT                   /protein_id="ACA11400.1"
FT                   /translation="MDDMKPEQRHVLQRCWVDVLSVTRHATCLRYLAFPALLPSAVALL
FT                   LGCLAALTLPRLPPVWVLWIFLFVGVMLAVIVRRVAWCGVVLFGFANCCLHGQFGLRHQ
FT                   LSLALEGRDLVLRGRIVSLPVPETRRTRFLLRVDTDQDQEPALRGRLLQLSWYDENKAV
FT                   APGPRSELHAGSVWQLHVRLRAPHSLLNPGGFDSERYALAQGIVATGYVRAPTMARELA
FT                   AATGINAWRERMSARIADAVLLEASVYLRALALGDTRGLSQQDWEVLRATGLTHLIAIS
FT                   GFHVGMVAGACALLVSLLWRVFPHLAWRWPRPLAMALIAVPAAAGYTVLAGASLPTVRT
FT                   ALMIGIVALARLTRRRAMPGHVLGLALLVVLVWDPLAILSAGFWLSFAGVAWLLWCMQD
FT                   GHAAPWRGFLSAQGVATLGLLPFTVALFGQVSFVGPLANLIAIPLWTFVVVPLALLGTA
FT                   LEALVPGWGSPMWRLGGNCFQWSWQLFEYLAQTDFALWWLPESDGVALGLALLGAFWLL
FT                   LPRGTPGKWLALLLWLPLLWPERERPRPGEFEMQMLDVGQGLSIVVRTSGHTLLYDAGP
FT                   AVNDGFDAGERVVVPALRASGIRRLDALVASHADSDHVGGLPAVLKAYPVDISYAPPDA
FT                   PLDVERRCSAGDSWLWDGVQFRFLHPAPHSRYLGNESSCVLRIDTRWGSALLTGDIGKV
FT                   VERGLLSQDRESVRADVVVVPHHGSAGSSSLGFVRAVNARLALVSSGDGNRFGHPRCSV
FT                   VESWSETADVLLTAHSGAVRIWVGQQGLQLRERRVWRRRFWDAVERRRSAAILSATEDV
FT                   SKERRRNETCWNW"
FT   gene            445808..446470
FT                   /locus_tag="Xfasm12_0387"
FT   CDS_pept        445808..446470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0387"
FT                   /product="biopolymer transport protein"
FT                   /note="KEGG: xft:PD0359 biopolymer transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11401"
FT                   /protein_id="ACA11401.1"
FT                   /translation="MLELVKAGGWPMLPLLMLGVVALAIVLERLWTLRRNEVLPSGLGR
FT                   EVREWVRRGKLDQNHLESLRRNSPLGALLAAALDVKGGVREMIRERIEDTGRHLVHRME
FT                   RFLNALGTIASAGPLLGLLGTVVGMIQMFLGILDYGVGDVNQLAGGIGKALVCTATGMI
FT                   IAIPALIFHRYFKGRITGYVIEMEQEAMLLLDAIDGLQIAIQGRNAEVAHPNAVTKD"
FT   gene            446475..446912
FT                   /locus_tag="Xfasm12_0388"
FT   CDS_pept        446475..446912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0388"
FT                   /product="biopolymer transport protein"
FT                   /note="KEGG: xft:PD0360 biopolymer transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11402"
FT                   /protein_id="ACA11402.1"
FT                   /translation="MRIGNQRLEDEPHIDLVPLIDVILVLIIFFVVTTTFDARSTLQLQ
FT                   LPNASDQHKSVPSKALSILVNADGHYFINDHEVLRTDVESLKRSIADVAGDDREQTVLL
FT                   RADARTPYQAVVTVQDALGQLGFRHIAIATAPDANKVGTAR"
FT   gene            446930..448678
FT                   /locus_tag="Xfasm12_0389"
FT   CDS_pept        446930..448678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0389"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="KEGG: xft:PD0361 ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11403"
FT                   /protein_id="ACA11403.1"
FT                   /translation="MRYATPWRTYRRLLSYAREYRWLLVVAACGALLEAVAGSTFLALM
FT                   KPITNETFIERNREVALWLPLGIVGLFLLRGIAGYITDMAMGRAARSIARDFRVCVLTK
FT                   YFRLPGGRFDGEPVASMLVRLGSDSEQVAHAVIDAMKVMVQQTLQVIGALVVMLWYSWT
FT                   VTLAILLVAPLLAWVMQRVAKRYRRISHHIQESNAQLMQAADQALSNYQDVKVYAAQES
FT                   ELERYARLANINLGLAIKVESTRSISSAAVQLLGAVGLAMLLLIAGHEALAGRLSPGDF
FT                   VSLMTSMIAVIPALKQLTNVQNMLQSGIASAQRLFSVLDSPDELDTGRRPLGRARGLIE
FT                   FRGITARYPGRSAPVLDSVSFVAAPGTVTAIVGRSGSGKSSLIKLIPRFYEPESGQILL
FT                   DGHPLQDYLLADLRRQIALVGQQVMLFDGSIAENIAYGEMHQVVSEQIERVVVDANAQD
FT                   FVNQLPEGLQFQVGVKGGRLSGGQRQRLAIARAMLKDAPILILDEATAALDNESERLVQ
FT                   DALQRLMPERTTLVIAHRLSTIKHADQVLVMDQGRIIESGTHVDLLARDGLYAYLYSMQ
FT                   FRERPT"
FT   gene            448675..449694
FT                   /locus_tag="Xfasm12_0390"
FT   CDS_pept        448675..449694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0390"
FT                   /product="Tetraacyldisaccharide 4'-kinase"
FT                   /EC_number="2.7.1.130"
FT                   /note="KEGG: xft:PD0362 lipid A 4'-kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11404"
FT                   /db_xref="GOA:B0U4R4"
FT                   /db_xref="InterPro:IPR003758"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U4R4"
FT                   /protein_id="ACA11404.1"
FT                   /translation="MSSGRGSRIPEYWYGQVPVPPFMRFMEVIYAGAVSLRRLAYRRGW
FT                   RRRYGVAVPVVVIGNLVAGGTGKTPLTIEIVARLREAGWTPGIASRGYGRRDLKTPRWI
FT                   QPDTPIELAGDEPAMIAWKTGMRVRVDVDRSAAACALVAEGCDIVVCDDGLQHYRLMRD
FT                   IEIEVIDGQRRYGNGHLLPAGPLREPMVRGRLCDFRVLNAGQYSDRPTSGFGPGDWQMR
FT                   LHIDHAQSLQGSRRRSLDAFSGQRVHAVAGIAHPERFFSMLRQRGIGVVPHAFPDHHFY
FT                   RAEDFTFGSRLPVLMTEKDAVKCRAFADDWFFSVPLRVELPTVFWTALFDRLERLVSC"
FT   gene            complement(450069..451151)
FT                   /locus_tag="Xfasm12_0391"
FT   CDS_pept        complement(450069..451151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0391"
FT                   /product="phage-related tail protein"
FT                   /note="KEGG: xft:PD1088 phage-related tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11405"
FT                   /protein_id="ACA11405.1"
FT                   /translation="MGVTPCYRLIANDNDITALITERMASLQLSDESGSHADTLEVVLA
FT                   DHLPNAPLKLPPMGAELELALGYDGQLRPMGVFVCSEITLSGWPATMTLRAHAAPWEGT
FT                   PKGKSDLQTQKTRSWPAGTTLGAMLSTMAAEHGMTWAISPSLTDVALPHIDQTEESDIN
FT                   VLLRLAQRYDAIAKPAGGRLIFAKRGEAKSVTGIDMPRITLTPDEIASWQMTYATRDSP
FT                   GTVIAFYRVARRAELHQVSVGDGHPVHRIKQYLPDATAAIAAARGELSRRARAETKLTL
FT                   EMAGRAELSAEAVLTLNGWREGVNGDWLVTRVQHCLDKNGYRCSIEAERPNNHPDVAAA
FT                   INTQVRDQVVRPSRTHHQKT"
FT   gene            complement(451142..451360)
FT                   /locus_tag="Xfasm12_0392"
FT   CDS_pept        complement(451142..451360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0392"
FT                   /product="phage-related tail protein"
FT                   /note="KEGG: xft:PD1089 phage-related tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11406"
FT                   /protein_id="ACA11406.1"
FT                   /translation="MSLHIYLTRHGDTVDWLAWKYYARTDATIISAIYEANHGLAAWGP
FT                   VLPEGIAITLPDPAATPRTIPGVTLWE"
FT   gene            complement(451357..451839)
FT                   /locus_tag="Xfasm12_0393"
FT   CDS_pept        complement(451357..451839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0393"
FT                   /product="phage-related tail protein"
FT                   /note="KEGG: xft:PD1090 phage-related tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11407"
FT                   /protein_id="ACA11407.1"
FT                   /translation="MIRQTLWSDVAAPLQNAFQTNNSGNRPVLMMLGGYTFSLATLVYQ
FT                   ELARVNEYRWAAIERYGQRDARQYTGPGDESIELPGIAYPDWQGQRASLDELRALAAQG
FT                   KPLQLIDSNGLIHGWYVIERIEERQSDHHPNGTPRRIEFTLALQRVNDDQAVEATP"
FT   gene            complement(451836..454055)
FT                   /locus_tag="Xfasm12_0394"
FT   CDS_pept        complement(451836..454055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0394"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD1091 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11408"
FT                   /protein_id="ACA11408.1"
FT                   /translation="MANKKQFHASLIIAGHLSSTLKSAFGSTQRNVQRIGAAVTTLSRQ
FT                   QRLLGQGIQTFGRMGRNIDGLRTRYDALTRQLERTRAAQQRLNQAQSALEGHRARLSQM
FT                   RGQLGGAVGTLGAVSAAAFFPIKAAVEFETAMLGVVKQVDGARDTTGKLTSVYYDMGNA
FT                   IQQLARTIPMATNELADMVTAGARMGIAEGMNPEQARKTLIEFTRVSAMAATAFEMPAG
FT                   ELADSMGKIAGIFKIPINTIERLGDAINYLDDNAISKGGDIIKVMQGDLAGAASTMGLS
FT                   AKNAAALASTFLTLGESAERADTAASGMLRQLQIAKMNPKRFQIGVGMLGMTADQLQKG
FT                   MVTDPQSMILDVLTRIKTLPVEQQMEAVTRLFGKDWGGAIAKLANGVDEYRRQLALANG
FT                   EAAKGSMSREFQARQRTTAAQWQITKNRLTELSVAIGNALLPAINDLLASSAPVIERFA
FT                   AWTQKHPGVVKAVLGTALALAGVRVAVIALRFAFAALHYPLLLGLRLIASWRAVGTLAS
FT                   MAQVRTAALAVGRVLGRVVPAAFMVAGRAALWLGRLLLMNPLGLAVTAIASGALLIIQH
FT                   WNTIKPFMTSLWEDVKKIFSGAWGVITGLFTGNFDRVKNGFKTMFDGIGTIATSFFDKL
FT                   KSLWNWATEKFTTMKQWLGIGDSLTQHTMTTAGAGAAPTATVRMPPLAQQHRTNNADYR
FT                   SYATYNITQQPGERGETLARRIAAQSSQSQRQPRSALYDDVRGQE"
FT   gene            complement(454182..454469)
FT                   /locus_tag="Xfasm12_0395"
FT   CDS_pept        complement(454182..454469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0395"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD1092 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11409"
FT                   /protein_id="ACA11409.1"
FT                   /translation="MAGPTTDKPYIREAEGGVHITLASPVSINGATVNELWMREPTAGD
FT                   MKRSFALPGNEGERELRIFSNLLEVAPEALETFSLRNYKRLQEAFLIFIE"
FT   gene            complement(454472..454981)
FT                   /locus_tag="Xfasm12_0396"
FT   CDS_pept        complement(454472..454981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0396"
FT                   /product="phage-related protein"
FT                   /note="KEGG: xft:PD1093 phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11410"
FT                   /protein_id="ACA11410.1"
FT                   /translation="MSAPRHILKHLNLFIDGKGYAGQVEDINLPKLTLKTEEFRGGGML
FT                   APVELTMGMEKLETDVSLICYSSDALLLFGVTEGKHVNCTVRGFLESFDGTTTSLAIHL
FT                   RGKVKEIDRGTWKPPDKSSLKLALALSYYKEVHNATVIHEIDVENMIFQQNGIDLLAPA
FT                   RNALGL"
FT   gene            complement(454981..456159)
FT                   /locus_tag="Xfasm12_0397"
FT   CDS_pept        complement(454981..456159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0397"
FT                   /product="phage-related contractile tail sheath protein"
FT                   /note="KEGG: xft:PD1094 phage-related contractile tail
FT                   sheath protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11411"
FT                   /protein_id="ACA11411.1"
FT                   /translation="MTEHYLHGVEVLEIDDGARVIQTASSSVIGLVGTAPLADATTYPL
FT                   NTPVLVPGSAAMAATLGTAGTLPQAMDSIFDQIGAAVIVVRIEDSVDETQRLSHAVGGI
FT                   HAANGTYEGVHALLAAENITGYKPRLLIAPGLTHQRPEQTQANPVVSELIGIAERLRAI
FT                   IIADGPGTTDAQAIAYAGDFGSKRVFLVDPPITTLGADGNTTTAYSSAAVAGLIAKIDN
FT                   RNGWWWSPSNQPLNGILGTSRPIDFALGDATSRANLLNEKKIATIIRHDGYRLWGNRTL
FT                   SSDPKWTYLCVVRIADIIADSLQAAHLWAVDRSITKTYASDVEEGVNAYLRRLKSLGAI
FT                   INGRCWADTALNTKDAITAGHVYFNFDFTPAYPAEHITFRSRLTSDYLVEVF"
FT   gene            complement(456223..457815)
FT                   /locus_tag="Xfasm12_0398"
FT   CDS_pept        complement(456223..457815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0398"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD1095 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11412"
FT                   /protein_id="ACA11412.1"
FT                   /translation="MTPLQITITPQGRAALVNAEHHGTVPVRLASVGLTAQHFDPAAAT
FT                   MPDESKRLTTFSGGVVAADTIHITIGDATSDQYDVRGFGVYLDDGTLFATYSQQDIILS
FT                   KSASAMLLLAIDVRFVDTDATQLSFGETSWNNPPATQTVAGVLTLSSNAQAIAGLDDRS
FT                   AIPPTALKATLDHRLGEAAPSDYAKTLMASADAPTLRHLLGLGDAAVMDTGSEKGLDAD
FT                   LLDGYHGTYYLQWRNLQNTPQTYPPSAHQHASSDIPDLASHLDTLVKKTGSLMTGSLQS
FT                   QGTLIGDALGNGRIPALKIGNDCEFWDNNIPYAATFRSGTSPAIAQLFFGTSNHCYFGT
FT                   STKNTSTVIGAKTGLLWIETAGNYYYQQHDTTHVAFYKKNGGHAFFWRRSDSGGSGSTN
FT                   EVQLMALEDNGNLSVKGTIVSAGGYAQGSSRKLKDIEGPLPYGLAEIEQLTPLIGRYKP
FT                   SYTPDGRRRLFLEAEQLLDLMPETVNPEGIPFQGAYVPSVNLDQLLPVLVNAIAQLSAK
FT                   VNALTGAPRHAEK"
FT   gene            complement(457823..458380)
FT                   /locus_tag="Xfasm12_0399"
FT   CDS_pept        complement(457823..458380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0399"
FT                   /product="phage-related tail protein"
FT                   /note="KEGG: xft:PD1096 phage-related tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11413"
FT                   /protein_id="ACA11413.1"
FT                   /translation="MNDPLHSLLPPTATPLMRTLEQVMARMADIPIPFKQLWDPHTCPE
FT                   PLLPWLAWSLSVDTWRSTWPVHIKRARIAAAIEIQRCKGSVKSVRDVVRSFGGDVLITE
FT                   WWQQNPPAAPHTFTLLLTLSGQSGSQSTAEFVADVITEVIRTKPVRSHFTFTQGVHTIG
FT                   QIGLIGGAQITAYRRVQLTQAA"
FT   gene            complement(458373..459266)
FT                   /locus_tag="Xfasm12_0400"
FT   CDS_pept        complement(458373..459266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0400"
FT                   /product="phage-related baseplate assembly protein"
FT                   /note="KEGG: xft:PD1097 phage-related baseplate assembly
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11414"
FT                   /protein_id="ACA11414.1"
FT                   /translation="MDNTLTAIDISKLPMPDVIRQVAADVILQEMLADLAARDPTLKDL
FT                   LPSDPIYTLLEVAAYREAVRRYQSNEDAKAVMVALASDADLDHLAALFRVKRLVLDAGD
FT                   PSKGIPPTMESDAAFRRRIVLAPEGYSVAGPEGAYIYHAISAHADVLDVSATSPTPGDV
FT                   IITVLSRSANGQPSQEVLDAVMAAVNQESVRPMTDHVTVQPAQITDYQVHARLHTYAGP
FT                   DAAVVLSEAHRRITAYTTDTFRLGRDIALSGLYAGLHVEGIQRVELITPQQGLTIDRTQ
FT                   AARCTNITVVHGGIDE"
FT   gene            complement(459266..459670)
FT                   /locus_tag="Xfasm12_0401"
FT   CDS_pept        complement(459266..459670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0401"
FT                   /product="phage-related baseplate assembly protein"
FT                   /note="KEGG: xft:PD0367 phage-related baseplate assembly
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11415"
FT                   /protein_id="ACA11415.1"
FT                   /translation="MSLAFGKPATGHRPGDPPKLLSMRGMNMHTGKPLDGIDHLRQSVQ
FT                   NILSTPLGSRIMRRDYGSRLPHLLDAPITRALTMDLYAATAQALAAHEPRITLRQVTAR
FT                   ATASGTVTLALTAHYLPEGKTVTLDGIQVR"
FT   gene            459712..459993
FT                   /locus_tag="Xfasm12_0402"
FT   CDS_pept        459712..459993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0402"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eba:ebB120 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11416"
FT                   /protein_id="ACA11416.1"
FT                   /translation="MSEKMTVSCGNVFEDLGFAPDEAAAMLARETLLIALEKELRKRGK
FT                   KQQELADELGVPRTRISEVMHLKTDRFSVDKLVSLLHRAGKRVEIRVR"
FT   gene            460005..460304
FT                   /locus_tag="Xfasm12_0403"
FT   CDS_pept        460005..460304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0403"
FT                   /product="putative plasmid maintenance system antidote
FT                   protein, XRE family"
FT                   /note="KEGG: gme:Gmet_2972 plasmid maintenance system
FT                   antidote protein, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11417"
FT                   /protein_id="ACA11417.1"
FT                   /translation="MTMSKTLPPIHPGEILREEFMVPLGLSSNALAKAIGVTAARINEI
FT                   VRERRGITAETALRLARYFGTDPQSWLNLEQHYALECAKRDLGDALSRIHPRVA"
FT   gene            460361..460642
FT                   /locus_tag="Xfasm12_0404"
FT   CDS_pept        460361..460642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0404"
FT                   /product="proteic killer suppression protein"
FT                   /note="KEGG: xft:PD0368 proteic killer suppression protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11418"
FT                   /protein_id="ACA11418.1"
FT                   /translation="MIKSFRHKGIQQFFLVGSTAGIQTKHAAKLRIQLTALESAKRPED
FT                   MNAPGWKLHPLKGADLKGHWSIWVNGNYRLTFAFEGEDAILVDYQDYH"
FT   gene            460653..460928
FT                   /locus_tag="Xfasm12_0405"
FT   CDS_pept        460653..460928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0405"
FT                   /product="putative plasmid maintenance system antidote
FT                   protein, XRE family"
FT                   /note="KEGG: xft:PD0369 proteic killer active protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11419"
FT                   /protein_id="ACA11419.1"
FT                   /translation="MKRMHNPAHPGEVLREYLGDLTVTNAAAKLGVSRVALSRILNGTN
FT                   GISADMALRLEDALGTSAEMWAAMQAKYDLWVASQQPRPKITRLHV"
FT   gene            complement(460933..461520)
FT                   /locus_tag="Xfasm12_0406"
FT   CDS_pept        complement(460933..461520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0406"
FT                   /product="phage-related baseplate assembly protein"
FT                   /note="KEGG: xft:PD1101 phage-related baseplate assembly
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11420"
FT                   /protein_id="ACA11420.1"
FT                   /translation="MRQTLNEHTRQLAHLILQGTVAELDPATACVRIEAGELLTDWLPV
FT                   MASRAGADRSWWLPHLGEQVIALCPNGDSALGIVLPGSLYQETFPAPSSTAHQPCLLFG
FT                   DGTRITYDRQAHALTVDASAASGTVTLICATATLNASDRLTLDTPSLHLTGNLTVEGTI
FT                   QAQGDITAAGIGLQRHHHTAQGPNAPTTPAQG"
FT   gene            complement(461517..462059)
FT                   /locus_tag="Xfasm12_0407"
FT   CDS_pept        complement(461517..462059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0407"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD1102 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11421"
FT                   /protein_id="ACA11421.1"
FT                   /translation="MADTNTDISLDALHTAIRDQIAAHFPDLATVAFYQDDEDHQLPMP
FT                   ACLLTLSEIEPAPENDAGTGQFPALLRFQARLVLGHRGPSTHLQARLAAAALGTWLYQR
FT                   RWRGVPTDPCRVIDIYPDEFNAELDRYVVWTVEWQQPVFLGNSAWNNPGTLPTNLWLSF
FT                   TPQTGPSVQDSYHQIAP"
FT   gene            complement(462035..462556)
FT                   /locus_tag="Xfasm12_0408"
FT   CDS_pept        complement(462035..462556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0408"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD1103 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11422"
FT                   /protein_id="ACA11422.1"
FT                   /translation="MIGIHIHTHSLTSIAQALNATEMQMEQALRSAKIKMAAWLRTRSV
FT                   RGLSDALQLQQKIVRRRLRTYRQRDQMKVWYGLNPVPLLWLKPKATPSGVSALGGRQIK
FT                   GAFIATVRGKRQVLKRLGRARYPVAVQKADIYAPSMTYIENGLLDTATFEARFYTLFEH
FT                   ELQWRTQTPT"
FT   gene            complement(462553..462876)
FT                   /locus_tag="Xfasm12_0409"
FT   CDS_pept        complement(462553..462876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0409"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD1104 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11423"
FT                   /protein_id="ACA11423.1"
FT                   /translation="MHHPSWDDLDAFLETDDFAVTAQLHSETSGRVHQCTIVFDATYID
FT                   ADIGDYRMNAPEPSLTCKEIDVMHFKKHDYALIEGRHYRLTHDPQPDGTGMALVRLAPM
FT                   VPP"
FT   gene            complement(462876..463136)
FT                   /locus_tag="Xfasm12_0410"
FT   CDS_pept        complement(462876..463136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0410"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD1105 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11424"
FT                   /protein_id="ACA11424.1"
FT                   /translation="MSTTTNTLKISAAVVIQGLIYRPGTIVQVPTALAHDLMRRGRAEL
FT                   AGDADGPVGVIIDPPSGGAPTPNTLPPTENNEKPAPRGGRR"
FT   gene            complement(463154..465028)
FT                   /locus_tag="Xfasm12_0411"
FT   CDS_pept        complement(463154..465028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0411"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD1106 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11425"
FT                   /protein_id="ACA11425.1"
FT                   /translation="MTTATEVVRDLRKGGTQYRNADVLSIDEPSRTLELAFSSEAAEVQ
FT                   TWSGVEILGHRPGEVRLHRLGDSAALLLDHNPRDQIGVVQSASIDRDQRGRAIVRFGRS
FT                   PRAEEILRDVLDGIRKHVSVGYLVHQVEVIGQRDAGPLYRATDWEPIEISIVSIPADPS
FT                   VGIGRALENPPQDTATVSQHTPGTPEDKTMTEPSTPAHADTTNTPQPTSNATDTPNSVD
FT                   AERTRVRHIADLGKTYGHLELAHDYITQGQSPEAFQRALLTKLTDKAPMPQSEPHTQTG
FT                   IGLSTQEIRHYSIVRAIRALLPNASQTDRNAAAFEIACSAAAEKTYGKQARGLLIPSDV
FT                   LNRAFSTTTPTDGPGGNIIATELHASSFIEILRNKTWVMQRATVMGGLVGNVDIPRQKG
FT                   TTQAYWVGEGESPEKSKPALDQIHFSPKSLAAYTDITRRLLLQSTPDAEQIVRSDLLNV
FT                   MALEVDRAAIYGSGSDMQPTGVKHHSGINAVSFAQKGQPSFAELVQMETQIALNNADVN
FT                   AMSYAFNAGIRGYAKTALKFPQTAASGTIWESGNTVNGYPASVSNQIKAGDVFFGNWAD
FT                   LIIAMWGGLDITVDPYSLSTSGGTRIVVFQDVDFNIRRTESFCYGAAA"
FT   gene            complement(465025..466611)
FT                   /locus_tag="Xfasm12_0412"
FT   CDS_pept        complement(465025..466611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0412"
FT                   /product="phage-related portal protein"
FT                   /note="KEGG: xfa:XF2498 phage-related portal protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11426"
FT                   /protein_id="ACA11426.1"
FT                   /translation="MNLWTWWTQRTAHPDPPTPDTATPQPNHTPRRWYQRMLPLGGMFK
FT                   AGQVNANDLWSSIPVSPDEYITQRLPILVARMREQWSNNDHVKRYIDLCRRNIVGPRGI
FT                   VMQAQSRKSRSGALDTAINDAIETWWQDWGRKGHCEVTGKLSWREIQTLCVETCARDGE
FT                   FIARKIYGTHAGPHGFCLQLIDPLRLPVRYQMLKTDQTGGFVRQGIEFNRFGKPLAYHF
FT                   SSIDERDTYYYSINGRGYVRVPAEEVIHIFKPVMVGQRRGLPWAATSLLRLHHLQGFEE
FT                   AAVQNARAAASKMGFVRYPEGFGPRADEQENVAQTIQMNAGPLAIHELPQGAEFQDWNP
FT                   QYPSGEFGLFTKAAKQSLAAGMDISYHALSGDLADVNYSSIRQGTLDERERWKEDQQFF
FT                   IESLHTPVFEAALKVALLSGQIRVHGKPLPAEQYDRYRRVSWQGRRWAWVDPRTDVESA
FT                   LTCIRGGLTSTSQVILEQGRDPQDVFREISQDLKEMQASGIPNDYLKYLLYGADLTAAN
FT                   ATPTKKEPTPP"
FT   gene            complement(466608..467156)
FT                   /locus_tag="Xfasm12_0413"
FT   CDS_pept        complement(466608..467156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0413"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD1108 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11427"
FT                   /protein_id="ACA11427.1"
FT                   /translation="MTFQHTCPTFPAKINAGCSLQISLTLKNYPWPDWTLHCLLRGPAS
FT                   LDLTAQGENTTHRFDIPAADTAQWTPGDYLYQLRAAHSPQTIEIKRGKLRVEPDFASLP
FT                   QGYDGRSDNQRALDAINAVLQKRATQDQQRYRINNRELWRTPIAELLKLRTFYAVAVQR
FT                   ETPTDTPRWGNIVPVRFVG"
FT   gene            complement(467160..469112)
FT                   /locus_tag="Xfasm12_0414"
FT   CDS_pept        complement(467160..469112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0414"
FT                   /product="phage-related terminase large subunit"
FT                   /note="KEGG: xft:PD1109 phage-related terminase large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11428"
FT                   /protein_id="ACA11428.1"
FT                   /translation="MSETLGIAALENQEGVDQMISNALQMLRPPPAMKPSEWAQTRIRI
FT                   PEGNAIPGPLRLDNAPYQREPMDMLVDPDCYRVTLKWGAQVGKTMLALCVQGYCIEMAP
FT                   RSQMMLQPSQGDLQAWLETKFSPLIAANQGLQRLIAKPRGRDGVNNQRMKSYPGGFLMF
FT                   AWSGSPKTMRGRSAPLIVCDEIDGYERTDEGHPVSLLWQRAATFGDERFLLEISTPTIE
FT                   GASYIDDAYRAGDQRRFYVRCPACGCEQTLEWEHVSWVGRQSDPDADLAAIDAHQPHTA
FT                   RYVCQGCGVCWDDGQRIAAVRQAHWQASKPFNGHASYELNELYSTFRRQSAIVQDYLDK
FT                   LKHQDLQTFTNVSLARVWSETAEQANLDDLLRRLETYLADVPMGGVFLTAGIDMQTDRL
FT                   EVEIVAWGIDEESWSIHTAVLYGDPLLGDVWEALDRYLSTTWQHESGLRLPIQAACLDT
FT                   GGTCGYTQAAYQYLRTRTGRRLFGIKGVGGWGRPIVDKAQRKHSGRNAPKINLFTVGVD
FT                   EAKLIVMRRLAITHPGPGYSHFPTDRSPDWFAQLTAEKLRTRYLKGQPVRQWTKPDKTP
FT                   NEALDCRVYAYAALKIINPHLPHDAKRIKDAAALLPKEKLPQDPTLEVQHHTPHLRPQH
FT                   PRPPLRRRRTWANDW"
FT   gene            complement(469105..469680)
FT                   /locus_tag="Xfasm12_0415"
FT   CDS_pept        complement(469105..469680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0415"
FT                   /product="phage-related packaging protein"
FT                   /note="KEGG: xft:PD1110 phage-related packaging protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11429"
FT                   /protein_id="ACA11429.1"
FT                   /translation="MRGVLILTCCLYRPMVLQKQQGKQVNRAGLSEIFGVALPTVDQWA
FT                   RNGCPVVKRGGRGREWTFDTAVVARWLRDKAAEEAAGGAVADIEEWKRRKIAAEAQREE
FT                   LHLADAKKQVAPLEQVEKTLARVFAQVRANLRTIPGRTVALLLGETDERRYKRVLLQEI
FT                   DQTLENLASLDLTQEDTDPDEDEETDDV"
FT   gene            complement(469811..470035)
FT                   /locus_tag="Xfasm12_0416"
FT   CDS_pept        complement(469811..470035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0416"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF1672 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11430"
FT                   /protein_id="ACA11430.1"
FT                   /translation="MITPPQVLLQPCEEPPLPRVETVRDVLNQTLAWRLAYEHCAAQVR
FT                   CVAAWVQAASVGQPWSPQGCGIEDSDTPS"
FT   gene            complement(470037..470498)
FT                   /locus_tag="Xfasm12_0417"
FT   CDS_pept        complement(470037..470498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0417"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0994 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11431"
FT                   /protein_id="ACA11431.1"
FT                   /translation="MIVNTLRRVWRGLPSVRLLVEYMMIGALVALVAHAVLAWSERSQL
FT                   AQRAAQLEGQLAAVESTLDAQVAINTEQDAAITRLRALREIDRQAIAGLHTDLNRITLR
FT                   DRALRQRMTHLEQHSDEAKAFLDMDVPDVLGCLLDGGSCQASYRHADPR"
FT   sig_peptide     complement(470382..470498)
FT                   /locus_tag="Xfasm12_0417"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.808) with cleavage site probability 0.676 at
FT                   residue 39"
FT   gene            complement(470488..470817)
FT                   /locus_tag="Xfasm12_0418"
FT   CDS_pept        complement(470488..470817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0418"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0995 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11432"
FT                   /protein_id="ACA11432.1"
FT                   /translation="MVDPSLLPAWWKEAFYVCLAMATGTLSYLMRALDAKERLAVSRVL
FT                   IEAGIAGFVGLFVMCVCEWLEMSQAFTVAAVIASGLIDTPQTLELIQNVIVPKLGMGRR
FT                   SSDDR"
FT   gene            complement(470810..471310)
FT                   /locus_tag="Xfasm12_0419"
FT   CDS_pept        complement(470810..471310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0419"
FT                   /product="phage-related lysozyme"
FT                   /note="KEGG: xfa:XF2314 phage-related lysozyme"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11433"
FT                   /protein_id="ACA11433.1"
FT                   /translation="MQTIGEEGIALIKFFEGLRLQAYICEGSALTIGYGETGKHVTPDM
FT                   CLANEQEADAMLRARLAKEFEPAVRRYVRVPLKQQQFDALVSLSFNIGVGAFHRSTLLK
FT                   RLNAGDVAGAAEQFHVWKWAGGRVQSGLIIRRAAERVLFEYGDWRAEAEKQRAALKSKG
FT                   RRG"
FT   gene            complement(471410..472141)
FT                   /locus_tag="Xfasm12_0420"
FT   CDS_pept        complement(471410..472141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0420"
FT                   /product="site-specific DNA-methyltransferase"
FT                   /note="KEGG: xft:PD1324 site-specific
FT                   DNA-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11434"
FT                   /protein_id="ACA11434.1"
FT                   /translation="MTAALSSAYRLHEGDALRLLCDIDSANVDAVITDPPYCSGAMRMS
FT                   DRFKPTKRKYINSTTKHIAPDFDCDFRDHRGFLAWSSQWLSECRRVTRPGGVLLVFTDW
FT                   RMLPTLTDAVQSAGWAWQGIVVWDKTPACRPQLVRFRSQAEFIVWASCGLMNPKAHTVT
FT                   PVGVFTTGTAPREKRHQVGKPLALMEHLIKIVPPTSTILDPFAGSGTTGVAALRAGHRF
FT                   IGMELSPWYCDVTKQRLADST"
FT   gene            complement(472331..472666)
FT                   /locus_tag="Xfasm12_0421"
FT   CDS_pept        complement(472331..472666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0421"
FT                   /product="HicB-related protein"
FT                   /note="KEGG: xft:PD1342 HicB-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11435"
FT                   /protein_id="ACA11435.1"
FT                   /translation="MKNIMTIESFKAIITYDPEIDMFRGEFVGINGGADFYAKDLKGLR
FT                   REGAISLKVFLEACKEDSVEPRKCYSGKFNARISPELHALASEAAAAQGISLNQFVEQA
FT                   IQHEVHT"
FT   gene            complement(472663..472917)
FT                   /locus_tag="Xfasm12_0422"
FT   CDS_pept        complement(472663..472917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0422"
FT                   /product="HicA-related protein"
FT                   /note="KEGG: xft:PD1343 HicA-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11436"
FT                   /protein_id="ACA11436.1"
FT                   /translation="MKRKHAKTLSAIYTRPVSANIQWRDIEALFVELGAKVEEREGSRM
FT                   LVRLFGERRIFHRPHPSPNTDKGAVESIRAWLKSNGVTP"
FT   gene            complement(472970..473692)
FT                   /locus_tag="Xfasm12_0423"
FT   CDS_pept        complement(472970..473692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0423"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD1344 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11437"
FT                   /protein_id="ACA11437.1"
FT                   /translation="MQTTNLLQHHNPRRLLARLNPSTIRYDTLPGGVPELTAQDIAHAL
FT                   GLVPAGLGREVLQACWWPDGAALRRSPLRDAAVALVVPEIRRQQQRLLEARTDVGIVKA
FT                   CMGWTRATTSAQQAALRRAEERLDKLKAHLWPQATLEMLPVLVAAVVDELSTPQLCPCC
FT                   HGRGERRVGALVKVCTACGGSGAVPASDRKRAAAIGRDESTYRTTWRSLYEWLLERMGA
FT                   AERQAATQLQEALQTDAA"
FT   gene            474170..475438
FT                   /locus_tag="Xfasm12_0424"
FT   CDS_pept        474170..475438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0424"
FT                   /product="phage-related DNA polymerase"
FT                   /note="KEGG: xft:PD1727 phage-related DNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11438"
FT                   /protein_id="ACA11438.1"
FT                   /translation="MGDWGNLLIPYRCRFPISLYTGRWAGRLFQPHNLPRPTLSQPVIA
FT                   VGIDAMKAGCVDVVFDDVMALTSSALRSCLIAPTHKKLVVADLSNIEGRVLAWLAGETP
FT                   KLHAFGDFDTCQGVDGTWHSGEAITHGALRGAPITLQRNAEHEPIRQGDDIYKRAYAHS
FT                   FGIAPQAVTKEQRQIGKVQELALGYGGGVGAFAAFAAMYHIDLEAMAEQAALPPLLLQE
FT                   AVEALQWTKANQRPTFGLSDRAWLACDVFKRAWRNAHPAIAAFWQALQFAATDAIGHPE
FT                   TAHTCCGITVQYSRAWLRLRLPSGRVLYYAAPRVDEHGALSYMGTHPITRKWTRITTYG
FT                   GKLVENITQAVSRDVLAACMPAIEAAGYAIVLTVHDEMITEADDNAAFNAAHLAALMAT
FT                   PPPWAQGLPLAAEGFQTHRYRKQ"
FT   gene            475435..475713
FT                   /locus_tag="Xfasm12_0425"
FT   CDS_pept        475435..475713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0425"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD1728 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11439"
FT                   /protein_id="ACA11439.1"
FT                   /translation="MMNIPRERTIERYLVAQVRAKGGEIRKVKWGGRHGAPDRIAMLPE
FT                   GRTLWVELKAPGQQCTLHQVREHERMRRMGQRVVVVDSLKGVDEVLA"
FT   gene            complement(475715..476020)
FT                   /locus_tag="Xfasm12_0426"
FT   CDS_pept        complement(475715..476020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0426"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD1729 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11440"
FT                   /protein_id="ACA11440.1"
FT                   /translation="MTSVAFDTLKFANRLKTAGVPAAHAEAEAEALAEVLETNLQDLAT
FT                   KRDLRELELKLESKIDKGFADVHKGFVEIKGEMLLLKWMFGVIVTSLVALIIKAFF"
FT   gene            476105..477523
FT                   /locus_tag="Xfasm12_0427"
FT   CDS_pept        476105..477523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0427"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD1194 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11441"
FT                   /protein_id="ACA11441.1"
FT                   /translation="MNLRPYQHTIVDFILTHPRCNLFVPMGLGKTVATLTALDVLLVVE
FT                   DIAPILVIAPLRVAATTWPDEVAKFPHLRHLRVSVVVGSAAARRHALEQDADIYCINYD
FT                   NLKWLVEFYQDRWPFRMVVADECSKLKGFRLRQGTRRARALAKHVHTKVERYIGLTGTP
FT                   APNRLQDLWALMWMVDRGARLGTHFKAFSDRWFRAVQIGSDPHAVRLVPAPNASQEIQD
FT                   KIRDLCLSLDPHAYFDLRQPIVNTIRVALPEHAQRLYKAMEQDMFIALECGAEVEAFNA
FT                   ASKTIKCLQLANGALYTDDTRQAWEVVHDAKLEALHDIIEEAAGMPVLVAYHFKSDVAR
FT                   LQRAFPKGRALDKNPDTIRDWNAGNIPVLFAHPASAGHGLNLQDGGNILAFFGHWWDLE
FT                   QYQQIIERIGPTRQAQAGHTRPVFIHHIVAAGTVDELVMARRESKREVQDLLLEAVKRR
FT                   ETGKPLTSQGAMTR"
FT   gene            477520..477765
FT                   /locus_tag="Xfasm12_0428"
FT   CDS_pept        477520..477765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0428"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0383 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11442"
FT                   /protein_id="ACA11442.1"
FT                   /translation="MSDPSKQTCGLPPAAGLCLSRSEVAELCGTPQRARQAAFLRKNGI
FT                   RHYLDAHDWPVVLRAAIDAMPPSPMVRPVWKSNKVA"
FT   gene            477765..478784
FT                   /locus_tag="Xfasm12_0429"
FT   CDS_pept        477765..478784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0429"
FT                   /product="phage-related integrase"
FT                   /note="KEGG: xft:PD0384 phage-related integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11443"
FT                   /protein_id="ACA11443.1"
FT                   /translation="MGRKPIKAGAIPRFRVRPQKSGVVYYYYDHGGKPRKETPLGRDYG
FT                   LAIKRWAELEHAQITPAIAVTFRHVAERYRAEVIPTKARSTQQMHHIYLNYLLKFFDDP
FT                   PAPFESIKPVNIRQYLDWRTSKVSANREVALFSHLWNWARSKGITDLPNPCGGIRRNKE
FT                   RGRDVYIDDTTYRAVYQAADQTLRDAMDLAYLTGQRVSDVVNMDERHIVNGALEICQAK
FT                   TGVKLAIAITGELAVLIKRILARKRGMKLRSTRLIVDEKGLGLNWKKLAYRFRKVRAAA
FT                   GIAKEVFQFRDLRAKAATDKADLAGDMRQAQAQLGHASVTMTEHYVRKRKGAKVTPTR"
FT   gene            complement(479138..479315)
FT                   /pseudo
FT                   /locus_tag="Xfasm12_0430"
FT   gene            479561..480202
FT                   /locus_tag="Xfasm12_0431"
FT   CDS_pept        479561..480202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0431"
FT                   /product="partition protein"
FT                   /note="KEGG: xfa:XF1084 partition protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11444"
FT                   /protein_id="ACA11444.1"
FT                   /translation="MKTFVVAGSKGGVGKTTIATNLAAQAALRGVRTVLADADPQKSST
FT                   RWTERRANMDSQVLSINANGANGSHCWRNDLPANTDLLIVDAPAGMFADDLEGFLEQSD
FT                   AVIVPVMASALDIEAVVGFLNTMAKVPRVHQRKLPVGLVLNRARSRTQTTQQAMQMLGD
FT                   WPYLLVAQLRDSQFYVVLAGQGRSVFDYRSAQAREHQQDWKPLLQWLHKL"
FT   gene            480230..480706
FT                   /locus_tag="Xfasm12_0432"
FT   CDS_pept        480230..480706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0432"
FT                   /product="putative phosphohistidine phosphatase, SixA"
FT                   /note="KEGG: xft:PD0386 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11445"
FT                   /protein_id="ACA11445.1"
FT                   /translation="MCELILLRHAHAEPTGIGQTDFDRPLSQQGMIEAEAAGHWLCKQH
FT                   LIPDRVLCSPARRTRETLEAIVAVLGDVEQRLEERLYEATVGTLMALADECRDVDRLLL
FT                   VGHNPSMERLVSLIHSNKTSDDVGMSTGSIALLTLPLKTGIELDTICLTALWWP"
FT   gene            480711..481283
FT                   /locus_tag="Xfasm12_0433"
FT   CDS_pept        480711..481283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0433"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0387 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11446"
FT                   /protein_id="ACA11446.1"
FT                   /translation="MSAMVWISILFSVLPVSWATAQQRLTLDSVHSYFEFEVRTRLGQS
FT                   IHGVLPRLEGEVVSLPEGREKVRLHLYAGDALIPGRTHYTDWVRGEHFFDVQHYPTIEF
FT                   ESQPYSSRVMLQGGKISGNLTIRGISRDETLQIQPAACARPGYDCDLVGTGVVLRERYG
FT                   IDGWRLILGNRVTFCWHGRLIEGPPSH"
FT   sig_peptide     480711..480770
FT                   /locus_tag="Xfasm12_0433"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.724) with cleavage site probability 0.563 at
FT                   residue 20"
FT   gene            481244..483238
FT                   /locus_tag="Xfasm12_0434"
FT   CDS_pept        481244..483238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0434"
FT                   /product="cardiolipin synthase"
FT                   /note="KEGG: xft:PD0388 cardiolipin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11447"
FT                   /protein_id="ACA11447.1"
FT                   /translation="MAWPFDRGAAKSLNIFIRLLLLAAVLLGSGCASLSHAQLDHAASV
FT                   AVAARPATLDCDRPNRCALDSPLYALGSRALSESTPVTPLHYVTILDKGESALVARINL
FT                   IRSATRSIDMQTYIFDKDDSARLIMDELLTAARRGVRVRLLIDQLSAISDLNILGALAG
FT                   AHVNFQLRIYNPIFGKAKLNYGDYVASVLCCFRRFNQRMHNKLLVIDEMIGVVGGRNYQ
FT                   DDYYDWDLEYNFRDRDVLVAGPAVLQMAVNFDAFWAAERSVPVERLRDVGRMVLQDGVP
FT                   MLPSAVFHLLERVQRVTAEANDPDYVKRTFVDAALAVNKVQYVADLPQKHRHEHNANPV
FT                   SIGPRLDSLISNARHEVILQTPYLVLSKPALNIFRRLNRTQDKPRVVVVTNSLAATDNP
FT                   IVYALFYKYKRRNMRDLGFDIYEYKPFPENPPIDLTGVVPIEGWNNDYLQRRQDLLAAA
FT                   KVSDDSDNARQLPQLENKGQVDRRVLRTETRPPFLGIHTVNKPLPVTRPGARMGLHAKS
FT                   LVVDRKVGVIGTHNFDPRSESYNTEAVVVIEDPAFAGLLASSIEGDIAPGNAWVVAPRK
FT                   KLPGLYKLNYSVGKLSEALPVLDLWPWRYATNYEFKPGLDCPIPLPRRDPNFMQCYEPV
FT                   GDFPEVNVGPKWLLVRMLIAFGAGLVPIL"
FT   sig_peptide     481244..481357
FT                   /locus_tag="Xfasm12_0434"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.974 at
FT                   residue 38"
FT   gene            complement(484241..484653)
FT                   /pseudo
FT                   /locus_tag="Xfasm12_0435"
FT   gene            complement(485043..485360)
FT                   /pseudo
FT                   /locus_tag="Xfasm12_0436"
FT   gene            complement(485463..485645)
FT                   /locus_tag="Xfasm12_0437"
FT   CDS_pept        complement(485463..485645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0437"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0390 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11448"
FT                   /protein_id="ACA11448.1"
FT                   /translation="MFAEHSGSKSVTDLDSAPNRIRDEIAWWRITSTKQSKSRYGDDLL
FT                   SRGTPHQTASNKQYL"
FT   gene            complement(485901..486386)
FT                   /locus_tag="Xfasm12_0438"
FT   CDS_pept        complement(485901..486386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0438"
FT                   /product="L-asparaginase"
FT                   /note="KEGG: xft:PD0391 L-asparaginase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11449"
FT                   /protein_id="ACA11449.1"
FT                   /translation="MEDLLIVTTGGTIDKIYFDEKSHYQIGDPQITQILEALGIAFRFN
FT                   VIPIMRKDSLHMVEADRELIHNTITAHPCQHVLITHGTDSMVETGKRLQSIQNKTIVIT
FT                   GALNPARFHGSDAHFNIGCAIGALQSLSSGVYIAMNGRIWHPDKVRKNIIKSCFETI"
FT   gene            complement(486629..487228)
FT                   /locus_tag="Xfasm12_0439"
FT   CDS_pept        complement(486629..487228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0439"
FT                   /product="tryptophan repressor binding protein"
FT                   /note="KEGG: xft:PD0392 tryptophan repressor binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11450"
FT                   /protein_id="ACA11450.1"
FT                   /translation="MTDILVLYYSHSGSVARLARQIARGIAEVPGMAARLRTVPPVTAV
FT                   TQALAPVVPEDGAPYVVPTDLTECAGLLLGSPTHFGNMAAPVKYFLDSLGTDWANGTLV
FT                   GKPAGVFTSTGSMHGGQEATLLSMHLPLLHHGCLIVGIPFTERALSHTRSGGTPYGASH
FT                   VANATNDTQPTDEETLLARALGRRVADLAQRLTQQR"
FT   gene            487442..487600
FT                   /locus_tag="Xfasm12_0440"
FT   CDS_pept        487442..487600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0440"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF1095 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11451"
FT                   /protein_id="ACA11451.1"
FT                   /translation="MRLHFYRLFKIANSERSGHEIAAACVVMRGDLVKIFDAFKQAFGC
FT                   ITCWDVP"
FT   gene            487630..487773
FT                   /locus_tag="Xfasm12_0441"
FT   CDS_pept        487630..487773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0441"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF1096 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11452"
FT                   /protein_id="ACA11452.1"
FT                   /translation="MWRNTFLDGAGVKRKQWFFTWIAVSVPLIGVDVTLHAEYPATLAW
FT                   GR"
FT   gene            487803..488987
FT                   /locus_tag="Xfasm12_0442"
FT   CDS_pept        487803..488987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0442"
FT                   /product="Nicotinate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.11"
FT                   /note="KEGG: xft:PD0393 nicotinate
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11453"
FT                   /protein_id="ACA11453.1"
FT                   /translation="MEFIIKSLLDTDLYKFTMMQAVLHQYPGAQVEYRFKCRTPGVDLA
FT                   RFINEISHEIDGLCALCFSKEELDYLRGLRFMKPDFVDFLGLFHLDRKYLQLRASSQVP
FT                   GEIELDIRGPWLHTILFEVPLLAIINEVWFRNTSVLNLDVGRDRLDAKVRLLKDESGYE
FT                   ECSIADYGTRRRYSRQWHAQLLPLLAQGLGSNFVGTSNVYFAKQYGYTPLGTMAHEYLQ
FT                   AFQALGPRLRDSQVAGLEAWAREYRGDLGIALSDVVGLDAFLGDFDLYFCKLFDGMRHD
FT                   SGDPFKWGERIIMHLESHRIDPRTKVLVFSDGLDMNKVMRLYQHFRGRCRLAFGVGTSL
FT                   TNDLGPTPLQIVIKMVRCNGQPVAKLSDSPGKSMCDDPGYLHYLRQVFGVSADV"
FT   gene            489040..489159
FT                   /locus_tag="Xfasm12_0443"
FT   CDS_pept        489040..489159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0443"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF1098 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11454"
FT                   /protein_id="ACA11454.1"
FT                   /translation="MIDDHCFLATPLLWLSCFTLFANDFVIHTTKNGVYNAGA"
FT   sig_peptide     489040..489108
FT                   /locus_tag="Xfasm12_0443"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.959) with cleavage site probability 0.959 at
FT                   residue 23"
FT   gene            complement(489176..489751)
FT                   /locus_tag="Xfasm12_0444"
FT   CDS_pept        complement(489176..489751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0444"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0394 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11455"
FT                   /protein_id="ACA11455.1"
FT                   /translation="MNTRIVLARIISILGHPGVLGSFAIATKLSNTPTSTHVKTVVIST
FT                   MLLVTVLGLAYSVWQVQRGYWSHIDASKPNERAQLLPILLLLLGIATLSLWALDMPKQV
FT                   VSGPIAGIALVLTAHSVRHWMKPSLHVGFGILATGLNNTLPVDVILLAATALVGWSRLA
FT                   LGRHTRREVAVGAALGAAAAALFRSMSE"
FT   gene            490147..490272
FT                   /locus_tag="Xfasm12_0445"
FT   CDS_pept        490147..490272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0445"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF1100 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11456"
FT                   /protein_id="ACA11456.1"
FT                   /translation="MMLFNGMRLDVLLIGLPKVACAKSTFYLDEWRLLRLFYSIF"
FT   gene            490618..490827
FT                   /locus_tag="Xfasm12_0446"
FT   CDS_pept        490618..490827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0446"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xfa:XF1101 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11457"
FT                   /protein_id="ACA11457.1"
FT                   /translation="MFGIGLYVVSVYIFTFSMSFMMRWLFYAKSLYVCESKDLNIQLQS
FT                   NIFGDVPCVQRIVIVVSMYKGNVS"
FT   gene            complement(491105..491398)
FT                   /locus_tag="Xfasm12_0447"
FT   CDS_pept        complement(491105..491398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0447"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0395 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11458"
FT                   /protein_id="ACA11458.1"
FT                   /translation="MKHAPLILLSLLIFSGCSTKGDIHADAPLKLHGAVITTKIMGNGD
FT                   RVDEFRVSGQLRMVKITPKHAPAYYLYDRNGDGHLDGDRNIVSPVYWNIYSW"
FT   sig_peptide     complement(491336..491398)
FT                   /locus_tag="Xfasm12_0447"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.942) with cleavage site probability 0.703 at
FT                   residue 21"
FT   gene            491483..494254
FT                   /locus_tag="Xfasm12_0448"
FT   CDS_pept        491483..494254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0448"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: xft:PD0396 DNA polymerase I"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11459"
FT                   /protein_id="ACA11459.1"
FT                   /translation="MSKLVLIDGSSYLYRAFHALPPLSNAAGEPTGALFGVVNMLRTTL
FT                   KERPDYAAFVIDAPGKTFRDALDSEYKMHRPPMPDDLRMQVEPMCGIVHALGIDILCIH
FT                   GVEADDVIGTLALAAVADGIAVTISTGDKDFAQLVRPGVELVNTMTGSRMDSAMAVINK
FT                   FGVAPDQIIDFLALMGDSVDNVPGVDKCGPKTAAKWLAEYGSLDAVIANADKIKGKIGD
FT                   NLRVVLPRLLLNRALITIKTDVVLEKRPQDLALRERDTEALRDFYQRYGFTQALKELDG
FT                   GSVAVTVAEQEPGRGRDAGFHVAPDASVAMEINPALSAPGEYETIFTVEQLQDWIVRLR
FT                   VAGQFALDTETDSLDPMQAVLIGLSFASEVGCAAYLPFGHDYPGAPVQLDRGQALALLQ
FT                   PLLEDAAVRKVGQHGKYDMHVLRRYGIVLAGYADDTLLESFVLTSGHARHDMDTLARRH
FT                   LGYETMKYVDLVGKGAKQIPFSHVGVQEATQYAAEDADITLRLHCVLAPKLLAEPILER
FT                   VYREIEMPLVAVLERIEANGVQIDAEELYKQSADLSRRMVIAQQKAMDLAGRHFNLDSP
FT                   KQLQVLLFDELKLPVVVKTPKGQPSTNEEALEAIVDQHALPRVILEYRSLAKLRNTYTE
FT                   KLPEMIHPHTGRVHTNYHQAGAATGRLSSSDPNLQNIPIRTDDGRRIRRAFVAPSGRKL
FT                   IACDYSQIELRIMAHLSGDAGLVDAFESGVDVHCAIAAEVFGRGIDEVTPNERRAAKAI
FT                   NFGLIYGMSAFGLARQLGISRGEAQDYIALYFDRFSGVRDFMENTRQQARDRGYVETVF
FT                   GRRLYLNSIASGNQTQRAGAERAAINAPMQGTAADIIKRAMVAVDGWLGVGGHRERALM
FT                   ILQVHDELVFEADEGFVPTLVHEVSARMAAAAQLRVPLVVDVGVGHHWDEAH"
FT   gene            complement(494587..494835)
FT                   /locus_tag="Xfasm12_0449"
FT   CDS_pept        complement(494587..494835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0449"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF1104 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11460"
FT                   /protein_id="ACA11460.1"
FT                   /translation="MRIKSPDGLPHHAIPTITCKPTAETRTFLASAKTTEKSHQHSLAL
FT                   QQKPPMKLTTHQKRHQSNDDATQHAHNTIKPETLQGQ"
FT   gene            494911..495624
FT                   /locus_tag="Xfasm12_0450"
FT   CDS_pept        494911..495624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0450"
FT                   /product="Dihydrodipicolinate reductase"
FT                   /EC_number="1.3.1.26"
FT                   /note="KEGG: xft:PD0397 dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11461"
FT                   /db_xref="GOA:B0U565"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U565"
FT                   /protein_id="ACA11461.1"
FT                   /translation="MDSFLRLLIHGASGRMGQSLLRLASEDPSFQVTAAVVGNAPHRHV
FT                   SDGVPFFAAAELAAVPAFDVAIDFSLPQGFSSLLALCVARAVPLVSGTTGLDSRQHEAL
FT                   VMAGARIPLVWGSNFSVGMAALVNLVERAGDALSGWDCDIVESHHVHKQDAPSGSALTL
FT                   GEAVACKGIAPRYTSLRAGDIVGDHLVQFTGLGERIELVHRATNRDVFARGALCVARRV
FT                   VGRVPGCYRVRDLIM"
FT   gene            495747..496946
FT                   /locus_tag="Xfasm12_0451"
FT   CDS_pept        495747..496946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0451"
FT                   /product="carbamoyl-phosphate synthase small chain"
FT                   /note="KEGG: xfa:XF1106 carbamoyl-phosphate synthase small
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11462"
FT                   /protein_id="ACA11462.1"
FT                   /translation="MFELSCNLISGGGIGVPGSQSETPPVTEPAILVLEDGTVFEGDAV
FT                   GANGLSVGEVVFNTALTGYQEILTDPSYAYQLVTLTYPHIGNTGCTDQDDEANKVWAAG
FT                   LIVRDVPRRPSNWRSQISLSDWLAARGVVAIAGIDTRKLTRILREKGAQHGALMAGEID
FT                   VGKAQDAARQFAGIKGMDLAKVVSTKQGYSWYEGQLDLDRNEFKRAAPQYEVVAYDYGV
FT                   KLNILRMLAERGCDLTVVPAQTPADEVLALCPDGVFLSNGPGDPEPCDYAVAAIKTFIM
FT                   RRVPIFGICLGHQLLAQAVGARVVKMSHGHHGANHPVQDLRSGRVMITSQNHGFAVDEA
FT                   TLPNNVRVTHRSLFDGTNQGIELLDVPAFSFQGHPEASPGPHDVDVLFDRFITMMAAQS
FT                   "
FT   gene            497145..500387
FT                   /locus_tag="Xfasm12_0452"
FT   CDS_pept        497145..500387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0452"
FT                   /product="carbamoyl-phosphate synthase large chain"
FT                   /note="KEGG: xft:PD0399 carbamoyl-phosphate synthase large
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11463"
FT                   /protein_id="ACA11463.1"
FT                   /translation="MPKRTDLRTILIIGAGPIVIGQACEFDYSGAQACKALRAEGFRVV
FT                   LVNSNPATIMTDPDMADAVYIEPIHWRTVEKIITKEKPDALLPTMGGQTALNCALDLAD
FT                   HGVLEKYGVELIGAKREAIRMAEDRELFRVAMQEIGLECPKAEVAKSLERALEIQAKVG
FT                   FPTIIRPSFTLGGTGGGIAYNRQEFEEIIKRGLELSPVHEVLVEESVLGWKEFEMEVVR
FT                   DASDNCIIVCSIENLDPMGVHTGDSITVAPAQTLSDKEYQRLRDASIAVLRKIGVDTGG
FT                   SNVQFGIDPQTGRVVVIEMNPRVSRSSALASKATGFPIAKIAAKLAVGYTLDELKNEIT
FT                   GGKTPASFEPSIDYVVTKIPRFAFEKFPQADARLTTQMKSVGEVMAMGRTFAESLQKAV
FT                   RGLETGKVGLEPTGLDLSSEDDLVVLKRELKAPGAERLFYVADAFRAGFAVADVYALSY
FT                   IDPWFLDQIEEIVAAEGRLVTDGLGSIDGARLRQLKRIGFSDARIAQLTGTNEVAVRTL
FT                   RRVLKVKPVYKRVDSCAGEFATGTAYLYSTYEEECEAAPSDRRKIMILGGGPNRIGQGI
FT                   EFDYCCVHAALALREDGFETIMVNCNPETVSTDYDTSDRLYFEPLTLEDVLEIVEVEHP
FT                   VGVIVQYGGQTPLKLAKALEANGVPVIGTSPESIDLAEDRERFQRLVQQLGLRQPPNCT
FT                   ARTADEALVLAREIGYPLVVRPSYVLGGRAMEIVYSEADLARYVRDAVKVSNDSPVLLD
FT                   RFLDNAVEVDVDIIADPEGQVLIGGVMEHIEEAGVHSGDSSCSLPPYSLSAATQDDLRR
FT                   QVIRLAQALNVIGLMNTQFAIQSNDDGSDIVYLLEVNPRASRTVPFVSKATGVPLAKIA
FT                   ARCMTGKTLAEQSVTCEVVPAYYAVKEAIFPFAKLQGVDPILGPEMRSTGEVMGVGRSF
FT                   AAAFARAQEAGDIRAPQPGRAFVSVRDPDKKRVLPVVLALVERGFGVVATAGTYAWLQQ
FT                   NGVACEVVNKVAEGRPHIVDLIKNGEIVYIINTTEGRAAIADSFSIRREALQHCVTYST
FT                   TIAGAKALVNSLEFRGTGPVWSLQELHKELQV"
FT   gene            500384..500860
FT                   /locus_tag="Xfasm12_0453"
FT   CDS_pept        500384..500860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0453"
FT                   /product="GreA/GreB family elongation factor"
FT                   /note="KEGG: xft:PD0400 transcriptional elongation factor"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11464"
FT                   /db_xref="GOA:B0U568"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U568"
FT                   /protein_id="ACA11464.1"
FT                   /translation="MRPPMTLKGVRRLRDELEHLKLVKRPEIINAIAEARAHGDLKENA
FT                   EYHAAREQQSFIEGRIKQLEGELSHAEVIDVAKLNAGTKIVFGATVTLADLGTDEESRY
FT                   QIVGDLEADIKQGLVAISSPVARALIGKQEGDTIVIEAPAGRREYEVVAVEYIS"
FT   gene            500868..501788
FT                   /locus_tag="Xfasm12_0454"
FT   CDS_pept        500868..501788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0454"
FT                   /product="regulatory protein"
FT                   /note="KEGG: xft:PD0401 regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11465"
FT                   /protein_id="ACA11465.1"
FT                   /translation="MSSVTLLLPERHCLLGTLRGDVVVRALARADRITGGCGERAQLGR
FT                   HFELVPASWPVAALTRQIDVGDAAGAAWVRADPAYVVPDMGAARLVACGEMLALDAKDQ
FT                   AALLPELQTLFSEAGLLLDAPTPARWYVQLTPEACLPAFSAPEDVLGDDLFNHLPDGDT
FT                   GRRWRALLTEVQVLLHQHAWNVERVARGKQMINSLWFWGAGVLPHTVMTPHRQVRSRDV
FT                   LLHALAKASGSDTDSLHMVDALVDLRHLCSLTQFSDEVVAPLLAAMGRGELKQLVLDFR
FT                   DGEIFTMTRAHRWRFWCGVRTQLAD"
FT   gene            501791..503599
FT                   /locus_tag="Xfasm12_0455"
FT   CDS_pept        501791..503599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0455"
FT                   /product="single-stranded DNA exonuclease"
FT                   /note="KEGG: xft:PD0402 single-stranded DNA exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11466"
FT                   /protein_id="ACA11466.1"
FT                   /translation="MPKIIRRLSLPLVVWPDNVPPLLRRVYTARGCADPVTAQPCLAQL
FT                   LSPAMLSNMQAATVLLTEVIKANGRILVVGDFDCDGATACAVAVRGLRLLGARNVMHAV
FT                   PNRMVHGYGLSSALVEELAPLQPALLVTVDHGIACHAGIAAAKARGWKVLVTDHHLPGE
FT                   ILPPADVIVNPNLPGDLFPSKTLAGVGVIFYVLLALRARLYPAARAACEGQETRIHSSI
FT                   SQKNRPDLTSLLDLVAVGTVADLVPLDTNNRALVAAGLRRLRRGQGCLGLRALIEVSGR
FT                   DESQLTATDIGFALSPRLNAAGRLEDMALGIELLLTEDWTRARAIAAMLEEINVVRRVV
FT                   QQGMSDDAEQAVAQAMAQSGGVLPMAVCLFDPDWHPGVIGLVASKMKDKMHRPVVALAP
FT                   AEPGGTVLRGSARSIPGLHIRDVLVALDSGYPGMIQKFGGHAMAAGLTLDAEVLPVFER
FT                   VFRAQVEMMVDKNVLQAELYSDGELAADELDALHARALRLGGPWGQGFPEPLFDGEFEV
FT                   LQWRVLKERHLKMEVRYSGRYDALNAIYFNGWQGDPPARRLRLAYRLVCDDYRGGDAIQ
FT                   LIVEYAEVIECDVSGSQAISSGLLDP"
FT   gene            504376..505392
FT                   /locus_tag="Xfasm12_0456"
FT   CDS_pept        504376..505392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0456"
FT                   /product="peptide chain release factor RF-2"
FT                   /note="KEGG: xfa:XF1111 peptide chain release factor RF-2"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11467"
FT                   /protein_id="ACA11467.1"
FT                   /translation="MTRELESPTIWNTPDYAQQLGRERSLLDKTVTGIAHVLNGVAEAS
FT                   EFLDLAEIEQDQEMLQAVLNDVDIYQLQVEKLEFQRMFSGKMDGANAFVDIQAGAGGTE
FT                   AQDWAEMLLRMYLRWAEGRGWKAELLEVSGGEVAGIKSATFRVEGDFAYGWLKTETGVH
FT                   RLVRKSPFDSDNRRHTSFTSVFVSPEVDDNIDIEINPADLKTDVYRSSGAGGQHVNKTE
FT                   SAVRITHVPSGIVVACQTERSQHANRDRAMKMLAAKLYESEIQKRNAEKDVLEASKSDI
FT                   GWGSQIRNYVLDQSRIKDLRTGVERSDTQKVLDGDLDEFIEASLKAGLEAGAKRADA"
FT   gene            505575..507095
FT                   /locus_tag="Xfasm12_0457"
FT   CDS_pept        505575..507095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0457"
FT                   /product="lysyl-tRNA synthetase"
FT                   /note="KEGG: xft:PD0404 lysyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11468"
FT                   /db_xref="GOA:B0U572"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U572"
FT                   /protein_id="ACA11468.1"
FT                   /translation="MTEHLPASQVSFDENALIAERRAKLLALRAQGVVYPNDVKREHYA
FT                   ADVQAAFANVETWTAETLEASSHRVRMAGRLMAKRLMGKASFAQIQDESGRIQLLIQSN
FT                   VLGEDSYAAFKVLDVGDIIAVEGGLTRTRTGELSVKVNVLRLLTKALRPLPDKWHGLTD
FT                   VEQRYRQRYVDLIVTPESREIFIKRSKIIRALRTWLDARLFLEVETPMMHYIPGGAAAK
FT                   PFVTYHNALDLELYLRVAPELYLKRLVVGGLERVYEINRNFRNEGVSTRHNPEFTMLEL
FT                   YEAYSTYHEVMDLAETMIRDTAQSVLGTTQVIWDGAQIDLGPIFRRWRMDEAVCHHNPE
FT                   ISVAECTDRDALLLHCERLKIKVKSSYGWGRLLLSIFEATVEHTLIQPTFITDHPVEIS
FT                   PLARESDIESGYTDRFELFINGKEIANGFSELNDPEEQAMRFQKQVEAKEGGDDEAMYY
FT                   DADYIRALEYGMAPTGGLGIGVDRLVMLLTGSTSIRDVLLFPYMRPER"
FT   gene            507233..508387
FT                   /locus_tag="Xfasm12_0458"
FT   CDS_pept        507233..508387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0458"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: xft:PD0405 response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11469"
FT                   /protein_id="ACA11469.1"
FT                   /translation="MHDVFAMQSGELSSLQHLNSYDVAHVGLNIVIVDDQMSARTMLRH
FT                   VIEDIAPHLQVFDFGDPSEALAWCEVSQVDLLLLDYRMPDMDGLEFALRLHQLPNRRDI
FT                   PILLITIVGDEPIRQAALDAGVIDFLIKPIRPRELRARCNNLLQLRQHSERAKQRVLSL
FT                   EQRLRAVMSEFEERERETVSRLARAVEYRHISSSTYLERMSQVAGLIAEQLGLSEEEVR
FT                   LIQSAAPLHDIGKIAIPDAVLLKRSTLNEEEMAMMRRHPRIGCELLSGSQNRCIQLGAL
FT                   IALRHHERYDGSGYPDGLVGEAIPLEARIVALADVFDALISLRPYKQAWTMEAAITYLY
FT                   AQRGRLFDPHCVDALIRGRDQLQRICVKFSTALARPGVWDAKES"
FT   gene            508371..510524
FT                   /locus_tag="Xfasm12_0459"
FT   CDS_pept        508371..510524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0459"
FT                   /product="regulator of pathogenicity factors"
FT                   /note="KEGG: xft:PD0406 regulator of pathogenicity factors"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11470"
FT                   /protein_id="ACA11470.1"
FT                   /translation="MLKKAKWICSRLSQRPDSEHVQNLIRFLIASLFIIYLSVCWHGET
FT                   DLNISRIIWLVLLSDLGVSLALMLAIVMHPQISHVRRCIGIIADYTSLTVLMLLMGEAG
FT                   SPLYVLCLWVTIGNGLRYGSAYLLVTTTLGALSFLTVILVSAYWKSNPFLAWGLLIGLI
FT                   AIPLYFQSLLKVLIRALRDARQANEAKSRFLANMSHEFRTPLNGLSGMTEVLATTRLDA
FT                   EQRECLKAIQASVHSVLSLIEEVLDISRIEAGKIRILHDTFSLQEVIGSVGLILQPQIR
FT                   NKALEYRVDVGLDVPEWLFGDAGYVRQVLLNIVGNAVKFTERGGITLCVSVLNRSRQHS
FT                   VVLRFEVADTGIGVPLGMRNRLFDVFEQADVGLDRRYQGSGLGTTIAKGLIELMGGSIG
FT                   FEENVPCGSLFWFELPFELAKEQVVAQEVSEASQCTEPSNVIAFSNPFLRHRARVKSMR
FT                   VLVADDHETNRMVLSRILDKAGHKLLCVDGAEAVLDCLISMEFDVVIIDLHMPGMSGLD
FT                   MLKQLRVMQSSSLPYTPVLVLSADATSDSIRCCEEAGARAFLSKPVLATKLLDVLAEIA
FT                   EGDGGALPYAALSQSSVQQHQVFDPAGLDDLAELNMDDDFEERFIVQSFRDAEHCQQTM
FT                   LSAAETNQWHEVREEAHALRGVLGHLGLMRASSLAAELMRIPDWQLQLEWCDRVQMLDE
FT                   ALLCGRDALEARRQERRRSGVLR"
FT   gene            complement(510547..511419)
FT                   /locus_tag="Xfasm12_0460"
FT   CDS_pept        complement(510547..511419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0460"
FT                   /product="enoyl-CoA hydratase"
FT                   /note="KEGG: xft:PD0407 enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11471"
FT                   /protein_id="ACA11471.1"
FT                   /translation="MSAVHPIPHPICESSIRIIEETHRNVYWIYMHAHLARTTGAAYFS
FT                   LKLIDDIMNYQSVLRQQLKEQTVQLPFVVLASDSNVFNLGGDLQLFCDLIRRKEREALL
FT                   DYACRCVRGAYAFHAGLNANVHSIALLQGNALGGGFEAALCCHTIVAEEGVMMGFPEVL
FT                   FDLFPGMGAYSFMRQRISPKLAERLILEGNLYSSEELLAIGLIDKVVPRGKGIEAVEQI
FT                   IRDSRRTQYTWAAMQQVKRIADEVSLEEMIRIAELWVDSALKLSNKSLRTMERLIRAQQ
FT                   THKNTALKN"
FT   gene            511699..514305
FT                   /locus_tag="Xfasm12_0461"
FT   CDS_pept        511699..514305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0461"
FT                   /product="aspartate kinase / diaminopimelate decarboxylase"
FT                   /note="KEGG: xft:PD0408 aspartate kinase / diaminopimelate
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11472"
FT                   /protein_id="ACA11472.1"
FT                   /translation="MSASPTVERWIVLKFGGTSVSRRHRWDTIAMVVRKRLEEHGTRVL
FT                   IVVSALSGVTNELTAIAQGVVDSAQRVAALEQRHRDFLAELGLDAQAVLGTRFAMLSDL
FT                   LQDARAVTRSLDWQAELLGQGELLSSTLGAAYLGASGVDIGWMDARDWLTALPPQPNQS
FT                   EWSQRLSVSCQWKSDVEWRTRFDAQRAQVLITQGFISRHQDGGTAILGRGGSDTSAAYF
FT                   GALLGAACVEIWTDVPGMFSANPKEVPDARLLTRLDYYEAQEIATTGAKVLHPRSIKPC
FT                   RDTDVPMLILDTERPDVLGTRIDAEVEPVLGVKAISRRDGIVLVSMEGIGMWQQVGFLA
FT                   DVFTLFKKHGLSVDLIGSAETNVTVSLDPSENLVNTDVLTALSTDLSQICKVKIIVPCA
FT                   AITLVGRGMRSLLHKLSEVWATFGKERVHMISQSSNDLNLTFVIDETDADGLLAVLHFK
FT                   LIESGAMPVQDRAVFGSPWREIIGHVRTRVMPWWHSARMRLLAMRDEEGIGPCYVYHLP
FT                   TVRERARQLNSVAAVDQRYYAIKANPHPAILRTLIEEGFGLECVSLGELRHVFAVVPHL
FT                   VPSRVLFTPSFASRVEYEQAFLLGVNVTLDNVEALRLWPEVFRDRTLWLRIDLGYGDGH
FT                   HEKVTTGGKTSKFGLSVKRIDEFIDVAKTLNITVTGLHAHLGSGVERGNHWSRMYDELA
FT                   GFASRIGSVSTLDIGGGLPIPYRPDDEPFDVGAWGASLAEVKALHPKFQLVIEPGRFLV
FT                   AEAGVLLTRVTQVIEKDDILRVGLEAGMHTLIRPALYDAWHGVENLSRLDETPHVLCDV
FT                   VGPICESSDVFGRRRRLPAATASGDLMLIADAGAYGFSMASTYNLRGLPAEVVLDA"
FT   gene            514309..515757
FT                   /locus_tag="Xfasm12_0462"
FT   CDS_pept        514309..515757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0462"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0409 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11473"
FT                   /protein_id="ACA11473.1"
FT                   /translation="MLWSGCNDNHAGCASCYMGTVDLSVQGVFMTSTFDTSQISAFRFV
FT                   RCTLDAQTGVVSLVYAFDQGPEFVEKIMVPGAPFALEGQRAEAVRQALRLLHLIAGVSY
FT                   YKAIVPSTVTMDDDSIDAETAALVEEVYLYGLSEFAYRNGLNLHGRFQLPVQATGAMAP
FT                   APQLGLREHALVAIGGGKDSLVSIEALRVAGMQQTVVWIGASQLIRACAERSELQMLNV
FT                   GRTLAPELFALNRKGAWNGHIPVTAINSAILVLVALLHGVDQVVFSNERSASYGSVIPG
FT                   TGEVNHQWSKSWAFEQHFSDYVQRRVAADLRYYSLLRPLSELAVARQFAHCARYDAYFS
FT                   SCNRNFHILGERPAHRWCGQCPKCHFVFLALAPFMPKTRLVGIFGRNLLDDASQASGFD
FT                   ALLEWQDYKPFECVGEARESRTALAVLATRAEWKEDALVMRFIREIQPHLDPAQLQLDP
FT                   LLTLSDEHRIPASLWESMSAHFRT"
FT   gene            515738..517144
FT                   /locus_tag="Xfasm12_0463"
FT   CDS_pept        515738..517144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0463"
FT                   /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
FT                   /note="KEGG: xft:PD0410
FT                   UDP-N-acetylmuramoylalanine--D-glutamate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11474"
FT                   /protein_id="ACA11474.1"
FT                   /translation="MRISALEGCRVALWGWGRESRAAYRAFRAAFPKQSLTLFCTIAEA
FT                   TEVQALTDPVLSIETEVSVPRLAAFDVVIKSPGISPYSPLAVAATAAGAHFIGGTQLWF
FT                   AAHADTDGVVPGAVCVTGTKGKSTTTALLAHLLRAAGHCTALTGNIGLPLLELLTPQPA
FT                   PEYWAIELSSYQTADVAGSGARPALALVLNVFPEHLDWHGGEQRYINDKLSLVTVARPL
FT                   IALLNAADPRLASLVLPQSDLRWFNRRDGWHVRGQVVYRGEQAVLDTALIPLPGAHNGS
FT                   NVCAVLATLEALGLNAVALAPAACNFRPLPNRLQFLGERDGILWVNDSISTTPHATLAA
FT                   LDCFLGRRRVAVLVGGYDRGVNWECFAARITRKVPLDIVTMGANGPHIKALLAPLAAGR
FT                   FGLHAAVDLPHAVALARTALGAQGGVLLLSPGAPSFGAYQDYVERGRHFAILAGFDPEV
FT                   ISSISGLGIA"
FT   gene            complement(517421..517505)
FT                   /locus_tag="Xfasm12_R0024"
FT                   /note="tRNA-Leu4"
FT   tRNA            complement(517421..517505)
FT                   /locus_tag="Xfasm12_R0024"
FT                   /product="tRNA-Leu"
FT   gene            complement(517828..518109)
FT                   /pseudo
FT                   /locus_tag="Xfasm12_0464"
FT   gene            518151..519113
FT                   /locus_tag="Xfasm12_0465"
FT   CDS_pept        518151..519113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0465"
FT                   /product="DGTP-pyrophosphohydrolase / thiamine phosphate
FT                   synthase"
FT                   /note="KEGG: xft:PD0412 DGTP-pyrophosphohydrolase /
FT                   thiamine phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11475"
FT                   /protein_id="ACA11475.1"
FT                   /translation="MTDSLRSIHVVAAVIVDVRGRLLLSRRTENSDMPGLWEFPGGKRE
FT                   SGETSEQALARELYEELGISADVGEWLMEVPQLYPGKRLRLEVRRVRAWKGGLRGREGQ
FT                   ALTWVEPDKLLRYSMPPADQPVVGMLRQPAHYLVTPEPGEKDAEWLDAVEHAYRLGIER
FT                   IQLRMRQHDPARWSGLVREAVQRRGRAHVEVLLNRDIALAEALGIGVHLGAKQLAVLYA
FT                   RPLPVGLPVGASCHCLADLCHAQRIGCDFAVLGPVLPTESHPGAVTLGWEGFEQLREQV
FT                   ALPIYAIGGMCADQVKEARRHGAQGIAAMRGLWPGGAKQ"
FT   gene            complement(519167..519994)
FT                   /locus_tag="Xfasm12_0466"
FT   CDS_pept        complement(519167..519994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0466"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /EC_number="1.5.1.20"
FT                   /note="KEGG: xft:PD0413 5,10-methylenetetrahydrofolate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11476"
FT                   /protein_id="ACA11476.1"
FT                   /translation="MIPISFEFYPPKNDDQRAQLDRTANRLRAFAPEYVSCTFGAGGST
FT                   LSYTSETVRHLSQHHGFDAAPHLSCVGGSRQEIRELLKLYRAIGCQRIVALRGDLPSGM
FT                   GHPGDLRYAADLITFIRTEHGDHFHLEIGAYPETHPQASNTLNDLHYFKAKADAGADAA
FT                   ITQYFYNPDAYFHFVDAVQRLGVTIPIVAGVMPISNFDQLRHFSEQCGAEIPRWITKKM
FT                   QAYGDDTKSIRAFGADVVTALCERLIAGGAPGLHFYTLNLAKPSTQVLQRLGY"
FT   gene            520312..520416
FT                   /locus_tag="Xfasm12_0467"
FT   CDS_pept        520312..520416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0467"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF1122 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11477"
FT                   /protein_id="ACA11477.1"
FT                   /translation="MVTADVLFSFVNESGYFSEQGTAKHILFSNEETC"
FT   gene            complement(520485..521213)
FT                   /locus_tag="Xfasm12_0468"
FT   CDS_pept        complement(520485..521213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0468"
FT                   /product="outer membrane protein"
FT                   /note="KEGG: xfa:XF1123 outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11478"
FT                   /protein_id="ACA11478.1"
FT                   /translation="MRIALPPVLIALSLFTGLATRAHAHDSSSCNLPNDATLLSISTEG
FT                   ESKRTPDTANLSASVFTKDPSSNTAMSQNAERMSRVMAGIKAAGIPNKDVQTSSISLYP
FT                   QYVYQEKLGQKLTGYQASNTINIKVRDLTKLGKIIDILTTNGVSQLNGPSFEIDQIESA
FT                   YDEARLSALQKAQAQAKSYADRLGLKVRRVIDISESRGGDSRPMKVMFTRAMKDNTETP
FT                   ISLGENSIGVSLNIKFELGK"
FT   sig_peptide     complement(521139..521213)
FT                   /locus_tag="Xfasm12_0468"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            521302..521901
FT                   /locus_tag="Xfasm12_0469"
FT   CDS_pept        521302..521901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0469"
FT                   /product="putative septum formation protein"
FT                   /note="KEGG: xfa:XF1124 putative septum formation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11479"
FT                   /protein_id="ACA11479.1"
FT                   /translation="MVCARVILPRMLYLASRSLCRRQLLQRLDIPFQVIDLEIPEVRRE
FT                   DELPQDYVRRVAQEKAQVGLARVRDAFAPKVLGADTEVVLDGRVFGKPADLVEAAAMLA
FT                   ALSGRTHQVMTAVSLVAAGGVAAQVLVVSEVSFALLSQGQIARYVDSGEPMGKAGAYAI
FT                   QGRGECFVSRLVGSYSGVMGLPLQQTAQLLATFEES"
FT   gene            521902..523395
FT                   /locus_tag="Xfasm12_0470"
FT   CDS_pept        521902..523395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0470"
FT                   /product="ribonuclease G (cytoplasmic axial filament
FT                   protein)"
FT                   /note="KEGG: xfa:XF1125 ribonuclease G (cytoplasmic axial
FT                   filament protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11480"
FT                   /protein_id="ACA11480.1"
FT                   /translation="MSEEILVNVTFGETRVAVVENGLLQELHIERDGCRGVVGNIYKGR
FT                   VQRVMPGMQAAFVDVGMERTAFLHVNDVVRSAPADSSVIDTDETTVPPLSEIPIVELLR
FT                   DGQELMVQVLKEPIGTKGARLTTQISIPSRYLVLLPQSKMVGVSLRIEDEAERARLKAV
FT                   VTDLAAQYGDYGYIVRTNAEGQSADVLVEDIAYLSRLWGVVERRGRELPVCSLLYEDLS
FT                   LSLRSVRDLIRKDVEKIKVDSKEAFAQLQGFVTKYMPVLADKLELYVGDHPIFDLYGVE
FT                   DEIGRALDRQIPLKSGGYLVIEQTEAMTTVDVNTGSFVGKRTLEETVFRTNLEAAQALA
FT                   RQLRLRNLGGIIVIDFIDMQDAEHRCQVLRVLEKALIRDHAKTKVYDFSPLGLVEMTRK
FT                   RTVESLQRQLSETCQECGGRGTIKTAETVTYEIFRDITRAVRQFDAVRLLVIASPNVVS
FT                   RMTDEESAAVAELEAVLGKAIRFQADPHYLQEQYEVVLL"
FT   gene            523507..527367
FT                   /locus_tag="Xfasm12_0471"
FT   CDS_pept        523507..527367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0471"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0417 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11481"
FT                   /protein_id="ACA11481.1"
FT                   /translation="MRPIFSSLLLFKVSSLLRFPRVFRYAAYACVAVFVAVALAMGVVS
FT                   QLLPVVERHPQQVADWLSVRAGQPVRFDTLSTSWTQRGPLLRLQGVRIGPQGKVGIGQV
FT                   EVLVAMYTGLLPGHSLIELRLRGMALTVHRDSAGRWSVYGLPRDVGGDPLEVLRRFGEL
FT                   QVIGGRLSVDAPSSGVSTTLSQINLRVRVAGDRLRAGVHGWLDSARAPVTGVVDFDRVS
FT                   GDGDVYVETLPNQLASWSSLLAGVMRGVHLRDGAGHVRAWAQLHRHHVEQVTVQGDLQG
FT                   VRFEGVRLAGQTVVPRVFWPQLQVLVRWQRQGDGWRVVAPRLRMGESGRLQKLDGVVVE
FT                   GGSFYTVSAPNAVDAGVVMAVLALGDWLAPDLRTWLLRARPQLRVAGLHVSRQADGRFW
FT                   VAGRVEQLGFLPVADAPGLSGVRGTLEGDAQGAVLTLDSDASVHLDWPSGFGRRHEIHL
FT                   AGRIVGWRQGDGWKVATPALRVQAADYAANLRGGLWFEGHGMLPRISLAVQLDDVAVPV
FT                   AKRFWVRSKMSRELIDWLNAALVNGSTSGGFALIEGELKDWPFNNHDGYFEAAGRIHGG
FT                   VMRFQSEWPVLEKLDADIAFIGNGFSIKGRAELAGVPQVQLEAGIEDFEKGDLYVRAHV
FT                   QSDATRLLGLLRRSPLHQHDADTLDSVSASGPTSVSFDMHLPLRHEQGADDGHFWGEVS
FT                   LENVNYIDRRWNLAFENVRGPVRYSSDGFSAEALHVLHQGLEGRLSVRVGDAVDDPAQI
FT                   FQARLSAAVNVKSLLRHAPQMDWLRPYVNGISQWRIGVDLAKSVPDAHGVLGHLTLDSD
FT                   LVGTALNLPAPLDKGSGRVLPAHINVALPMEQGDIALALGKLVAARVRHRDGGGVGVRV
FT                   VMGSDSVREAPLEHGLVVIGHSTSLDAIDWMRLVRGGSAVSSDLPLRLIDLQVDSLLLL
FT                   GGMFPNTRFQLRPVHQGVAVVVDGPALSGQLSIPESTDGTVTGTLGVLHWQAAQAPSVK
FT                   VSGSVQSAMADVDPASIPSLAFEVEDARLGQVKLGRVGLRTRRLSDGMQVDQLQTNSPS
FT                   QRLSMFATWRGKGEASIIRLSARVDSRDLGELAQAIGYGEQLRGGEGQIQLSAGWNGPP
FT                   VGFQLPSLSGDLKVNARNGQLLELKPGAGRVLGLLSVTQLPRRLMLDFRDLFSKGLAFN
FT                   RFYGEVHFGDGKAHTDRLKIEGPAVNIAIRGQSDLSTQTFDQIVDVNPKSGNLLTVVGA
FT                   VAGGPVGAAVGAAANMVLGKSLGAIGAKTYHVSGPWNDPKVQVMNLDSRQRDKPSNSKS
FT                   EN"
FT   sig_peptide     523507..523629
FT                   /locus_tag="Xfasm12_0471"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.752 at
FT                   residue 41"
FT   gene            527492..528949
FT                   /locus_tag="Xfasm12_0472"
FT   CDS_pept        527492..528949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0472"
FT                   /product="TldD protein"
FT                   /note="KEGG: xft:PD0418 TldD protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11482"
FT                   /protein_id="ACA11482.1"
FT                   /translation="MKNTALSVAESRLLLPAGLDDGQIDSIFGTLLGPGVDFGDLYFQH
FT                   ARRESWSIEDGIVKDGTHSIEQGVGVRAISGEKTGFAYSDDINRDALLEAAYAARAISR
FT                   SPGDGVQGTHAVLRRHGRELCLYPALDPVGGMDNAEKIAVMRRVDQLLRAADPRVTQVM
FT                   INLSGGVDVVLIARSDGVLAADVRPLVRLNVQVIVEGHGRRESGYAGGGGRYGYAELFA
FT                   DGRPEAFAREALRQALVNLEAIPAPAGVMPVVLGAGWPGVLLHEAVGHGLEGDFNRKAT
FT                   SVYAGRIGERVASPGVTIVDDGTLDGRRGSLNIDDEGTPTQCTTLIEDGVLVGYMQDTL
FT                   NARLMGVASTGNGRRESFAHLTMPRMTNTYMRAGAHSREEMIRSVKKGLYAVNFGGGQV
FT                   DITSGKYVFSATEAYLIEDGRVTAPIKGATLIGNGPETMQRVRMIGDDLALDAGVGVCG
FT                   KDGQSVPVGVGQPSLLIDGLTVGGTQA"
FT   gene            complement(529444..530013)
FT                   /locus_tag="Xfasm12_0473"
FT   CDS_pept        complement(529444..530013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0473"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0419 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11483"
FT                   /protein_id="ACA11483.1"
FT                   /translation="MWKNGAMRGCNKETGEFLGPSRSQQRRTALEVLVLSEKLAALTPA
FT                   QLAKLPIPERLLPHITETKRITSHIARKRQLAFLAKQMRREDDTTLEAIREKLDASGIQ
FT                   AQREVATLHRTEQWRKRLLEEGDSALTELLNQYPQADCGKLRQLLRNSKTEQARNKAPQ
FT                   AFRELYQVLHGLIITQNSDNQHQTTQ"
FT   gene            530073..531440
FT                   /locus_tag="Xfasm12_0474"
FT   CDS_pept        530073..531440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0474"
FT                   /product="PmbA protein"
FT                   /note="KEGG: xft:PD0420 PmbA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11484"
FT                   /protein_id="ACA11484.1"
FT                   /translation="MNVCSTDLNSVDDSQVRLDVLADIAQRLLERAHACGATQAEVGCS
FT                   EERGLDVNVRMGDVETVESTCDRSIGVTLYFGQRKGSASTADLQEASLEATVAQACAIA
FT                   RYTEDDPANGLADPVRMATVFPDLDCWHPWTLEAGTAVDLALGCEAAGRAADARIVNSD
FT                   GASVSTRFALSVYANSHGFVGRERMTQHSMSCALIAGQGDGMQRDGWYTNALAREDLEL
FT                   PVAVGRKAAERTVARLQPRSLATTQLPVLFVPEVARSLIGHLLNAVSGGALYRRASFLL
FT                   DSVGTRLFPEWFAINERPHLRRGLRSATFDAEGVATCDAPLVAGGVLQRYVLSSYSARK
FT                   LGLQSTANAGGVHNLEVIANAADLDALVAGLPRGLLVTELMGSGVNPVTGDYSRGAAGF
FT                   WIENGAIAYPVDGLTIAGNLREMFSAIEAVGADVDRRSHVSMGSLLIGRMMVAGND"
FT   gene            complement(531527..532432)
FT                   /locus_tag="Xfasm12_0475"
FT   CDS_pept        complement(531527..532432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0475"
FT                   /product="transcriptional regulator (LysR family)"
FT                   /note="KEGG: xfa:XF1132 transcriptional regulator (LysR
FT                   family)"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11485"
FT                   /protein_id="ACA11485.1"
FT                   /translation="MQNMFDGVQLFVEVVEAGSFAKAGERLSLTRSTIGKAIARLEMRL
FT                   GVQLFQRTTRVQSLTEDGQQYYERCLRAIKELRAGEAMLEQGRREVAGRLHVSLPVLFG
FT                   RHCVAPILRTYAREHPQLELELNFSDHHVDLIADGFDLAVRNGPLGNGTTLRARRLGNQ
FT                   RKILCASPTYLAARGKPHTLADLADHDLLTYWRNDRKMAWTLPDATGALVDIPVTSRLR
FT                   CNDLEVIADTAVDGMGVAWLPYWLLMERMQRGELIGIWGDRPSAVMECHVVWPAAQHVP
FT                   LRSRLAINLLAAELPKYLEA"
FT   gene            532658..533227
FT                   /locus_tag="Xfasm12_0476"
FT   CDS_pept        532658..533227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0476"
FT                   /product="tryptophan repressor binding protein"
FT                   /note="KEGG: xft:PD0422 tryptophan repressor binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11486"
FT                   /protein_id="ACA11486.1"
FT                   /translation="MLISIVYDSGYGHTARVAQAVAAGVQEMKGADVRLMAVADGSVDW
FT                   ETLEKSDAIIFGSPTYNGLISAKFKQFFEDSTKKAWVSQKWRNKIAAGFTNSGAQHGDK
FT                   LNSLMSMVLFAAQHGMIWVGLDLMPGNNSSTGSPDDLNRLGSWLGVMTQSNNDEAPEIA
FT                   PPASDLKTAQHLGLRVAETVRRFQPV"
FT   gene            533260..533559
FT                   /locus_tag="Xfasm12_0477"
FT   CDS_pept        533260..533559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0477"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2750 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11487"
FT                   /protein_id="ACA11487.1"
FT                   /translation="MKLLCLDAPQPGASLEKYQPYMLDEVRHGWQMYKSDIIRDIYFRQ
FT                   DRPGVVIIVEAESVDAARKALSKFPLAEAGLIGWDVIPLGPFVNWEALFASGNA"
FT   gene            533645..534703
FT                   /locus_tag="Xfasm12_0478"
FT   CDS_pept        533645..534703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0478"
FT                   /product="NADP-alcohol dehydrogenase"
FT                   /note="KEGG: xfa:XF1136 NADP-alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11488"
FT                   /protein_id="ACA11488.1"
FT                   /translation="MNVMGFAALSATGPLEQFAFGRRAPRPDDVVIDILYCGVCHTDLH
FT                   LARNHGGFTTYPIVPGHEIIGCVREIGKTVTRFKRGDLVGVGCMVDSCQHCQPCLKGWE
FT                   QDCIEGSIFTYNSTDRRDGSITYGGYSDVIVVRDKFVLSLPDGLDPAGAAPLLCAGITT
FT                   WSPLRRWNVGKDSKVAVVGLGGLGHMALKLAKALGADVTLFTRSSGKEGDAFRLGADRV
FT                   VLSSDLEQMKAVYSRFDVIIDTVPYDHDVNPYMPTLVLEGVLVLVGYLGPLSMPVNAGG
FT                   VVRGRRAISGSFIGGVPETQQMLDFCGQHGIVSDVEIIPIQKINEAYERMLKSDVKYRF
FT                   VIDMTSLTSSGA"
FT   gene            534708..535397
FT                   /locus_tag="Xfasm12_0479"
FT   CDS_pept        534708..535397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0479"
FT                   /product="NonF-related protein"
FT                   /note="KEGG: xfa:XF1137 NonF-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11489"
FT                   /protein_id="ACA11489.1"
FT                   /translation="MTNNIKPILCVVTSHPIRGDSGEPTGFAMVELTHPLEVFEAAGIL
FT                   VEIASIRGGHPPIDFFDLSDPVNDRFWKNKAFRHALAHSFVLGDLDPLRYSAVFFVGGH
FT                   GTMWDFADSLAVQNVIRGIWESDGIVSAVCHGPAALVNATLSDGSYLVAGKKVAAFTDE
FT                   EETEVKYANVVPYLLATTLKQRGALHQSAPNWVENVVVDGRLITGQNPASAYGVGQRVV
FT                   DQLKASI"
FT   gene            535826..536044
FT                   /locus_tag="Xfasm12_0480"
FT   CDS_pept        535826..536044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0480"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF1138 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11490"
FT                   /protein_id="ACA11490.1"
FT                   /translation="MVTLAKRIVALSKADYSVSEIANLLLYTESNVERVLALTYVKRKP
FT                   RGSILLQYFHGNVGALENNVSRFLLMY"
FT   gene            complement(536146..536404)
FT                   /pseudo
FT                   /locus_tag="Xfasm12_0481"
FT   gene            complement(536810..538183)
FT                   /locus_tag="Xfasm12_0482"
FT   CDS_pept        complement(536810..538183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0482"
FT                   /product="Glucosamine-1-phosphate N-acetyltransferase"
FT                   /EC_number="2.3.1.157"
FT                   /note="KEGG: xft:PD0425 glucosamine-1-phosphate
FT                   N-acetyltransferase / UDP-N-acetylglucosamine
FT                   pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11491"
FT                   /db_xref="GOA:B0U595"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U595"
FT                   /protein_id="ACA11491.1"
FT                   /translation="MPLSLPLHIVILAAGEGKRMKSALPKVLHPIAGKPMLAHVITTAR
FT                   ALTPDVIHVVYGHAGNQVRTAFADQTDLHWVEQTQQLGTGHAVKQTMSAIPNAANVLVL
FT                   YGDVPLIRAETLQRLPRASTPIAVLVTDLANPAGYGHIVRNSEGKVAAIIEDKDADEEQ
FT                   RRIHTVNTGILCAESTALRRWLSKLSNTNMQGEYYLTDIFASATADLTPANMIMVTDPR
FT                   EVEGVNDLWQLTQLERTWQIRAARALCLQGARVADPARLDQRGTIRIGQNVHIDIDVVL
FT                   EGEIELGDNVVIGPFVRLKNVKLGPGTKVHAHCDLEGVTTTGSALIGPFARLRPGTMLA
FT                   DGVHIGNFVETKNTSIGADSKANHLTYLGDAQIGTKVNIGAGTITCNYDGVNKSITLIG
FT                   DGAFIGSHSALIAPVSVGAGATLGAGTVLTHDAPAHQLTVARARQTTLDGWQRPKKKT"
FT   gene            complement(538550..539125)
FT                   /locus_tag="Xfasm12_0483"
FT   CDS_pept        complement(538550..539125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0483"
FT                   /product="chorismate mutase"
FT                   /note="KEGG: xft:PD0426 chorismate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11492"
FT                   /protein_id="ACA11492.1"
FT                   /translation="MSLSSLLRHNVHLAAFIISLSLFGYTDQAHSAPSTLTTLLGKVAE
FT                   RNAIGDEVALSKWDTGKPVLDVSRETAVLQSVRDQAPQYRLDPDLAARFFSAQIESNKL
FT                   VQYQLLNRWQLRGKAPNRTRPNLIALRDRLDHLQNELLDALAQSMRLREQNNCTSEIAL
FT                   AAEAYARQLNLDNLHYLALIRSLGDFCH"
FT   sig_peptide     complement(539030..539125)
FT                   /locus_tag="Xfasm12_0483"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.909) with cleavage site probability 0.614 at
FT                   residue 32"
FT   gene            complement(539372..539803)
FT                   /locus_tag="Xfasm12_0484"
FT   CDS_pept        complement(539372..539803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0484"
FT                   /product="ATP synthase epsilon chain"
FT                   /note="KEGG: xft:PD0427 ATP synthase epsilon chain"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11493"
FT                   /protein_id="ACA11493.1"
FT                   /translation="MASMSTIRCDIVSAEQEIFHGEATFVVATGELGELGIAPKHAPLI
FT                   TRLKPGKVVITTVNGEQLDFAISGGILEVQPQVVTILADSAIRADTIDEVAVRKAKEEA
FT                   ERILANRGETIDVAKAQQQLVEAVVQMQALERLRRTVKH"
FT   gene            complement(539873..541273)
FT                   /locus_tag="Xfasm12_0485"
FT   CDS_pept        complement(539873..541273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0485"
FT                   /product="Sodium-transporting two-sector ATPase"
FT                   /EC_number="3.6.3.15"
FT                   /note="KEGG: xfa:XF1143 ATP synthase, beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11494"
FT                   /db_xref="GOA:B0U598"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U598"
FT                   /protein_id="ACA11494.1"
FT                   /translation="MNQGKIVQIIGAIVDVEFPRNNVPKVYNALKIDGTAIILEVQQQL
FT                   GDGIVRTIALGSTDGLKRNLIATDTGHAITVPVGTGTLGRIMDVLGNPIDEAGPITYTD
FT                   QWEIHRNAPSYEDQASTTELLETGIKVIDLMCPFAKGGKVGLFGGAGVGKTVNMMELIN
FT                   NIAKAHSGLSVFAGVGERTREGNDFYHEMKDSNVLDKVAMVYGQMNEPPGNRLRVALTG
FT                   LTIAEYFRDEKDSSGKGKDVLLFIDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMG
FT                   VLQERITSTANGSITSIQAVYVPADDLTDPSPATTFGHLDSTVTLSRSIAALGIYPAVD
FT                   PLDSSSRQMDPLIIGEEHYNTTQRVQQTLQKYKDLKDIIAILGMDELSEDDKLAVSRAR
FT                   KIERFFSQPFHVAEVFTGAPGKYVPLKETIRGFKAIVDGEYDHLPEQAFYMVGNIEEVI
FT                   EKANKMTA"
FT   gene            complement(541356..542219)
FT                   /locus_tag="Xfasm12_0486"
FT   CDS_pept        complement(541356..542219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0486"
FT                   /product="Sodium-transporting two-sector ATPase"
FT                   /EC_number="3.6.3.15"
FT                   /note="KEGG: xfa:XF1144 ATP synthase, gamma chain"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11495"
FT                   /db_xref="GOA:B0U599"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U599"
FT                   /protein_id="ACA11495.1"
FT                   /translation="MASGREIKSKIKSVQNTRKVTRALEMVSASKIRKAQEQMKISRPY
FT                   AQAMKQMIGHLAQANTDYLHPFLIAHKQVKRIGYIVISSDRGLAGGLNNNLFRKILGEM
FT                   RQWQDKGVEVDIVTIGQKASVFFRRIKVNILGSVTHLGDTPRLEQLIGVIKVMLDAYTE
FT                   EKLDRVYLVYNRFINTMVQKASFDQLLPLLAAKDKVAHHDWDYLYEPDAATVLEHVMTR
FT                   YIESLVYQAMLENIASEHAARMVAMKAASDNANKLIGTLQLVYNKARQAAITQEISEIV
FT                   GGAAAV"
FT   gene            complement(542312..543859)
FT                   /locus_tag="Xfasm12_0487"
FT   CDS_pept        complement(542312..543859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0487"
FT                   /product="Sodium-transporting two-sector ATPase"
FT                   /EC_number="3.6.3.15"
FT                   /note="KEGG: xft:PD0430 ATP synthase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11496"
FT                   /db_xref="GOA:B0U5A0"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U5A0"
FT                   /protein_id="ACA11496.1"
FT                   /translation="MATTLNPSEISELIKTRIEQVKLSAESRNEGTVTSVSDGIVRIFG
FT                   LADAMQGEMIELPNKTYALALNLERDSVGAVILGDYKHLREGDVAKTTGRILEVPVGKS
FT                   LLGRVVNALGEPIDGKGTLGPTQTAPVERVAPGVIWRKSVDQPVQTGYKSVDAMIPIGR
FT                   GQRELIIGDRQTGKTAMAIDTVISQKDTGIKCVYVAIGQKASTIANIVRKLEENDALDH
FT                   TIVVAATASESAALQYISAYAGCTMGEYFMDRGEDALIIYDDLSKQAVAYRQISLLLKR
FT                   PPGREAYPGDVFYLHSRLLERAARVSEEYVEKFTQGEVKGKTGSLTALPIIETQAGDVS
FT                   AFVPTNVISITDGQIFLETDLFNAGIRPAVNAGISVSRVGGSAQTKIIKKLSGGIRISL
FT                   AQYRELAAFAQFASDLDETTRKQLERGQRVTELMKQKQYTSMSVANQALSIYAVNEGYL
FT                   DDIPVDKVLTFEEGLHAHFSNTQGALIDKINNSGDWDNNIEAAFKQHIEEFKTTGSW"
FT   gene            complement(543909..544436)
FT                   /locus_tag="Xfasm12_0488"
FT   CDS_pept        complement(543909..544436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0488"
FT                   /product="ATP synthase, delta chain"
FT                   /note="KEGG: xfa:XF1146 ATP synthase, delta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11497"
FT                   /db_xref="GOA:B0U5A1"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U5A1"
FT                   /protein_id="ACA11497.1"
FT                   /translation="MSQALTLARPYARAAFAIACEKGKCMQWSQALTFSAQVANNPIAA
FT                   TLLSHPQLDHEQAAALLSPEGADPAYVRFLEVIAEAHRLDVLLQVAGLYEKLRAEAEHV
FT                   IKAKITSAIELAPNELNNIVTALKKRFDCEIEVTTGVDHSLIGGAVIDTGNVVIDGSIK
FT                   SKLTRLQASLTH"
FT   gene            complement(544440..544973)
FT                   /locus_tag="Xfasm12_0489"
FT   CDS_pept        complement(544440..544973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0489"
FT                   /product="ATP synthase, B chain"
FT                   /note="KEGG: xfa:XF1147 ATP synthase, B chain"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11498"
FT                   /db_xref="GOA:B0U5A2"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U5A2"
FT                   /protein_id="ACA11498.1"
FT                   /translation="MWSHTRFCSVTIIRNKQIESPMDITFTIFAQSIAFAALIWIVATK
FT                   IWPPLIKVIEERQQKIAEGLAAADLGQKELAQAQEEIKKTLKNAREKANEIIEQAHARA
FT                   HQIIEAAKAEAITETNRQQNLAQVEIEAAAKRAREELRKHVSILAVNGAEKLLKREIDV
FT                   NTHKMLLDELAAEI"
FT   gene            complement(545031..545336)
FT                   /locus_tag="Xfasm12_0490"
FT   CDS_pept        complement(545031..545336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0490"
FT                   /product="ATP synthase C chain"
FT                   /note="KEGG: xft:PD0433 ATP synthase C chain"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11499"
FT                   /protein_id="ACA11499.1"
FT                   /translation="MSLDVLTNFAQIQSFTALAIGIMIGLAALGAGLGLAIMAGKFLES
FT                   AARQPELIPLLQVRMFISAGLIDAAFIISVAVGLLLAFANPLSSTLLVAVSKALAG"
FT   sig_peptide     complement(545244..545336)
FT                   /locus_tag="Xfasm12_0490"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.708) with cleavage site probability 0.539 at
FT                   residue 31"
FT   gene            complement(545400..546197)
FT                   /locus_tag="Xfasm12_0491"
FT   CDS_pept        complement(545400..546197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0491"
FT                   /product="ATP synthase, A chain"
FT                   /note="KEGG: xfa:XF1149 ATP synthase, A chain"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11500"
FT                   /protein_id="ACA11500.1"
FT                   /translation="MAGEEATPTSYIQHHLHNLTFQMQDGSKFWVLHLDTLIMAVLMGL
FT                   VMVLVFWSGTCKATSGIPGKWQAFVEVCLEFVDRQVKDTYHGPSKLVTPIAITLFFWIF
FT                   LMNLIKVIPADFIAIPFSWAGVHAWKPVPTADVNATLGMSISVFFLMLFFSFRAKGISG
FT                   FLKEFLTTPFGKWMMPFNLVLNIVEWLSKPISLAMRLFGNMFGGEIVFLLIWVLGGAGI
FT                   SGMLASSTFGLAWMLFHLLVIPLQAFIFMMLSIVYLSLSEDSH"
FT   gene            complement(546227..546598)
FT                   /locus_tag="Xfasm12_0492"
FT   CDS_pept        complement(546227..546598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0492"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0435 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11501"
FT                   /protein_id="ACA11501.1"
FT                   /translation="MLTSTYTTKKLALRAAISSLIAVTITSLALLIFDVKYACGATLTG
FT                   LAITLGSWLSAQVALGGRVQGAVAVIARLILAFLLKWVSVITALLLGFCLWRLPALGLL
FT                   SGITIGLFFQALTMTRQQS"
FT   sig_peptide     complement(546509..546598)
FT                   /locus_tag="Xfasm12_0492"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.950) with cleavage site probability 0.653 at
FT                   residue 30"
FT   gene            547934..548245
FT                   /locus_tag="Xfasm12_0493"
FT   CDS_pept        547934..548245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0493"
FT                   /product="30S ribosomal protein S10"
FT                   /note="KEGG: xft:PD0436 30S ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11502"
FT                   /db_xref="GOA:B0U5A6"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U5A6"
FT                   /protein_id="ACA11502.1"
FT                   /translation="MADQKIQIRLKAFDCRLIDRSAGEIVETAKRTGAHVRGPIPLPTK
FT                   IERCTILVSPHADKDARDQYETCTYKRVLYIVDPNDKTVDALMRLELAAGVDVQIKLT"
FT   gene            548260..548907
FT                   /locus_tag="Xfasm12_0494"
FT   CDS_pept        548260..548907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0494"
FT                   /product="50S ribosomal protein L3"
FT                   /note="KEGG: xft:PD0437 50S ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11503"
FT                   /db_xref="GOA:B0U5A7"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U5A7"
FT                   /protein_id="ACA11503.1"
FT                   /translation="MGCYSMGFVGRKAGMSRVFLEDGRSIPVTLIEATANRVVQIKTSD
FT                   VDGYDAIQVTVGSRRSVLVNKPESGHFAKAKVEAGRGLWEFRVEKTQLGSYSVGSEVGL
FT                   SIFAVGQKVDIQGITKGKGFQGTIKRHNFRMGDATHGNSLSHRAPGSLGQRQTPGRVFP
FT                   GKKMSGHMGAVRQSVQNLEVIKIDVERFLIAVRGAIPGASGGDVLIRSASKI"
FT   gene            548919..549533
FT                   /locus_tag="Xfasm12_0495"
FT   CDS_pept        548919..549533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0495"
FT                   /product="50S ribosomal protein L4"
FT                   /note="KEGG: xft:PD0438 50S ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11504"
FT                   /db_xref="GOA:B0U5A8"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U5A8"
FT                   /protein_id="ACA11504.1"
FT                   /translation="MDLTIVGSDNTLPVSDVVFGREFSEALVHQVVVAYRNTARSGTKA
FT                   QKSRSQVSGTTKKSKKQKGGGARHGALTAPIFVGGGVAFAAKPRSFSQKVNRKQYRSAI
FT                   CSIFSELNRQGRLKVVDAFDVEVSKTKVFAEKIKSLEVVGVGSSLLIVSDEISECLSLS
FT                   SRNLPCVDVRSVQALDPVALVGSDVVVLTVGAVKKIEEWLV"
FT   gene            549530..549832
FT                   /locus_tag="Xfasm12_0496"
FT   CDS_pept        549530..549832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0496"
FT                   /product="50S ribosomal protein L23"
FT                   /note="KEGG: xfa:XF1154 50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11505"
FT                   /db_xref="GOA:B0U5A9"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U5A9"
FT                   /protein_id="ACA11505.1"
FT                   /translation="MNSSCEKIFGVLRSPRVSEKSSRLQEISNVYVFEVSSDATKVDVK
FT                   NAVERLFDVKVGVVRVLNVKGKSKSFRNRGGSRSGWRKAYVRLIDGQSIDVAASV"
FT   gene            549844..550671
FT                   /locus_tag="Xfasm12_0497"
FT   CDS_pept        549844..550671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0497"
FT                   /product="50S ribosomal protein L2"
FT                   /note="KEGG: xft:PD0440 50S ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11506"
FT                   /db_xref="GOA:B0U5B0"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U5B0"
FT                   /protein_id="ACA11506.1"
FT                   /translation="MPLIKFKPTSPGRRSAARVVTPNIHKGSPHASLLESQSKTGGRNH
FT                   HGRITVRHIGGGCKQRYRVIDFKRDKEAIPARVERIEYDPNRTAHIALLCYIDGERCYI
FT                   IAPKGLKEGDKIISGPNVPIKLGNSLPLRNIPVGTTVHAVELKPRKGAQMARSAGSSVQ
FT                   LVAREGVYATLRLRSGEMRRVLAECRATIGEVGNEEHNLRKLGKAGAKRWLGVRPTVRG
FT                   AAMNPVDHPHGGGEAKSGQGNPHPVTPWGVPTKGYKTRKNKRTQQFIIRGRRG"
FT   gene            550679..550948
FT                   /locus_tag="Xfasm12_0498"
FT   CDS_pept        550679..550948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0498"
FT                   /product="30S ribosomal protein S19"
FT                   /note="KEGG: xfa:XF1156 30S ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11507"
FT                   /db_xref="GOA:B0U5K3"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U5K3"
FT                   /protein_id="ACA11507.1"
FT                   /translation="MPRSTKKGPFFDHHLIKKVESAAGSKRPIKTCSRRSVILPQMVGH
FT                   TIAIHNGKNYHPVVINENMVGHKLGEFSITRVFKGHGGDKKSGK"
FT   gene            550955..551296
FT                   /locus_tag="Xfasm12_0499"
FT   CDS_pept        550955..551296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0499"
FT                   /product="50S ribosomal protein L22"
FT                   /note="KEGG: xfa:XF1157 50S ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11508"
FT                   /db_xref="GOA:B0U5K4"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U5K4"
FT                   /protein_id="ACA11508.1"
FT                   /translation="MNMEATAILRGARISPQKARLVAAQVRGLSAESAVNLLRFSSKKA
FT                   ACLIKKVVESAIANAENNHGSNIDDLKINTIIVDEGRMLKRFMARAKGRSSRIVKRSSH
FT                   ITVVVGPAK"
FT   gene            551315..552034
FT                   /locus_tag="Xfasm12_0500"
FT   CDS_pept        551315..552034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0500"
FT                   /product="30S ribosomal protein S3"
FT                   /note="KEGG: xfa:XF1158 30S ribosomal protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11509"
FT                   /db_xref="GOA:B0U5K5"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U5K5"
FT                   /protein_id="ACA11509.1"
FT                   /translation="MGHKVHPIGIRLGISADWNSKWYANKAEFAGYLAADLKVRQVLRK
FT                   KMSQAGISKILIERPSNAACVSMHVARPGVVIGKRGEDIEMLRKQLSDIMGVSVHINVI
FT                   EVRKPELDAQLVAESVAQQLERRIMFRRAMKRSVSNAIRLGALGIKISVAGRLNGAEIA
FT                   RSEWYREGRVPLQTLRADIGYGFSEAHTNYGVTGVKVLIYHGDIFSFSSVGQEKQDDGS
FT                   RGDRNADRSSRRSREVR"
FT   gene            552040..552453
FT                   /locus_tag="Xfasm12_0501"
FT   CDS_pept        552040..552453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0501"
FT                   /product="50S ribosomal protein L16"
FT                   /note="KEGG: xft:PD0444 50S ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11510"
FT                   /db_xref="GOA:B0U5K6"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U5K6"
FT                   /protein_id="ACA11510.1"
FT                   /translation="MLQPKRTKYRKMHKGRNCGLSWNANVVSFGQYGLRATAHGQLTAR
FT                   QIEAARRSISRYVKRGGKLLIRVFPDKPITKKPIEVRMGSGKGNVEYWVAQIQPGRMIY
FT                   EIEGVSEDVAREAFRLAASKLSVTTAFVVRTVR"
FT   gene            552450..552650
FT                   /locus_tag="Xfasm12_0502"
FT   CDS_pept        552450..552650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0502"
FT                   /product="50S ribosomal protein L29"
FT                   /note="KEGG: xfa:XF1160 50S ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11511"
FT                   /protein_id="ACA11511.1"
FT                   /translation="MMDIEQFRGKSVDDLKAHLIELRKEQFSMRMQLAMGQFQKTHEIR
FT                   RVRRNIARVKYLLSWINRASA"
FT   gene            552647..552916
FT                   /locus_tag="Xfasm12_0503"
FT   CDS_pept        552647..552916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0503"
FT                   /product="30S ribosomal protein S17"
FT                   /note="KEGG: xfa:XF1161 30S ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11512"
FT                   /db_xref="GOA:B0U5K8"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U5K8"
FT                   /protein_id="ACA11512.1"
FT                   /translation="MMNDNNERKPLRTIKGRVISNKMQKTVTVLVERQIKHALYGKYIK
FT                   RSTKIHAHDADDLCNEGDVVLMTEVAPISKTKNWRVVEIVARSD"
FT   gene            552940..553308
FT                   /locus_tag="Xfasm12_0504"
FT   CDS_pept        552940..553308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0504"
FT                   /product="50S ribosomal protein L14"
FT                   /note="KEGG: xfa:XF1162 50S ribosomal protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11513"
FT                   /db_xref="GOA:B0U5K9"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U5K9"
FT                   /protein_id="ACA11513.1"
FT                   /translation="MIQMQSYLGVADNSGAKEVMCIKVLGGSKRRYASIGDIIKVTVKE
FT                   AIPRGKVKKGEVYDAVVVRTRSGVRRPDGSLIRFDGNAAVLLNNKQEPIGTRVFGPVTR
FT                   ELRSEKLMKIVSLAPEVL"
FT   gene            553309..553641
FT                   /locus_tag="Xfasm12_0505"
FT   CDS_pept        553309..553641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0505"
FT                   /product="50S ribosomal protein L24"
FT                   /note="KEGG: xfa:XF1163 50S ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11514"
FT                   /db_xref="GOA:B0U5L0"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U5L0"
FT                   /protein_id="ACA11514.1"
FT                   /translation="MDDIEMASRIKKGDQVIVIAGKDKGKQGEIIRIDGHRVVVSNVNI
FT                   VKRHTKPNPQRGISGGLIDREAPIHVSNIQILNPMTGKGDRVGFKILDDGCKLRIFRST
FT                   GEVIGA"
FT   gene            553653..554192
FT                   /locus_tag="Xfasm12_0506"
FT   CDS_pept        553653..554192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0506"
FT                   /product="50S ribosomal protein L5"
FT                   /note="KEGG: xft:PD0449 50S ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11515"
FT                   /db_xref="GOA:B0U5L1"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U5L1"
FT                   /protein_id="ACA11515.1"
FT                   /translation="MTRLENMYKKEVVPALIKRFGYSNPMAVPRLVKITLNMGVGEAAT
FT                   NKKVLENAVADMAKVSGQKPIVTKSRISVASFKIRNGWPIGCKTTLRRSKMYEFLDRLI
FT                   NISLPCVRDFRGIPPRSFDGRGNFNMGVKEQVVFPEIDFDAVDAIRGMDIAITTTANSD
FT                   AEAKALLDAFNFPFRN"
FT   gene            554209..554514
FT                   /locus_tag="Xfasm12_0507"
FT   CDS_pept        554209..554514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0507"
FT                   /product="30S ribosomal protein S14"
FT                   /note="KEGG: xft:PD0450 30S ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11516"
FT                   /db_xref="GOA:B0U5L2"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U5L2"
FT                   /protein_id="ACA11516.1"
FT                   /translation="MAKISMINRDLKRKRLAKKFADKRLSLKKVISSYASSYEEKIEAS
FT                   CKLQKLPRDSSPTRLRNRCEISGRPRGVYCKFGLGRNKLREAAMRGDIPGLRKASW"
FT   gene            554673..555071
FT                   /locus_tag="Xfasm12_0508"
FT   CDS_pept        554673..555071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0508"
FT                   /product="30S ribosomal protein S8"
FT                   /note="KEGG: xfa:XF1166 30S ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11517"
FT                   /db_xref="GOA:B0U5L3"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U5L3"
FT                   /protein_id="ACA11517.1"
FT                   /translation="MSMTDPIADMLVRIKNAASVGKPNVRFPFSKVKLAIALVLKHEGY
FT                   IFDAKVIQGDNSKSDIEVVLKYFEGRPVIRILKRVSRSGLRKYCGKAELPKVLGGLGVS
FT                   IISTSKGIMTDSKARESGVGGEVLCFVA"
FT   gene            555084..555611
FT                   /locus_tag="Xfasm12_0509"
FT   CDS_pept        555084..555611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0509"
FT                   /product="50S ribosomal protein L6"
FT                   /note="KEGG: xfa:XF1167 50S ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11518"
FT                   /db_xref="GOA:B0U5L4"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U5L4"
FT                   /protein_id="ACA11518.1"
FT                   /translation="MSRVAKKPISIPKGVEVSVQSDMLTVKGVKGVLTFPKSDNVNVVM
FT                   DGDILTLSANDPSHISLAGTVRAILSNMIKGVSIGFERKLELVGVGYRASMQGKDLNLT
FT                   LGFSHPLVFVPPEGITLLTPSQTEVVVQGIDKQRVGEVAAKIRSFRPPEPYKGKGLKYA
FT                   AEAIIRKEAKKA"
FT   gene            555698..556057
FT                   /locus_tag="Xfasm12_0510"
FT   CDS_pept        555698..556057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0510"
FT                   /product="50S ribosomal protein L18"
FT                   /note="KEGG: xft:PD0453 50S ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11519"
FT                   /db_xref="GOA:B0U5L5"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U5L5"
FT                   /protein_id="ACA11519.1"
FT                   /translation="MSIGKNVARLRRAKSTRVHIRKLGVPRLSVLRTGRHLYAQIFTAD
FT                   GSKVIAAANTLQSQVKDGLKNGKNSLAATKVGKLIAERAKAVGVDRIAFDRSGYLYHGR
FT                   IKILADAARDAGLKF"
FT   gene            556234..556773
FT                   /locus_tag="Xfasm12_0511"
FT   CDS_pept        556234..556773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0511"
FT                   /product="30S ribosomal protein S5"
FT                   /note="KEGG: xft:PD0454 30S ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11520"
FT                   /db_xref="GOA:B0U5L6"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U5L6"
FT                   /protein_id="ACA11520.1"
FT                   /translation="MAEERSQRSRDRSREEKIDDGMIEKLVAVNRVSKTVKGGRQFTFT
FT                   ALTIVGNGEGSVGFGYGKAREVPVAIQKSMEYARKRMANVSLNNGTLWHPVKANHGAAS
FT                   VFMKPASEGTGVIAGGAMRAVLEAVGVKDVLAKAIGSRNPINLVRATLKGLEDMQSPTH
FT                   IALKRGKNVRDFSHGS"
FT   gene            556793..556954
FT                   /locus_tag="Xfasm12_0512"
FT   CDS_pept        556793..556954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0512"
FT                   /product="50S ribosomal protein L30"
FT                   /note="KEGG: xft:PD0455 50S ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11521"
FT                   /protein_id="ACA11521.1"
FT                   /translation="MCLVRSLIGVRSRHRLSVHALGLSKVSDMRKVNDTPQVRGLIKKV
FT                   HYLVRIQD"
FT   gene            556961..557404
FT                   /locus_tag="Xfasm12_0513"
FT   CDS_pept        556961..557404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0513"
FT                   /product="50S ribosomal protein L15"
FT                   /note="KEGG: xft:PD0456 50S ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11522"
FT                   /protein_id="ACA11522.1"
FT                   /translation="MSLRLNDLKPALGASSSRARVGRGIGSGLGKTAGRGHKGSFARKG
FT                   GGKIKPGFEGGQTPMQRRLPKIGFRSRSVANTAEVLSYKLDNLEPGEIDFASLRLAKLV
FT                   PSTAKKAKIVKKGRLTKVFVLKGIESTAGARAMIETTGGSFQE"
FT   gene            557412..558785
FT                   /locus_tag="Xfasm12_0514"
FT   CDS_pept        557412..558785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0514"
FT                   /product="preprotein translocase SecY subunit"
FT                   /note="KEGG: xft:PD0457 preprotein translocase SecY
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11523"
FT                   /protein_id="ACA11523.1"
FT                   /translation="MSQPSLGNLGNRFGKSIELRNRLLFLFGALIVYRVGCYVPVPGVN
FT                   PEAMLALMQKQGGGIVDMFNMFSGGALHRFSIFALNVMPYISASIVVQLATHIFPSLKA
FT                   MQKEGESGRRKITQYSRIGAVILAVIQGGSIALALQNQTAPGGAAVVYAPGAAFVMIAI
FT                   VALTAGTVFLMWVGEQVTERGIGNGVSMIIFAGIVAGLPGSVLQTIDAFRSDALSLISL
FT                   LIIVFIVLSFTFFVVFVERGLRRITVNYARRVEGRNSYMNKSSFLPLKLNMAGVIPPIF
FT                   ASSILAFPVTLSMWSGQASSNTVFGAWLQRVASALGPGEPLHMILFAVLIIGFAFFYTA
FT                   LVFSSQETADILKKSGALIPGIRPGKATSDYVDGVLTRLTAVGSLYLVIVCLLPEFMQS
FT                   RMGASFHFGGTSLLIAVVVVMDFISQIQVHQASNQYDGVSFFKKANLKGVSKKRRFVN"
FT   gene            558925..559281
FT                   /locus_tag="Xfasm12_0515"
FT   CDS_pept        558925..559281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0515"
FT                   /product="30S ribosomal protein S13"
FT                   /note="KEGG: xft:PD0458 30S ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11524"
FT                   /db_xref="GOA:B0U5M0"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U5M0"
FT                   /protein_id="ACA11524.1"
FT                   /translation="MARIAGVNLAIQKHVWIGLQSIYGIGRTRSRKVCDAANVAIYTKI
FT                   RDLSEPEIERLRVEVGKYVIEGDLRREVGMAIKRLMDLNCYRGLRHRRCLPLRGQRTRT
FT                   NARTRKGPRKAIKK"
FT   gene            559297..559689
FT                   /locus_tag="Xfasm12_0516"
FT   CDS_pept        559297..559689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0516"
FT                   /product="30S ribosomal protein S11"
FT                   /note="KEGG: xft:PD0459 30S ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11525"
FT                   /db_xref="GOA:B0U5M1"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U5M1"
FT                   /protein_id="ACA11525.1"
FT                   /translation="MAKQSVVKTKKRVKRVITDGVAHICASFNNTIVTITDRQGNSLFW
FT                   CTSGASGFRGSRKCTPFAAQVAAEKAGRAVLDYGMKSLEVRINGPGPGRESAVRSLSNV
FT                   GYKITNIIDVTPIPHNGCRPPKKRRV"
FT   gene            559704..560330
FT                   /locus_tag="Xfasm12_0517"
FT   CDS_pept        559704..560330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0517"
FT                   /product="30S ribosomal protein S4"
FT                   /note="KEGG: xft:PD0460 30S ribosomal protein S4"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11526"
FT                   /db_xref="GOA:B0U5M2"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U5M2"
FT                   /protein_id="ACA11526.1"
FT                   /translation="MARYIGPSCKLARREGADLSLKSPSRALDSKCKLEQRPGQHGAVR
FT                   KSKLSDYASQLREKQKVKRIYGVLERQFRNYYKNASTKKGNTGENLLQLLETRLDNVIY
FT                   RMGFAVTRPAARQLVSHRGVLVNGKIVNLPSYHVKPGDIVALSQRAQKYLCVQESLTIK
FT                   DQHGSAFSWVEVDSEKFSGVFKALPDRADLPSDINEALIVELYSK"
FT   gene            560386..561384
FT                   /locus_tag="Xfasm12_0518"
FT   CDS_pept        560386..561384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0518"
FT                   /product="DNA-directed RNA polymerase"
FT                   /EC_number="2.7.7.6"
FT                   /note="KEGG: xft:PD0461 RNA polymerase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11527"
FT                   /db_xref="GOA:B0U5M3"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U5M3"
FT                   /protein_id="ACA11527.1"
FT                   /translation="MTVTISQVLRPRGPQIERLTENRAKVVLEPLGRGYAHTLGNALRR
FT                   VLLSSIPGSAITQVEIDGVLHEYTTVEGLQEDVLEVLLNLKDVAIRIHSGDTATLSLFK
FT                   QGAGVVTAADIKTDHNVEIINDGHVICHLTKDTTINMRLKVERGFGYQPAVVRRRPDDE
FT                   NRTIGRLILDASFSPVRRVAYVVEAARVEQRTDLDKLIIDIETNGTIDAEEALRTAADI
FT                   LTDQLSVFGDFTHRDRGTVKPASSGVDPVLLRPIDDLELTVRSANCLKAESIYYIGDLI
FT                   QKTEVELLKTPNLGKKSLTEIKEVLGQRGLGLGVKLENWPPPGVSQYGMLG"
FT   gene            561514..561894
FT                   /locus_tag="Xfasm12_0519"
FT   CDS_pept        561514..561894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0519"
FT                   /product="50S ribosomal protein L17"
FT                   /note="KEGG: xfa:XF1177 50S ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11528"
FT                   /db_xref="GOA:B0U5M4"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U5M4"
FT                   /protein_id="ACA11528.1"
FT                   /translation="MRHQKSGRKFNRTDAHRGAMFSNMVASLFKYQLIKTTLPKAKELR
FT                   RVAEPLITLAKVDSVANRRLAFARLRNKEAVGILFSNLGPRYITRPGGYIRLLKCGFRH
FT                   GDNAPMAYVEMLERPIIAEEVT"
FT   gene            562939..563199
FT                   /locus_tag="Xfasm12_0520"
FT   CDS_pept        562939..563199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0520"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0463 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11529"
FT                   /protein_id="ACA11529.1"
FT                   /translation="MIDLNHLDTIANRLSDLLPPALYESRGELQTLFKDVLQAGLAKLD
FT                   LVTREEFEIQRVILLSTREKLETLLHTLVLLEDRLTDQGKN"
FT   gene            563210..564730
FT                   /locus_tag="Xfasm12_0521"
FT   CDS_pept        563210..564730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0521"
FT                   /product="competence-related protein"
FT                   /note="KEGG: xft:PD0464 competence-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11530"
FT                   /protein_id="ACA11530.1"
FT                   /translation="MSLALVHSRARAGVFAPSVRVEVHLSGGLPATQIVGLPEAAVRES
FT                   RDRVRAALLCACFEYPARRITINLAPADLPKEGGRFDLPIALGILAASGQLPLDALAGK
FT                   EFLGELALTGELRSVDSVLPAALAASQAGHWLVIPESNGAEAAIAGCCEAYTARTLLEV
FT                   CAGLCGKTLLPAAQRFEVKADVLHDIPDISDVRGQEEARRVLEIAAAGGHHLLLIGSPG
FT                   CGKTLLASRLPGLLPPASEQEALESASIASVSGHDLNLTHWRRRPYRAPHHSASAVALI
FT                   GGGVQARPGEISLAHNGVLFMDELPEWQRKTLEALREPMESGVVTIARATRSVDYPARF
FT                   QLVAAMNPCPCGWAGDSSGRCQCGVDAIRRYRRRISGPLLDRIDLQLEIPRLAPQLLRP
FT                   STPRGEHSVTVRRRVTDSRTLQYNRQAGLNAHLGQAATERHCCLDVTDQQLLERAIEQL
FT                   QLSARSMQRILRVARTIADLDGSTLITSMHLHEAIGYRRFDRTAFGIA"
FT   gene            567310..567856
FT                   /pseudo
FT                   /locus_tag="Xfasm12_0522"
FT   gene            568011..568613
FT                   /pseudo
FT                   /locus_tag="Xfasm12_0523"
FT   gene            568748..568882
FT                   /locus_tag="Xfasm12_0524"
FT   CDS_pept        568748..568882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0524"
FT                   /product="lipase modulator"
FT                   /note="KEGG: xft:PD0466 lipase modulator"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11531"
FT                   /protein_id="ACA11531.1"
FT                   /translation="MTPDGMRLQIVGFLGPEVAYRVVEMRRQDEIWQEKYKNYAAQHA"
FT   gene            complement(569368..569454)
FT                   /locus_tag="Xfasm12_R0025"
FT                   /note="tRNA-Leu3"
FT   tRNA            complement(569368..569454)
FT                   /locus_tag="Xfasm12_R0025"
FT                   /product="tRNA-Leu"
FT   gene            569590..570882
FT                   /locus_tag="Xfasm12_0525"
FT   CDS_pept        569590..570882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0525"
FT                   /product="polysaccharide biosynthetic protein"
FT                   /note="KEGG: xft:PD0468 polysaccharide biosynthetic
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11532"
FT                   /protein_id="ACA11532.1"
FT                   /translation="MVADKQGEPTLARIAVVGLGYVGLPLAVAFGRQRPTLGFDIDICR
FT                   VQQLCAGHDITCEIELEELQAARHLRYSSDPRELSDCQIFIITVPTPIDVAEQPDLGPL
FT                   RSASMLVASVLKPGDLVIYESTVYPGTTEEVCVPLLEAGSGLRFNVDFHCGYSPERINP
FT                   GDRKRRLQDICKILSGSTPDITAVVDALYSQIIVAGTWCAPSIRVAEAAKVVENIQRDV
FT                   NIALVNELALIFDRLGIDTLDVLEAAETKWNFLPFRPGLVGGHCIGVDPYYLLHKSESV
FT                   GYYPDLIHTARRVNSRVSRHVVDRVVALLGELSVPMTRAVVLVLGVTFKEDCPDLRNSR
FT                   ALDLVRMFRNLGAQVDVCDPCADPQQALEHEAVTLCTEPKAGAYDAIVLAVAHAQYRMY
FT                   DVATIAALGKPQAVVYDVKSVWPRAAVTDRL"
FT   gene            complement(570839..571123)
FT                   /locus_tag="Xfasm12_0526"
FT   CDS_pept        complement(570839..571123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0526"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11533"
FT                   /protein_id="ACA11533.1"
FT                   /translation="MIGCYMPWQDNFGTSLLISCFTNHKNIRHPITTLYAITQHTQAAL
FT                   IANVLQDKLRNTYEITNARRDTRKLKAQSNIENIISIDDQLPLHAATLI"
FT   gene            complement(572017..572817)
FT                   /pseudo
FT                   /locus_tag="Xfasm12_0527"
FT   gene            complement(573865..573948)
FT                   /locus_tag="Xfasm12_R0026"
FT                   /note="tRNA-Leu2"
FT   tRNA            complement(573865..573948)
FT                   /locus_tag="Xfasm12_R0026"
FT                   /product="tRNA-Leu"
FT   gene            574371..575666
FT                   /locus_tag="Xfasm12_0528"
FT   CDS_pept        574371..575666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0528"
FT                   /product="peptidyl-prolyl cis-trans isomerase"
FT                   /note="KEGG: xft:PD0471 peptidyl-prolyl cis-trans
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11534"
FT                   /db_xref="GOA:B0U5N0"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U5N0"
FT                   /protein_id="ACA11534.1"
FT                   /translation="MPVLIESIGNLERRLTFSVPEDRLESHVDERLREIARTARINGFR
FT                   AGKVPAKVIGQRFGEKVRAEVLDSLLRETLDSAIRAHSLRLAGAARIDHANEGGLNFVA
FT                   TFEVVPDFGEIDVSKLGVVRRTAKVTDVDIDQMIENLRLQRRTWRVAEHGAQVGYLVAL
FT                   ETWSQAGDERLPIEGVEAGSTILGSGVMFEQIERGLEGLSKGDENVLDVTFPDDWRVMQ
FT                   LAGKAVQVHVKVIEVSEPVLLEVNEEFIKSFGVKSGKLEDFRADIRANLERELKGALVS
FT                   HLRREVGEQLIAAYAHVEMPPRLVEKEARLMLAKQIEQIRLSGRDPTGIPDDAHIGFMD
FT                   AACKRVLVGLLVGEIAGRNRLRLDPMRVTETLHLIASTYEEPEEVFQMYRNDPKLMEGV
FT                   QSLVMEEQVIEWIADRAQKTEQVLSFQEAIQQ"
FT   gene            575804..576430
FT                   /locus_tag="Xfasm12_0529"
FT   CDS_pept        575804..576430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0529"
FT                   /product="Endopeptidase Clp"
FT                   /EC_number="3.4.21.92"
FT                   /note="KEGG: xft:PD0472 ATP-dependent Clp protease
FT                   proteolytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11535"
FT                   /db_xref="GOA:B0U5N1"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U5N1"
FT                   /protein_id="ACA11535.1"
FT                   /translation="MDDVTKALNLVPMVVEQTSRGERAYDIYSRLLKERLIFLVGPIDD
FT                   YMANLIVAQLLFLEAENPEKDINIYINSPGGVVTAGMAIYDTMQYIKPAVSTICVGQAA
FT                   SMGALLLASGASGKRYALPNSRVMIHQPLGGFQGQATDVDIHAREILALRARLNEILAK
FT                   HTGQSLETIAHDTERDNFKSAVDAQAYGLVDQVFGQRQEELIQSS"
FT   gene            576558..577838
FT                   /locus_tag="Xfasm12_0530"
FT   CDS_pept        576558..577838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0530"
FT                   /product="ATP-dependent Clp protease ATP binding subunit
FT                   Clpx"
FT                   /note="KEGG: xfa:XF1188 ATP-dependent Clp protease ATP
FT                   binding subunit Clpx"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11536"
FT                   /db_xref="GOA:B0U5N2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U5N2"
FT                   /protein_id="ACA11536.1"
FT                   /translation="MSEDRLSRSGDGNKILYCSFCGKSQREVRKLIAGPSVFICDECVE
FT                   LCNDIIREELEEKSQSARSSLPKPKEILEVLDQYVIGQQRAKRTLAVAVYNHYKRIESR
FT                   HKNDDIELAKSNILLVGPTGSGKTLLAETLARLLNVPFTIADATTLTEAGYVGEDVENI
FT                   IQKLLQKCDYDVEKAQHGIVYIDEIDKISRKSENPSITRDVSGEGVQQALLKLIEGTVA
FT                   SVPPQGGRKHPQQEFLQVDTKNILFICGGAFAGLDKVIQQRCTEAGGIGFGVKVKSSES
FT                   KRDVGKVLAGVEPEDLIKFGLIPEFVGRLPVVATLDELDESALVKILTEPKNAITKQFK
FT                   KLFEMENVELEFRQDALSAVARKALKRKTGARGLRTIVELVLLDTMYELPSQEGISKVV
FT                   VDESVIENKSEPYLIYQTMPAKVASGE"
FT   gene            577990..580461
FT                   /locus_tag="Xfasm12_0531"
FT   CDS_pept        577990..580461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0531"
FT                   /product="Endopeptidase La"
FT                   /EC_number="3.4.21.53"
FT                   /note="KEGG: xfa:XF1189 ATP-dependent serine proteinase La"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11537"
FT                   /protein_id="ACA11537.1"
FT                   /translation="MTQSSQKALDLQVLPLRDVVVFPYMVIPLFVGREKSMRALEKAMD
FT                   ADKRILLVAQKTADIDDPSAVDLHTIGTYAQVLQLLKLPDGTIKVLVEGLTRVSVDQVV
FT                   EHDGALRGCGIEIASTQEREEREIEAIVRSLLSLFEQYVKTNRKLPPELLQTLNGIDDP
FT                   GRLADTIAAHLSVRLAYKQRLLETIEIGDRLEILIGLVDGEIDVQQMEKRIRGRVKSQM
FT                   EKSQREYYLNEQMKAIQKELGDFDDLPSELEELARKIAEIGMPKSVQSKAKSELNKLKQ
FT                   MSPMSAEAAVVRNYLDWLLGVPWRKCTKVRKDLKVAQSTLDDDHYGLDKVKERILEYLA
FT                   VQSRVKQMRGPILCLVGPPGVGKTSLGQSIAKATNRKFVRMSLGGVRDEAEVRGHRRTY
FT                   VGSMPGRVVQNLNKVGSKNPLFVLDEIDKMAMDFRGDPSAALLEVLDPEQNNAFNDHYL
FT                   DVDLDLSEVMFVATSNSLNIPGPLLDRMEVIRIPGYTEDEKLNIATRYLVPKQIRANGL
FT                   GVEELAIGEDAIRDIVRYYTRESGVRNLEREISKICRKIVKEIALVGVKPFAKKSTKSK
FT                   VLFAVTSKNLEKYLGVRRFDFGRAEEANEIGLVTGLAWTEVGGDLLQIESTLVPGKGNL
FT                   ILTGQLGNVMKESASAALTVVRSRADRFCIDVDFLHNQDVHLHVPDGATPKDGPSAGVA
FT                   MVTSLVSMLTKVPVRADVAMTGEITLRGRVSVIGGLKEKLLAALRGGIRTVLIPEGNRR
FT                   DLADIPANVTRALTIVPVKWIDEVLDLALESPLEPKVAAQLGKSKPRKPHSRVSTVRGK
FT                   SKGSSNARVRH"
FT   gene            580682..580966
FT                   /locus_tag="Xfasm12_0532"
FT   CDS_pept        580682..580966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0532"
FT                   /product="histone-like protein"
FT                   /note="KEGG: xft:PD0475 histone-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11538"
FT                   /protein_id="ACA11538.1"
FT                   /translation="MNKTELIDGVAAAANLSKVEAGRAIDAVVNEITEALKKGDSVTLV
FT                   GFGTFQVRPRAERPGRNPKSGEPIMIAASNNPSFKPGKALKDAVKSSAG"
FT   gene            580968..581042
FT                   /locus_tag="Xfasm12_R0027"
FT                   /note="tRNA-Val1"
FT   tRNA            580968..581042
FT                   /locus_tag="Xfasm12_R0027"
FT                   /product="tRNA-Val"
FT   gene            581073..581149
FT                   /locus_tag="Xfasm12_R0028"
FT                   /note="tRNA-Asp1"
FT   tRNA            581073..581149
FT                   /locus_tag="Xfasm12_R0028"
FT                   /product="tRNA-Asp"
FT   gene            581535..583502
FT                   /locus_tag="Xfasm12_0533"
FT   CDS_pept        581535..583502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0533"
FT                   /product="peptidyl-prolyl cis-trans isomerase"
FT                   /note="KEGG: xfa:XF1191 peptidyl-prolyl cis-trans
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11539"
FT                   /protein_id="ACA11539.1"
FT                   /translation="MLQKLREKTSGWIATAIIGLLVIPFLFVIDVRYIGGGGKDDVAQL
FT                   QASPTWWKSAPAFWPISLLWQRQGISKQEFQSRFDQARLQQRAQQGEGFDAREFETLNN
FT                   KLKLLDQLIEEHVMRLVAEGAGVVISDDAVRSIIANDQRFQVKGKFNQDRYRLLLAQEP
FT                   TMRTPQMYENYVRSMMQLSMIPSTIFDSGFVPNTELERILALLGQTRNAELVTLPALKL
FT                   DMAEISNMQIKEWYAAHRDDFRQPETLSFEYVDLDAAHLPRPTPSEAVLRKRYDAQQRG
FT                   EAQNEQRKAAHILITAGADAASQKVAEAKAAKLVEEARKPGADFAALARINSQDPGSKD
FT                   AGGDLGWVQRGMMVKPFEDALFAMKVGEVVGPIKTEFGNHVIKLEEIKAAKQLPFEAVR
FT                   DQLAAEQTKEDLDKEFNDVTGKLMDLLVKNPTDLSSASEQLGLPLRKLGPLSRRDAVGI
FT                   AANPAVQRVLFNHDFIQEGKVSDPIQINPNHSVVLRVIAHTTEQQLPLDKVREQVVAAV
FT                   RADRADKDGASAADALVARLQKGDTLEEVAKAEKLQITPLTGLQRTAQVPAFAATRAIF
FT                   SALSPVAGKPTVGKVRLDDGRYAVFTVTRVIPGDLTKLPEEQKAMLRQQLDQIEGTLAV
FT                   HAYVDMMRKRFKVTIHKSQL"
FT   gene            584754..585791
FT                   /locus_tag="Xfasm12_0534"
FT   CDS_pept        584754..585791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0534"
FT                   /product="integral membrane protein"
FT                   /note="KEGG: xft:PD0479 integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11540"
FT                   /protein_id="ACA11540.1"
FT                   /translation="MLRDFRISFIFTAFCLSLAAWWGYSTALGVWQALWLCLVLSVLEV
FT                   SLSFDNAVINAGILKHMSEFWRKLFLTIGILIAVFGMRLVFPIVIVAVATGMGLIPVMK
FT                   LALEHPEQYSLVLTDHYPSIAAFGGMFLLLVFLNFLFDNERQLHWLGPIERMLAKLGKA
FT                   DAMAVIVAVACLMGTKFFLPYEVFQDVLFAGLGGILLYLLVDSVDALFKMDGQEDGVMG
FT                   PGKRSGVAAFLYLEVLDASFSFDGVIGAFAITRDVVIIMLGLAIGAMFVRSITLYLVRK
FT                   GTLDEFVFLEHGAHYAIGVLAVIMLVGTVYHVPEVITGLMGVALIAASLWSSFQYRKRL
FT                   ITVGR"
FT   sig_peptide     584754..584837
FT                   /locus_tag="Xfasm12_0534"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.467 at
FT                   residue 28"
FT   gene            complement(585808..585951)
FT                   /locus_tag="Xfasm12_0535"
FT   CDS_pept        complement(585808..585951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0535"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF1193 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11541"
FT                   /protein_id="ACA11541.1"
FT                   /translation="MTDSILTQVLHRRTPNQLPLTITSESKGAIIIRWQGLMGHKEALP
FT                   TR"
FT   gene            586481..586690
FT                   /locus_tag="Xfasm12_0536"
FT   CDS_pept        586481..586690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0536"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF1195 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11542"
FT                   /protein_id="ACA11542.1"
FT                   /translation="MNVQPVDVVVWPVVCDAKNKTNGASKAWVISQHFVLTMPFLPIIL
FT                   WLLAQVDLTSSGAFGGTAPPCRGV"
FT   gene            586993..589485
FT                   /locus_tag="Xfasm12_0537"
FT   CDS_pept        586993..589485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0537"
FT                   /product="Ribonucleoside-diphosphate reductase"
FT                   /EC_number="1.17.4.1"
FT                   /note="KEGG: xft:PD0480 ribonucleoside-diphosphate
FT                   reductase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11543"
FT                   /protein_id="ACA11543.1"
FT                   /translation="MIPKEQFAAAIADSLPNPGHVAGSVPPVALSVFHPDEPEDEVPIP
FT                   RQTAMMHTRAVEEANVSTWITKEAGNRRMPFDCARLECAIDTIHQEFPQLDVAEYKRAV
FT                   FGFVERKDSVNADDLVDLLIREAEARVDLTAPEWEYFAARLYLRRLYKRASRNRFYDAS
FT                   QKYGSFVGLQESLADRNIYSNDILRSYSKEELIEAGQMIDPERDKLFTYNGLYLLATRY
FT                   LATDASRGVFELPQERWLTIALYLMQDEYGPGKGGRERRMQLVGEAYWALSNLYMTVAT
FT                   PTLGNAGKINGQLSSCFIDTVDDSLQGIYDSNTDIARVSKHGGGVGAYLGYVRSSGSMI
FT                   RGVANSSGGVVPWIKQLNNTAVSVDQLGQRKGAIAVYLDIWHRDIEAFLDLRLNNGDQR
FT                   LRAHDVFTSVCIPDLFMEAVERRGDWYLFDPYEVKRVKGWYLQDFYDEKRGDPNGSFRR
FT                   KYEDVVADERISRKTVKAIDIFKRIMVSQLETGNPFMFYRDEVNRKNPNKHVGMVYSSN
FT                   LCTEILQNMTPTRLIQEMISGNQIVTTKHAGDFVVCNLSSINLGRAITVQADLLGADVL
FT                   ERLIPIQVRMLDNVIDLNLLPVPQATITNQKYRAIGLGTFGWHHLLAQKAIHWNSQEAE
FT                   QYSDVLYERINYLTIRASMELAKEKGTYAVFPGSDWQTGEYFRARDYNSPQWLELAAQV
FT                   AVNGVRNAYMVAVAPNMSTAQIAGSTASIDPVYSAFYYEEKKDYRRPVAAPGLSLDTWP
FT                   YYEKGAYKLDQFASIRQNARRQRHVDQSLSFNFYVPSTIRASTLLDLHMTAWREGLKTT
FT                   YYVRSNDIDISECEWCSS"
FT   gene            589554..590603
FT                   /locus_tag="Xfasm12_0538"
FT   CDS_pept        589554..590603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0538"
FT                   /product="Ribonucleoside-diphosphate reductase"
FT                   /EC_number="1.17.4.1"
FT                   /note="KEGG: xft:PD0481 ribonucleoside-diphosphate
FT                   reductase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11544"
FT                   /protein_id="ACA11544.1"
FT                   /translation="MTNMAISLDRIKILEPRNPNRSTGIINGKTSGILNWNDIPYPSFY
FT                   RAYKELSTNFWIPDEVDMKIDKRQYGELSAREKNAYDAIIGLLATLDSPQTRFIYNVAE
FT                   YITDPAAHANAAIIGQQEVIHNESYSYVLASITDLANQNRVFEIARTHPTILKRNAPIM
FT                   QAYDDFMREKTAETLLYSLIQSSILEGINFYSGFAYFYNLVRQNRMTGTGKIISFINRD
FT                   ELAHTKFISEVIRAIVGENPELQTDALTDYVHQAFAHAIELETQWTGEVLNGIDGIDVE
FT                   EMIRYVKYRANKMAGMLGIETLYTETTDNVMPWIRAYADNFTETKTDFFEMRNASYKKT
FT                   NVDNCFDDL"
FT   gene            590615..591097
FT                   /locus_tag="Xfasm12_0539"
FT   CDS_pept        590615..591097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0539"
FT                   /product="flavodoxin"
FT                   /note="KEGG: xft:PD0482 flavodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11545"
FT                   /protein_id="ACA11545.1"
FT                   /translation="MRILLALASLSGNTREVARVIRARCEERGHRVDWIETDLQTLAGQ
FT                   ALDPRTYTLFLLGTWTDNAGRTPFEMKRFIAELLELIGKPPSVAVFGTGETQWGQEYYC
FT                   GAVHRISDFFASRFPRLLIEQMPHGERDARAIVEWTDQVLDQCNKDSDADHYRYVA"
FT   gene            591069..591395
FT                   /locus_tag="Xfasm12_0540"
FT   CDS_pept        591069..591395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0540"
FT                   /product="thioredoxin"
FT                   /note="KEGG: xft:PD0483 thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11546"
FT                   /protein_id="ACA11546.1"
FT                   /translation="MQIITATSPDEFNAALKAHSRLLVDFYKEHCPGCRMLDMALNKFA
FT                   ATDAAAGVVVLKIRLETIGEDFFRDLGLRQTPTLGVFKNGLEVSRLLGFQSLAQIEAAV
FT                   QTYL"
FT   gene            591802..592512
FT                   /locus_tag="Xfasm12_0541"
FT   CDS_pept        591802..592512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0541"
FT                   /product="ribosomal small subunit pseudouridine synthase"
FT                   /note="KEGG: xft:PD0484 ribosomal small subunit
FT                   pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11547"
FT                   /protein_id="ACA11547.1"
FT                   /translation="MKLLKYIANLGYGSRKEVARIFREGRITNGEGEVLYADDHVQHTA
FT                   VRFDGEPLDPPPGLMVMLHKPSGYICSTKDAGRLVYDLLPARFRLRSPLLSTVGRLDGD
FT                   TSGLLLLTDDGALLHRMISPKTHLPKVYEATLVQALRGDEATLFASGTLLLDGDTKPLQ
FT                   PAVLEVLGPCQVRLTLYEGRYHQVRRMFGATGNRVNTLHRSAIGGLVLDGLPEGQWRVL
FT                   EAQDLAMLFSQGSR"
FT   gene            592512..593189
FT                   /locus_tag="Xfasm12_0542"
FT   CDS_pept        592512..593189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0542"
FT                   /product="hydrolase"
FT                   /note="KEGG: xft:PD0485 hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11548"
FT                   /protein_id="ACA11548.1"
FT                   /translation="MVSAPLSFMPEAVIFDMDGLMLDSERVSIECRCRAAFDLEQQIEP
FT                   DYWLQMVGVSDIACHAQLSARIGAVSATALLARSDALYEAVVMKGVPHRPGIVTLLEWL
FT                   FARGIPCAVGTSTRRPLALRKLNTAGLLSRFDVVCTASEVAQAKPAPDIYLLAAHTLGI
FT                   VPGRCLVVEDSPIGVRAALAAGMTPIQVPDLLMPDAQVSALGHRIVASLTEVQSLLEAC
FT                   FDV"
FT   gene            complement(593772..593969)
FT                   /locus_tag="Xfasm12_0543"
FT   CDS_pept        complement(593772..593969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0543"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF1203 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11549"
FT                   /protein_id="ACA11549.1"
FT                   /translation="MDAPQNALTCVHHIHTPASPQYAVQQHIACKLDKHQMGATSTNVT
FT                   GPCGSTLKPGSRLRTSSIST"
FT   gene            complement(594049..594606)
FT                   /locus_tag="Xfasm12_0544"
FT   CDS_pept        complement(594049..594606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0544"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0486 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11550"
FT                   /protein_id="ACA11550.1"
FT                   /translation="MTATIADPLALTRQWIERAVIGLNLCPFAKAVYIKQQLRLVLSDA
FT                   TKPETLLEHLAKELLLLRDTPAEHIDTTLIVHPHILTDFLDYNDFLDNVDAIIKTLDLQ
FT                   SILQVASFHPKYQFHGTAPDDMSNYTNRSPYPSLHLLREKSVDHAIAAFPDPNVIVQRN
FT                   IQTLKRLGDTGWQQVLAGTQIE"
FT   gene            complement(594603..595028)
FT                   /pseudo
FT                   /locus_tag="Xfasm12_0545"
FT   gene            595201..595437
FT                   /locus_tag="Xfasm12_0546"
FT   CDS_pept        595201..595437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0546"
FT                   /product="50S ribosomal protein L28"
FT                   /note="KEGG: xft:PD0488 50S ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11551"
FT                   /db_xref="GOA:B0U5P7"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U5P7"
FT                   /protein_id="ACA11551.1"
FT                   /translation="MSRVCQVTGKRVQTGNNVSHANNKTRRRFLPNLHKRRFWVASENR
FT                   WVKLRVSTCAVRTIDKNGIDAVLAELRASGEKV"
FT   gene            595451..595615
FT                   /locus_tag="Xfasm12_0547"
FT   CDS_pept        595451..595615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0547"
FT                   /product="50S ribosomal protein L33"
FT                   /note="KEGG: xft:PD0489 50S ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11552"
FT                   /db_xref="GOA:B0U5P8"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U5P8"
FT                   /protein_id="ACA11552.1"
FT                   /translation="MAGKRDKIRLISSADTGHFYTTDKNKKNTPGKLEFKKYDPRVRRH
FT                   VIYKEGKIK"
FT   gene            595802..597205
FT                   /locus_tag="Xfasm12_0548"
FT   CDS_pept        595802..597205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0548"
FT                   /product="cardiolipin synthase"
FT                   /note="KEGG: xft:PD0490 cardiolipin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11553"
FT                   /protein_id="ACA11553.1"
FT                   /translation="MEGTWLFALDWVIRLVALLWIPARTTPSAARSWLLLIGFVPVFGL
FT                   PLYLVFGHPWLSRKRVLRQALASHVIREWQRGLGALRWQPQENGVAAELVPLVEHQGDF
FT                   MPTRGNALDLLDDYQASLHLLINDIDSACERVHLLYYLMFDDAVGDAVVAALQRAAARG
FT                   VSCRLLLDAVGAKRGLRAYQQCLRAHGVEVHAMLPGGLRWRRSGRMDLRNHRKIAVIDN
FT                   RVAYIGSQNLACPDFVPHFPNRELVARVCGPAVSHLEAVFLSDWFVETGQRLGMRPDVP
FT                   ICEQNVAAQLVASGPAYPYENARDAVNTMIHLARRRIVLTTPYFVPDEATFSALRIAGT
FT                   SGVDVQLILSESNNQFLMAWAQEAYFEELLRAGIKIALYRPHFLHAKHLSVDDDIALFG
FT                   SINLDIRSFALNAEIGMICYDSRIVTRLREVESDYLANARQLNLVEWQQRPAWRRSREG
FT                   IARLADALM"
FT   gene            597548..598198
FT                   /locus_tag="Xfasm12_0549"
FT   CDS_pept        597548..598198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0549"
FT                   /product="Glutathione S-transferase-like protein"
FT                   /note="KEGG: xfa:XF1210 glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11554"
FT                   /protein_id="ACA11554.1"
FT                   /translation="MHNSVPLLLRSSSMKLYIKPGACSLADHILLRWSGSSFDLQFLDH
FT                   QSMKAPEYLALNPSGAVPALQVGDWVLTQNAAILNYITDIAPAERGLSGDGSLKARAEI
FT                   NRWIAFSSSDVHPMYWALFGGTTYLQDPQMIARSQDNLARNCVCCTSVLMHILSITIGL
FT                   LTDSVPVLMRICTSRCDGLKKSVWIFLVWMRYQRSLSVWRLIPGCRLHYRRKG"
FT   gene            complement(598374..599360)
FT                   /locus_tag="Xfasm12_0550"
FT   CDS_pept        complement(598374..599360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0550"
FT                   /product="Malate dehydrogenase"
FT                   /EC_number="1.1.1.37"
FT                   /note="KEGG: xft:PD0492 malate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11555"
FT                   /db_xref="GOA:B0U5Q1"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR010945"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U5Q1"
FT                   /protein_id="ACA11555.1"
FT                   /translation="MKALVRVAVTGAAGQIGYSLLFRIAAGEMFGKDRSVILQMLELPD
FT                   EKAQAALKGVMMELEDCAFPLLAGMVVTDNPDIAFKDADAALLVGSRPRGPGMERKDLL
FT                   MENAKIFTAQGAALNKVARRDVKVLVVGNPANTNAYIAMKSAPDLNPKHFTAMLRLDHN
FT                   RALSQLSTKLSKPVANIEKLIVWGNHSPTMYPDYRFATADGTPIIEAINDQAWNANSFI
FT                   PTVSKRGAAIIEARGLSSAASAANAAIDHMRDWLLGSNGKWITMGVPSDGSYGIPEGMI
FT                   FGFPVTTTNGEYSIVKDLPIDTFSKTYIDKTLAELEEERASIAHLLR"
FT   gene            complement(599493..599987)
FT                   /locus_tag="Xfasm12_0551"
FT   CDS_pept        complement(599493..599987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0551"
FT                   /product="Peptidylprolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="KEGG: xft:PD0493 peptidyl-prolyl cis-trans
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11556"
FT                   /protein_id="ACA11556.1"
FT                   /translation="MHLIAHLDTVRGPIKINLFADKTPLTVANFVNLAKRGFYDGLNFH
FT                   RVIANFMIQGGCPEGSGRGGPGYRFEDETNNGMCHERGSLSMANAGPNTNGSQFFITHV
FT                   ATPWLDGKHTVFGKVLDGQDVVDAIAQGDIINKITIEGDADGVLALKTDRIIEWNSILA
FT                   T"
FT   gene            600228..602057
FT                   /locus_tag="Xfasm12_0552"
FT   CDS_pept        600228..602057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0552"
FT                   /product="GTP-binding elongation factor protein"
FT                   /note="KEGG: xft:PD0494 GTP-binding elongation factor
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11557"
FT                   /protein_id="ACA11557.1"
FT                   /translation="MSIENLRNIAIVAHVDHGKTTLVDQLLKQSGTFSERAQVGERVMD
FT                   SNDQEKERGITILAKNTAIKWNGNRINIVDTPGHADFGGEVERVLSMVDSVLLLVDAMD
FT                   GPMPQTRFVTQKAFAMGFKPIVVVNKIDRPGARPDWVVEQVWDLFDCLGATPEQMDFPI
FT                   VYASALNGYASLESSARAGDMNPLYEAIMQHVQPPQVDLHGPFQMRISQLDYNSYVGLI
FT                   GIGRIQRGKVSTNMPVTVIDRIGNKHNGKVLQVLGFLGLERHEVEEAQAGDIVAISGIE
FT                   SLSISDTLTDPTAPDALPALSVDEPTISMTFQVNNSPFAGQKEYSGGKFLTSRQIRERL
FT                   ARETLHNVALRVEDTEDPDRFKVSGRGELHLSVLIETMRREGYELGVSRPEVIIKEIDG
FT                   ILQEPYEQLVVDVEEEHQGGVIERLGTRKAQLSNMELDGKGRVRLDYIIPARGLIGFQT
FT                   EFKTITSGSGLLFHIFDHYGPKADGPIAKRINGVMISNGHGKAPGYALMGLQERGRLLI
FT                   DAGEDIYEGMLVGIHSKDNDLTVNALREKQLTNIRASGKDDAISLTPPIKMSLEQALEF
FT                   IEDDELVEVTPKAIRLRKKYLSENDRKRASRTG"
FT   gene            602077..602559
FT                   /locus_tag="Xfasm12_0553"
FT   CDS_pept        602077..602559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0553"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC1003 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11558"
FT                   /protein_id="ACA11558.1"
FT                   /translation="MTDKPCNPDSHSHSGLHAIALFEAFKGVLSLVGATGLELLGPLPL
FT                   QNVVSNLIRLLHLDPEHGFLPSLLKMIDPNAVHLAAVVMLAYGVLHLIEFWGLWRVKAW
FT                   ASLLGCVSAAIYLPFDIYAIIHHPGWPSWSVLAINLLVVAVLTRDLIRRRYASALH"
FT   gene            602785..604047
FT                   /locus_tag="Xfasm12_0554"
FT   CDS_pept        602785..604047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0554"
FT                   /product="colicin V secretion protein"
FT                   /note="KEGG: xft:PD0496 colicin V secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11559"
FT                   /protein_id="ACA11559.1"
FT                   /translation="MKDLFRKEVLEAKRTSWLGGISLIQPIKAWLLVFASSVMALLVVV
FT                   FLCVGTYTRRSTVTGQLVPSKGLVTVVAPATGMVSHIKVSEGANALSGQILALVTVPRT
FT                   TLASGDAIRALEQQLQERKQGLSMGQQAQAQVLSAQTSGIEAQLSAAQRELAQIEIEIA
FT                   TRQKQIQIANETLQRLKQLEDARYVGTLQIKQQESTVLDYTSQMQAMQRQAMMTRRSIA
FT                   QLQQSLRELPGQYQNSQATYRRELAQLEQEKVETEARGALSVVSPIDGIVATQIVKSQQ
FT                   TVQAGQPMLSLLPVNGELEAELLLPSSAIGFIEQGDEVRLRYQAYPYQKFGHQRGQVSR
FT                   ISRSALTSSELAALIGNTQQTEPYYRVVVKLPQQSITVYGRHEPLKPGMLIDADILSEK
FT                   RRLIEWIFEPLYSLRGKVSDN"
FT   gene            604272..604526
FT                   /locus_tag="Xfasm12_0555"
FT   CDS_pept        604272..604526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0555"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF1217 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11560"
FT                   /protein_id="ACA11560.1"
FT                   /translation="MGIDKLRELKTQEIESVDGGVYFLNLNYRSLGGLIRTPMLTFFGI
FT                   GNTAIAVNFGRGSSFYIKPTLNIDTVNATSITQEVHQGT"
FT   gene            604674..604979
FT                   /locus_tag="Xfasm12_0556"
FT   CDS_pept        604674..604979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0556"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF1218 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11561"
FT                   /protein_id="ACA11561.1"
FT                   /translation="MEMNQMRELAFQEIENVDGAFFFVIYPESFSNGTVSSVSFTAGSS
FT                   ATVNTGSLTLPDPVVSGPVLSGIGFFGTGTGFLRTSSRHVSIGTVNLYNVIQKINL"
FT   gene            605206..605439
FT                   /locus_tag="Xfasm12_0557"
FT   CDS_pept        605206..605439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0557"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF1219 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11562"
FT                   /protein_id="ACA11562.1"
FT                   /translation="MRELVMQEIRSVDGGIFFFVSPNVSSSSSFDSFPDSALTPPFKHS
FT                   GSNVSLFGFNFGRIVSQDFYVRNVKIYNIIQE"
FT   gene            606114..608237
FT                   /locus_tag="Xfasm12_0558"
FT   CDS_pept        606114..608237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0558"
FT                   /product="colicin V secretion ABC transporter ATP-binding
FT                   protein"
FT                   /note="KEGG: xft:PD0499 colicin V secretion ABC transporter
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11563"
FT                   /protein_id="ACA11563.1"
FT                   /translation="MRSVLQSEVSECGLASLAMVANAHGKHLTLSQLRQRFPSSLKGAK
FT                   LTHLVHIAQQLGFSTRPLRLDMEDLGKLKLPCILHWDLNHFVVLAKVGTTKVTIYDPAI
FT                   GKRKLSLNEVSKYFTGIALELTTTTEFKQQKPPPSISARQLTGPIRGLWRALAQILLLS
FT                   LALQVFVVLSPFYMQWVVDQVLVSADRDLLVVLGLGFGLVLLLQIAIGLFRSWSVIYLS
FT                   SRLGLQWMGNVFAHLLKLPLEYFEKRHLGDLTSRMSSVQSIQKTLTTSFVEAIIDGLMT
FT                   LVTLGLMLVYSWKLALVTLVAVVLYMVIRAVSYWPVRDCTEQQLVVGAKQQTHLLESLR
FT                   GIQSLKVACEESLRRSTYENLLNDTVNQEVRLARMSLGFSTASQLVFGLERIAVIWYGA
FT                   TLALSNVFSVGMLIAYLSYKDQFASRISSLIDKWVEFRMLRLHGERLADIVLTPPEEDY
FT                   ELPEMQLPKKEPDIEVEGLSFRYGEDEPWVLKDCSFKVAAGESVAIIGASGCGKTTLMK
FT                   LLLGLLKPTAGTIRISGRDLHKFGTRNVRSIVGAVMQDDQLFAGSVADNISFFDPDFDL
FT                   ERIEAAAKLAAIHEDIAAMPMGYHALIGDMGSALSGGQKQRVILARALYRQPKLLFLDE
FT                   ATSHLDVMRERLVNDAVHQLKLTKVIVAHRPETIASTDRVVILDHGRIVQTVAMPEDRD
FT                   DSIQIVHNTIQST"
FT   gene            complement(608766..609545)
FT                   /locus_tag="Xfasm12_0559"
FT   CDS_pept        complement(608766..609545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0559"
FT                   /product="ABC transporter permease protein"
FT                   /note="KEGG: xft:PD0500 ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11564"
FT                   /protein_id="ACA11564.1"
FT                   /translation="MTNTPSNTQRNLTALSTIVRREVRRILRIWSQTLVPPAITMGLYF
FT                   LIFGKLIGTRVGQMDGFDYMHFIVPGLVMMSVIQNSYGNISSSFFGAKFGRHVEELLVS
FT                   PMPNWVILWGYVAGAVLRGVMVGAIVMVIAMYFTPVRLPYPLVTLSTAVLGAIIFSLAG
FT                   FINATYAKKFDDIAIIPTFVLTPLSYLGGVFYSVKLLPGWAEAATYANPIFYMVNAFRY
FT                   GLLGHSDVPLWKAYALMLTFIAGLSALSLWLLRREID"
FT   gene            complement(609624..610556)
FT                   /locus_tag="Xfasm12_0560"
FT   CDS_pept        complement(609624..610556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0560"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="KEGG: xft:PD0501 ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11565"
FT                   /protein_id="ACA11565.1"
FT                   /translation="MNSTIPNTPALHVYNLHKTYSNGTQALKGISLDITPGDFFALLGP
FT                   NGAGKSTLISIVSSLVNLSSGSVEVFGIDLVHERSAAIRLIGLVPQEINFNLFEKPLDI
FT                   LINYAGFYGIPYAKAEALAEIELKRAHLWEKAHVMSRTLSGGMKRRLMIARAMMTQPRL
FT                   LILDEPTAGVDVEIRRDMWRVLQEINANGTTIMLTTHYLEEAESLCRNLAIINGGQIIE
FT                   KGPMRTLLAKLDVEGFLLDIDGTLPAQLPSIEDTTLNALDDHTLDLSMPRAMNLNHVFA
FT                   ALSAANIQVRSMRTKSNRLEELFIRLTST"
FT   gene            611399..615085
FT                   /locus_tag="Xfasm12_0561"
FT   CDS_pept        611399..615085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0561"
FT                   /product="PilY1 gene product"
FT                   /note="KEGG: xft:PD0502 PilY1 gene product"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11566"
FT                   /protein_id="ACA11566.1"
FT                   /translation="MKEQDLMVGMSRIILNNLFFFRCVVAVFSAHSLVISGAVHAGVQI
FT                   SQSPLHGGGDVPGNLAIVASIEFPTVISVANLADTYTPGGRYVGYFDSNKCYKYHYSPQ
FT                   ESDRYFYPVASPRPQANYGCNTTGGVWAGNFLNWAATQTIDPFRSALTGGYRVRDTVSE
FT                   IILEKAVMDRAYPGNFPRRTIQGLALTTSVPAQWLRFRMRIDGLGNRMRFTQFTGLSMD
FT                   PLEMEGQPYDPSRHPLNSNDRGVYEVSVRVKVCDASVGLESNCVAYPSGFYKPEGLIQE
FT                   YSKRVRYSVFSYKNDDYYLDDGGVLRARQKFVGPKTYYPEQGEKTNPHAEWDPQTGVLY
FT                   DNPNPEDAKATTHRVGRTIGNSGVINYLNKFSQMETGKNTKGFDPVSELYYTAYRYFKR
FT                   LGNVPEYSVLTGSVNEKYQQADAFPVITDWDDPIRYACQSNVVLGIGDTHTNFDKNLPG
FT                   NTNTTGEPVKPQAVRNDRSIDVVKRMVQIFQMEGMRQQDAMTSAVAPSFNFLVPGAGNN
FT                   SAYIAALAYDARTKDMRPDLEGDQLLTTHWVDVVEGGDYKIPISTNQYWLAAKYGGFQV
FT                   PAGYDPDKTVNPLSEATWWTNGEYVNGDPNAKRADNFYVAADAEKMVASLKQAFSRIVA
FT                   EIKGAGTGLSSNSARLETGAVTYQAQFFSGTWRGDLIAYHVDKVTGALTPFWNANFPAW
FT                   EQRVIKFANATTLQDFTKKNLGQTALASASAQQINYLRGDRSQEGNVPGKLRIRSGIMG
FT                   DIVNSQPLYVGAPNGRLYTTANFTGASAYAAFAAQQANRVPVVYVGANDGMLHAFDANT
FT                   GKEIFAFVPRAAMPKLLEYTDQNYVHQYYVDGELTAADIYDTKLGWRSVLVGTLGRGGK
FT                   GLFALDVTDPSNIRLLWDKTSADIGGLGNTLSKPMIVQTSDGTWSVLLGNGPNSTADNA
FT                   QLIVMNLLTGHAAQVPVSKTSNNGLSGVFPWSSQSNGITDRVYAGDLLGTLWRFTFSDN
FT                   AWKVVPLFTATYQGKAQPISATPLGAIERSTGRMWIFFGTGRVLSSHDMDNKEVQSWYG
FT                   LIDQGTTISGRTGLSQVQIVDEGVVNGYAVRTVSDPKNIGTDGWYMDLISPKSGKQGER
FT                   MIVSNMFRGAALIGTTRIPDNSDICKLSGSGFVMAINPFTGGRLGQWFFDLNTGGGSGG
FT                   SGGALNGNPVSGVGVSSAPNSPVFTGNIMQIGADDGTVTSLKTPSSGGLNINRVSWREI
FT                   LRP"
FT   sig_peptide     611399..611524
FT                   /locus_tag="Xfasm12_0561"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.726) with cleavage site probability 0.724 at
FT                   residue 42"
FT   gene            complement(615494..615982)
FT                   /locus_tag="Xfasm12_0562"
FT   CDS_pept        complement(615494..615982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0562"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0503 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11567"
FT                   /protein_id="ACA11567.1"
FT                   /translation="MLRFATAGFFYILLTPMVKASTPHYSVNTPFNQSAPTTVVTPMNT
FT                   MFYNAKTPLGIPGKALSQRYNNEYLMDPMLLHLRVNSRQSIAKTKTTSTESTANSNNKT
FT                   ETDYKKQTIYDNTPWRFNMNQQGKRMTADEFDTWMKARGVHIIPSQTNNNVQSVSEAK"
FT   sig_peptide     complement(615920..615982)
FT                   /locus_tag="Xfasm12_0562"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.925) with cleavage site probability 0.925 at
FT                   residue 21"
FT   gene            616247..616456
FT                   /locus_tag="Xfasm12_0563"
FT   CDS_pept        616247..616456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0563"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xfa:XF1227 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11568"
FT                   /protein_id="ACA11568.1"
FT                   /translation="MCVSGGIEDDFYFLVLMCCVICQSVHPWLIFPASAYLGLKVILFV
FT                   SVVCDSALYDFVMLDLLVDSQLPS"
FT   gene            complement(616901..617290)
FT                   /locus_tag="Xfasm12_0564"
FT   CDS_pept        complement(616901..617290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0564"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF1228 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11569"
FT                   /protein_id="ACA11569.1"
FT                   /translation="MNKFTAMTDRALKHTMDLAQQANDRIRRTAPQASQWLKSGAALEV
FT                   VKSSGKVTGKLIKRNPSIAVAVAAVSAGLAGYMIYRKYKMNHKKNIVINGKGEHMLNEP
FT                   ADHVEVRRSIHRHRSAAAPTDTNSG"
FT   gene            complement(617557..620058)
FT                   /locus_tag="Xfasm12_0565"
FT   CDS_pept        complement(617557..620058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0565"
FT                   /product="ATP-dependent helicase"
FT                   /note="KEGG: xft:PD0505 ATP-dependent helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11570"
FT                   /protein_id="ACA11570.1"
FT                   /translation="MNHHALPIDALLPAITTSLSNHPRLILEALPGAGKTTQVPLALLD
FT                   APWLNGRSIILLEPRRVAARNAALFMARQCGEEVGGLVGYHIRFESKVSARTRIHVVTE
FT                   RILTRIIQDDPLLDGIGALLFDEFHERHLASDLGLALALDVQTQLREDLRIVVMSATLQ
FT                   GQRLAQFLDAPRLTSEGRAYPITITHFPARRDESLETQARRAIQHALDTHQGDVLTFLP
FT                   GQREIARLQAILEKTLSPELHVMPLHGELPLQEQTRVLEPDQHGRRRIVLATNVAESSI
FT                   TLPGISVVIDSGLAREPAYDPNTGFTRLDVVSITQASADQRAGRAGRLAPGWAYRLWPQ
FT                   SQRLEAQRRPEMIQTELSGLALELTAWGSSTLRFIDPPPSGALSAARELLQRLGAISNT
FT                   STLTPLGQRMLALGIHPRLAAMLLAPHDPQEQALACDLAALLDARDPLRGSGDALISRW
FT                   RALAELRSGCLPHDTRRSTLRAIDAATHQWRRRIRCDTTPPDAIEAHTLGNLLTHAFPE
FT                   RIAARHSSDPLYYVLANGRRMRLFDNSALHGEPWIIASELHHGIKDIQLLCGAPLDERR
FT                   LHADFPERFIQHDVIRWETDKRALVAQRESCFDRIVLDVRPAGRIDPVQAANVLTGAVR
FT                   TLGLDTLSWTEHLRQWQARAVALRHWMPELELPDLSNTTLLATLDTWLRPAFAGKTRLD
FT                   ALDEAAFEQAVKSLLSWTQHALIDRHVPAHIIVPSGMGRHIDYGLADDGTPQPPVLSVK
FT                   LQELFGLPDTPHIAKNRIPLTLHLLSPGGRPLQVTQDLKSFWTNTYPEVKKEMKGRYPK
FT                   HPWPDDPWTATATHRTKSPGK"
FT   gene            complement(620055..620294)
FT                   /locus_tag="Xfasm12_0566"
FT   CDS_pept        complement(620055..620294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0566"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11571"
FT                   /protein_id="ACA11571.1"
FT                   /translation="MHHTIPTQSNSILNPTASPLKIGGGVKHPFAMRCYDPRVLGSHGR
FT                   LLECLLLSIKVRNQAVQKDAFNGGHLNPHLLCAA"
FT   gene            complement(620573..621055)
FT                   /locus_tag="Xfasm12_0567"
FT   CDS_pept        complement(620573..621055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0567"
FT                   /product="GAF domain-containing protein"
FT                   /note="KEGG: xfa:XF1230 GAF domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11572"
FT                   /protein_id="ACA11572.1"
FT                   /translation="MLAPFILTGNKPEQYAQLEAQAKALIHGETDRIANAANLAALIFH
FT                   SLPGLNWVGFYFYDGRELVVGPFQGLPACIRIPLDKGVCGTAARTQRTQRIDDVDTFPD
FT                   HIACDSASRSELVVPLLKDDTLIGVLDLDSPTCARFDSDDQTGIESLARVFVSSLR"
FT   gene            621368..623206
FT                   /locus_tag="Xfasm12_0568"
FT   CDS_pept        621368..623206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0568"
FT                   /product="pathogenicity protein"
FT                   /note="KEGG: xft:PD0507 pathogenicity protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11573"
FT                   /protein_id="ACA11573.1"
FT                   /translation="MLLECEIYHSILLPRYTAQMIRRFIPPMLSLWLLFASLAQANATV
FT                   DKIQIKGLDKGDDVEMMKNITVSLSLYSVVGKEQGESRLEYLFSQAEFQTRQALEPFGY
FT                   YAPAIRIDAPRQNDHITVVIYVDKGEPVRVRQAHVAMTGAAAQDHYLQRDLEDFKPKLG
FT                   EIFNHPTYEASKVRITRRLAERGYFDADFTRRQVEVTRATYAADIDLIWESGRRYDMGP
FT                   VRFHYDYFHEGLFNPLVYWDEGSYFHEGKLDRLRESLTKLDYFSSIDIQPKPEEADSEG
FT                   NVPVDVKLERAKSKIYTAGISYGSESGAGLRAGVERRYMNARGHKMNARLDYAQNRKSL
FT                   TTAYQIPAFKWLDGWYIFSARAYDEQTQYIDLRNVKLSAARSGQINRHLTATASLNALR
FT                   ERWRYGGDDGTNTVAYQQSTLVYPQLEASYVDVDDATFPRNGSVATVLLRGGASALGSK
FT                   SNFTQLHGQLRWFHGLGSSSRLILRGEAGTTWASDLVAMPPSLRFFAGGVNSIRGYAFR
FT                   EVGPRTAKPDAFALGAKHVFSAGAEYEYYYKGGPFGGAVFVDSGSAFNRYPDWHTGVGI
FT                   GLRYRSPVGPVRVDIARGLNSPDSKIQLYIDIGANL"
FT   sig_peptide     621368..621493
FT                   /locus_tag="Xfasm12_0568"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.705) with cleavage site probability 0.657 at
FT                   residue 42"
FT   gene            623203..627024
FT                   /locus_tag="Xfasm12_0569"
FT   CDS_pept        623203..627024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0569"
FT                   /product="pathogenicity protein"
FT                   /note="KEGG: xft:PD0508 pathogenicity protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11574"
FT                   /protein_id="ACA11574.1"
FT                   /translation="MNAPQPIGALRRRRLWFGIGLIATGLFLTLLALLYWLLQTTSGRD
FT                   VLLAQVVTRLPAATALTWDRAEGAVAGPLTLHNIEFRYQDIHFRAARLRMDPDIWRLLL
FT                   LRLRLDVLEMSNASLSLGQSEEPFKLPSWPDVLPSINVPLALQIDTITIDNFRISKLKQ
FT                   PLIHLRRIRGAVNVADGELKIQRLAVDSDRGNIRADGYYRPRHDYSTDLTATAVLPSVR
FT                   GRPPASFGLVIRGDLDRLQLALAGRAPAPLQADVVLNGRSDPRWTFSAASEHFEPGLLL
FT                   PGELTGTPSATALAFNVQAQGQGGKADLKGQFKQGEQTIVLQPSRLRLANQMLMVEPLV
FT                   IDAFGGRTNLRGKVDLRDPANTRFHFSVNARGLSFKPSPEPGNTQVRAVPVVLEEAGLG
FT                   VSGTLRAWAAVGRARLTRDAQQARLIFDVRGDAEHATFKQVQAATPGGLLDFTGGVTWA
FT                   PALRWDLKAELAQFDPGYFIPGWNGHVSGQLTSQGRQRTVSSGIEAIVAVPGLNGQLRQ
FT                   RPMQASGRFTLKDHQGEGAFQLGIGDSHISAKGKVGPHLDLAVQLQSLHLNDLLPSKEG
FT                   TLKGSLLLRGPAHTPDVIVDLNGTSLRWNDYRAKQFALHGHLPWRGNNGKLTLQAQELE
FT                   IGTLLDSVRIHASGAVENLNLQADVRHAMVLLTLHGGVHRDGARWRGNLSQLRIEPAKG
FT                   PAWALRAPAQFVMNAPAFTLFAACLDAQGGGALCLHADWPHEGLVLKGQALPLTLVHPW
FT                   LPKKNGRSINLRGVLTLDGHLRPHGDAWEGSFRASSLEGGIRLGEPRYADVLGVQDRGE
FT                   LVRYDQFSVQVDLTSQHIVGKLGIGFQGNGFVDAKFNTGWDPYAPLTGDLYMNMSRLYW
FT                   LEMFVPDIGNPRGLIEGHVSLRGTRSGPLLGGEATLRDFTAEYPSIGLNLSQGQGRFTA
FT                   QPDGSARILASVKSGDGTLNIDGGLSWFGENNPLQLNIRGRNVLAYNTSELRIVSDPDL
FT                   RFGLINNTMQLQGEVAVSEADIDLERLDRGVSVSEDVVVLDPIDPERTTVSPLEMNLRI
FT                   VLGDKVNMSGFGLKGGLSGQMQIRARPGREMTANGGLDVRGRYKAYGQDLTITRGQLVW
FT                   NNNIVSDPRVNIRAQRRIADITAGIDVSGRAQSPRAQVWSDPVMSQSEALSYLVLGRKL
FT                   ATASSDENQQVASAAAALSAGGGLIASQLGAKLGLDDAGISQSSTMGGSVLGFGKYLSP
FT                   KLYVGYGVSMVGSGSVLTLKYLLSRGFDLEVESSTVETKGSVNWRKEK"
FT   gene            complement(627124..627243)
FT                   /locus_tag="Xfasm12_0570"
FT   CDS_pept        complement(627124..627243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0570"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF1233 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11575"
FT                   /protein_id="ACA11575.1"
FT                   /translation="MFLFEHEHIGNSAMSLAIGASFLVIDQPGFIGQAMRCKP"
FT   gene            627784..628680
FT                   /locus_tag="Xfasm12_0571"
FT   CDS_pept        627784..628680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0571"
FT                   /product="carboxyphosphonoenolpyruvate phosphonomutase"
FT                   /note="KEGG: xft:PD0509 carboxyphosphonoenolpyruvate
FT                   phosphonomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11576"
FT                   /protein_id="ACA11576.1"
FT                   /translation="MSTSLPIQTPGQCFRTALMTERPLQVIGAMNAYHALLAQRAGYRA
FT                   LYLSGGGVAAGSLGLPDLGINTLEDVLIDVRRITDVCDLPLLVDIDTGFGPSALNIERT
FT                   IKTLIKAGAAACHIEDQVAAKRCGHRPGKEIVSLSDMADRVKAAADARTDATFFLIART
FT                   DAIQAEGVEAAIERAQAYVEAGADSIFAEAVSDLETYRHFVERIRVPVLANMTEFGKTP
FT                   LLTREQLEAVGVAMQLFPLSAFRAANKAAETVYMAIRRDGHQQAVLPHMQTRAELYERL
FT                   DYHAFEQRLDALSARST"
FT   gene            complement(628998..629073)
FT                   /locus_tag="Xfasm12_R0029"
FT                   /note="tRNA-Lys4"
FT   tRNA            complement(628998..629073)
FT                   /locus_tag="Xfasm12_R0029"
FT                   /product="tRNA-Lys"
FT   gene            629586..629741
FT                   /locus_tag="Xfasm12_0572"
FT   CDS_pept        629586..629741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0572"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF1235 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11577"
FT                   /protein_id="ACA11577.1"
FT                   /translation="MPPLAGSGTTGVAALRAKHRFIGMALSLVYSDVAKQRLSDRVCGL
FT                   IRDVYL"
FT   gene            629728..629868
FT                   /locus_tag="Xfasm12_0573"
FT   CDS_pept        629728..629868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0573"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0995 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11578"
FT                   /protein_id="ACA11578.1"
FT                   /translation="MCICEGLELSQSFTVAAVIASGLIDTPYTLALIRNFIVLKLGIGG
FT                   K"
FT   gene            629865..630173
FT                   /locus_tag="Xfasm12_0574"
FT   CDS_pept        629865..630173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0574"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0511 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11579"
FT                   /protein_id="ACA11579.1"
FT                   /translation="MIMIRKALRRIPDYLPNMRLLVEYVMIAVLVSLAAHAVLSWVNHA
FT                   KLTQRATHIQEQVASMERTLNEKATMNAEQHAAIVQLLLLRNSDSRAVAVPRCTREL"
FT   sig_peptide     629865..629978
FT                   /locus_tag="Xfasm12_0574"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.707) with cleavage site probability 0.560 at
FT                   residue 38"
FT   gene            630489..630626
FT                   /locus_tag="Xfasm12_0575"
FT   CDS_pept        630489..630626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0575"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF1237 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11580"
FT                   /protein_id="ACA11580.1"
FT                   /translation="MLWLKSTSWNLGCRLAGSKNRNTATIKNAFLEALDYLGGVPALAE
FT                   "
FT   gene            630631..630816
FT                   /locus_tag="Xfasm12_0576"
FT   CDS_pept        630631..630816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0576"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF1237 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11581"
FT                   /protein_id="ACA11581.1"
FT                   /translation="MQIARNFYTLAARLIPKQTHIASKFALNSADVAELDAAIAVLTTQ
FT                   SCLGIIAGRKNAPPLY"
FT   gene            630797..630940
FT                   /locus_tag="Xfasm12_0577"
FT   CDS_pept        630797..630940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0577"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xfa:XF1238 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11582"
FT                   /protein_id="ACA11582.1"
FT                   /translation="MHRRCTKRLANYPAYAKQHAFHVMGATMRERLLILANQSGKTAVC
FT                   LS"
FT   gene            631055..631726
FT                   /pseudo
FT                   /locus_tag="Xfasm12_0578"
FT   gene            complement(631991..632242)
FT                   /locus_tag="Xfasm12_0579"
FT   CDS_pept        complement(631991..632242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0579"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11583"
FT                   /protein_id="ACA11583.1"
FT                   /translation="MYRSRHLLQPPRIQATPHLAVHRYVVANHCGTFAGAHQNGTASVH
FT                   GSTDTSCRVWMRCWHDSEQRFDDKRGDADNTHAKHPLK"
FT   gene            632383..635088
FT                   /locus_tag="Xfasm12_0580"
FT   CDS_pept        632383..635088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0580"
FT                   /product="aconitate hydratase 1"
FT                   /note="KEGG: xcb:XC_3213 aconitate hydratase 1"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11584"
FT                   /protein_id="ACA11584.1"
FT                   /translation="MVPKGGPLSPHRHSRYVDYTAAAVPSPMHNRYCKPLPGTPFHYCD
FT                   ARAAIDALCPGAYAALPYVARVYAENVLRRAAPDQWPAYLGQLIGRRCDTDIPWFPARI
FT                   VCHDILGLTALVDLAGLRDAIAAQGGDASQVNPTVPVQLIVDHSLAVEYGGSDPEAVAK
FT                   NRAIEARRNADRFHFIEWTRHAFENVTVIPPGYGIMHQINLEALSPVVAVQDGVAFPDT
FT                   CIGTDSHTPHVNALGVVAIGVGGLEAESVMLGRAVWLRCPESVGVELHGRPRPGITATD
FT                   IVLALTAFLRQARVVGAYLEFRGEGVAALTVGDRATIANMAPEYGATAALFFIDAQTVE
FT                   YLRLTGRDKAQVALVDTYAKQAGLWADTLEGAQYARLLHFDLSSVARTMAGPSSPHHQL
FT                   PTSALTERGIAGGLAQARAEEAAGHLPDGAVIIAAITSCTNTSNPRNLIAAGLLARNAH
FT                   ARGLRCKPWVKTSLAPGSQAVPLYLEAAGLLYALQQLGFGVVGFACTTCNGMSGALDPL
FT                   IQHAIMARHVHTVAVLSGNRNFDGRIHPDATQAFLASPPLVIAYAIAGTIRFDIERDVL
FT                   GHDADGTPVMLKDIWPGDADIDALVRRSVHPEQFRRVYMPLLQASRQWRECVPPLYAWH
FT                   PQSTYIRRPPYWEGVLASARTLRGLRPLAVLGDNITTDHLSPSNAILPNSAAGEYLARM
FT                   GVPQEDFNSYATRRGDHLTAQRATFANPMLLNELVRDADGKVRQGSLTRLEPDGTVMRM
FT                   WEAIEIYMQRSQPLIIIAGADYGQGSSRDWAAKGVRLAGVEAIVAEGFERIHRTNVIGM
FT                   GVLPLTFHPGTTRITLRIDGTELFDVCGVPSVGAVLILRIQRRDGSVAEVPVTCRLDTA
FT                   EELSIYAAGGVLQRVAQQMLVTTSGTSQRV"
FT   gene            635187..635357
FT                   /locus_tag="Xfasm12_0581"
FT   CDS_pept        635187..635357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0581"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF1242 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11585"
FT                   /protein_id="ACA11585.1"
FT                   /translation="MPPLSYVEVSMPDEIPQGSTFMWAMRTQYVRCPGASSVFEWRCRY
FT                   RCDWQESFSMM"
FT   gene            635436..636632
FT                   /locus_tag="Xfasm12_0582"
FT   CDS_pept        635436..636632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0582"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0514 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11586"
FT                   /protein_id="ACA11586.1"
FT                   /translation="MLPLPQCRIPATYLRGGTSKGVFFRLEDLPPACRVPGPARDALLL
FT                   RVIGSPDPYGKQIDGMGGGTSSTSKVVIIAPSAYPNHDVDYLFGQVAIEGACVDWTGNC
FT                   GNLSAAVGPFAIAAGIVDPARVPHRGICSVRIWQANIGKTIVAHVPILDGQVQESGDFM
FT                   IQGVAFPGAEVRLEFLNPADVGGDRAMFPTGHLIDTLEVPGLGPIEATLINAGIPMLCV
FT                   DAHALGYTGTELQEAINGDPHALVCLETLRAYGALRMGVIGHLEDMVQHQHTPKLAFVA
FT                   APADYVASGGRHVHATEIDVLVRAMSMGRLHHAMMGTAAVALGTAAAIPGTLVNRAAGG
FT                   GLRRVVRFGHPSGTLQVGAEVHQVNGQWSVANVRMSRSARVLMEGCVRVPAESVQNVD"
FT   gene            636646..637077
FT                   /locus_tag="Xfasm12_0583"
FT   CDS_pept        636646..637077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0583"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11587"
FT                   /protein_id="ACA11587.1"
FT                   /translation="MHVLLSWGAVRCFCACRVFATITLGWLYIFPSDSHTARQVQEPML
FT                   NGRIALCSVSSSTLMFHHLRFHLCHVQNGSASACLITDADFSALPTCWLCGVIQRPRSI
FT                   SVKLRKKRSCGFNQLCLVRARRAVYSFLRGASHLALHLP"
FT   gene            complement(637553..638071)
FT                   /locus_tag="Xfasm12_0584"
FT   CDS_pept        complement(637553..638071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0584"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF1248 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11588"
FT                   /protein_id="ACA11588.1"
FT                   /translation="MRLNYNGRQIFHFGVNASQIHPAIQVWTKRFLPPSAVISHAKERS
FT                   AAELMKRRTMSNEPSPQEQETLRQVAASIWQPWIVNYWDMNAAVGNILATVTGEILKCS
FT                   IAYSFVPQQILDPFTKPQLKDAWRLVKAYFKQIIHENYKISQNQRYQSCIYVAAANWRS
FT                   PIEMASAGI"
FT   gene            638851..639744
FT                   /locus_tag="Xfasm12_0585"
FT   CDS_pept        638851..639744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0585"
FT                   /product="arginine deaminase"
FT                   /note="KEGG: xft:PD0517 arginine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11589"
FT                   /protein_id="ACA11589.1"
FT                   /translation="MKDAMSIIKKKTIRMLFPQWQGGNQELYSLGARLLAWLAPETEAP
FT                   VFEVNVPDFKKETPEPERGVIYRQQLFKQYDEAYRLLEREDPDYVVIFGGDCLVDLAPF
FT                   AWLNEKHHGQLGVLWIDAHPDIKTPQDSMNGHTMVLGSFLGEGDNEFAAKVKVPLKPSR
FT                   VMFAGLIETGLTEQESEVIHRLGLNVAKPEVLFDNSQTVIDWVRKEKIEKLVIHFDLDV
FT                   LNPDVFRSLLFAEPEPEFDWRATYPVGQLRLAQVIRLIRDVAAETELVAIGITEHLPWD
FT                   VWHLKESLSKVPLLNR"
FT   gene            640264..645189
FT                   /locus_tag="Xfasm12_0586"
FT   CDS_pept        640264..645189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0586"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0518 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11590"
FT                   /protein_id="ACA11590.1"
FT                   /translation="MRDRVAMMLRPLVCGWIPRAVLLLTVAFSFGCNRNHNGQLPQSSG
FT                   EPVAVAKEPVKGFVLVRAYPDQHDGELALALEFSQPLAATQEFDTLVRLEQGSGNHDGG
FT                   WSLSDDAKTLRYPYVEADKHYTVLISGDLLAATGSRLGKSRKEPVYTGELDPVVGFASR
FT                   GSILPARGSRGVPVVSVNVPEVDVEFMRVREKALPAFLARYHNAGQRSSWELSNQGNSR
FT                   KRLSELADPVYVTRFVLDGKKNERALTYLPIQNIRELREPGLYFAVMKPTGSFSDAFET
FT                   AFFSVSNIGLHTRAYKDKLFVHTASLRSGNPYKQVDLLVLDAKGETVLQGATDDNGNAL
FT                   LNYTLNAGHVLVSRNGRDISILPFNQPALDLSEFAVAGRENPWFDVFAWSGRDLYRPGE
FT                   TLRISALLRDSDGKPVKPQPVFLRLKQPDGKTFRETRLQPAEQGYLEFTQKIPSDAPTG
FT                   RWRVEFRTDPASKEAVQGLAVRVEEFLPERMKLELSSAQPVLRAKAPFTLTADAAYLYG
FT                   APAAGNRFTANLAVAVEQHPLDNMPGWFFGDATLQLPRGAKETIDITLGADGHLVHDIV
FT                   LPEEAKPVSPMAVVVSGSVYESGGRPVTRSLKRVLWPADALVGVRPLFDVASGADANGM
FT                   ARFELTRVGVDGKPQSAKGLKATLVRELRDYHWRYSDGRWDYDFTRRFENKETRTVDIS
FT                   TSHTTTLSLPVEWGDYRLEVFDPVTGLTMRYLFRAGWSWGDDNRGLDARPDKVKLALDK
FT                   TSYRAGDTLKVTITPPHPGKGLLLVESDKPLYVQAIDANPSTTLEIPVTADWERHDVYV
FT                   TALVFRGGSASNNTTPARAVGEAYVPMQRKERRVAVGLVVPKQMRPAQSLPVTVSVPEL
FT                   AGKQAHVTISAVDAGILNITGFPVPDAAAHFFAQRRLSVDAYDIYGRVIESFEGGTGRL
FT                   KFGGDMALPPLPQAKRPTARSQTVDLFSGAVKLDAKGNAHIQLPVPDFNGALRVSALVY
FT                   SDTRYGQRDAETVVRAPILAEASMPRVMAPGDRSTVTVDVQNFTGKQGKFAVKVEGVGP
FT                   LVVAEAGRSVTLGIDGKTTLNFPLRALEGNSVAQVRVRVEGNGSKAERHYDLPVRAVWP
FT                   QGLRTQAHVLNVLAPIAFDPALAKGLMPDSVNARLSVSALAPIPFASVLQGVFEYPYGC
FT                   AEQTASKGYAALWLDDATIRSLGIQGVTPAQRLERLEGALGRLASLQTTNGHFSMCGGN
FT                   SDVNPVLTPYIAGFLLDAKDAGFAVSDTVLQKALNRLSEDLLSGAHLFYGNDQSEALMF
FT                   AHQAWSGYVLARVNRAPLGTLRTLYDNERGKAVSGLSLVHLGVALSLQGDRKRGEAAIE
FT                   AGFAKSEGGRPEVFGDYGSVIRDNALMIALVRAHGLAKPAYEARVMALGRDLQARRRSG
FT                   WLWLSTQEQVALAQLGRALLVDHKKQVSGTLYVGKQREDIAASRLIGRSFDAAALARGV
FT                   RFVPQGDVPLYASFEVAGIPRQAPVSDDSQLLVVRRWYTVDGKPWTPGPLKEGQALIVR
FT                   VSVTSKQNMPDALLTDLLPAGLEIENFNLGETRQWADVTVDGIALSERADAADIKHEEF
FT                   RDDRYVAMLQLTGGRTANLFYLVRAVTPGSYNVPPSLVEDMYRPALRGTGRVAPATVTV
FT                   VQP"
FT   gene            complement(645295..646308)
FT                   /locus_tag="Xfasm12_0587"
FT   CDS_pept        complement(645295..646308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0587"
FT                   /product="lipase"
FT                   /note="KEGG: xft:PD0519 lipase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11591"
FT                   /protein_id="ACA11591.1"
FT                   /translation="MKFTRKLATAAILALASTSCQAAGSPGVEHRTQAFLEDLAKGGGA
FT                   PIETLSPANARQVLVNAQKGAKLPPADVSEKTITIDGKQIVLNIVRPAGVKGILPGFMF
FT                   VHGGGWVLGDFQTHERLVRDLVSDSGAVAIFVNYTPSPEARYPVAINEIYAATQWVAEH
FT                   GAQINVDGQRLAIVGNSVGGNMATVVAQMAKEKGTPALRAQVLFWPVTNANFENTSYNE
FT                   FANGHFLTKNMMKWFWDTYTTDSKQRQDIYASPLLATAEQLKGLPPTLIQTAEKDVLRD
FT                   EGEAYARKLDAAGVNVVITRYNGMIHDFGLLNVLADLPATRAALHQASEELKVHLR"
FT   sig_peptide     complement(646240..646308)
FT                   /locus_tag="Xfasm12_0587"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 23"
FT   gene            646526..647383
FT                   /locus_tag="Xfasm12_0588"
FT   CDS_pept        646526..647383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0588"
FT                   /product="transcriptional regulator AraC family"
FT                   /note="KEGG: xft:PD0520 transcriptional regulator AraC
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11592"
FT                   /protein_id="ACA11592.1"
FT                   /translation="MSIEVTGACTDRLEALLNHFPVRARMFHSGALCGIADFSVPAEGG
FT                   QVHLLRSGAMDVIHPGRELLQVSVPSLLFYPRPMSRRFVADAQCGADLVCAQLDFEGGS
FT                   ANQVAGALPDVVCLPLENIDGAAQVLELLFDEAFGDHCGRRVLIDRLFEVVLIQMLRYL
FT                   METGGVAGGMLAGLSHPKLRKVLVAMHEQPERGWSLEALAYLAGMSRSVFAGTFRRVVG
FT                   CTPGVYLQGWRVKLAQQALRQGRQLLKTIAVEVGYGSEAALSRAFKAQCGMTPREWRQR
FT                   QDED"
FT   gene            complement(647601..647846)
FT                   /locus_tag="Xfasm12_0589"
FT   CDS_pept        complement(647601..647846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0589"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xft:PD0521 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11593"
FT                   /protein_id="ACA11593.1"
FT                   /translation="MPLYNRWLSLLFHKTVRFSMQIKAMIKGLVRELPSGSMRELTEAE
FT                   LDLIVGGSSQKQFDQHTQPNLIRIQITWMIKDKVRS"
FT   gene            647909..648100
FT                   /locus_tag="Xfasm12_0590"
FT   CDS_pept        647909..648100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0590"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xfa:XF1256 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11594"
FT                   /protein_id="ACA11594.1"
FT                   /translation="MIFDSFLSRFSSIYDFIGIIFFCTGMGESHVIVSITQCELLIVRV
FT                   AFIRSGSVLRSTLVMRDA"
FT   gene            648372..648953
FT                   /locus_tag="Xfasm12_0591"
FT   CDS_pept        648372..648953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0591"
FT                   /product="oligoribonuclease"
FT                   /note="KEGG: xft:PD0522 oligoribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11595"
FT                   /protein_id="ACA11595.1"
FT                   /translation="MVAELPVVESDRRLIWIDLEMTGLDTHRDSIIEIATVVTDAQLNV
FT                   LAEGPEFAISHPLNVLEAMDEWNRNQHRHSGLWQRVLNSEIQHAQAEASTIAFLQQWVK
FT                   TGASPMCGNSICQDRRFLHRQMPCLERYFHYRNLDVSTLKELAGCWSPSILDGVVKTSN
FT                   HTALSDIYDSIAELRHYRKSMGTFAGLSVV"
FT   gene            complement(649177..650094)
FT                   /locus_tag="Xfasm12_0592"
FT   CDS_pept        complement(649177..650094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0592"
FT                   /product="small conductance mechanosensitive ion channel"
FT                   /note="KEGG: xft:PD0523 small conductance mechanosensitive
FT                   ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11596"
FT                   /protein_id="ACA11596.1"
FT                   /translation="MDWTKLLSNIVSPATVTTFHGRFNWTRIDWIHILMNLTAAAVIAI
FT                   LGVWLSKRLSNGLHRILIRAHVEITLANFLRNIAYALLLIIVSVSVLQRLGVPATSLAA
FT                   VVGATGLAVGLALKDSLSNIAAGVMLIVLGPVRSGDHVVIAGQEGIIDEIRIFQTRLRT
FT                   FDQRIITLPNSTITTVPIINYSTLPTRRVEITVGVSYQNNLKQAQELLVKIARENPKIL
FT                   DDPAPLVYVNNLGESSVDLLLLAYTQNDNFNPAKSEILEQIHNQLPENGLNIPYPQRDL
FT                   HLYHHDTNNGKIASLLLPSMTDKS"
FT   gene            complement(650095..652494)
FT                   /locus_tag="Xfasm12_0593"
FT   CDS_pept        complement(650095..652494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0593"
FT                   /product="Pyruvate, water dikinase"
FT                   /EC_number="2.7.9.2"
FT                   /note="KEGG: xfa:XF1259 phosphoenolpyruvate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11597"
FT                   /protein_id="ACA11597.1"
FT                   /translation="MALNGASYLNENILWLHELRLTDLARVGGKNSSLGEMIGNLTALG
FT                   VSVPGGYATTAAAFKAFIAYNNLSKRIYDKLATLDVEDVKALTAAGKEIRDWVIDAPLQ
FT                   PELEKDIRDAYDTLSKDNSGNDVAVAVRSSATAEDLPDASFAGQQETFLNVIGADQVVH
FT                   KIKEVFASLYNDRAIAYRVHHGFKHEDVFLSAGIQLMVRSDISASGVLFTLDTESGFRD
FT                   VVFVTASFGLGEMVVQGAVNPDEFYVYKKTLKAGKPAILRRRLGSKLVRMVYSDAPGER
FT                   VKIEDTPTELRHCFAISDADVQELARQALIIEQHYGRPMDIEWAKDGVSGKLFIVQARP
FT                   ETVKSRSHTTQIERFALQQRGEILTEGRAIGQKIGSGIARVVHSLEDMHHMQPGDVLVA
FT                   DMTDPDWEPVMKRASAIVTNRGGRTCHAAIIARELGVPAVVGTGNALSIIQDGQPITVS
FT                   CAEGDTGYIYAGKLPFERTTTDLGHMPPAPLKIMMNVANPERAFDFGQLPNAGIGLARL
FT                   EMIIAAHIGVHPKALLEYHKQDADTKQKIDAKIAGYPDPVSFYVNRLAEGIATLTASVA
FT                   PHTVIVRLSDFKSNEYAHLIGGQHYEPQEENPMLGFRGASRYVDPSFSDAFALECKAVL
FT                   KVRNEMGLDNLWVMIPFVRTLEEGRKVIDVLRQNGLKQGENGLKVIMMCEVPSNALLAD
FT                   EFLDIFDGFSIGSNDLTQLSLGLDRDSSIVAPLFDERNAAVKKLLSMAIKAARSKGKYI
FT                   GICGQGPSDHPDLAEWLMQEGIESLSLNPDTVVDTWLRLAKLKTVH"
FT   gene            652619..653440
FT                   /locus_tag="Xfasm12_0594"
FT   CDS_pept        652619..653440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0594"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF1260 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11598"
FT                   /db_xref="GOA:B0U5U4"
FT                   /db_xref="InterPro:IPR005177"
FT                   /db_xref="InterPro:IPR026530"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U5U4"
FT                   /protein_id="ACA11598.1"
FT                   /translation="MSTIRPVFYVSDGTGITAETIGHSLLTQFSGFTFVTERMVFIDDA
FT                   EKARDASQRILAASERYRVRPIVVNSCVNPYLSVILAESGALMLDVFAPFIGLLEHELN
FT                   TSRHSRVGRAHGMVDFETYHRRINAMNFALAHDDGVAASYDEAEVVLVAVSRAGKTPTC
FT                   IYLALHYGIRAANYPLIDEDLNSDQLPLRLRPYRKKLFGLTINPERLQQIRQERRPNSR
FT                   YAALDTCKREVAAAERMFSAERITTLSTTHTSIEEISSKVLVTLGLQREMF"
FT   gene            653526..654023
FT                   /locus_tag="Xfasm12_0595"
FT   CDS_pept        653526..654023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0595"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0526 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11599"
FT                   /protein_id="ACA11599.1"
FT                   /translation="MLNDMMLHQRIPCLSRLSWLMALYAENYRHLKRLFAPGDLEKGSY
FT                   VSVIGDGLDLCLDVIERHRYTVDLRLTYELCDPMTGEPDPSAYVRLYCDALQVETTHCY
FT                   VGRRWQDVIGLSPLPGELMHYRMRMNIFLGKWLDYLAERGHGMATLSAIGRSHRVCRVM
FT                   RG"
FT   gene            654079..654579
FT                   /locus_tag="Xfasm12_0596"
FT   CDS_pept        654079..654579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0596"
FT                   /product="7,8-dihydro-8-oxoguanine-triphosphatase"
FT                   /note="KEGG: xfa:XF1262
FT                   7,8-dihydro-8-oxoguanine-triphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11600"
FT                   /protein_id="ACA11600.1"
FT                   /translation="MNVHMAYTPIIATLGYVLSPDQCRVLMIHRNARSGDAHLGKYNGL
FT                   GGKVEPGEDVLAGMRRELYEEAGIDCLSIRLRGTISWPGFGKQGDDWFGFVFVIDAFQG
FT                   EPKTHNPEGVLEWVECQRLFELPMWEGDAKFLPLVFDDDPRPFHGVMPYCEGRMQSWSF
FT                   SRL"
FT   gene            complement(655058..657250)
FT                   /locus_tag="Xfasm12_0597"
FT   CDS_pept        complement(655058..657250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0597"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0528 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11601"
FT                   /protein_id="ACA11601.1"
FT                   /translation="MERKNHKKTTLATLISVLLMGGAGATYANSASISEKLDLATQHLD
FT                   GAASTGEAISSDGKTIATSINNRTRAFLLSGDNWATKTELGSLKSDSSGTSIVRALSAD
FT                   GKIAAGISSVDSSSTQLHATIWSGDNWATKTTLGTLATNNGGDSVVYALSADGKVAAGQ
FT                   TAASTGTLHAVIWSGDNWATKTDLGTIRSDGAGDSMVKALSADGKIAVGSADSDIKTPV
FT                   NGMYAGGVLTGPNSVRAIAWSGDNWATKTDLGTLRSDNLGAAVANAISADGKVIGGASH
FT                   HYVTTEYYRSNDDQLATIWSGGNWATKTNLGSLRSDNSGASLVAALSADGSIAGGAALN
FT                   DANATRAIIWSGRHWATKTDLGTLKSDNSGNSEVAALSPDGSVAVGTAAADSGSSHATV
FT                   WKITYPAESTSTSDSTTNTPTPSQPSVVTVDADNTKKTLSRLGAETFSVMDLQRQGLTR
FT                   LQQHCQIDAAGQSCWAVQTAISSIDGNRDKVAGIKLGHGFTETFSVGLSLDRSLSRSLP
FT                   DSYLKNNGNLGAGLYAQWNTAFHGSQWYVRPAVAFNRYNVTVQRPVLENTEAGIGTSRM
FT                   KGRGASLETGQTFKSDHGVLLGWHLGGRYNNVSRAEYSEQNAAFPTTYGKASFKRTSAY
FT                   LGADATIPLTTNLKWMAAAEIDRALKNRDAVYSAQADYIGSFNHRAGIKGTIATLSSGL
FT                   QYTISEKILLGLTLDVNQTAFGDIARGGTFTVGGHF"
FT   sig_peptide     complement(657164..657250)
FT                   /locus_tag="Xfasm12_0597"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.669 at
FT                   residue 29"
FT   gene            complement(657974..659860)
FT                   /locus_tag="Xfasm12_0598"
FT   CDS_pept        complement(657974..659860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0598"
FT                   /product="Cellulase"
FT                   /EC_number="3.2.1.4"
FT                   /note="KEGG: xft:PD0529 cellulose 1,4-beta-cellobiosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11602"
FT                   /protein_id="ACA11602.1"
FT                   /translation="MSVSLLAGSLFSTSYVYAEAHVDNPFVDATSYLNPDYSKDIDTSI
FT                   TKVSDVSLKEKMETIKNYPTGVWLDTIDAVKGGPKNPGRLNLTGHLDAALAQKKGNTPI
FT                   TATFVIYDMPGRDCHAFASNGELPLTPAGLQRYKKEYIDTIANIFANPKYKDIRIVTVI
FT                   EPDSLPNIITNMSTPNCAKAKNTGIYEESIKYALDTFAEIPNVYSFLDMAHSAWLGWDN
FT                   NRIPAISLYTKLIQSTKAGFASVNGFATNTANYTPLIEPNLPNPNLNIGGQPIKSAKFY
FT                   EWNPLFDEMDYSETLYNDFVAAGWPSSIGFIIDTGRNGWGGSQRPTSAFGNDINSYVNS
FT                   GRIDKRNHRGNWCNQDAGIGLPPTVAPGGHVDAFQWIKPPGYSDGSSSMIPNDQGKGFD
FT                   RYCDPTFTTPDGVLTGALPNAPLSGDWFHAQFVKLINNAYPDISRTPLPGSGSSSSSGS
FT                   SSSFGSSSSSGSSSSSSSGSSSSSSSGSSSSSSSGSSSSSSSGSSSSSSSGSSSSSSSG
FT                   SSSSSSSGSGFNPGSGFNPGAGSDPTKNPITSSITVDSDWYTGYCERVKVTNTGSSRSS
FT                   WTVTIPLKGTIQTLWSATWSLSGSDKLIASGLEWNKTLEPHGTTEFGFCANY"
FT   sig_peptide     complement(659804..659860)
FT                   /locus_tag="Xfasm12_0598"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.972) with cleavage site probability 0.645 at
FT                   residue 19"
FT   gene            complement(661076..662197)
FT                   /locus_tag="Xfasm12_0599"
FT   CDS_pept        complement(661076..662197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0599"
FT                   /product="lipoic acid synthetase"
FT                   /note="KEGG: xfa:XF1269 lipoic acid synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11603"
FT                   /db_xref="GOA:B0U641"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031691"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U641"
FT                   /protein_id="ACA11603.1"
FT                   /translation="MTQPIVRSIPLHVVSNDHPSSSPLQPGVKQSGEDKIGRSPVQFAD
FT                   VPVLRKPSWIRVRIPSGNAVQSLKAKLRENRLVTVCEEAACPNIHECFSHGTATFMILG
FT                   EVCTRRCSFCDVAHGRPKPPDPEEPISLARTVAEMGLKYVVVTSVDRDDLRDGGAQHFV
FT                   DCIAAIRQSAPQTRIEILTPDFRGKGRMDRALDILAACPPDVFNHNVETVPALYPNVRP
FT                   GADYQWSLTLLKRFKAQHPQVPTKSGIMLGLGETLDQVQATLRDLRAHDVDMVTVGQYL
FT                   QPTSHHHPVLRYWTPDEYKALEEYGMALGFSHVASGPMVRSSYHADHQAKEAGLGFNAT
FT                   VSLGSPAVSSTEHRERHTIASKSASKTESIPHR"
FT   gene            complement(662234..662914)
FT                   /locus_tag="Xfasm12_0600"
FT   CDS_pept        complement(662234..662914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0600"
FT                   /product="lipoate-protein ligase B"
FT                   /note="KEGG: xft:PD0531 lipoate-protein ligase B"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11604"
FT                   /protein_id="ACA11604.1"
FT                   /translation="MNACGAVAPSHVGRAALLRMLGAQPYVPVWHAMQRFTDVRDATAV
FT                   DELWVVEHEPVFTLGQAGKLEHVLDPGEIPVVHVDRGGQVTYHGPGQLMVYPLLDLSRL
FT                   GLGVRDYVYGIEQAVINTLAQWNILGERREHAPGVYVGGAKIAALGIRVRRGCSFHGVA
FT                   FNVAMDLEPFHRIHPCGYRGLQVTSVLDLGGPSEMDTVAAALLAELARQFGFVLHPTSG
FT                   WLSS"
FT   gene            complement(662911..663189)
FT                   /locus_tag="Xfasm12_0601"
FT   CDS_pept        complement(662911..663189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0601"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0532 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11605"
FT                   /protein_id="ACA11605.1"
FT                   /translation="MEIKSDHSEHGFQFPGTFELSAVGTAGKALETELPRLLALCGVEL
FT                   VQERISWKHSSTGKYVSVRIGFRALDREQYDAAHQVLRDHPEVKWTL"
FT   gene            complement(663369..664172)
FT                   /locus_tag="Xfasm12_0602"
FT   CDS_pept        complement(663369..664172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0602"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0533 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11606"
FT                   /protein_id="ACA11606.1"
FT                   /translation="MVSILKIHFSQQQQPDHTLSPGVHRIVRHASGVVAFADEVQGRGV
FT                   VLAQFSLDNRGLWLQVAKGIRGIHVNGRPVRRMAWLRVGDAVYADGVEMLVIGIQAEPP
FT                   DDATATLDRNCLVLRGVGGRHYGRSFTLEKPRIVGQEAGVDIWIDDPVFAARHAVFERH
FT                   GDRVLLRDLGSEEGSVVNGCKVRDAWLQAGDQIVLDGQHRFVLESPLFLLLPLSCSMSE
FT                   DVAAPLPPAAVSVRTPHRAARWPWLLLSALLLATALGALLWFDVR"
FT   gene            complement(664180..664449)
FT                   /locus_tag="Xfasm12_0603"
FT   CDS_pept        complement(664180..664449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0603"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF1273 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11607"
FT                   /protein_id="ACA11607.1"
FT                   /translation="MGVIALVKGKVFSLMDDGWVYVKVLRGFGRQCGNGEADEGGVQDV
FT                   GYSDLGHGGIAFVQVNVSCLASLLDAASAMYFKRLVLQQVGPNC"
FT   gene            664699..665205
FT                   /locus_tag="Xfasm12_0604"
FT   CDS_pept        664699..665205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0604"
FT                   /product="poly(hydroxyalcanoate) granule associated
FT                   protein"
FT                   /note="KEGG: xft:PD0534 poly(hydroxyalcanoate) granule
FT                   associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11608"
FT                   /protein_id="ACA11608.1"
FT                   /translation="MIPTNHHNEHPSRKDPNEQTNDHDNEEFTQRLGKSAERVWLAGIG
FT                   ALGRVQSEGARFFEALVNEGEEIKQRRRENSLHSAESIREHVEVKLEETWGNTQRNWRR
FT                   MNQLFDERIQDILHTLKIPTREEIEALRHEIEILRNELHELRNEKKTRTPSPSTPKSNK
FT                   SHTED"
FT   gene            complement(665221..665409)
FT                   /locus_tag="Xfasm12_0605"
FT   CDS_pept        complement(665221..665409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0605"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xfa:XF1276 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11609"
FT                   /protein_id="ACA11609.1"
FT                   /translation="MAVCCWRQRDTNHAQGDGLACGELRRLQCRKITKKLGGCLLVDAS
FT                   ALKTKTAVLRVAMSVLR"
FT   gene            666011..667366
FT                   /locus_tag="Xfasm12_0606"
FT   CDS_pept        666011..667366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0606"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF1278 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11610"
FT                   /protein_id="ACA11610.1"
FT                   /translation="MRIHPLLTYTSPMPGSQSSSPATDPRLRQLRFMKVMALLLLLIML
FT                   GGFILAHTQGNRGIWAWLGAFCEAAMVGALADWFAVVALFKHPMGLPIPHTAILPRNKD
FT                   RLADGLAHFVRDHFLAPYSILEKLRLFNPAARLGEWLSTPKQTQALTQMTRDWAIQTLN
FT                   LLNETTVRNAIEHLVITHLREWNAAITTGDIMALLTTDKRHQRLFDKALLRLSRWLDND
FT                   KIKAQASALIVRYARREWPTLMGTVNWITSVDEIGDRLAERIARAGLEELQLILTTPKH
FT                   PLRQQYELWLQDYIHRLRNDPALIERVEEFKQQAIDNSTIQTYIRDLWTQINTALRTDL
FT                   ESADSTLAGHLEGVLQSLGKALSEDPNLRDKLNEHLLDTSERLSERLRDTVTHHIASTM
FT                   RGWDEHHLTRQLELNVGCDLQYIRFNGTLVGGIIGLLLHAVIYGCEIYSVMG"
FT   sig_peptide     666011..666166
FT                   /locus_tag="Xfasm12_0606"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.905) with cleavage site probability 0.776 at
FT                   residue 52"
FT   gene            667599..667712
FT                   /locus_tag="Xfasm12_0607"
FT   CDS_pept        667599..667712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0607"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xfa:XF1279 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11611"
FT                   /protein_id="ACA11611.1"
FT                   /translation="MKLFILFASVDLKKENQKLYKYSNWVGLIIFRFFIFW"
FT   gene            complement(668068..669387)
FT                   /locus_tag="Xfasm12_0608"
FT   CDS_pept        complement(668068..669387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0608"
FT                   /product="hemolysin"
FT                   /note="KEGG: xft:PD0536 hemolysin"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11612"
FT                   /protein_id="ACA11612.1"
FT                   /translation="MFELLIVIALIFLNGFFAMSEMSLMTSRKSRLKQMAHSSKHAAKA
FT                   LTLAQNPESFLSTVQIGITLIGILTGLFGGDAIGTAIGQWLTALTPQLGEYTSIIGKTL
FT                   SVALITFLTLIFGELVPKRLALTHSENIASTIAVPMSVLARIAAPGVWVLAKSTQLVLR
FT                   VFGFGKIPSSAVTEEEIRLLVAESHEAGVIDDYERNMMNRVMRLGDRTADSLMTPRNRI
FT                   AWLDNSADLEHNLEIMREHQFSRYPVYRSSDQDIVGILEVKSVITRIDSQTQTTLSLFQ
FT                   ELCEPVFVSESTHALKLLEIFREEQQSMALVVDEYGEILGLVTISDLMGAVIGRLQNVE
FT                   NTDEDALMVTREDGSFLIDGTLPIEELREVLGAELPDGEENNYHTLAGMCISYFGRIPH
FT                   VGEYFDWAGWRIEIVDLDGARIDKLLLQRLNKEKNHVPHK"
FT   sig_peptide     complement(669325..669387)
FT                   /locus_tag="Xfasm12_0608"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.670) with cleavage site probability 0.637 at
FT                   residue 21"
FT   gene            complement(670154..671665)
FT                   /locus_tag="Xfasm12_0609"
FT   CDS_pept        complement(670154..671665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0609"
FT                   /product="carboxypeptidase related protein"
FT                   /note="KEGG: xfa:XF1282 carboxypeptidase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11613"
FT                   /protein_id="ACA11613.1"
FT                   /translation="MAMTPRIALLSLLLSGSVPLAYATATPPKPDKETTTPATTLPALP
FT                   ANTQIRQSIRIGNRTLSYKAIIGALPVQDDKGKTIGDVMFTAYIMKGNNRPVTFALNGG
FT                   PGASSVYLNMGAIGPKVVHFGTQGTSPSDPAILHNNPSTWLDFTDLVFIDPIGTGFSRA
FT                   RIEGEEAKKQFFNPKADVDYLSRTIYDWLVANGRLLSRKYLVGESYSGFRVPRIAHTLQ
FT                   TQMGIALNGLVLVSPYLNPTLDDNSDVSPLAWIVTLPSIAAAHLERQHQLSEAKMREVI
FT                   EYTRGDYASTLMKGRSDPAATEMMLQQVIHLTGLDPTYVRRAGGRLETQAYLREVFRDT
FT                   GELGSLYDINVTALDPFPYDSEQRTNDPLLDSIIAPTTTAMVDFVTRTAGWKVHERYQA
FT                   LNYDVNRQWDWNEELRKGSVTQLRQSVAIDPKLRVLIAHGWNDLSCPFMASVLTIDQIP
FT                   KMGSDPTRIQVREYPGGHMFYNRPDSQSSFRQDVQAMYEHPQDTP"
FT   sig_peptide     complement(671594..671665)
FT                   /locus_tag="Xfasm12_0609"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.878 at
FT                   residue 24"
FT   gene            671708..671875
FT                   /locus_tag="Xfasm12_0610"
FT   CDS_pept        671708..671875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0610"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xfa:XF1283 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11614"
FT                   /protein_id="ACA11614.1"
FT                   /translation="MGVSEVAGGHVFMSELMGSVWCCLYRDGREVFLVDGVIAVCYRSV
FT                   LVARMLRSID"
FT   gene            671868..672101
FT                   /locus_tag="Xfasm12_0611"
FT   CDS_pept        671868..672101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0611"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0538 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11615"
FT                   /protein_id="ACA11615.1"
FT                   /translation="MIDPNALWWILHGDCAVSVSDVVVWFRGCIVQRVSLLLSEPAVVL
FT                   LALSWSERVDSKMPGYIAQQDAGVRLSDRAVM"
FT   gene            complement(672368..674257)
FT                   /locus_tag="Xfasm12_0612"
FT   CDS_pept        complement(672368..674257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0612"
FT                   /product="DNA topoisomerase (ATP-hydrolyzing)"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: xft:PD0539 topoisomerase IV subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11616"
FT                   /protein_id="ACA11616.1"
FT                   /translation="MNSRYNAADIEVLTGLDPVKRRPGMYTDTTRPNHLAQEVIDNSVD
FT                   EALAGYANRIEVTLYKDGSCEVADNGRGMPVDIHPEEKIPGVELILTRLHAGGKFSNRN
FT                   YTFSGGLHGVGVSVVNALSSKVDLFIKREGSEHHMEFREGFAVSKLKVLGTVSKKNTGT
FT                   RLRFWPDSKYFDTPKFNVRVLRHLLRAKAVLCPGLTVELLEEATGEINTWHFKDGLRDY
FT                   LKGEMTESELLPAELFIGCLKKDTEVVDWAVAWVPEGELTQESYVNLIPTPQHGTHVNG
FT                   LRSGLTDALREFCDFRNLLPRGIKLAPEDVWDRVTFVLSLKMSDPQFSGQTKERLSSRQ
FT                   AAGFIESTVHDAFSLWLNQNVDIGEHIAQIAIERASARLKTEKQVTRKKITHGPALPGK
FT                   LADCISLDLSRTELFLVEGDSAGGSAKQARDKDFQAILPLRGKILNTWEVASGSVLASD
FT                   EVHNLAIAIGCDPGKDNLSGLRYGKIVILADADSDGLHIATLLTALFLKHFPGLVAAGH
FT                   VFVAMPPLFRVDVGKQVFYALDDEEKTILLEKIQREKIKGQVSVTRFKGLGEMNPQQLR
FT                   ESTIHPDTRRLVQLTMDDNTQTCSLMDMLLAKKRASDRKQWLETKGNLASLDI"
FT   gene            674291..674713
FT                   /locus_tag="Xfasm12_0613"
FT   CDS_pept        674291..674713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0613"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF1287 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11617"
FT                   /protein_id="ACA11617.1"
FT                   /translation="MCCLLQIFARHSGSFSEGLAIPGRLGGGIPIEVALFRVRTGTSGV
FT                   ATMKLKYLVMLMLVPAVVGVAVPSALAQAKASMQPPASSSTDMSTNSEGQSMGEHTDEH
FT                   KAKKVKKHRSHTAKPTNTGSAAVPTKEAEENTAVTR"
FT   gene            674863..676527
FT                   /locus_tag="Xfasm12_0614"
FT   CDS_pept        674863..676527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0614"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /note="KEGG: xft:PD0541 CTP synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11618"
FT                   /db_xref="GOA:B0U656"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U656"
FT                   /protein_id="ACA11618.1"
FT                   /translation="MTPLIFVTGGVVSSLGKGIAAASLASILEARGLKVTMVKLDPYIN
FT                   VDPGTMSPFQHGEVYVTDDGAETDLDLGHYERFVRTRLSRKNSVTTGRIYQNVICKERR
FT                   GDYLGATVQVIPHITDEIRRCIDEATASFDVALVEIGGTVGDIESLPFLEAIRQVRIER
FT                   GAERTMFMHLTLVPYIAAAGELKTKPTQHSVKELRSIGIQPDVLLCRSEQVIPDSERRK
FT                   IALFTNVSERAVIGCPDIDVLYGMPLELRRQGLDEIVIDQFKLSGTTSLADLSEWEDVV
FT                   DAIKHPLDEVTIAVVGKYVDYRDAYKSVGEALKHGGLRQRTKVNLKWVEAQDLEGSDMA
FT                   ALKDIDGILVPGGFGDRGFEGKVLASRYAREQRVPYFGICYGMQAAVVDYARHVAGLEG
FT                   ANSTENDRQSSHPVIALITEWRTTTGEVERRDEKSDLGGTMRLGLQEQRLKAGTLAREL
FT                   YGRDVVGERHRHRYEFNNRYRTQLEDAGLVIAAKSMDDTLVEMIELPREMHPWFLACQA
FT                   HPEFLSTPRDGHPLFIGFVKASRARKAGGKLLREVCV"
FT   gene            676688..677518
FT                   /locus_tag="Xfasm12_0615"
FT   CDS_pept        676688..677518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0615"
FT                   /product="2-dehydro-3-deoxyphosphooctonate aldolase"
FT                   /note="KEGG: xft:PD0542 2-dehydro-3-deoxyphosphooctonate
FT                   aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11619"
FT                   /db_xref="GOA:B0U657"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U657"
FT                   /protein_id="ACA11619.1"
FT                   /translation="MKLCGFEVGLNQPLFLIAGPCVIESLQLQLDTAGVLKEITSKLGL
FT                   NFIFKSSFDKANRTSGSSFRGPGLEEGLKVLEAVKTQIGVPVLTDVHEYTPIDEVATVV
FT                   DVLQTPAFLVRQTDFIRNVCAVGKPVNIKKGQFLSPWDMKPVVEKAKSTGNSQILVCER
FT                   GASFGYNNLVSDMRSLAVMRETGCPVVFDATHSVQLPGAQGGRSGGQREFVPVLARAAV
FT                   AVGISGLFAETHPDPPNALSDGPNAWPLRTMAMLLETLVELDAVTKKRGFLEQD"
FT   gene            677923..679260
FT                   /locus_tag="Xfasm12_0616"
FT   CDS_pept        677923..679260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0616"
FT                   /product="Phosphopyruvate hydratase"
FT                   /EC_number="4.2.1.11"
FT                   /note="KEGG: xfa:XF1291 enolase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11620"
FT                   /protein_id="ACA11620.1"
FT                   /translation="MVLWYCSLLWLLTGPMTAIVKIYAREILDSRGNPTLEAEVTLENA
FT                   VCGRAAVPSGASTGTKEAVELRDGDKTRYLGKGVRAAVDNVNGVIAAALVGFDGADQTG
FT                   LDHRLINLDGTENKGRLGANALLGVSLATAHAVAAARKQPLWMYLSTLGESKLSLPVPM
FT                   MNIINGGAHADNNVDFQEFMVLPVGFASFSEALRAGAEIFHALKSVLKGRGLSTAVGDE
FT                   GGFAPDFRSNVEALDAILEAIGRAGYIAGEDVLLGLDVASSEFRDNGKYNLVGENKRLT
FT                   SEQFVDFLDDLVAQYPIISIEDGLAEDDWVGWKQLTERIGHKVQLVGDDLFVTNPKVFQ
FT                   EGITSGIANAILIKLNQIGTLTETLESIAMAHRAQYAAIVSHRSGETEDTSIADIAVAT
FT                   TATQIKTGSLCRSDRVAKYNQLLRIEQALGVGVRYAGRDAFVSLKS"
FT   gene            679264..679620
FT                   /locus_tag="Xfasm12_0617"
FT   CDS_pept        679264..679620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0617"
FT                   /product="cell division protein FtsB"
FT                   /note="KEGG: xft:PD0544 cell division protein FtsB"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11621"
FT                   /db_xref="GOA:B0U659"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="InterPro:IPR023081"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U659"
FT                   /protein_id="ACA11621.1"
FT                   /translation="MRNWRWLLLVLAALLAWLQHRFWFGPGNSGEVRMLQVQIVQQHQE
FT                   NERLRQRNASLAAEVKNLKDGDAAIEERARSELGMIKPGEIFYRVVEDIPAPLPNDTSA
FT                   DHGVDLSQPRREKR"
FT   sig_peptide     679264..679353
FT                   /locus_tag="Xfasm12_0617"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.856) with cleavage site probability 0.539 at
FT                   residue 30"
FT   gene            679617..680312
FT                   /locus_tag="Xfasm12_0618"
FT   CDS_pept        679617..680312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0618"
FT                   /product="4-diphosphocytidyl-2c-methyl-d-erythritol
FT                   synthase"
FT                   /note="KEGG: xft:PD0545
FT                   4-diphosphocytidyl-2c-methyl-d-erythritol synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11622"
FT                   /db_xref="GOA:B0U660"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U660"
FT                   /protein_id="ACA11622.1"
FT                   /translation="MSVGVWAVIPAAGRGVRFGSPVPKQYLPVVGRPLIVYTLEALAAH
FT                   PAVCGLMVVVTEGDLAWSGWTEVAGKPLLTCSGGVTRAASVLSGLLALPQVVHADDFVL
FT                   VHDAARPNVALSDLERLLEAGCAHPVGAILAVPVRDTLKRAGSDGSIDGTEPRERLWRA
FT                   FTPQLFRRSQLVRGLQVAAADGIEMTDEAMVMERQGLRPLLVECAESNFKITTPDDLVR
FT                   FEFELARRV"
FT   gene            680336..680839
FT                   /locus_tag="Xfasm12_0619"
FT   CDS_pept        680336..680839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0619"
FT                   /product="2-C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /EC_number="4.6.1.12"
FT                   /note="KEGG: xfa:XF1294 2-C-methyl-D-erythritol
FT                   2,4-cyclodiphosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11623"
FT                   /protein_id="ACA11623.1"
FT                   /translation="MTGLNVRIGQGYDVHAFGPGDHVMLGGVLVPHRCGVLAHSDGDVI
FT                   LHALCDAMLGALGFGDIGQHFPPSDVRWKGVDSGVFVRHCNLLLRERDWCVGNVDATAI
FT                   CESPKIAPYVNAMREGIARLLEVQPECVSVKATTSEGLGFIGRGEGLAAQVVVLLYRLN
FT                   GVVV"
FT   gene            complement(681051..681590)
FT                   /locus_tag="Xfasm12_0620"
FT   CDS_pept        complement(681051..681590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0620"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0547 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11624"
FT                   /protein_id="ACA11624.1"
FT                   /translation="MTQHNDNDDAALFRAAIGPVRPLRPSETAITIKPRSRPRRRIIQH
FT                   HEDEVKSEFAQLLRESAPLEAGDTISYRSKALPSRLFQRLKRGQFSVQDELDLHGATVV
FT                   QAETLLRQFLLEAHTYEYGCVRIIHGKGLQSNGGTPVLKNLVNQLLRLRKDVLAFHSSP
FT                   PAQGGTGAVLVLLTHR"
FT   gene            681866..682024
FT                   /locus_tag="Xfasm12_0621"
FT   CDS_pept        681866..682024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0621"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xfa:XF1296 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11625"
FT                   /protein_id="ACA11625.1"
FT                   /translation="MARVLWVYFLWVKMQFEIELELVVHVKMLSALGVSVIRLVRCGQC
FT                   AGFWPYP"
FT   gene            complement(682075..683091)
FT                   /locus_tag="Xfasm12_0622"
FT   CDS_pept        complement(682075..683091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0622"
FT                   /product="Gluconolactonase"
FT                   /EC_number="3.1.1.17"
FT                   /note="KEGG: xft:PD0548 gluconolactonase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11626"
FT                   /protein_id="ACA11626.1"
FT                   /translation="MKATRKNYFTHIIIAGFFLTLPFHGITTPHNTKIQTAKIQKEDPL
FT                   FETLIDKAPELITIYDQGIWLEGPQTLPDGSLIWSDVKANRVLRWQEGKGVSVFLEPSH
FT                   FQNGHALDNEGRLLAASHGKRAIERLEKDGKWTIVVDSYQGNKLNSPNDLIVDRSGDIW
FT                   FTDPAFGINNPKESYGGKAVQGGDYSYRYSPKTGTIVRLKTPLVKAPNGIALSPDEKTL
FT                   YIADSELAYNSNNSALNSRIVAYDIKKDKSLRNGRVLASISHGIPDGIVTDANGNIWSS
FT                   SEGAIQIFSPKGKLLSKVILPGTVGNMNFALDKENNPILYVTASHAIYRLKIKVKGK"
FT   gene            complement(683230..684876)
FT                   /locus_tag="Xfasm12_0623"
FT   CDS_pept        complement(683230..684876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0623"
FT                   /product="Electron-transferring-flavoprotein dehydrogenase"
FT                   /EC_number="1.5.5.1"
FT                   /note="KEGG: xft:PD0549 electron transfer flavoprotein
FT                   ubiquinone oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11627"
FT                   /protein_id="ACA11627.1"
FT                   /translation="MLAAKQETETNTIERDVMEYDVVTVGAGPAGLAFAIRLKQLNPAL
FT                   SVCVIEKSSTIGAHILSGAVIEPAPLDSLLPGWRNAPPPICVPATEDEFWLLSKNGAHK
FT                   FPIMPPSLRNHGNVIVSLGALCAWLAPQAETLGVDIYPGFSATETLHDAAGQVIGVRIG
FT                   DMGIAKNGTHKPNFTPGIAINAKVTVLAEGARGHLTKHLIKHFSLDQNSDPQTYSIGIK
FT                   ELWHVPEKRSSPGKILHTLGWPANTHTYGGGFLYHLNDNRIALGYVSGLDYHDPMYEPW
FT                   EAFQQWKNHPLIKPLLESGDLLSGGARAIVTGGWQSLPKVDMPGALLIGDTAGLLNVPK
FT                   IKGTHQAIRSGMLAAEHLVATQLTPYGFDAKLRASKAMTELKQVRNIKPGFKKGLWLGL
FT                   LNAAWETATRGASPWTLKNTPDWAALQRLDKNQQTKHDYVQRTLPPRDRLHSVYFAATV
FT                   HNEDQPIHLKVTDPERCVTRCVEEYGNPCTRFCPANVYQIIEDPNSATNKRLHINAANC
FT                   VHCKTCDIKDPYQIIDWITPEGGSGPNYQNL"
FT   gene            684984..685568
FT                   /locus_tag="Xfasm12_0624"
FT   CDS_pept        684984..685568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0624"
FT                   /product="alkylated DNA repair protein"
FT                   /note="KEGG: xft:PD0550 alkylated DNA repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11628"
FT                   /protein_id="ACA11628.1"
FT                   /translation="MDLFPFLPGARISLQSGWLPSGPADALLAGLLEGVPWEVHRIHIF
FT                   GREVNSPRLSCWVGDPQASYRYSGRCFQPRPWWPALAELRMCLEGETGAVFNSVLLNRY
FT                   RHGGAAIGWHSDDEAELGIDPLIASLSLGASRRFVFRHRRERHLRAECVLSHGDLLLMG
FT                   GTTQRDYQHALPRTLRVVGERVNLTFRRILM"
FT   gene            complement(685763..686404)
FT                   /locus_tag="Xfasm12_0625"
FT   CDS_pept        complement(685763..686404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0625"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0551 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11629"
FT                   /protein_id="ACA11629.1"
FT                   /translation="MKLIHPLVCLSVLTLASCSSTLLGEKKPTTIYSPQIHVTTDPSWP
FT                   RVTWHLTVLHPKAPRMIDTPRINVQPTPGEIQVYHNVSWAQPTTDMLEDALIRVFEDSG
FT                   KIAGVTRAGTGIRTDYSLSLDLRRFESDYAGTPMPTATIEVNAKLIGAHNKRLIASRTF
FT                   IVTQPATNTDTSTVANAFGQALTQLTNELVGWTLTMGQSDAISNDKPSQH"
FT   sig_peptide     complement(686330..686404)
FT                   /locus_tag="Xfasm12_0625"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.855 at
FT                   residue 25"
FT   gene            complement(686401..687327)
FT                   /locus_tag="Xfasm12_0626"
FT   CDS_pept        complement(686401..687327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0626"
FT                   /product="ABC transporter permease"
FT                   /note="KEGG: xft:PD0552 ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11630"
FT                   /protein_id="ACA11630.1"
FT                   /translation="METKANYVLIGSFTILTGLALLIFGLWAAKYSSDRTWQNYRVVFR
FT                   EAVTGLSVGSPVQYNGIAIGSITQLTLAPNDPRQVVAHIRVNSTTPVKKDTRAKLAITS
FT                   LTGPSIIQLSGGTPESPSLTSIYKDDAPIIQTTPSALQNITDTANDIVERLYDVLSDKN
FT                   VAAISTILQNMQKISGQVSDSDTGLEALLTSARDATRQLNTTLTTANGTVQQLDNNLVK
FT                   QLPVILNKLEATLTKIDATASNANSILDNNQAAINSFANEGLSQFAPTMSELRNLIRDL
FT                   RQISNKLEGNPKRYLLGRDAPKEFDPK"
FT   sig_peptide     complement(687241..687327)
FT                   /locus_tag="Xfasm12_0626"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.936) with cleavage site probability 0.930 at
FT                   residue 29"
FT   gene            complement(687331..688161)
FT                   /locus_tag="Xfasm12_0627"
FT   CDS_pept        complement(687331..688161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0627"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="KEGG: xft:PD0553 ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11631"
FT                   /protein_id="ACA11631.1"
FT                   /translation="MSKTTTHPIAAEHKEANLAIRVRGLINRFGTQTVHDGLDIDVHRG
FT                   EILGVVGGSGTGKSVLMRTILGLHSPNAGSIEVLGVNPHSQSSEDLRIIARNTGVLFQD
FT                   GALFSSMTVGENVQVPMKEHHGEFPKRLYYELALLKIKLAGLPANALDKLPSQLSGGMR
FT                   KRAGLARALALDPPLLFLDEPTAGLDPIGAASFDQLIKTLQKALGLTVFLITHDLDTLY
FT                   TICNRVAVLAERKVIANAPLAEIETIDHPWIREYFHGPRGRAARTAQHTSTGSS"
FT   gene            complement(688167..689285)
FT                   /locus_tag="Xfasm12_0628"
FT   CDS_pept        complement(688167..689285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0628"
FT                   /product="ABC transporter permease"
FT                   /note="KEGG: xft:PD0554 ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11632"
FT                   /protein_id="ACA11632.1"
FT                   /translation="MPKKTVTAPHIEQDAQDRGQIHLSGSWVLANVLTASELLQSYSNS
FT                   IQHINARNIDQLDSAGALQLLRFATRTGLKNEAIEFREEHRPLISTIEILDDEHPKPER
FT                   DYGFLAALERLGIAVVKTRRNIIDVCSFLGENLVKIAQLAREPRRFRITSTVHHMEQVG
FT                   LDAVPLVVVLSYLVGAVIAFLGSTILRNFGAEIFVVELVNIAFLREFAVLLTAIVLAGR
FT                   TASAFTAQIGAMKSREEIDAIQTLGLDPIDLLVIPRLIALLVMLPLLTFIAMIAGLAGG
FT                   ITVGAFDLGIPPQMYLSRMHETMQFRHFIIGMSKAPLFALIIGLIGCLEGLKVTGTAQS
FT                   VGKHTTSSVVQTISLVIIIDALAALWFMRMGW"
FT   gene            689395..690657
FT                   /locus_tag="Xfasm12_0629"
FT   CDS_pept        689395..690657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0629"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0555 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11633"
FT                   /protein_id="ACA11633.1"
FT                   /translation="MSSAPLLSPALSTSYAQRVAFVAEIAGRLHTYGTTAQRLEASLVA
FT                   LSQQLGLDCEPWSNPTGIILSFSDPAKAIGSSDITRVIRLAPGDNDLYKLSVADNVAQA
FT                   VASGRMSISQGHTTLRRLDRELDRRSKMMRVFGFGLAAGGVAGLWKLPWLDVATAAMVG
FT                   LLIGLLTQYTDHRAATREASEALAALLAGFVATLVATLIGPINLNTVIIASVVVLLPGM
FT                   SLTNAVNELSSQHWVSGTARLAGALTVVFKLTVGALIAVSLCKLIGLKPQIYVAQPQPQ
FT                   WVEWVALLTTAYGFAVLFKARFRDYPWVMAAAMAGYVIARYAGKLSGNAEEGVFLSAMV
FT                   LTAAGNLFGRLMPKPGALIRLPGIIMLVPGSTSMRGFMDVVEHQSIHVGQDELLGVTNV
FT                   VMALVAGLLFGNLLIPTRKNL"
FT   gene            691007..691150
FT                   /locus_tag="Xfasm12_0630"
FT   CDS_pept        691007..691150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0630"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0556 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11634"
FT                   /protein_id="ACA11634.1"
FT                   /translation="MRTINDVEMEEVTGGFLGLATVASLLAPVGTAVMVIGTACFSGVR
FT                   FI"
FT   gene            complement(692418..693590)
FT                   /locus_tag="Xfasm12_0631"
FT   CDS_pept        complement(692418..693590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0631"
FT                   /product="phage-related integrase"
FT                   /note="KEGG: xft:PD1075 phage-related integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11635"
FT                   /protein_id="ACA11635.1"
FT                   /translation="MPRPRKYHPSIPPHIDQSKIPKGIYWGDGRWYTLIPHPEGGRHQK
FT                   RTIAGRAARLSDLHAIIEQQHTGNVKGTVGDVFNQFHHSSEFAGLAKATQKDYQWCAQA
FT                   IQSFLLKDNTTLGSKAVNRLNVPTWQRLVEVIAQGRPAQGDSEAIQPAPSKANHMLRYA
FT                   RRAFAWGIRHGHCTTNPAHGVKQAKERTRYRMPDLKTFAAIHAFAAERGQRQAHSIGSV
FT                   APYLAAAMTFAYGLRLRGIEVCTLTDAHHKPEGILSNRRKGSRDNITRWNDELRSAWDW
FT                   LVQYRAARWASHKRATPLRPENRFLFVNQSGARLSKSSLDTAWQRMIVMAIMEGVITEE
FT                   ERFSLHGLKHRGITDSEDKRSGGHRTEAMRERYDHEIPIVEPPKKPEFSR"
FT   gene            complement(693590..693862)
FT                   /locus_tag="Xfasm12_0632"
FT   CDS_pept        complement(693590..693862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0632"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF0481 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11636"
FT                   /protein_id="ACA11636.1"
FT                   /translation="MNAPVKQMHHTLSSIEHRLPDIYTFHDLQLLCGRGKKVKRARVEE
FT                   WARRQGIPYKYDGEGGIWTTLQALNAALGIGTDLDDVPYRPEDLV"
FT   gene            complement(693884..694402)
FT                   /locus_tag="Xfasm12_0633"
FT   CDS_pept        complement(693884..694402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0633"
FT                   /product="single-stranded DNA binding protein"
FT                   /note="KEGG: xft:PD1603 single-stranded DNA binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11637"
FT                   /protein_id="ACA11637.1"
FT                   /translation="MLFAHCRMWTSSACPLHCPLGALTMARGINKVILVGNLGNEPDIK
FT                   YTQSGMTITSISLATSSGRKDREGNTQERTEWHRVKFFGKLGEIAAEYLHKGSQCYIEG
FT                   TIRYDKFTGQDGQERYVTEIIADQMHMLGGRGEGSSGITPQRQPAKVRNNDKAYAYAGD
FT                   DFHDDDIPF"
FT   gene            complement(694404..694775)
FT                   /pseudo
FT                   /locus_tag="Xfasm12_0634"
FT   gene            complement(694777..695010)
FT                   /locus_tag="Xfasm12_0635"
FT   CDS_pept        complement(694777..695010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0635"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF0484 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11638"
FT                   /protein_id="ACA11638.1"
FT                   /translation="MMSLLWKITARNWMDRPTERQHRVTGKRQHIEYSRTWTRADGPKP
FT                   QAEISMTTTESLPHHTQARHFNDVLEKVKSND"
FT   gene            complement(695007..695540)
FT                   /locus_tag="Xfasm12_0636"
FT   CDS_pept        complement(695007..695540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0636"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF0485 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11639"
FT                   /protein_id="ACA11639.1"
FT                   /translation="MKDRPIIFSAPMVNAIIQGYKTQTRRIAKKTNHPCPFGTPGDRLW
FT                   VRERYTPCEVTGIVCYAADALPETMTNRRRWMSSIHMPRLASRLLLLIKNIRLEQLQDI
FT                   TEADAMAEGVCDLKERSSNTCDTATSTFRNLWCRLHGEWLPDTWVWVIQFERIELRTHV
FT                   CLNTAKNDSVMEVA"
FT   gene            complement(695537..696130)
FT                   /locus_tag="Xfasm12_0637"
FT   CDS_pept        complement(695537..696130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0637"
FT                   /product="UDP-3-O-(3-hydroxymyristoyl) glucosamine
FT                   N-acyltransferase"
FT                   /note="KEGG: xfa:XF0486 UDP-3-O-[3-hydroxymyristoyl]
FT                   glucosamine N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11640"
FT                   /protein_id="ACA11640.1"
FT                   /translation="MNNTFNHKFSDDLTATARHWIHPGGSEGGIVATSADIHPSAWILR
FT                   NAVIYPDVIIGKRVYIGHETTIGQRAIINEDTYIRSDCTIGAGVSIGTRSNIGAHSHIN
FT                   DAVSIGESVSIGDFVRIATNAALRKNARIRDFALIGKRVTIGAEATVNHQAKIDDGASI
FT                   GERAVIEGYAHIKAGAVMNDDPVITHVNAARGEA"
FT   gene            complement(696223..696756)
FT                   /locus_tag="Xfasm12_0638"
FT   CDS_pept        complement(696223..696756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0638"
FT                   /product="fimbrillin"
FT                   /note="KEGG: xfa:XF0487 fimbrillin"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11641"
FT                   /protein_id="ACA11641.1"
FT                   /translation="MKKQQGFNVIELMILIVIIAVLTAITLPIYQYYIAKSQVTAALID
FT                   ITPGKVQTEVRLAGGVPGTTSPNDIGLHDTTTRCHHIDVSVDSAAAESRTDSLGHHTTT
FT                   LKAPTSTITCTINGNNSVNHKFIQWVRTADLNWVSADNGGNDLKGKWFCITNVAEALRP
FT                   ITCAVALPQMPIGT"
FT   gene            complement(696889..697155)
FT                   /locus_tag="Xfasm12_0639"
FT   CDS_pept        complement(696889..697155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0639"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF0488 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11642"
FT                   /protein_id="ACA11642.1"
FT                   /translation="MTGPLYSIPPRKEVERTQLAEAMTKFQRNGGKVDVLPSLRADKPP
FT                   KIRKPRSRRQATADGHRERNDKDKQHANTRKKQVIKPKAMRHE"
FT   gene            complement(697152..697430)
FT                   /locus_tag="Xfasm12_0640"
FT   CDS_pept        complement(697152..697430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11643"
FT                   /protein_id="ACA11643.1"
FT                   /translation="MNINLNEVLAWAHHQKHPFTLEGLCNGVFGKPAQSLPIATRDGIR
FT                   DALHNAGWKEITQHQPMTIFERPLSDTLVLEMTESPPQSLNEHVRHT"
FT   gene            697451..697645
FT                   /pseudo
FT                   /locus_tag="Xfasm12_0641"
FT   gene            complement(697645..698103)
FT                   /locus_tag="Xfasm12_0642"
FT   CDS_pept        complement(697645..698103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0642"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF0490 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11644"
FT                   /protein_id="ACA11644.1"
FT                   /translation="MTASTHFIDTSYIQAFRQRLTSAFELAAQALRQASPSDQKEFTMT
FT                   SPQKPLLIRDFSTGIDQNILLMAISRDRKTVTAQLITNPEKRNVAVHTSGPLSPHYDTV
FT                   ITAYKDSLIIGITGPTFFTVTPEPMKAITAWLQENNVSVLILKEREAT"
FT   gene            complement(698561..698920)
FT                   /pseudo
FT                   /locus_tag="Xfasm12_0643"
FT   gene            699048..699671
FT                   /locus_tag="Xfasm12_0644"
FT   CDS_pept        699048..699671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0644"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF2124 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11645"
FT                   /protein_id="ACA11645.1"
FT                   /translation="MFGMTDRVHLLLEARMKREPRFLPPLQSVIYGYTRRMLDQTAMNA
FT                   QSFAMVLAETYLSLTAPDVRGVALRIGDDVAEDMRNNAQVLRRYMDGTVKTLPADLVDA
FT                   WVLALPEPYRGECERDLARRRGVLPVRLPSADSAAGVVGVAELVSEFAQLLEVIAPALA
FT                   DSRIDKNDLPFARRILDESDDVIAAVLGVRGQVQAMFQEESADA"
FT   gene            699735..699956
FT                   /locus_tag="Xfasm12_0645"
FT   CDS_pept        699735..699956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0645"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF2123 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11646"
FT                   /protein_id="ACA11646.1"
FT                   /translation="MMAPHRLPSGYRRQGRVTMTPRQCAGLRAALEALYSSEPGVSGAA
FT                   ALAERERMRVEAEASRCRQGVLLLRGGP"
FT   gene            700173..700526
FT                   /pseudo
FT                   /locus_tag="Xfasm12_0646"
FT   gene            700528..701241
FT                   /locus_tag="Xfasm12_0647"
FT   CDS_pept        700528..701241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0647"
FT                   /product="phage-related terminase large subunit"
FT                   /note="KEGG: xft:PD1598 phage-related terminase large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11647"
FT                   /protein_id="ACA11647.1"
FT                   /translation="MRWSGQSRILETPHGFLKQTLYLVRGRAEIKSDRAVYRPSKTTVD
FT                   ERGKTLARDVGVWGVGTSVLKHMIYGWLGAALAAKDNAAQTGTAEDISARMLRFPGGRG
FT                   DDNHDPLHPDPGALPEHYFAGLTAEYFDKDAGRWIKPRGVRNEPLDTAVYALWATLAPA
FT                   LKVDVMRESQWEALQALYQPTNGSLFDPPAAPPTDTARGTLRSVTATPAPPSAPHEMPP
FT                   LPNSGFGSDRWNKRL"
FT   gene            701318..701554
FT                   /locus_tag="Xfasm12_0648"
FT   CDS_pept        701318..701554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0648"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF0509 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11648"
FT                   /protein_id="ACA11648.1"
FT                   /translation="MSLATDQVALLKDAYRKVLLGQSVRYGERQVTRADAKWISDELDK
FT                   WLRRAAAEAAPSTGGTVRIAIADFRRDSGGDAP"
FT   gene            701551..702066
FT                   /locus_tag="Xfasm12_0649"
FT   CDS_pept        701551..702066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0649"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD1596 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11649"
FT                   /protein_id="ACA11649.1"
FT                   /translation="MTTAPPRLQRLVAAFDRSLLQLAPAWAASRAQSRVKAVAYRQAYE
FT                   AAEKTHLRQASRDFGSGNTIVTMTGAALRNQARHLDRNHDIISGGLSTLVQNIIGPSGI
FT                   NIVPTPRDVDGNLVESLVDAILPLYQAWSKRPEVTWMHDWPSVQRRTGPLETRRRPRSA
FT                   WPGVAPCR"
FT   gene            702063..702473
FT                   /pseudo
FT                   /locus_tag="Xfasm12_0650"
FT   gene            702600..703028
FT                   /locus_tag="Xfasm12_0651"
FT   CDS_pept        702600..703028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0651"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF0524 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11650"
FT                   /protein_id="ACA11650.1"
FT                   /translation="MGLIARLRRWYHLWVWRLRYWWYDTPSGVCAQHWALGLGVLVLIV
FT                   QLVRVCVAAALPAPHGAPAQAVYWWVWQLAIAVVAAYVSAALRPKPEPVKPQQAQVPTV
FT                   QDGQAVKHHFGTVWVGDEFILAWKMQGTIPIKTKGGKK"
FT   gene            703025..703261
FT                   /locus_tag="Xfasm12_0652"
FT   CDS_pept        703025..703261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0652"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF0525 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11651"
FT                   /protein_id="ACA11651.1"
FT                   /translation="MTGLTVTTKHLFTIPHFSRRAGFCRGGARQFFMDHGLDWSDFVRN
FT                   GIAAEALSATKDALANALVAWAQQCEQGRDDGR"
FT   gene            703251..706076
FT                   /locus_tag="Xfasm12_0653"
FT   CDS_pept        703251..706076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0653"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0767 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11652"
FT                   /protein_id="ACA11652.1"
FT                   /translation="MGGKSKKATIGYWYLPMFHHGLGVGPLDAFLEFRGGDRTAWSGEL
FT                   TDTGTVHVDAPHLFGGEKDQGGIVGDMDVLFGKADQMPHSYLLATLGPQVPAWRGIATV
FT                   VWKGGKYGAMNPYPQPASYKIRRILKGWDHDACWYPEKAAIGMQMAPSVAVYFAIDLSG
FT                   SMHYVGGNGRSRLDNMKTALNAALDQLGQSIASGTAVDIMLAGFGDAPDHRQTLLRRNC
FT                   TAQGIAELKSWVAARQALYGTYFPAGTMDMPSFYAAAPSNAVRVAFFMTDGEPDPPSAT
FT                   LAQAARADVDQVAHLRCYGINIDLANTTYTDMVHNVPGTTSAVVLGGDATTMVGLIRSA
FT                   IFTGVLAMNVAHVLYYANTNAEMGREPLDGIDAASFRAGADWYHSQGFGICTCFDPAAE
FT                   SADAFSTRIQRLGGCSVSRDRTDGKLHLDIANGIYTLEALPILTDDAILEWREHPSVFD
FT                   NAVNSVSVTYFDPDQKTDITTPPVQDLALIQAYGVIHQTIDYPEIPTAPLALRIAAREL
FT                   RASVTPLRTFELKTTRAAYALRPNQYVRLQCPKRGIADMVCIVGSTQSGSLKSGAITLL
FT                   LTQDIYRLPVSFSVEMAASRGAAPAQPPLPITSQHVFEAPYIELVRSLPSRDLSALSAD
FT                   ASYLLAVAHDPATSRNYTLQVDAGTGEYRVAGDGQWCPCARIVAGDVTRIATEFSLTDP
FT                   YRLDQVAIGSAALWGSEIVRVDRITPVGRQLRITLGRGCGDTVAAIHAAGECIWFYEDN
FT                   AAADLTEYVKGETVNVALLTNTGSAQLSSADAAALPLTFVGRAARPYPPGNVTIAAADW
FT                   PEAVSGEFVVMWAHRARLTQADQLVDDRMGSVTLPRNQRYGLRFTDSRGVLLIEHTRMG
FT                   ADSATVSLNTTGQVTMELWSIDNGGTSLHTHRHAFVYTPTDPPPQDSTISAADAMPVFE
FT                   GVIVDGGNLDG"
FT   gene            706078..706512
FT                   /pseudo
FT                   /locus_tag="Xfasm12_0654"
FT   gene            706584..707003
FT                   /locus_tag="Xfasm12_0655"
FT   CDS_pept        706584..707003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0655"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0769 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11653"
FT                   /protein_id="ACA11653.1"
FT                   /translation="MAKSSKQSFVQSVGNFAAQISHATGAGGKVTLFTVGSERGDDEEL
FT                   RALQISNTDTAAIVVNFYVQIAGTNVDVLVGSVSAAAGTTTDCRNTVALAGLFQHDVNG
FT                   NRVHYMQKNHTWKVAAVTAPAVGNTLDIFGVTGKF"
FT   gene            707079..707774
FT                   /locus_tag="Xfasm12_0656"
FT   CDS_pept        707079..707774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0656"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0770 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11654"
FT                   /protein_id="ACA11654.1"
FT                   /translation="MLGDFNTRVRRVKRIPAVLTQWAGFVPAVATQVTQTAPAVLADGD
FT                   VLLAFVMHRSGLTVIPSGFTLVAVASGPTGYAGRDYDQCLSIYQKRAFKSDAGQVHHWG
FT                   QRDNERLIVGYHRYTGSYPLRITGALPSWTHEGGHQVRVPSLGALTAMSDVVLAAATLN
FT                   ITTSETVTAQVSAGWEIQSLATTGNLRLLVAAAVPVSPDTAPPVLDLWPGEWMSGNFNA
FT                   SIALGVASR"
FT   gene            707771..708124
FT                   /locus_tag="Xfasm12_0657"
FT   CDS_pept        707771..708124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0657"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11655"
FT                   /protein_id="ACA11655.1"
FT                   /translation="MITLLTHISNAPLFGNVVGLVLLARRVARAIGITGTLLLGAVADT
FT                   QKHARRHQDPRVIARVPSHGPASLTGGAALTGGFICLTQSSRGLAGSGVCLSIFIRTSR
FT                   SMSAMWKPSLVGF"
FT   gene            708148..708795
FT                   /locus_tag="Xfasm12_0658"
FT   CDS_pept        708148..708795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0658"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mja:MJ0014 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11656"
FT                   /protein_id="ACA11656.1"
FT                   /translation="MCIILFIMERLVGIGEAAQALGVSITTLRRWEASGRLIAEHTVGG
FT                   HRRYDMAKLRPEMFRAQAEANRRTVAYARVSSHDQKDDLERQKQVLELYCAQQGWTFEV
FT                   IADLGSGMNYHKKGLKRLLDAIIDGQIGRLVITHKDRLLRFGAELVFALCEAKNVEVVI
FT                   LNQGQDTSFEEDLAKDVLEIITVFSARLYGSRSSKNQKLLEAVKTAVEASPC"
FT   gene            708789..709985
FT                   /locus_tag="Xfasm12_0659"
FT   CDS_pept        708789..709985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0659"
FT                   /product="transposase OrfB"
FT                   /note="KEGG: xfa:XF0536 transposase OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11657"
FT                   /protein_id="ACA11657.1"
FT                   /translation="MLMAHRIALDPNNVQATHLSRVAGVARFAYNWALAEWRHQYEACT
FT                   LDSALPKPSQHSLRRQLNAIKREQFPWMGEVTKNAPQMAIIQLGQAFQNFFTGRAKYPK
FT                   FRKKGAHDRFTLTNDQFDLNASRIRIPRLGWVRMRETLRFAGRIMSATVSRVAARWFVS
FT                   ITVDVPDPSHLPQAENQGAVGVDLGVLALATLSTGETICGPRPHRALLGRVRRLSRSVS
FT                   RKVKDSANRHKAKATLAHLHARIAAIRLDALHKLTSDLTRRFHTIGIENLNVKGMVKNR
FT                   HLARSIADMGFFEFRRQLEYKAAMRGGQVVVADRFFASSKMCSTCGHTLKELPLSVRQW
FT                   ACLGCGTRHDRDVNAAVNLKNMAVSSTVSACGEEGTGPRRKTAVKPASVKQEVSFESV"
FT   gene            710019..710696
FT                   /locus_tag="Xfasm12_0660"
FT   CDS_pept        710019..710696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0660"
FT                   /product="prophage PSPPH06, putative adenine modification
FT                   methytransferase"
FT                   /note="KEGG: psp:PSPPH_4982 prophage PSPPH06, putative
FT                   adenine modification methytransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11658"
FT                   /protein_id="ACA11658.1"
FT                   /translation="MLLLRPNPAPVEVLNDINGDVVNLYRCVRHHLDEFVRQFRWALNS
FT                   RAEWLREQRVRAETLTDIQRAARFYYLQKLAFGGKVVNQHFGFVTCGASRLNLLRIEEE
FT                   LSAVHVRLADVIIENGPWRVVVDRYDREHTLHYLDPPYWQQEGYGVDFPWSEYEAIADF
FT                   MRVAKGKVVLSINDHPEIRELFEGMNIIPLQLRYSISRTKENNTPSGELIIKSWADTQA
FT                   QLL"
FT   gene            complement(710953..711351)
FT                   /locus_tag="Xfasm12_0661"
FT   CDS_pept        complement(710953..711351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0661"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF2112 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11659"
FT                   /protein_id="ACA11659.1"
FT                   /translation="MNYNRNSNNSGAWVILLSIGALILLVWGFSALLGLDMQSGGSFLL
FT                   GLLIIAALFIVSLFFRGIGEIIHLRKIWPILLALAWACFWPALNYWSSQTLFGHFDTPW
FT                   WATWYTKGGVLFAIIGLGYLINKIFEDF"
FT   sig_peptide     complement(711265..711351)
FT                   /locus_tag="Xfasm12_0661"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.926) with cleavage site probability 0.327 at
FT                   residue 29"
FT   gene            complement(711402..711701)
FT                   /locus_tag="Xfasm12_0662"
FT   CDS_pept        complement(711402..711701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0662"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF2111 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11660"
FT                   /protein_id="ACA11660.1"
FT                   /translation="MNKFKAMINAFYSSIESSFESAFLEERITRLRMKISFLIISIFVF
FT                   LVILFTEIDVSSSGVGGLVILGSIYSAVLFFINHYLNNRFNPDGSLKKKKDASE"
FT   gene            complement(712061..712303)
FT                   /locus_tag="Xfasm12_0663"
FT   CDS_pept        complement(712061..712303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0663"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11661"
FT                   /protein_id="ACA11661.1"
FT                   /translation="MRILSVSEVSDISGGNALTTGMSFRAGAGAFWGVMGGSTSSLILG
FT                   GFTGAGALVGAAGGAGWMLGTFIHNRLASAYPTIF"
FT   gene            complement(712709..712984)
FT                   /locus_tag="Xfasm12_0664"
FT   CDS_pept        complement(712709..712984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0664"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF0532 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11662"
FT                   /protein_id="ACA11662.1"
FT                   /translation="MKSRPVITDEQKARLNAIATMQDERIDYSDAPCLPDAEWVKSAEL
FT                   PDAKRQITLRIDADVLDFFRNTGKRYQTRINAVLRSYVEAHKTGAL"
FT   gene            complement(712986..713273)
FT                   /locus_tag="Xfasm12_0665"
FT   CDS_pept        complement(712986..713273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0665"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF0533 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11663"
FT                   /protein_id="ACA11663.1"
FT                   /translation="MPQMELEWDTDKAALNLQKHGVSFEDAALIFYDQGRIETYDEREN
FT                   YSEDRWATIGRAYSALLYAVYTVRDERIIRLISARKANASERKQYHEANP"
FT   gene            complement(713551..713895)
FT                   /locus_tag="Xfasm12_0666"
FT   CDS_pept        complement(713551..713895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0666"
FT                   /product="putative transcriptional regulator, XRE family"
FT                   /note="KEGG: xfa:XF0534 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11664"
FT                   /protein_id="ACA11664.1"
FT                   /translation="MMSELIESVQILRDAGGHPAFAVIPFSDYQALIKGEFKVNPGIPA
FT                   AVVDLAMDNTWSAARAWREHKQLTQIEVAQRMGITQGAYAQLEAKKSIRKSSREKIALA
FT                   LGIHESQLDF"
FT   gene            715620..715862
FT                   /locus_tag="Xfasm12_0667"
FT   CDS_pept        715620..715862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0667"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF1308 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11665"
FT                   /protein_id="ACA11665.1"
FT                   /translation="MSLICDDHVVVWHMWFRGDALAASAECAMSVCHWERYVQDACLSP
FT                   KNVTASVWISDAVVVIVLVFLLTIDCRKKEGDSLG"
FT   gene            716078..717121
FT                   /locus_tag="Xfasm12_0668"
FT   CDS_pept        716078..717121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0668"
FT                   /product="rod shape-determining protein"
FT                   /note="KEGG: xft:PD0557 rod shape-determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11666"
FT                   /protein_id="ACA11666.1"
FT                   /translation="MSKKLRGMFSNDLSIDLGTANTLIYVRGQGIVLNEPSVVAVRQDR
FT                   AIGGTRSVAAVGVEAKQMLGRTPGNITTIRPMKDGVIADFTYTEAMLKHFIKKVHKARF
FT                   LRPSPRVLVCVPAGSTQVERRAIKESAEEAGARDVYLIEEPMAAAIGAGMPVTEARGSM
FT                   VIDIGGGTTEVAVISLNGIVYSQSVRIGGDRFDESITNYVRRNHGMLIGEATAERIKLE
FT                   VGCAYPQVEVHELEISGRNLAEGVPKVIKINSNEVLEALHEPLSGIVSAVKSALEQTPP
FT                   ELCADVAERGIVLTGGGALLRDLDRLISDETGLYVQVADDPLTCVARGGGRALELVDMH
FT                   GNEFFAP"
FT   gene            717320..718270
FT                   /locus_tag="Xfasm12_0669"
FT   CDS_pept        717320..718270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0669"
FT                   /product="rod shape-determining protein"
FT                   /note="KEGG: xft:PD0558 rod shape-determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11667"
FT                   /protein_id="ACA11667.1"
FT                   /translation="MPSYPGFSLASRSPAVVSTIRLLTYLTLAIVLVVLDSRGAWLSQL
FT                   RQRANWLAQPVWALAGLPGWFGGQLSERAISNARLVNENRQLRNQLLIANARLTRLQTA
FT                   ARDNAQLRELLNFAEHHGLDVQLAPILDVDLDPTRQRLVLDAGSRDGVSVGQTVIDAGG
FT                   LMGQVIEVTPLHSIVLLLTDPDHAVPVTVARNGVRLIVYGRGDRLELRNIPLSSGVKIG
FT                   DVLITSGLGARFPAGFPVGNISALHPDDSHAFLVGEITPAAKLDRGRNVLLLRLGASMS
FT                   PGGGGSLTSRSIIDSNSESHSTNLGASRVIKEPQQ"
FT   gene            718267..718752
FT                   /locus_tag="Xfasm12_0670"
FT   CDS_pept        718267..718752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0670"
FT                   /product="rod shape-determining protein"
FT                   /note="KEGG: xft:PD0559 rod shape-determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11668"
FT                   /protein_id="ACA11668.1"
FT                   /translation="MTRLRNTWLLPVSVILALLLGLLPLPVSVRPIRPYWLALVLMYWV
FT                   IETPGRVGIGFAFVMGVLADFLYGGLLGEQALRLVVMSFIVQRFRARLRFFPMPQQALV
FT                   IGGLLFNDCVVATALHLTLGQPLLPWSYWSAPLLGMLLWAPLFVLLDALRLGHGSRK"
FT   sig_peptide     718267..718356
FT                   /locus_tag="Xfasm12_0670"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.977 at
FT                   residue 30"
FT   gene            718757..720820
FT                   /locus_tag="Xfasm12_0671"
FT   CDS_pept        718757..720820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0671"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="KEGG: xft:PD0560 penicillin-binding protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11669"
FT                   /protein_id="ACA11669.1"
FT                   /translation="MSVHHPQAKHTYAEVEQFRRRALLSLFVVVVCLFGLVGWYFKLQV
FT                   LDHEIYATRSDANRIKLHPVVPGRGMIYDRDGRLLADNVPAFRLDVMPDKVADMEAMLV
FT                   ELGKVIPLSEDELERFHRERKVRRRFMPVTLKLRMSEEEMARFAVDRWRFPGVELEPYF
FT                   TRRYLYSDLFAHVIGYVGRIDEKDLETLNGGDAALTYIGKSGLERYYEQVLRGKIGYQQ
FT                   IETNVQGRAIRSLGRVTAQAGADLRLSIDADLQRAMVAAFGQYEGAAVAMDPRSGEILG
FT                   MVSLPSYDPNLFVNGISHAQFNALNANPSRPQFNRLVSGGVAPGSTLKPLIALAGLDAG
FT                   VRRPEDRILSTGMFYLPGVNRGWGDSHRGGHGWTDLRKSIAQSVNTYYYKLALDLGIER
FT                   FTDYMRRYGLGQLTGVDLTGEISGILPSLEYKRKVRKQAWYQGDTVNVSIGQGDWKVTL
FT                   LQLVRSVAGLASGHMNRPHLVVAERAAFSQPWQVLPQPPSQPISSNPGHVQVVREGMID
FT                   TMRPGGTGYQAAIGAPYSIAGKTGTAQVASRKGEAAVDPRNLPMHLRHRALFVGFAPAD
FT                   NPTIAVAVAVEGGGYGASTAAPIARKIFDAWLLGKLPEGLEPLDSARGRTAIGLTQFDM
FT                   TVAGVCEAGNRAALQLGELQVSVAGGMLNSTAMMPVAPRAPVTLDSLPEEDP"
FT   gene            720877..721938
FT                   /locus_tag="Xfasm12_0672"
FT   CDS_pept        720877..721938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0672"
FT                   /product="rod shape-determining protein"
FT                   /note="KEGG: xft:PD0561 rod shape-determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11670"
FT                   /protein_id="ACA11670.1"
FT                   /translation="MPLCLTLGALMVIGLMVMHSAGAAVTGTSHLMLSQSVRFAFGLVI
FT                   MWCLSRVPVPRLRAWSPLVYVFSMVPLMVVFILGTGKYGRQWLDLKLFYLQPAELLKIS
FT                   LPMMMAWYLHRMPLPPRLFTVMVSFMIIGIPTSLIMLQPDFGTSVLVAASGVFVLLLAG
FT                   LPWWWIGIGVVSIAMIAPFSWFWLLRPYQKDRIMMFLNPENDTLGAGWNIIQSKIAIGS
FT                   GGLAGKGWGLGTQSHLNFIPEQTTDFAFSVLSEEFGWVGVTTVLMLYLFVIMRCLWIAG
FT                   QARDTYSRLLVGALALSFFVYVLVNGGMISGLLPVVGVPMPLMSYGGTSAVSLLVGFGL
FT                   VMGVRSHRRMHHR"
FT   sig_peptide     720877..720948
FT                   /locus_tag="Xfasm12_0672"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.966 at
FT                   residue 24"
FT   gene            722034..723077
FT                   /locus_tag="Xfasm12_0673"
FT   CDS_pept        722034..723077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0673"
FT                   /product="S-adenosylmethionine: tRNA
FT                   ribosyltransferase-isomerase"
FT                   /note="KEGG: xft:PD0562 S-adenosylmethionine: tRNA
FT                   ribosyltransferase-isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11671"
FT                   /db_xref="GOA:B0U6A9"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U6A9"
FT                   /protein_id="ACA11671.1"
FT                   /translation="MLKKSDFHYDLPEELIAQGPLPERSASRLMLVPSAPEQFQDCYVR
FT                   DLPELLQPGDLLVFNDTRVIPARLFGRKVSGGRVEVLIERFLGTHQAVVQLRTSRSLKV
FT                   GNRILLDAGGHAEVLGRDGEFYLLSFDVESPLEQWLSDVGQLPLPPYIHREPDEYDRER
FT                   YQTVFARAVGAVAAPTAGLHFDESLLARLRARGVEFGYITLHVGAGTFQPVRVALLQEH
FT                   VMHSEWFKVGAELVEQVRSARARGGRVIAVGTTVVRSLESAMRHGELQPFVGETQIFIF
FT                   PGYCIRSVDAMVTNFHLPESTLLMLVAAFAGRTRILDAYYHAVQQRYRFFSYGDAMLLF
FT                   PRNAGEQ"
FT   gene            723803..725959
FT                   /locus_tag="Xfasm12_0674"
FT   CDS_pept        723803..725959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0674"
FT                   /product="GTP diphosphokinase"
FT                   /EC_number="2.7.6.5"
FT                   /note="KEGG: xft:PD0563 ATP:GTP 3'-pyrophosphotranferase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11672"
FT                   /protein_id="ACA11672.1"
FT                   /translation="MNVSLFPQELDVLLRRSGVSTLNPELSQGLVQACQALPSEAGQQV
FT                   AWPVLLDMLDALVVLSADETLLIAALLFDLPMLRPMLPVLPWRSSTHQQMVGSLLDGQD
FT                   AAEQVWTLHAGCAAGRNGEGLRRLLLALVHDLRVVPILLARQLAKMRAAGVLLESQRRA
FT                   LAQLTRDIHAPLANRLGIWQLKWELEDLAFCYLESEIYRSIASALDESRVARERYISVI
FT                   AMELSRVLAEHGVCAEVSGRPKHIYSIWRKMQKKRLHFEQVYDLQAVRVMVEDMAACYA
FT                   ALGVVHALWAPVPGEFDDYIARPKANDYRSLHTAVLGPEERTVEVQIRTHEMHAHAELG
FT                   VAAHWKYKEDGKGAERDFDRKIVWMRQLLEQAQEGEFGEVVEALDTELLEDRVYALTPK
FT                   GEVIDVPQGATPLDFAYHVHTMVGHCCRGAKVNGRIVPLTYRLRSGDRVEILTAKEANP
FT                   HRDWLLRANGFLASRRSRDKVRAWFNKIERARNVQVGKESLDRELKRVGQQHVDLSPIA
FT                   RRFHADSVDDLYVQIALGNIGPNQVSRALLETERVVAFAPFARPSKKRHGLSKSMFTVQ
FT                   GVSNILVQLARCCQPVCGEPIAGYLTLSRGVTVHRADCAVLMRLNAMHPQRVLLVEWGS
FT                   QLSGSYEVEILVRAVNRRWLLKDIADVITQEDAHMLEMSSDAFRDNAYLQFRVRLRLSH
FT                   HRQLAALLGKLDGLSGVNEVRRMG"
FT   gene            726086..727597
FT                   /locus_tag="Xfasm12_0675"
FT   CDS_pept        726086..727597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0675"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0564 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11673"
FT                   /protein_id="ACA11673.1"
FT                   /translation="MFFPFFSRLRLRMCILLRRCSVWHVLSIGTLLLGVAVLMLSKFLA
FT                   DWAWPDSRITQLLQRGEVALAQGNLSAPDGSGARELFETAKALDSDRHEAQDGLLRTGQ
FT                   AALAQARITFDRGQFDAAERYLRLARVLQMPQDQVDVLERLVRQRQAEHADLDQLLVRA
FT                   DEAYVAGRLEGDPNSALPLYQRVLELVPGFARALQGREDALSELLRQACVDLERGQLDA
FT                   AAAKLNVAQRYDPGHVDLPQTQDLFNRAIDVHLHRAVRLLRRGLLAPAARDFRAVLAVR
FT                   PEQSAARRGLEDVVERYVAHAGRQAAEFHFEQAELSLARARALLPDQGSIYLAEQALQR
FT                   ARQTRLSLQPKLSKVERERYLGELMGRFDVAERLKEWLTPPGISAYDQVRAAQAIAPAD
FT                   ARVQRAAQRLLVAMRACFEEELGRNRLQSAQACLDVWQAINGQDVGLLGARKRLAQRWI
FT                   AVGSERFGEGDITFARRALEQARRWGSRTPELDELARRVDLASQR"
FT   gene            complement(727662..727883)
FT                   /locus_tag="Xfasm12_0676"
FT   CDS_pept        complement(727662..727883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0676"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11674"
FT                   /protein_id="ACA11674.1"
FT                   /translation="MERRPSYKPSQQKDSNPNEVSTRSDSTKLKSDWVASITPSTSKLD
FT                   WDANTRYSTKSNQLSQGKRRLDPTRSED"
FT   gene            complement(728112..728615)
FT                   /locus_tag="Xfasm12_0677"
FT   CDS_pept        complement(728112..728615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0677"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF1319 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11675"
FT                   /protein_id="ACA11675.1"
FT                   /translation="MPSTLTTSQTTPNALENVVRIGHIVPEDALELLARYGLHLHLIED
FT                   GAPIPGSYWGEPEAGIIGCNVYVRNDTPVHSMLHEACHLIVLPPEQRATVHTNATNSSE
FT                   EEDATCYLQIVLADALPGIDRDRLMQDMDAWGYSYRLGSTRAWFEQDAENARDWLNARG
FT                   LLTP"
FT   gene            complement(728678..728935)
FT                   /locus_tag="Xfasm12_0678"
FT   CDS_pept        complement(728678..728935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0678"
FT                   /product="cell division topological specificity factor"
FT                   /note="KEGG: xft:PD0566 cell division topological
FT                   specificity factor"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0678"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11676"
FT                   /db_xref="GOA:B0U6B4"
FT                   /db_xref="InterPro:IPR005527"
FT                   /db_xref="InterPro:IPR036707"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U6B4"
FT                   /protein_id="ACA11676.1"
FT                   /translation="MGLIDFLRNKTKTAETAKNRLQIIIAQERTQRGGPDYLPLLQREL
FT                   LEVIKKYVKIDANAVKVDLIKDGANDVLDISVALPDDSER"
FT   gene            complement(728938..729747)
FT                   /locus_tag="Xfasm12_0679"
FT   CDS_pept        complement(728938..729747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0679"
FT                   /product="septum site-determining protein"
FT                   /note="KEGG: xft:PD0567 septum site-determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0679"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11677"
FT                   /protein_id="ACA11677.1"
FT                   /translation="MAEIIVITSGKGGVGKTTTSASLACGLARRGKKVAVIDFDVGLRN
FT                   LDLIMGCERRVVYDFVNVIHGEATLKQALIKDKRFDNLYLLAAAQTRDKDALTKEGVEK
FT                   VLNELQAEGFDYICCDSPAGIEKGASLAMYFADRAVVVVNPEVSSVRDSDRIIGLLDSK
FT                   TKKAETGGSIITTLLLTRYSPTRVESGEMLSITDVEEVLGLKAIGIIPESGDVLNASNK
FT                   GEPVILDNNSLAGLAYEDAVGRILGEDHPMRFTTVEKKGFFSKLFGS"
FT   gene            complement(729784..730500)
FT                   /locus_tag="Xfasm12_0680"
FT   CDS_pept        complement(729784..730500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0680"
FT                   /product="cell division inhibitor"
FT                   /note="KEGG: xfa:XF1322 cell division inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11678"
FT                   /db_xref="GOA:B0U6B6"
FT                   /db_xref="InterPro:IPR005526"
FT                   /db_xref="InterPro:IPR007874"
FT                   /db_xref="InterPro:IPR013033"
FT                   /db_xref="InterPro:IPR016098"
FT                   /db_xref="InterPro:IPR036145"
FT                   /db_xref="InterPro:IPR038061"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U6B6"
FT                   /protein_id="ACA11678.1"
FT                   /translation="MSNVNMDFEQAGELKIGQVGIATLRIRTLNVPRLIQEMSDRVTRA
FT                   PKLFRRTAVILDFGELPHPPDLTTAKALVDGLRAANVLPVAIAYGTNEIDLLSQQLGLP
FT                   LLSKFRAHYERQEVAAPPPQSTPPINTGRIQHTTVRSGQQLYAEHCDLTILNTVGAGAE
FT                   VIADGNIHIYGTLRGRAMAGARGNAEMRIFCRDFQAELIAIAGRYKVLDDIPTELRGKA
FT                   VQVWLEQNQIKIAALD"
FT   gene            complement(730516..731094)
FT                   /locus_tag="Xfasm12_0681"
FT   CDS_pept        complement(730516..731094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0681"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF1323 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0681"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11679"
FT                   /protein_id="ACA11679.1"
FT                   /translation="MPIIIRDVRESELDAVLTLNNEAGLAILPLDLSALYRFYKEADYF
FT                   RVAERDGNLAGFLVGFGSASRHSSSNFAWFRERYENFFYIDRIVVASRRRGGGVGRAFY
FT                   ADVHSYAELRYPYLTCEVFLDHGAEAALLFHGSFGFHEVGQNTMTDIDVRASMLMKKMC
FT                   SYPWIQETYGDKLPNLPWVGLQRHIGTPN"
FT   gene            731497..732684
FT                   /locus_tag="Xfasm12_0682"
FT   CDS_pept        731497..732684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0682"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0570 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11680"
FT                   /protein_id="ACA11680.1"
FT                   /translation="MIRSRITEFLIALGMVAVLFLVIGFVLPAQRHMSESIGTNRKATI
FT                   VYDTVNSFRRFKDWSPLLLRDPKLQINLVGPESGKGARVEYSSNQKDIGSGSWEIINSV
FT                   KNERVEIAIQDATRGYDKVTTFTLKPSGKNNRNIEITQDYNVKYGFNLFGRYAGLYVSR
FT                   NVGEHLKVGLLRLSNILASVPNVDYRAEMDGKLTVANLRIVEVPAENLLVVNAGNIDRQ
FT                   NDTIKKSIKDNQEWIKRVMDANGLEPSAPIRIVTTDFAQQKYAFDVVQPVRKKVESKPG
FT                   ETKSKTDSKEKKPQKNVVDKDKVVHAATVSADGTLKVAISAGAPVKYVHTKPRRAASAS
FT                   YTGHMAGLDAARNALRAWAVTSGYEVIDRPYESWKGGVDKAFTQEGSYDLYWAVK"
FT   gene            732812..733033
FT                   /locus_tag="Xfasm12_0683"
FT   CDS_pept        732812..733033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0683"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0571 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0683"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11681"
FT                   /protein_id="ACA11681.1"
FT                   /translation="MRNVFSSSGAVLVVFVPSGSCSLIWTALALHCQLQCSLAVFQSRV
FT                   GRCVVAGLDSDSSVLLDRDDDRQDTAGY"
FT   sig_peptide     732812..732880
FT                   /locus_tag="Xfasm12_0683"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.821) with cleavage site probability 0.280 at
FT                   residue 23"
FT   gene            733055..733735
FT                   /locus_tag="Xfasm12_0684"
FT   CDS_pept        733055..733735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0684"
FT                   /product="DNA-3-methyladenine glycosidase"
FT                   /note="KEGG: xfa:XF1326 DNA-3-methyladenine glycosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0684"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11682"
FT                   /protein_id="ACA11682.1"
FT                   /translation="MAWYPRGFDVVAAYDHLYHCDPGLSGWMQRLGPLPALRGWRQPFN
FT                   VVDALARAILFQQLSGKAASTIVARIEAVIGSTCLYAETLACIDDACLRACGVSSNKIL
FT                   ALRDLTRREVAGELPSVRQMGAMHHNTIVEKLIPIRGIGRWTVEMMLMFRLGRPDVLPV
FT                   DDLGVRKGIQRVDTLAFVPTPKALCTRGECWAPYRTYAGLYLWRIADFHEGEGAMISDR
FT                   SQDE"
FT   gene            complement(734079..734648)
FT                   /locus_tag="Xfasm12_0685"
FT   CDS_pept        complement(734079..734648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0685"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0573 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0685"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11683"
FT                   /protein_id="ACA11683.1"
FT                   /translation="MFKGSFLTVLTAAALVIGCCVVPPACATDYVQTSGSILVFSNKYD
FT                   GKVFTGTFPGFYTQMSFDPNDLSKAHLDVTIPLTHAQTGDKDRDSTLQSADFFNVSKFA
FT                   TAHYQASKFRALGHDKYAADGTLELHGMTKPVTLTFTWTPGTQPVLNGKATVNRLDFGI
FT                   GSGDWADIKIIPNETAISTKVVFKAK"
FT   sig_peptide     complement(734565..734648)
FT                   /locus_tag="Xfasm12_0685"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 28"
FT   gene            complement(734666..735232)
FT                   /locus_tag="Xfasm12_0686"
FT   CDS_pept        complement(734666..735232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0686"
FT                   /product="cytochrome b561"
FT                   /note="KEGG: xft:PD0574 cytochrome b561"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0686"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11684"
FT                   /protein_id="ACA11684.1"
FT                   /translation="MTLKGTAERWGWMSQALHWLIAVLILGLGIGGLIMGKLPKTPNYF
FT                   WVYTAHKSIGISVLALAVLRLLWRLYVGAPKPIAGTPVWQERVANATHIMLYVLIFTIP
FT                   LAGWLYDSARGLRTFYWFGLFEMPALVSPNETIRGIALEIHKLSFWALIGLVVLHAGAA
FT                   FHHHLIQRDATLARMLPRNWFSSKS"
FT   gene            complement(735245..735949)
FT                   /locus_tag="Xfasm12_0687"
FT   CDS_pept        complement(735245..735949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0687"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0575 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0687"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11685"
FT                   /protein_id="ACA11685.1"
FT                   /translation="MFRINLMLLALLLTVPLVGTAATTRYVLDPVHTRIMFVIDHAGIS
FT                   KALGTVSGSTGILDFDPDNWSNAQLDVHIPLQRVDLGDAKWNKATLAQGLLDTAHYPEA
FT                   HFVSTQVTATSPSNGKAIGQLTLHGITREVVLDITLYGIKRHPLPPFRRTAGFSANTTL
FT                   SRSAFGINAWKSMIGDEVQLRIEVEAVRQRGIKKETTEQTVHQDTTTSSNTKESDATLH
FT                   KTDTSKKTNELL"
FT   sig_peptide     complement(735884..735949)
FT                   /locus_tag="Xfasm12_0687"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.960 at
FT                   residue 22"
FT   gene            736148..739687
FT                   /locus_tag="Xfasm12_0688"
FT   CDS_pept        736148..739687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0688"
FT                   /product="histidine kinase/response regulator hybrid
FT                   protein"
FT                   /note="KEGG: xft:PD0576 histidine kinase/response regulator
FT                   hybrid protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0688"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11686"
FT                   /protein_id="ACA11686.1"
FT                   /translation="MPRFRVLDATSGLPSNVVRAMLQDAAGYLWLATSDGLARYDGTAF
FT                   KVWRHDPNDPGSLPGDSVLALYIDVQDRIWVLSENAGLAVLDAQRRRFIQIPVGSVAKT
FT                   DALHTLTGHGDAIWLSDLHASVIRIDSAGALTRYALADVSPTLKDTPVVALTFDANGRL
FT                   WVGTPDGLLYFEAGRLHLAPPPLDKASIHSIAAVGSRLWVGSTDGVYLQDAEGRWRAPN
FT                   WGPMFAFGNLLLSVADAGDGEFWLGSERGLWRTRQERPPVQIHLSDMHHGVSTVSSLWR
FT                   DTSGGLWVPVYGRGLGYLRQDWKRMAVVRPSDGGESSYCNVAPAAYSGGLWQLNRIGEL
FT                   MHLNTSTGELVHTGWQRHELRGVNITTTLEDSRGRLWLANMQNGLSRLDLKNGQWREWA
FT                   AHGDDAVPLYGPISWIVEMPDSSLWLEALGVLQQRDLESGRVLNQIVPGSHGLDGSRVE
FT                   QIGLGPDGRLWLAAGSGVYAWESQRRMFVPIPDLTGTRAYSFVPVGGNEVWVHRLRGLE
FT                   QWRHSSHGWKRVALVGPQHGLPAMESLGMQHDAQGRIWLSTRRGLWRIDNTDELQVRNF
FT                   GLRDGLGTQEFAEACLWMAPDGVLVGGTTDGYLMLFDTAMPDPAPFVPQLRMETVSVIR
FT                   AGRRIDFPVDRPFELLPNDRQLIVGARLLSFGDPLSNRYSYWLKGFDTGWIDQGSSGTR
FT                   EFSSLPPADYTLLIQGTDPMGNLSRIHLVTFRVLPPWWRSAWGMSVLTGSGLLLLWGVS
FT                   WNYHRRLRRRARLQLEQHQREVAERASLAKTQFLATLGHEVRTPMTGVLGMSELLLETP
FT                   LDTRQHGYATSIQAVGKHLLRLVNDALDLAKIEAGKLSLERRDFDFHALLEQVVAMIRP
FT                   MVERKGLRFVYRLDPEVPQYVHGDADRLQQILLNLLINATKFTEHGEVVLQVAPGQEQA
FT                   CLGVRIDVVDTGPGLSEEQCQRLFRRFEQVNGASTAARYGGSGLGLAICRELATVMEGE
FT                   IHVDSELGKGTCFRVLLPLPWVLAVQPAVAVMDMEPSPCSNPLHLLLIEDDPTVAEVIV
FT                   ELLRVRGHRVTHALHGLEALVEVTLTRFDACLCDLDLPGLDGAGLIVQLRAQGQSFPIV
FT                   VVTARTDADARRQAFQVGCDAFLRKPVTGEMLEQVLTQVLSAPRQEVDVHTPKKRNGMG
FT                   RPRISDSIKRDLG"
FT   gene            complement(740407..741471)
FT                   /locus_tag="Xfasm12_0689"
FT   CDS_pept        complement(740407..741471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0689"
FT                   /product="Uroporphyrinogen decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /note="KEGG: xft:PD0580 uroporphyrinogen decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0689"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11687"
FT                   /db_xref="GOA:B0U6C5"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U6C5"
FT                   /protein_id="ACA11687.1"
FT                   /translation="MLKNDRLLRALRRDTVDRTPIWLMRQAGRYLPEYRAARQHAGSFL
FT                   KMAKTPELACEITLQPLRRFPLDAAILFSDILMIPDAMGLELHFIEGEGPRLGKPIRDA
FT                   AAITQLAVPDMETELRYVMDAVRLIRKELDNSVPLIGFSGSPWTLACYMIEGGGSKEYA
FT                   HIKAMAFNAPDVLHQLLNTVTDAVISYLAAQRAAGAQALQVFDTWGGILSPTMYRTFSL
FT                   PYLTRIARELERGTGTEHTPLVLFGKGNGPYIAELAMSGTEAVGVDWTIELEDAARRSN
FT                   GQVALQGNLDPATLYGTPNNIAREVQRTLDSYAAGNGGSREGHVFNLGHGMTPGMDPDH
FT                   VSALVEAVQRLSRR"
FT   gene            complement(741557..741802)
FT                   /locus_tag="Xfasm12_0690"
FT   CDS_pept        complement(741557..741802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0690"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF1333 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0690"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11688"
FT                   /protein_id="ACA11688.1"
FT                   /translation="MHHTPSLTPQPHQMHPHNNDNRSPCVHPCPPLSNDPILSNALRNL
FT                   IYWNVRNGYNRTSRSAHASNCNRCTVHDSKHRIACV"
FT   gene            complement(741852..742964)
FT                   /locus_tag="Xfasm12_0691"
FT   CDS_pept        complement(741852..742964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0691"
FT                   /product="3-dehydroquinate synthase"
FT                   /note="KEGG: xft:PD0581 3-dehydroquinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0691"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11689"
FT                   /db_xref="GOA:B0U6C7"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U6C7"
FT                   /protein_id="ACA11689.1"
FT                   /translation="MTTPTPLRSVTVNTPPPYTIAIGPGLLHDPPRLAATIRGRHALIL
FT                   SDSEVAPRYAAQLHETLLRARPDLHLNVFTLPAGETSKSLENFGAAIAQLATLGATRDA
FT                   CLFALGGGVIGDLTGFTAACWMRGIDYVQVPTTLLAMVDSSVGGKTAVDIPQGKNMVGA
FT                   FHPPRAVIADTDTLATLPLRELRAGLSEVIKYGAIRDPVFFHWLQTTREALLARDPAAL
FT                   AQAIARSCEHKADIVGRDPLEKGERVLLNLGHTFGHAIETTQGYSTPGSNNLNHGEAVA
FT                   VGMVLAARLSNTLGLAPAEDTETLKNLLDAYGLPTVLPSGLKPETLLERMRLDKKNIAG
FT                   RLRLVLWRGIGHAEAVPDVDEAAVRQILAN"
FT   gene            complement(742961..743503)
FT                   /locus_tag="Xfasm12_0692"
FT   CDS_pept        complement(742961..743503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0692"
FT                   /product="Shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="KEGG: xft:PD0582 shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0692"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11690"
FT                   /db_xref="GOA:B0U6C8"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U6C8"
FT                   /protein_id="ACA11690.1"
FT                   /translation="MNPAPNLVMIGPMGAGKSSIGRRIAKHFNLHFADTDHAIVERAGT
FT                   SISTIFKYSGEPEFRRLEREVLHDLLNHENRLIATGGGTILDPENRHRMQKRGFVVFLK
FT                   INVNTQLERLAHDRYRPLLQQTDRKQVLSDLYATRQPLYQKIADMIVTTDHMSPNTATA
FT                   QLILDLTAHWQKSSNTA"
FT   gene            743762..744361
FT                   /locus_tag="Xfasm12_0693"
FT   CDS_pept        743762..744361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0693"
FT                   /product="Pyridoxamine-phosphate oxidase"
FT                   /EC_number="1.4.3.5"
FT                   /note="KEGG: xft:PD0583 pyridoxamine 5'-phosphate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0693"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11691"
FT                   /protein_id="ACA11691.1"
FT                   /translation="MLNLYAEALSTFSLLFEEAKSSSEIEPDAMMLATASLEGHPSVRT
FT                   VLLKKFDARGFVFYSHLDSPKGRDLQNNPQAALLFLWRSLREAGVQVRIEGRVKQVLAE
FT                   EADAYFASRPRQSQIGAWASMQSCPLGSPEEFQARLAEVKAMFEGRDVPRPEEWVGFRV
FT                   VPRVFEFWYGASFRLHERWRYQADAAGYWRKFLLYP"
FT   gene            complement(744627..746369)
FT                   /locus_tag="Xfasm12_0694"
FT   CDS_pept        complement(744627..746369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0694"
FT                   /product="Glutamine--tRNA ligase"
FT                   /EC_number="6.1.1.18"
FT                   /note="KEGG: xft:PD0584 glutaminyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0694"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11692"
FT                   /db_xref="GOA:B0U6D0"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR004514"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020059"
FT                   /db_xref="InterPro:IPR020061"
FT                   /db_xref="InterPro:IPR022861"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U6D0"
FT                   /protein_id="ACA11692.1"
FT                   /translation="MSEITTTDAQAQPEKKDFIRQIIREDLAHGTHTHIHTRFPPEPNG
FT                   YLHIGHAKAICLDFGVAAEFGGHCTLRMDDTNPSKEDPAFAAAIQEDVSWLGFHWNALR
FT                   HTSDYFEVLYLAAEKLIADGKAYVCDLNSEQVREYRGTLTEAGRPSPWRERSPDENLEL
FT                   FRQMRAGTFPDGTRTLRAKIDMASGNINLRDPALYRIKHVEHQNTGNTWPIYPMYDFAH
FT                   ALSDAIEGITHSLCTLEFEDHRPLYDWCINHVDLPNNSHLLKPLLDKGFPQEPSQPRQI
FT                   EFSRLNINYTVMSKRKLTALVDEKLVEGWDDPRMYTLQGLRRRGYTPAAMRLFVERIGI
FT                   SKQNSIIDFSVLENCLRENLDTIAPRRMATIAPMKLVLTNLPEDHEEQLIFPNHPKDDT
FT                   QGTRTVPFSRELWIERDDFSEVPPKGWKRLVPGGEVRLRGAGIARIDEVVKNAEGHIIA
FT                   LHGWLDPTSRPGMEGAHRKVKGTIHWVSAPHAVAAEIRLYDRLFSIEKPDDNTDGKTYR
FT                   DFLNPDSKRVVHGYIEPAAAQTAPEHAFQFERLGYFVTDRHDHDATHPVFNRSVTLRDT
FT                   WQRD"
FT   gene            746740..747051
FT                   /locus_tag="Xfasm12_0695"
FT   CDS_pept        746740..747051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0695"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF1340 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11693"
FT                   /protein_id="ACA11693.1"
FT                   /translation="MFSGIKQLCGCWGSTFFTVSGEFSLVCSCGRICVYLAIWVYLYGS
FT                   VRGVLMVQCVEVGGVVAVHGYLYVGSSGYGMGFIGHWVALIGWDGVAWLSDVECLEVR"
FT   gene            747058..747864
FT                   /locus_tag="Xfasm12_0696"
FT   CDS_pept        747058..747864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0696"
FT                   /product="copper homeostasis protein"
FT                   /note="KEGG: xft:PD0586 copper homeostasis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0696"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11694"
FT                   /protein_id="ACA11694.1"
FT                   /translation="MFMSCAFLGSHEDKSRGSWEEGMSVSAGLEVAAGSVASALAAQEG
FT                   GAMRVELCHGLEGGGLTPSYGMLAVVRERLHIPLYVLIRPRGGDFVFSEEEMEVMCGDV
FT                   ECCVRLGCDGVVLGALDPAGEVEMGMMRVLIAAAGSLGVTFHRAIDVSADPGRTLEDVI
FT                   VLGCERVLTSGGRSSALEGAETIAALVAQAAGRVVVMPGAGVSVGNVLELRVRTGAHEF
FT                   HASARSVVAARRLGPHPYIHDLGGDYDCTDVDKVRQLVRLLSQGAS"
FT   gene            748107..748418
FT                   /locus_tag="Xfasm12_0697"
FT   CDS_pept        748107..748418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0697"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF1343 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0697"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11695"
FT                   /protein_id="ACA11695.1"
FT                   /translation="MDKVKMCQSVFRFLCCVLVVMPIFILSACALKSSRPNMLQPVVLP
FT                   QVSGNVARYRFEMTQNGQRMTADQFDAWMQANGIHIVKKVSGMPTSQRHITRLGGSAP"
FT   sig_peptide     748107..748199
FT                   /locus_tag="Xfasm12_0697"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.778) with cleavage site probability 0.463 at
FT                   residue 31"
FT   gene            748561..749580
FT                   /locus_tag="Xfasm12_0698"
FT   CDS_pept        748561..749580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0698"
FT                   /product="ABC transporter sulfate binding protein"
FT                   /note="KEGG: xft:PD0588 ABC transporter sulfate binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0698"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11696"
FT                   /protein_id="ACA11696.1"
FT                   /translation="MNRCIPIRYVAALLLGLLLSVSLAGAREQTLLNVSYDPTREFYRD
FT                   YNAVFERHWKQTTGKTVKIETSHGGSGKQARSVIDGVEADVVTLALAYDVDAIVERSKL
FT                   VDPGWQKRLPDNSAPYTSTVVFLVRKGNPNNIRDWPDLLRSGVQVITPNPKTSGGARWN
FT                   YLAAWSYADYIFKGDREKILRYMRALFRNVPILDTGARGATTTFAQRGIGDVLLTWENE
FT                   ALLAREELGPDKFEIVMPKMSILAEPSVALVDKNADKHGNRAVAEAYLQYLYSPSGQRL
FT                   AAKHFYRPRHPELVDAVDLARFPRIKLVTIGRAFGSWTKVQQEHFTDGGVFDQIQAGK"
FT   sig_peptide     748561..748641
FT                   /locus_tag="Xfasm12_0698"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.931 at
FT                   residue 27"
FT   gene            749584..750444
FT                   /locus_tag="Xfasm12_0699"
FT   CDS_pept        749584..750444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0699"
FT                   /product="sulfate transport system permease protein"
FT                   /note="KEGG: xfa:XF1345 sulfate transport system permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0699"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11697"
FT                   /protein_id="ACA11697.1"
FT                   /translation="MTESTAVPTPLSRRRVIPGLGLSLGITFVWLGLIVLIPLVGVFVK
FT                   ASGLGWSGLWNVWMEPRVLSALSVSFGAALVAAAFNAVMGTWVAWVFGRYDFPGKRVFD
FT                   AIIDLPFALPTAVAGIALAALYGPNGWIGCWLELAGFKIAYTPLGIVVALVFVGLPFVV
FT                   RIVQPVLAEAEKELEEAAASLGANRWQTMFRVVLPTLWPAMLTGFALAFARGVGEYGSV
FT                   IFIAGNLPNATEIAPLLITIRLEEFDYSGATAIAAVMLLLSFTVLLMVNAMQACLLRVK
FT                   HRGGR"
FT   gene            750441..751400
FT                   /locus_tag="Xfasm12_0700"
FT   CDS_pept        750441..751400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0700"
FT                   /product="sulfate transport system permease protein"
FT                   /note="KEGG: xfa:XF1346 sulfate transport system permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0700"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11698"
FT                   /protein_id="ACA11698.1"
FT                   /translation="MSKDMMSGPSPCVQGQRGVQRWHRLLTASATTESLWVQWLLILGA
FT                   LGFLLAFLLLPLMLVFSEALRGGVQVFLRAVSDPDALAAIRLTMLVTMIVLPVNMVFGV
FT                   AVAWAVSKHQFPGKRLLVSLIDLPFSVSPVVAGLVFVLIFGRQGWAWPLIEDGVRFSLP
FT                   LFGEVIVKLPRVVFALPGIVLATIFVTLPFIARELMPLMEQQGNEEELAALSLGASGWQ
FT                   TFWRVTLPNIRWGLLYGALLCGARAMGEFGAVSVVSGHIRGRTNTMPLHVEILYSEYAY
FT                   SAAFACASLLALSALLTLALKAFLEKRHGELLAVGRQH"
FT   gene            751414..752460
FT                   /locus_tag="Xfasm12_0701"
FT   CDS_pept        751414..752460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0701"
FT                   /product="sulfate ABC transporter ATP-binding protein"
FT                   /note="KEGG: xft:PD0591 sulfate ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0701"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11699"
FT                   /protein_id="ACA11699.1"
FT                   /translation="MGIRIQELRKQFEDFTALAGIDLDIRQGELLALLGPSGSGKTTLL
FT                   RIIAGLEHADAGRVLFGDEDATTMSVQARRVGFVFQHYALFKHMSVYENVAFGLRVRRG
FT                   KARWPESQISARVFELLSLVQLDGLEQRYPMQLSGGQRQRVALARALAIEPRVLLLDEP
FT                   FGALDAQVRRDLRRWLREIHDRTGLTTVFVTHDQEEALELADRVAILNQGGIEQVASPA
FT                   EVYNRPSSPFVYSFVGAVNRLPGCVSADGLEVAGIVLSCPPQLSGGGAVDLYVRPEDLV
FT                   LDAQEGWSAIVLWSQRSGPRMRVRARLEHSAHEVEIELSSATDEYVEGQKLRLIPRHYG
FT                   VFFSESGS"
FT   gene            complement(752682..753632)
FT                   /locus_tag="Xfasm12_0702"
FT   CDS_pept        complement(752682..753632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0702"
FT                   /product="lipid A biosynthesis lauroyl acyltransferase"
FT                   /note="KEGG: xft:PD0592 lipid A biosynthesis lauroyl
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0702"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11700"
FT                   /protein_id="ACA11700.1"
FT                   /translation="MNANSKIRWLYRVASLVGHIPWPLLKRLSDLIAYCWLCLNARESR
FT                   VTQRNLELTYPELSPQEHTHLHHQIIYSTVRQAFEMLHIWTHPEIENLARLREYHGVDL
FT                   YSAALARNRGMIIVVPHFGNWELLKQYLSDLAPLTLMYRPANSAVLDGFLQRVRGGNNV
FT                   HQVRAEGMAVRHLFKVLKNGGTIGILPDQQPKIGEGVFAPFFGIEALTMTLIQRLAERT
FT                   GATVLYAWCERISPHLEFALHMEHADPAVADPDPLIAATALNAGIERIARRDPTQYQWT
FT                   YKRYSLRPPDSGEHNPYEIKHQSHSIAKTLKHPDR"
FT   gene            753988..755859
FT                   /locus_tag="Xfasm12_0703"
FT   CDS_pept        753988..755859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0703"
FT                   /product="RNA polymerase sigma-70 factor"
FT                   /note="KEGG: xft:PD0593 RNA polymerase sigma-70 factor"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0703"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11701"
FT                   /protein_id="ACA11701.1"
FT                   /translation="MRSPIMSNERTAQQSDIKQLISKGLEQGYLTYAEVNDHLPEDLVD
FT                   PDQIEDIIGMINGMGIEVHEVAPDAETLLLNEGNTGNREVDDTAAEEAAAALSALDTEA
FT                   GRTTDPVRMYMREMGTVELLTREGEIAIAKRIEEGLSEVQAALGAFPLSTELLLSEYEL
FT                   HKEGKRRLTEVVVGFNDLIEDDNSVTSSVDVTDESIVEVDEEDDDSVGNDEDAPMIGPD
FT                   PAEVASRIESLSTEYAKFKKLYAKHGPEHKAVIKVREDMAAIFVTFKLSLPLTDLLVQQ
FT                   LQNMVNSVKDHERKVLHLATNVAKMPRKDFIRSWENNQTNLEWVEDAIKRKQKWSSALR
FT                   DIKDQITAEQQSSIDLEKVNSLTLADIKEINRMMVYGEAKASKAKKEMVEANLRLVISI
FT                   AKKYTNRGLQFLDLIQEGNIGLMKAVCKFEHRRGFKFSTYATWWIRQAITRSIADQART
FT                   IRIPVHMIETINKLNRISRQMLQQFGREATPEELAKEMDMPEDKIRKVMKIAKEPISME
FT                   TPIGDDEDSHLGDFIEDPNVESPVDTTTNVNLSETVREVLAGLTPREAKVLRMRFGIDM
FT                   NTDHTLEEVGKQFDVTRERIRQIEAKALRKLRHPSRSEQLRSFLDID"
FT   gene            756189..756359
FT                   /pseudo
FT                   /locus_tag="Xfasm12_0704"
FT   gene            complement(756421..758670)
FT                   /locus_tag="Xfasm12_0705"
FT   CDS_pept        complement(756421..758670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0705"
FT                   /product="topoisomerase IV subunit A"
FT                   /note="KEGG: xft:PD0594 topoisomerase IV subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0705"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11702"
FT                   /protein_id="ACA11702.1"
FT                   /translation="MTDLTRPFFHGFEQMPLREYAERAYLDYSMYVVLDRALPFIGDGL
FT                   KPVQRRIIYAMHELRLNPKAKPKKSVRAVGDVIGKYHPHGDLACYEALVLMAQPFSYRY
FT                   PLIEGQGNFGSSDDPKSFAAMRYTESKLTPISEILLSELSEGTVNWITNFDGTLEEPAW
FT                   LPSRLPHLLLNGTTGIAVGMATDVPPHNLNEITSALIHLLDNPNATIAALCQYIRGPDY
FT                   PTAAEIITPPSDLQNLYETGNGSVRTRATYHKEDGNVVITSLPYQVSPSKVIEQIAQQI
FT                   RSKKLPWLDGEGVRDESDHKNPVRIVLFPRSQRIDVEQLMGHLFATTDLEKSHRVNLNV
FT                   IGLDGRPQVKPLKQLLSEWLSFRSDTVTRRLKYRLQKVENRLHLLEGLLITFLNLDKVI
FT                   HIIRNEDEPKPVLIARFGLSDAQTEYILDTKLRQLARLEEMAIRSEQDALTKERDEINV
FT                   ILDSDVQLKKLIKDELLADAKTFGDARRAPLVARQAAQAIDESELVASEPMTVVLSEKG
FT                   WIRAAKGHDVDPSGMSYREGDRLLAAVRTRSTHQVSFLDSEGRAYSTLVHTLPSARGNG
FT                   EPLTGRFSPAPGASFQAMASADNDKLFVLASSHGYGFITRFENLTGRNKAGKAMIHLTP
FT                   GAQVMGLAPLTDVQHDRIVAVTSAGNLLAIAASELPELDKGKGNKLIDIPKTKLATERL
FT                   VAVIAVASSHTLLLYSGERTMHLSFKDLEAYLDTRGSRGQLLPRSWHKIDTLDIQ"
FT   gene            759021..759458
FT                   /locus_tag="Xfasm12_0706"
FT   CDS_pept        759021..759458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0706"
FT                   /product="transcriptional regulator MarR family"
FT                   /note="KEGG: xft:PD0595 transcriptional regulator MarR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0706"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11703"
FT                   /protein_id="ACA11703.1"
FT                   /translation="MDPSTSPGISLLLRQVCDGLVRQLDEEMRQEFPDLGFTHYLGLKV
FT                   IAIHAPCTANKLAQALDQTPSAVTRLLDKLEAMGVVRREPHAQDRRALHIVMTETGKDL
FT                   WRRLKQHGECATTYALRELSEDDQGQLIHLLTRIRNSLDLS"
FT   gene            complement(759609..759845)
FT                   /pseudo
FT                   /locus_tag="Xfasm12_0707"
FT   gene            760000..760227
FT                   /locus_tag="Xfasm12_0708"
FT   CDS_pept        760000..760227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0708"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0596 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0708"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11704"
FT                   /protein_id="ACA11704.1"
FT                   /translation="MVIAFLVLVIWSLTDKDPVINPKWFITVTATPLRLLMLAYLVQGL
FT                   EYFPYIVWWLFGDAGRWYDCSSCRLEGHDV"
FT   gene            complement(760252..761019)
FT                   /locus_tag="Xfasm12_0709"
FT   CDS_pept        complement(760252..761019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0709"
FT                   /product="biotin biosynthesis protein"
FT                   /note="KEGG: xft:PD0597 biotin biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0709"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11705"
FT                   /db_xref="GOA:B0U6I9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR010076"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U6I9"
FT                   /protein_id="ACA11705.1"
FT                   /translation="MYIEVTGYGPALVLIHGWAMHSGVFAPLVEQLRPHHTLYLVDLPG
FT                   HGYNHTTPTPLALPQVVHAIAAATPPAVWLGWSLGGLFALHAAATLPQVRGLIMLAATP
FT                   CFVRREDWPHAVEVSIFTQFAQDLKQNYTETINRFLALDTLGSTHAQSELRQLRKILNA
FT                   RHTPNTATLQAGLELLAHTDLRRAVIDLTPPSLWIAGQRDRLVPAASIQAATALAPSGQ
FT                   TELLTITGGGHAPFLSHANQMTAALQHFIATLP"
FT   gene            complement(761175..762380)
FT                   /locus_tag="Xfasm12_0710"
FT   CDS_pept        complement(761175..762380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0710"
FT                   /product="8-amino-7-oxononanoate synthase"
FT                   /EC_number="2.3.1.47"
FT                   /note="KEGG: xft:PD0598 8-amino-7-oxononanoate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0710"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11706"
FT                   /db_xref="GOA:B0U6J0"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004723"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022834"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U6J0"
FT                   /protein_id="ACA11706.1"
FT                   /translation="MTRPDLNERILSLRKLRLAQCRTRTRRTIERRNGVRLEINGSWLV
FT                   EFCSNDYLGLAQHFEIIAALQDAAARNGIGATASHLICGHHAIHKALEYELAEWLGYPR
FT                   ALLFGSGFTANLAVQQALLTKENDICVQDRLNHASLIDATRLAGCRLRRYPHLDVDGAA
FT                   HQLKNAPEGAAMLATDGIFSMDGDIAPLRALSLVARTQQALMYVDDAHGIGVTGPQGRG
FT                   CIAAAWLSVEEVPLQLVTLSKALGGYGAAVLGSATLIQHLAETARPYIYTTALPPAQAA
FT                   AALTAIRIARRDEWRRQRLQELVERFRENSRRHGLEIMDSETPIQPLQCGDETTTMAMS
FT                   AALEREGFLVNAIRPPTVPEGKSRLRVTLSALHTTEQIDTLVQALARSRDTLATEAAPV
FT                   QV"
FT   gene            762433..762826
FT                   /pseudo
FT                   /locus_tag="Xfasm12_0711"
FT   gene            762937..764100
FT                   /locus_tag="Xfasm12_0712"
FT   CDS_pept        762937..764100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0712"
FT                   /product="cytochrome oxidase assembly protein"
FT                   /note="KEGG: xft:PD0599 cytochrome oxidase assembly
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0712"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11707"
FT                   /protein_id="ACA11707.1"
FT                   /translation="MDSFVRPLLFRHFHRMAWLAALFTASTIMFGSFVRLSDAGMSCPD
FT                   WPTCYGRITWPQTVAEANAHAASQIRPLEMYKVWREQVHRFLAGMLGVEVLVLSLLAAR
FT                   RRRFSVVQIFSAVVLVVVSIQLYMAGQHAGAMAAALLGEVILLLAALRWNNQDLSRAAV
FT                   LTLAVVIFQALLGMWTVTLLLKPIVVMGHLLGGLLMFALLVWMAWRATHLPITLVDATK
FT                   VRWWLRWGVVILVLQIALGGWVSANYAALACGGGAWLVDNFPRCVGEWWPPHDFTEGFT
FT                   LFRTIGVDYEGGVLDGASRIAIQMMHRLWAIVASVYLVWLAWRLSREPGMLTWALALAF
FT                   LVVVQVMLGVLNVKLVVPLVVGVMHNGSAVALLFVLVSLLARLRAPE"
FT   sig_peptide     762937..763050
FT                   /locus_tag="Xfasm12_0712"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.949) with cleavage site probability 0.605 at
FT                   residue 38"
FT   gene            764103..765008
FT                   /locus_tag="Xfasm12_0713"
FT   CDS_pept        764103..765008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0713"
FT                   /product="cytochrome c oxidase assembly factor"
FT                   /note="KEGG: xft:PD0600 cytochrome c oxidase assembly
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0713"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11708"
FT                   /protein_id="ACA11708.1"
FT                   /translation="MAARLRDYWDLTKPKVVALIVFTALVGMFLAIPGMPSVVQIQSGA
FT                   LGFLGIWLAAAAAAAINQLLDAKIDAQMARTSWRPLVVGKVRPVQVLVFAGVLITLSMT
FT                   ILTLWVNLITAVLTFTSLIGYAVIYTVYLKRMTSQNIVIGGLAGAMPPMLGWAAVTGLS
FT                   TAADWINASLLVAIIFVWTPPHFWALAIFRRADYAKASIPMLPVTHGVQHTSRQILLYT
FT                   VILSVVTLLPVATGMSGVFYLGTALVLDAVFLWYAWRLLDPPDELFAMKTFGYSIVYLM
FT                   ALFAFLMFDHWLRLADFYWN"
FT   gene            765679..766518
FT                   /locus_tag="Xfasm12_0714"
FT   CDS_pept        765679..766518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0714"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF1361 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0714"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11709"
FT                   /protein_id="ACA11709.1"
FT                   /translation="MITVTPFQTGTIRIKTAQQAGQDSKSGIGRKLDIFRDPNWTEALP
FT                   IFCFLIEHPEGRFLVDTGDTWRNSIPGYLPRWNPFFTKQVIVKVALHEEIGPQLLAKNI
FT                   DPSRDVEAVILTHMHHDHAGGLDHFPHTRIIVTQENYDASRGFFGRVAGCLPQHWPIWL
FT                   KPKLIELTGPAVGPFASSYPITRDGRIVLVPTPGHVKGHVSVLVRNDDLSIFIAGDATY
FT                   TEDILRSGKVDGVTFDPVLSKDTLRRITEYATSTLTVIMPSHDPDGPARLVVRQTFI"
FT   gene            complement(766876..768126)
FT                   /locus_tag="Xfasm12_0715"
FT   CDS_pept        complement(766876..768126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0715"
FT                   /product="tRNA nucleotidyltransferase (CCA-adding enzyme)"
FT                   /note="KEGG: xft:PD0602 tRNA nucleotidyltransferase
FT                   (CCA-adding enzyme)"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0715"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11710"
FT                   /db_xref="GOA:B0U6J4"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR012006"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U6J4"
FT                   /protein_id="ACA11710.1"
FT                   /translation="MKSYLVGGAVRDALLGQPAGDCDWVVVGADPAHMKSLGFKPVGRD
FT                   FPVFLHPKTGEEFALARTERKNGHGYRGFIVNADPTVTLEQDLQRRDFTINAIARDQTN
FT                   STLIDPYGGVNDLEQRVLRHISPAFAEDPLRVLRAARFMARLAPLGFSIAPETLAMMRQ
FT                   MVANGELNSLIPERIWKELSRSLAYTQPAAFLHTLRTVNALEVVLPELNALYGVPQHAD
FT                   YHPEIDTGLHQELVSDIAAKLAPGDMLIGFAALCHDLGKALTPRATWPHHPMHEQRGMA
FT                   PTQQLSERLKVPRDYQQLALIACREHLNVHRLSKLHDHTVYELLQRCDAFRRPERIAQL
FT                   AIVCEADYRGRYGHEDANYPQGQHLCRLHAAALAVNARDLNRQDLHGTQIGEALAQARI
FT                   RAISSAGVYDGGTGTNF"
FT   gene            complement(768219..770168)
FT                   /locus_tag="Xfasm12_0716"
FT   CDS_pept        complement(768219..770168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0716"
FT                   /product="soluble lytic murein transglycosylase precursor"
FT                   /note="KEGG: xft:PD0603 soluble lytic murein
FT                   transglycosylase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0716"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11711"
FT                   /protein_id="ACA11711.1"
FT                   /translation="MTMLLRLVTALTLGIAACARAQGDDPQLMAVRDAIAAAENGRLDP
FT                   SQAATLNKHPLYGWIEYANLRRNIDTISNTQAQSFLSRYADQAVAQAFRSAWLPVVARR
FT                   KDWNTLLTHWKPTRTVSLRCAQLEARYRLGKADTQWTKEAQELWRDADKPVPNICDSVF
FT                   ATLSAQGGLDNALRWARIEAAADAQQPEVMRASARGLPASDQTLANNYAAFVEAPNQAQ
FT                   AVSNWPKTERSQRIVIDGLARMAKADPNAAERSLPKYTDALNFNEAQRGQVLYQIALWT
FT                   VASYQPESARRLAAVPESAYDERLHEWRTREAMARGDWQAALNAIRKMPPTQRGDPRWQ
FT                   YFEARLAEKTGDSVQSQTLYRAAARSATFHGFLAADHLQQPYSLCPWHPNDTPDHAQAK
FT                   AAVARTPALVRAIALFQIDRTAWATLEWNNALTRFNDNERRLAVEVASDAEWFDRAVFA
FT                   LGKQPAELRMYDLRFPIRHETTIRSEATKNGLDPAWITAEIRAESVFNPRARSPANARG
FT                   LMQVLPSTAASVAKRIGLTDYVNADSLYDADTNIIIGSAYLRQLLDQYSQTYLTIAAYN
FT                   GGPGSVQRWLSQRPNYDPDLWIETINYKETREYVARVLAFSVIYDWRINGDTLLLTDRL
FT                   LGKSTHRRKQIICQ"
FT   sig_peptide     complement(770097..770168)
FT                   /locus_tag="Xfasm12_0716"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.631 at
FT                   residue 24"
FT   gene            complement(770210..770350)
FT                   /locus_tag="Xfasm12_0717"
FT   CDS_pept        complement(770210..770350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0717"
FT                   /product="soluble lytic murein transglycosylase precursor"
FT                   /note="KEGG: xfa:XF1363 soluble lytic murein
FT                   transglycosylase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0717"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11712"
FT                   /protein_id="ACA11712.1"
FT                   /translation="MKNEIHHELIQSIKLSRISCGDAKTITHCKQNYHVTQITYSQASP
FT                   A"
FT   gene            complement(770916..771797)
FT                   /locus_tag="Xfasm12_0718"
FT   CDS_pept        complement(770916..771797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0718"
FT                   /product="Phosphatidylserine decarboxylase"
FT                   /EC_number="4.1.1.65"
FT                   /note="KEGG: xfa:XF1365 phosphatidylserine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0718"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11713"
FT                   /db_xref="GOA:B0U6J7"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033177"
FT                   /db_xref="InterPro:IPR033178"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U6J7"
FT                   /protein_id="ACA11713.1"
FT                   /translation="MNFVTTLTYLLPHRMLSSLARHIAYCQHPLIKQWLIDTVIAKFDV
FT                   NLSEAAEPDAHAYPSFNAFFTRSLKAGIRLPDPNPDTLLMPADGRISQLGPIREGRIFQ
FT                   AKGQSFTATELLGDTAAASAFTNGLFATVYLSPRDYHRVHMPCTGQLLKTVHVPGRLFS
FT                   VGPDAVRQIPRLFARNERLVCHFDTAFGPMVLVMVGALLVSGVETVWGGVEIPAYGDRI
FT                   THKDYQGRNIAIERFAEMARFNYGSTVIVLLPPNVFTLAPHLTAESPVTLGQALAHRLS
FT                   LNHSTQAPTQEK"
FT   gene            complement(771794..772222)
FT                   /locus_tag="Xfasm12_0719"
FT   CDS_pept        complement(771794..772222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0719"
FT                   /product="truncated cytochrome c oxidase"
FT                   /note="KEGG: xft:PD0605 truncated cytochrome c oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0719"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11714"
FT                   /protein_id="ACA11714.1"
FT                   /translation="MFFGFTSCLDVCPSTLAILEQAEKHWENLPKTRRPQVLFVSIDPD
FT                   RDSPLRLSGYARAFHKNILTTTADTPALQRFATALGLPFRKVPGKSYAENPLDDTMDHP
FT                   TAIVVLDPQGHHVGMIHPPFNAEEIPTDLQKLTKEITL"
FT   gene            complement(772232..772467)
FT                   /pseudo
FT                   /locus_tag="Xfasm12_0720"
FT   gene            772537..773463
FT                   /locus_tag="Xfasm12_0721"
FT   CDS_pept        772537..773463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0721"
FT                   /product="Site-specific DNA-methyltransferase
FT                   (adenine-specific)"
FT                   /EC_number="2.1.1.72"
FT                   /note="KEGG: xft:PD0606 adenine-specific methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0721"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11715"
FT                   /protein_id="ACA11715.1"
FT                   /translation="MTPAAADELHTIVDLIRYGASRFSEAGLTFGHSYDNALDEATQLV
FT                   LHALHLPPDLGPAYGQARLLRTEKECVLALFERRVTERVPVAYLTGDAWFAGLNFKSDA
FT                   RALVPRSPIAELIQAGFEPWLAGRDVRHALDLCTGSGCIAIAMGHYNPHWSVDGADISE
FT                   DALSLALENKVRLLAHNVELIKSDVFAGLVGRRYQLIVSNPPYVTDAETDALPQEYGYE
FT                   PELGLRAGPDGLNLVLKILRDAPAHLDEEGLLICEVGESEQQLVQLLPQVDFAWVEFKV
FT                   GQMGVFAVECRELIAHHDRIAALAAER"
FT   gene            773475..774593
FT                   /locus_tag="Xfasm12_0722"
FT   CDS_pept        773475..774593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0722"
FT                   /product="Chorismate synthase"
FT                   /EC_number="4.2.3.5"
FT                   /note="KEGG: xft:PD0607 chorismate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0722"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11716"
FT                   /db_xref="GOA:B0U6K0"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U6K0"
FT                   /protein_id="ACA11716.1"
FT                   /translation="MGANTFGKLLAVTTFGESHGPAIGCVIDGCPPGLELAAEEFAHDL
FT                   QRRATGRSRHTSARREADEVEILSGVYEGRTTGTPIALLIRNTDQRSKDYATIVRQFRP
FT                   GHADYTYWQKYGIRDPRGGGRSSARETTMRVTAGVVAKKWLKQRYGVIVRGFLSQLGEI
FT                   RPEGFAWDAIEDNPFFWPHAAQVPALEAYMDALRKSGNSVGARVGVVAEGVPPGWGEPI
FT                   YGKLDGELAAALMSINAVKGVEIGAGFGSAVQKGTEHRDLMTPLGFLSNHAGGIIGGIA
FT                   TGQPIIVSIALKPTSSLRLPGETVDVDGCAVQVITKGRHDPCVGIRAPPIAEAMVALVL
FT                   MDQALRHRAQCGDVGEMSPCIPEGVGLRNADD"
FT   gene            774643..774837
FT                   /locus_tag="Xfasm12_0723"
FT   CDS_pept        774643..774837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0723"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xfa:XF1370 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0723"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11717"
FT                   /protein_id="ACA11717.1"
FT                   /translation="MWFDVLLFISADMSFWGLQNSLAVKYVLLYGVHAHAPLQRIHCCL
FT                   CNVVMFHSGVFGIADKGFD"
FT   gene            775171..776205
FT                   /locus_tag="Xfasm12_0724"
FT   CDS_pept        775171..776205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0724"
FT                   /product="Aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /note="KEGG: xft:PD0608 aspartate-semialdehyde
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0724"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11718"
FT                   /protein_id="ACA11718.1"
FT                   /translation="MSSSKSDRCFNIAIVGATGAVGEAMLSILEERHFPVAKLIPLASA
FT                   RSTGSQITFKGESINVLELEHFDPHGVDIALFSAGSRVSEAYAPQFAAAGVVVIDNSSA
FT                   FRYEEDVPLVVSEVNPHALKQRPRGIIANPNCSTMQLMPVLAPIHREYRIERINVATYQ
FT                   SVSGGGRSALEELGQQTAQLLAFQEINPKRFPVQIAFNLIPHIDDFQSNGYTKEEMKLV
FT                   WETKKILEDSSIQVNPTAVRVPVFFGHSEAVNIETQKKVTSEQARALLASAPGVEVVDE
FT                   WQPGGYPTPVTHASGKDPVFVGRIRDDLSHPRGLNLWVVADNIRKGAALNAIQLAELVT
FT                   GETI"
FT   gene            776252..778174
FT                   /locus_tag="Xfasm12_0725"
FT   CDS_pept        776252..778174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0725"
FT                   /product="putative membrane protein"
FT                   /note="KEGG: xft:PD0609 putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0725"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11719"
FT                   /protein_id="ACA11719.1"
FT                   /translation="MGWLLPFAVCASSNTDRIVVIRSTIPAAPVILVFMKSMGKGVLSP
FT                   VYGLTALFLVLCSNAALALGLGDIRVLSKPGQPLVAEIPVISNEAGELDDVRVALASPE
FT                   TFARVGLERPNGFLDDLQFQFSKDRHGRAVVRVTSNQSVQQKAINFLIDVEWKQGRLVR
FT                   EYSALIDAPNTAAAIAEPAINAPQVASANVIVRPAPAPSVPVPPPPPAVPVTAPTPFIS
FT                   SVDEATDTASADVGDATETEGVGTVGTPAAPPSDAGPVTVQRGQTLSQLASQLARQSGR
FT                   TLDQTMLAMLRTNPSAFIGSNINLLKQGAVLRTPTQEALSELGAAEAKAMVREQAAQWR
FT                   QARASIPQPAESWAASQSRAVAGPDTATDRLEIAPAVPIDTKKAGTISGTSNSREGDMP
FT                   GGEQLQQAREDIASRDAEIQDLRSRLIDLEQLRKKQQQLIALKDSELAAAQQHLPKTQG
FT                   HSRLGNGAMILLGGAALLFICMVWWWVNRRPKPSPLPHLPSREFDSEALVVAFPHTAAV
FT                   SRSDFLEMPDQVVREGERMHVPDLTLDRVSAGMYTSVNPSVKPQTFVQVQAANVQAASV
FT                   AAQQSQPQAQQPGPPSGVRDRLELAVAYLDLGDKETARSLLREVVVTGDDVARAEAAAL
FT                   LNQIA"
FT   gene            778216..778989
FT                   /locus_tag="Xfasm12_0726"
FT   CDS_pept        778216..778989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0726"
FT                   /product="Pseudouridylate synthase"
FT                   /EC_number="4.2.1.70"
FT                   /note="KEGG: xft:PD0610 pseudouridylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0726"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11720"
FT                   /db_xref="GOA:B0U6K4"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U6K4"
FT                   /protein_id="ACA11720.1"
FT                   /translation="MMRYALGVEYDGSEFLGWQQLGEMGPSVQATLQQALASVADASVR
FT                   VVCAGRTDAGVHGQCQVVHFDSAVTRPPRAWILGTTTRLPSSVAVRWCVPTSEDFHARF
FT                   SACARRYRYRLLNRQVRPALQHQFLSWERYPLDAQAMHVAAQMLLGENDFSAFRSAQCQ
FT                   ALHARRELQAISVRRDAEVIEICVQANAFLHHMVRNIVGSLLMVGTGERPMEWIAELLA
FT                   GRDRTMAGPTASARGLVFVGPLYPEKWHLPMEVSV"
FT   gene            778986..779648
FT                   /locus_tag="Xfasm12_0727"
FT   CDS_pept        778986..779648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0727"
FT                   /product="Phosphoribosylanthranilate isomerase"
FT                   /EC_number="5.3.1.24"
FT                   /note="KEGG: xft:PD0611 phosphoribosylanthranilate
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0727"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11721"
FT                   /db_xref="GOA:B0U6K5"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U6K5"
FT                   /protein_id="ACA11721.1"
FT                   /translation="MNIPPYRTRIKFCGMTRVGDVRLASELGVDAVGLIFASGSSRLLT
FT                   VSAACAIRRTVAPMVNVVALFQNNSADEIHTVVRTVRPTLLQFHGKEEDAFCRTFNVPY
FT                   LKAIPMAGAEAKRICTRTLYLKYPNAAGFIFDSHLKGGTGQTFDWSRLPIDLHHPFLLA
FT                   GGITPENVFDAIAATVPWGVDVSSGIELQPGIKDGDKMRQFVEEVRRADGRRQFGVA"
FT   gene            780150..781367
FT                   /locus_tag="Xfasm12_0728"
FT   CDS_pept        780150..781367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0728"
FT                   /product="Tryptophan synthase"
FT                   /EC_number="4.2.1.20"
FT                   /note="KEGG: xfa:XF1375 tryptophan synthase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0728"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11722"
FT                   /db_xref="GOA:B0U6K6"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U6K6"
FT                   /protein_id="ACA11722.1"
FT                   /translation="MSDITVANYHAFPDARGHFGRYGGRFVAETLIGPLQELAQAYDAA
FT                   RHDPDFIAAYNKDLKDYVGRPSPIYHAERLSRKVGGAQILLKREDLNHTGAHKINNTIG
FT                   QALLAARMGKTRIIAETGAGQHGVASATVAARLGLECVVYMGATDIERQQINVYRMKLL
FT                   GATVVPVTSGSATLKDALNEAMRDWVTHVGHTFYIIGTVAGPDPYPRMVRDFNAIVGRE
FT                   ARAQMIEDYGRLPDAMTACVGGGSNAIGLFHAFLNDASVRIYGAEAAGDGIATGRHAAS
FT                   IVAGRPGVLHGNRTYVICDDDGQILETHSVSAGLDYPGVGPEHAFLADSGRVQYVGIRD
FT                   EEALAAFHLLAHTEGILAALESSHAVAHAMTLARDLPKDALVLCNLSGRGDKDVHTIAA
FT                   REGVRV"
FT   gene            781493..782299
FT                   /locus_tag="Xfasm12_0729"
FT   CDS_pept        781493..782299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0729"
FT                   /product="Tryptophan synthase"
FT                   /EC_number="4.2.1.20"
FT                   /note="KEGG: xft:PD0613 tryptophan synthase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0729"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11723"
FT                   /db_xref="GOA:B0U6K7"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U6K7"
FT                   /protein_id="ACA11723.1"
FT                   /translation="MHRIDETFRRLRAQSRKALIPFITAGDPSLEAAVPVMHALVRAGA
FT                   DVIELGVPFSDPMADGPVIQHSSERALQRGVGLAYVLQTVDVFRQSDAVTPVVLMGYLN
FT                   PLEIYGIARFTQQALASGVDGVLLVDLPPEEADEIRAIFSAAGLALIVLASPTTSASRL
FT                   ATLSGVAQGYLYYVSFAGVTGADRLDAQSAGDRLRGLRAQTQVPVVVGFGIRDAASAVV
FT                   MAVDADGVVVGSALVTALSDAPDVDTACRRADAFLAPLRQALDAVK"
FT   gene            782304..782540
FT                   /pseudo
FT                   /locus_tag="Xfasm12_0730"
FT   gene            complement(782540..783931)
FT                   /locus_tag="Xfasm12_0731"
FT   CDS_pept        complement(782540..783931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0731"
FT                   /product="DNA repair protein"
FT                   /note="KEGG: xft:PD0614 DNA repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0731"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11724"
FT                   /protein_id="ACA11724.1"
FT                   /translation="MTKNAASKARIAYVCTECGTEYSKWQGQCTECGTWNCLSQITLGN
FT                   AGSVKNPTMKHGNWTGQLDPPKITALKDVQHSEQARISTGIGEFDRVLGGGLVAGAVVL
FT                   IGGDPGIGKSTLLLQALARMASNLPTLYVTGEESLAQVAGRAVRLDLPLEGLNALAETG
FT                   IESILQHASSARPRLIVADSVQTLWTEALTAAPGSVSQVRESAAQLVRYAKETGTTVFL
FT                   VGHVTKEGGIAGPRVLEHMVDAVLYFEGESGSRFRLLRAFKNRFGAVNELGVFAMSEKG
FT                   LKEVANPSAIFLSGRNSDQPGSCVMVTREGTRPLMVEVQALVDTSPLSNPRRVTVGLEQ
FT                   NRLAMLLAVLHRHGNVLVGDQDVFINIVGGIRVQETAADLPVLLAVRSSLCNRALPEKT
FT                   IAFGEVGLSGEIRPVPNGEERLREAATHGFKHAIVPKANAPKSAIKDMQIIAVERLDQA
FT                   LEASY"
FT   gene            784109..785074
FT                   /locus_tag="Xfasm12_0732"
FT   CDS_pept        784109..785074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0732"
FT                   /product="luciferase"
FT                   /note="KEGG: xft:PD0615 luciferase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0732"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11725"
FT                   /protein_id="ACA11725.1"
FT                   /translation="MIKSWMFEQLNISCDADPAYFDVVACSKEYAWRSELWAQLETLGF
FT                   HGIFFSEHHFSGLRASPSPGVLAAWVAACSQNLRIGVLGWVLPLWQPWRFLEEVAVLDQ
FT                   LSQGRVEIGVARGSSVDEAAAVGIAEVDIVPMYREALDILEQAWLSPYLSHCGRYWSFE
FT                   QLGMVPRPLHYPSPPIWTTVRSTDAAAEAAKRGHRLCTGFLHTDAIVRLFDVYREATVH
FT                   MHTAERLAIRRCIFVAKTEAQAHEHARAAQAQMPSIVDDDIIAGTPTQVTEQILFQLGR
FT                   TGAANIVGFFAGHRCDPGAVRTSCDLFGEYVIPALQSASI"
FT   gene            complement(785275..785754)
FT                   /locus_tag="Xfasm12_0733"
FT   CDS_pept        complement(785275..785754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0733"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0616 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0733"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11726"
FT                   /protein_id="ACA11726.1"
FT                   /translation="MKTHTVLLFSLIFTGPALAQPETSAATAPTNATSTSNLDLTPPEL
FT                   PIQYRADPTASNTVPPGTYYGDTSGITAAITDKRNIGLVGQHTCEGKLSGAVSTGVGYT
FT                   NRGGNNHWQAANLNTCKTYYDDAGAAHRVGISLSVGQTKGPHYYSLWFHRPHPAW"
FT   sig_peptide     complement(785695..785754)
FT                   /locus_tag="Xfasm12_0733"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT   gene            complement(785877..787679)
FT                   /locus_tag="Xfasm12_0734"
FT   CDS_pept        complement(785877..787679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0734"
FT                   /product="ATP-dependent DNA helicase"
FT                   /note="KEGG: xft:PD0617 ATP-dependent DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0734"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11727"
FT                   /protein_id="ACA11727.1"
FT                   /translation="MSTSSATQTVLQRVFGYDTFRGPQQAIIEHVAAGHDALVLMPTGG
FT                   GKSLCYQVPALLRKGIGVVISPLIALMQDQVETLRQLGVRAAYLNSTLDATQAQRIEHA
FT                   LVTADLDLLYIAPERLLTAHFLSLLERSQIALFAIDEAHCVSQWGHDFRPEYRQLTVLH
FT                   ERWPHVPRIALTATADPPTQREIAERLDLSDAHHFISSFDRPNIRYTVVQKNNMRRQLQ
FT                   EFLSRHRNTAGIVYAMSRRKTEEIAAYLCTQGYNALPYHAGLPAETRAKHQRCFLREEG
FT                   IVMCATIAFGMGINKPDVRFVAHIDLPKSLEGYYQETGRAGRDGEAAEAWMCYSLGDVV
FT                   LLKQMIEQSEASEARKCVERAKLDHLLGYCESMQCRRQLLLSSFGETYPNPCGNCDNCL
FT                   TPATAWDATVLSQKALSCVYRTGQRFGVGHLIDILRGSKSQRILQLGHDQLSTYGIGRD
FT                   VDERSWRSVFRQLIATHLLEVDNEGYGGLRLTPSSRPVLKGERQVMMRRDQFIRERDRT
FT                   GQRHGLSVLPEDLGLFNALHRLRAQLAKEQNVPAFVIFHDSTLRHIAEQRPTNLNALSK
FT                   ISGIGSNKLTRYGHQLIELVLAQG"
FT   gene            complement(787859..788401)
FT                   /locus_tag="Xfasm12_0735"
FT   CDS_pept        complement(787859..788401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0735"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF1382 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0735"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11728"
FT                   /protein_id="ACA11728.1"
FT                   /translation="MSKKQQNSKSENKTELASAISMPDVNIGIKNSDRKSIAEGLSHYM
FT                   ADAFTLYLKTHTFHWNVTGPMFNSLHSMFETQYTEQWAALDEIAERIRALGYNALGSYK
FT                   DYLELTSIKEEPGLNDNTDWREMVRQLVIGNEAVCRTARKVLDTAEDGSDDPTADLLTQ
FT                   RLQIHEKYAWMLRSLLQ"
FT   gene            788459..792895
FT                   /locus_tag="Xfasm12_0736"
FT   CDS_pept        788459..792895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0736"
FT                   /product="helicase, ATP dependent"
FT                   /note="KEGG: xfa:XF1383 helicase, ATP dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0736"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11729"
FT                   /protein_id="ACA11729.1"
FT                   /translation="MYCHAIFCNLRLMSVIEQNILGQLRQYRRAIDDAMTRDRGRLLGL
FT                   WSRWQSQPHDHEARANFQRVLSASRAQRQVRENNQPVVTVDTRLPIAQEAERIVALIRA
FT                   HPVVIIAGETGSGKTTQLPKLCLSAGRGIAGTIGCTQPRRIAARAVATRVAEELQTPLG
FT                   MVVGFQVRFTEKVSDASRIKFMTDGILLAEVASDRWLSAYDTIIIDEAHERSLNIDFLL
FT                   GYLKQLLKKRADLKVIVTSATIDTARFSKHFDDAPVIHVAGRTYPVEVRYRPLDAMWAS
FT                   DDRLGEPYGGTESPAVNRWVGGSGGDGALSKPIVAVPQEDQRTVNDAIVAVIDEITRED
FT                   PHGDVLVFLPGEREIRELYRVLEQRKYRETELLPLYARLSARDQDRVFNPGSGRRLVLT
FT                   TNVAETSLTVPRIRYVIDPGYARVKRYSARQKLDRLYIEPISQASANQRAGRCGRIADG
FT                   VCYRLYSEADFLVRPAFTDPEIRRSSLAGVILRMLQLGLGRIGGSAASLSEPVSGPEQQ
FT                   RTSWIIESFSFLEPPDERAVADGWQQLVELGAVDSQHALTTIGREMARLPVDVKLARML
FT                   VAARQHGCVYEMTVIAAFLGVQDPRERPPDAREAADNAHARFADARSEFVGILRLWEAY
FT                   RQIRGHVTQSKLRQWCQRHFLGFLHMREWCELQLQLSLLCAGEQAEQPRKGRAAAAFPK
FT                   EGCLPSQRSNPGAEAGKVNELPSSTTVLQALLAGQGTSTQSEHRGNTPSRGQLHRAARL
FT                   ARECSAVPKVTQNTQSVKAVAGQSVSNAGMQAQFVVTPNDAPHIGERERAAAYQALHRA
FT                   LLTGLPIQIGHRTDKGDFQAPRQRRFMLFPGSMLAKKPPPWVLAANLLDTQKVWGLTNA
FT                   AIEPDWVIAELPHLLMRKHFNPHWSRTQGRVLVSEQISLFGLVLAPKKPMHYGRIDPVA
FT                   AHDLFVRQGLVTGEINTRAGFVADNLKVLEQAHEEEAKLRRAGIVADEDWQARWYFDRV
FT                   PSDIHTADALDSWWKGLPVEKRHGLYWSLIDLLPGEGGEEDRYPKYFALGDVRLPLHYS
FT                   FDPGAVDDGVTLDVPLHLLNALDPVRLSWLVPGFVADKAAALIRSLPKALRRSYVPAPD
FT                   FAHAFAQAFQQPSADEMRGELARFLSRITGVRVAAIDFDEQTLEPYLHLRVRLHDESGQ
FT                   VLAESRDFDALRARFGSHSGEAFVARAGRTLIMEELREFPAVSIPLQLTGEAGVPMYPA
FT                   LVDDGEMAALRIFADPTEAAQVHPHGVRRLLEIALANKIKQARKQLPVSSKSGLLYAAI
FT                   ESKECLRDDLVKAALNAVLAHGLESIRDPVAFAQCRDVAAQQLFSEAMARLSLAEEILA
FT                   AVAELKPLLEAPLMGWARGNLDDMERQLAQLVYPGFLRQTPADVLTQYPRYLKAMMMRS
FT                   ERAKRDPSRDQARMLEFKPFLDALEVAMAQGVSDTPGWETLRWDVEELRVSLFAQELGV
FT                   RSGISVKKLAQRLAALR"
FT   gene            793259..796204
FT                   /locus_tag="Xfasm12_0737"
FT   CDS_pept        793259..796204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0737"
FT                   /product="Glycine dehydrogenase (decarboxylating)"
FT                   /EC_number="1.4.4.2"
FT                   /note="KEGG: xft:PD0620 glycine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0737"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11730"
FT                   /protein_id="ACA11730.1"
FT                   /translation="MMSHTLSSLRDLEYHGAFVERHIGPNDVEIAHMLRVVGYDSLESL
FT                   TDAIVPEKIRSTVALDLPKGITEEEALAKIRVIANKNRVFRSFIGQGYYGTHTPKVILR
FT                   NILENPAWYTAYTPYQAEISQGRMEALINFQTMCADLTGMEIANASLLDEATAAAEAMS
FT                   LAKRSAKSRSDLFFVHDAVHPQTLELLRTRAEPLGIVLRVGTPEEALQADVFGILLQYP
FT                   DTFGRIGDHRVLANAVHAQGGLVVVASDLLALTLITPPGEWGADIVVGNSQRFGVPFGF
FT                   GGPHAGFMACRDIYKRSIPGRLIGVSVDAAGHPAYRLALQTREQHIRREKATSNICTAQ
FT                   VLLAVMASMYAVYHGPQGLLRIAWRTHRMAAILAAALRGAGLTVGEYFFDTLHIVGIDA
FT                   VAIHCAAAAAGMNLRMIDNAQLGISLDETVTRSDVVALGQVFGVQVDVEALDAITADAL
FT                   PAGLLRSSAFLTHPVFNTHHSEHELLRYLRMLADKDLAMDRTMIPLGSCTMKLNATAEM
FT                   IPVTWQEFACIHPLAPVVQWSGYRQLIDELEAMLAECTGYDAISLQPNSGAQGEYAGLL
FT                   AIRAYHRSRGEERRNVCLIPESAHGTNPASAQLCGMQVVIIKCDRSGNVDVDDLRMKAE
FT                   KYSDTLAALMVTYPSTHGVFEEAITEICEIVHAHGGQVYTDGANMNALVGVAKPGRWGS
FT                   DVSHLNLHKTFCIPHGGGGPGVGPCAVKAHLAPFLPKTLPLPGDAAGLPVQGTQEAKVG
FT                   MVSAANFGSASILPVSWMYITMMGAAGLRKATQVALLNANYIAKRLAPHYKTLYTGRHG
FT                   LVAHECILDVRSLEKVSGVSAEDIAKRLIDFGFHAPTLSFPVAGTLMVEPTESESQQEL
FT                   DRFVDAMIQIRGEIAAIEKGHLDPEDNPLKQAPHTAVQVMASQWEHAYSRELAAFPLGV
FT                   LHHAKYWPPVARVDNVYGDKHVMCACIPVEAYKEKEDSEIQDLIEEDASRC"
FT   gene            complement(796649..796990)
FT                   /locus_tag="Xfasm12_0738"
FT   CDS_pept        complement(796649..796990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0738"
FT                   /product="cytochrome O ubiquinol oxidase subunit IV"
FT                   /note="KEGG: xft:PD0621 cytochrome O ubiquinol oxidase
FT                   subunit IV"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0738"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11731"
FT                   /protein_id="ACA11731.1"
FT                   /translation="MSHHPHHSSEPTVPSQSTHLKSYLIGFVLAVILTAIPFAIVMNRS
FT                   FSKETTVALVSALAAVQMLVHLVYFLHMDRSEEQRSNVHVALFSLLVIGIVIVGSLWVM
FT                   HNLNIHMMY"
FT   gene            complement(796990..797598)
FT                   /locus_tag="Xfasm12_0739"
FT   CDS_pept        complement(796990..797598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0739"
FT                   /product="cytochrome o ubiquinol oxidase subunit III"
FT                   /note="KEGG: xfa:XF1388 cytochrome o ubiquinol oxidase
FT                   subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0739"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11732"
FT                   /protein_id="ACA11732.1"
FT                   /translation="MPISTKIDMHNSDHAHHDTGDNTVFGFWVYLMSDCLIFAGLFATY
FT                   AVLVGATVDGPTAKELFDLKFVLVETFLLLFSSLTFGFAMIAAHKRHIPALYGWLMVTA
FT                   LFGLGFLGMELYEFHHLIQEGAGPGRSAFLSAFFTLVGTHGLHVASGLLWMLILVIQIV
FT                   KNGLTPRNSTRLACLSLFWHFLGVIWIGVFTIVYLLGAL"
FT   gene            complement(797604..799601)
FT                   /locus_tag="Xfasm12_0740"
FT   CDS_pept        complement(797604..799601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0740"
FT                   /product="Cytochrome-c oxidase"
FT                   /EC_number="1.9.3.1"
FT                   /note="KEGG: xft:PD0623 cytochrome O ubiquinol oxidase
FT                   subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0740"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11733"
FT                   /protein_id="ACA11733.1"
FT                   /translation="MLGKLSWDAIPYDPIVLTAVGGGGLAILGVMIAITYFKKWGYLWR
FT                   EWLTSVDHKKIGVMYIVVALVMLLRGFADAIFMRTQLAIAHSGNEGIFPPHHYDQIFTA
FT                   HGVIMIFFMAMPLMTGLLNLIVPLQIGARDVAYPFLNSLSFWLFVGGAALINISLAVGE
FT                   FAQTGWLAYPPLSELEYSPGVGVDYYLWALQISGLGTLLTGINFLVTIMRMRAPGMTLM
FT                   RMPVFTWTALITNILIIAAFPILTVTLALLGADRYLGTHFFTNDGGGNAMMYVNLIWIW
FT                   GHPEVYILALPAFGIYSELVATYCRKKLFGYTSMVYATSCIGVLSFIVWLHHFFTMGSG
FT                   ANVNAFFGITTMIISIPTGVKIFNWLFTMYRGRVHFSAPMWWTIGFMITFTIGGMTGVM
FT                   LAIPAVDFVLHNSLFLIAHFHNTIIGAAVFGYLAGMTYWFPKAFGFKLNETLGKASFAC
FT                   WIVGFFVAFMPLYALGFMGMTRRLNSYNNPQWEPWLLVAAGGAVIIGIGIFLNLVQFAY
FT                   SLWTHKQNRDLTGDPWDGRTLEWSTSSPPPFYNFAHVPHVDSLDQFWEDKQRGKAWKKP
FT                   DKYEDIHMPRNTAAGFWIGAFSIVLGFALTWHIWWMAILGLVGMIGSFIARSFDNDIDY
FT                   WVPAEEVARIENERFALLEKGQTALAAKAV"
FT   gene            complement(799595..800554)
FT                   /locus_tag="Xfasm12_0741"
FT   CDS_pept        complement(799595..800554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0741"
FT                   /product="cytochrome O ubiquinol oxidase subunit II"
FT                   /note="KEGG: xft:PD0624 cytochrome O ubiquinol oxidase
FT                   subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0741"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11734"
FT                   /protein_id="ACA11734.1"
FT                   /translation="MISSKQTRQLLHLVLLLPLLLILTGCDWAVLNPKGQIGQEEKTLL
FT                   IISVALMLLVVIPVIVMTVAFAWKYRASNTKARYEPEWAHSTAIEVVVWSIPCLIILVL
FT                   AILTWCSSHSLDPHRPLKSDVKPITIEVVAMDWKWGMIYPEQDMATVNEIAIPINTPVN
FT                   FKITSDTVMNSFFIPQLGSQIYAMAGMQTKLHLIANETGTFRGISANYSGHGFSKMNFV
FT                   VHVLPDQAAFDAWVAKVKTSPLKLQQDEYQALADDRNEKSDYPVTYYSSVEKGLFKSLI
FT                   DKHMMGHGHHADDHDNHHEHQLSLEDSVSMCTSGGKQC"
FT   sig_peptide     complement(800465..800554)
FT                   /locus_tag="Xfasm12_0741"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.797) with cleavage site probability 0.787 at
FT                   residue 30"
FT   gene            complement(801017..802018)
FT                   /locus_tag="Xfasm12_0742"
FT   CDS_pept        complement(801017..802018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0742"
FT                   /product="Trans-hexaprenyltranstransferase"
FT                   /EC_number="2.5.1.30"
FT                   /note="KEGG: xft:PD0625 octaprenyl-diphosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0742"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11735"
FT                   /protein_id="ACA11735.1"
FT                   /translation="MSIATTPLHTALSLPQIQSFAASDMAAIDTLIHDRLTSDIVLINQ
FT                   IADHIICSGGKRLRPMLTMLAGHAIGPTGPHHHQLAAIIEFIHTATLLHDDVVDGSELR
FT                   RSRSTANALWGNAPSVLVGDFLYSRSFQLMTELANLEVMQILAETTNRISEGEVLQLLH
FT                   VHNPDTDETTYLSVIERKTAILFAAAAQLGALASHADTQTQTRMYEYGMQLGYAFQITD
FT                   DVLDYTANNSQLGKNLGDDLAEGKATLPVIHAMTHSDAATCERLRMIISKGDSDAMPEV
FT                   LNAIRTTGSLDYSRQRASAYAATAERALDGLPETEAVAALRGLARYAVQRTY"
FT   gene            802267..802761
FT                   /locus_tag="Xfasm12_0743"
FT   CDS_pept        802267..802761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0743"
FT                   /product="single-stranded DNA binding protein"
FT                   /note="KEGG: xfa:XF1392 single-stranded DNA binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0743"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11736"
FT                   /protein_id="ACA11736.1"
FT                   /translation="MARGINKVILVGNLGNDPDIKYTQGGMTITTISLATTSVRKDKEG
FT                   NTQERTEWHRVKFFGKLGEIAGEYLRKGSQCYIEGSIRYDKFTGQDGQERYVTEIVADE
FT                   MQMLGGRSDGGGMGGGGERPQRQTSQRQDYAPRRQARQPSQSPQSSPPPMDDFADDDIP
FT                   F"
FT   gene            803980..804108
FT                   /locus_tag="Xfasm12_0744"
FT   CDS_pept        803980..804108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0744"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF1395 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0744"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11737"
FT                   /protein_id="ACA11737.1"
FT                   /translation="MKAFVAVFTLTLGFWWYCEFAVWGTFSRDGDLLWINLSNQCE"
FT   gene            804358..805268
FT                   /pseudo
FT                   /locus_tag="Xfasm12_0745"
FT   gene            805531..806769
FT                   /locus_tag="Xfasm12_0746"
FT   CDS_pept        805531..806769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0746"
FT                   /product="Na+/H+ exchange protein"
FT                   /note="KEGG: xft:PD0628 Na+/H+ exchange protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0746"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11738"
FT                   /protein_id="ACA11738.1"
FT                   /translation="MIPILDAEKFMTLSMNRELIYLMLIFALLVVPRALQRFMVPAPLT
FT                   CLLFGIGTMLVMGGEPHDDVIVLLSTLGISSLFLFAGLEVDLKALRRELWPLGVHLQVY
FT                   SVALFCLGWLVWRYVGLTWQVAGLLALALLTPSPGFIIDSIGRLGLNEHERFWVVNKAI
FT                   ASELLALTVLFFVLQASDPWQMALSSGVLVALFVCLPLLFVALDRWVVPQAPGSEFSLL
FT                   VMVGMIAAYATYKIGVYYLVGAFITGLIARLLHQRMPHLASEENLNAVRLFASFFVPFY
FT                   FFRAGTNVSPQALSFEALGLGILITMVVLPLRIAVIWVQRRVLFGKGEDFRSSLRVSLA
FT                   LVPTLIFTLVLAGILRDRFSISEVLFGALLLYAAFTTLLPSLIFRLLSAWGVPSRSGDQ
FT                   ASRETLPSSGMAG"
FT   gene            complement(806931..807458)
FT                   /locus_tag="Xfasm12_0747"
FT   CDS_pept        complement(806931..807458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0747"
FT                   /product="Lactoylglutathione lyase"
FT                   /EC_number="4.4.1.5"
FT                   /note="KEGG: xft:PD0629 lactoylglutathione lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0747"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11739"
FT                   /protein_id="ACA11739.1"
FT                   /translation="MHPKNFQHQLKTIPQPPDETRDFVFNHTMLRVKEINASLDFYARI
FT                   LGFRLIDQRDFPEAQFSLYFLALLPQTVHISDNDTERRLWMSGIPGVLELTHNYGTETQ
FT                   EGQIYHNGNSEPRGFGHICISVPDLYSACARFDTLQVPYQKRLTDGRMKNIAFIKDPDG
FT                   YWVEIISNTPLP"
FT   gene            complement(807580..807735)
FT                   /locus_tag="Xfasm12_0748"
FT   CDS_pept        complement(807580..807735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0748"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF1400 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0748"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11740"
FT                   /protein_id="ACA11740.1"
FT                   /translation="MYRSIGRRVIIPMTLKRLGFHPALAGGVILTTLTNTNVTGFLGLA
FT                   TLILLR"
FT   gene            complement(807753..808799)
FT                   /pseudo
FT                   /locus_tag="Xfasm12_0749"
FT   gene            complement(808983..810755)
FT                   /locus_tag="Xfasm12_0750"
FT   CDS_pept        complement(808983..810755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0750"
FT                   /product="phosphotransferase system enzyme I"
FT                   /note="KEGG: xfa:XF1402 phosphotransferase system enzyme I"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0750"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11741"
FT                   /protein_id="ACA11741.1"
FT                   /translation="MPHSAHRSTPTLHTQMNVRLQGHGAARGTALGRAWVRQMNIIEIQ
FT                   DKYITDTNAELHSLYQAMSAARQEIQVLRERMHGTLSHEVGEFLDLYTLLIDDPELLRS
FT                   LNELILTHNYSAEYALKIQRDHLTTEFEAMEDHYLKSRMDDLNHVLGRIHAFLKKHSPE
FT                   PKDAAGEILICNNIAPSELAQVQAQGIIGIVIAAGNTLSHSAILAHSLHLPLIVGAGDL
FT                   LLQKITNGDMLIIDGNSGEIIVNPSPQDLRHYHSRLRERAKEQRELEQLRSKHSRTRDN
FT                   VDIVVQANAESPDDVSQAYTLGAAGVGLYRTEFLFLQRNKLPDEEEQFQTYRDTVLRMN
FT                   GRPVTIRTLDLGADKTDCTGLTLSNEENPAMGLRGIRLSMAHPAVANTQLRAILRTSTY
FT                   GHVRILVPMISCREEIILLRKQIKALSIQLRTEGHDIAEQVPLGAMIEVPAAAIALNSF
FT                   IKEIDFLSIGTNDLVQYLLAADRNNAAISEIYSPLHPGVLAVLAQIIVTAHTHATPVAI
FT                   CGEIAGDPHYVPMLLALGLTEFSLHPATLLEVRRAIRNSDLGTLKTSATTLLRARDRKS
FT                   IEEWMAAHANTTPT"
FT   gene            complement(810771..811040)
FT                   /locus_tag="Xfasm12_0751"
FT   CDS_pept        complement(810771..811040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0751"
FT                   /product="phosphotransferase system HPr enzyme"
FT                   /note="KEGG: xft:PD0632 phosphotransferase system HPr
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0751"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11742"
FT                   /protein_id="ACA11742.1"
FT                   /translation="MLEHELTVTNKLGLHARATAKLVQTMSKFQSNTTLSTKGREVNAK
FT                   SIMGVMLLAASQGTVIRIRIDGEDEHTAMQALSELFENRFNEDT"
FT   gene            complement(811033..811425)
FT                   /locus_tag="Xfasm12_0752"
FT   CDS_pept        complement(811033..811425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0752"
FT                   /product="sugar transport protein"
FT                   /note="KEGG: xft:PD0633 sugar transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0752"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11743"
FT                   /protein_id="ACA11743.1"
FT                   /translation="MACGILLITHPGIGHALLRVATALLQQLPLKIEAFEVPLDVDLDT
FT                   LLPHASAAMHRVNNGEGVLIMTDLYGASPSNLAHRLAQLDTPVRRVSALSLPMLLRVMN
FT                   HPEQNLQDLPATAAAATRNGAIIDDA"
FT   gene            complement(811796..812668)
FT                   /locus_tag="Xfasm12_0753"
FT   CDS_pept        complement(811796..812668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0753"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0634 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0753"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11744"
FT                   /db_xref="GOA:B0U6M8"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U6M8"
FT                   /protein_id="ACA11744.1"
FT                   /translation="MKPPEHSLIIISGLSGSGKSIALKTFEDLDYYCSDNLPVELLPHF
FT                   LRRRLRVAELSDQRIAIGIDIRSGSNLSELDQWRHTAKHYNIKAHLLFFDASNETLLKR
FT                   YADTRRRHPLSHLGLSLPEAIALERELTAPLREAAEAVIDTSTFNVHQLRRHVVTEFAL
FT                   THSDKLSLLFESFAYKRGIPTEADFVFDARILPNPHWKPELRSLTGRDSNVRDYMEQQP
FT                   DVILYLTQITEFLDTWLARLQADTRSYVTVAFGCTGGKHRSVYLAEQMARHAREKGWSE
FT                   VATFHRELE"
FT   gene            complement(812665..813615)
FT                   /locus_tag="Xfasm12_0754"
FT   CDS_pept        complement(812665..813615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0754"
FT                   /product="HPr kinase"
FT                   /note="KEGG: xft:PD0635 HPr kinase/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0754"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11745"
FT                   /db_xref="GOA:B0U6M9"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR011126"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U6M9"
FT                   /protein_id="ACA11745.1"
FT                   /translation="MNTSITARELFDLQRDRLSLRWIAGQQGEHRQIDSGDTRARRPSL
FT                   AGYLNTIYPNKVQILGTEELTWLDSLEPNKRKETIEKIIQFQPLTLVISKNQSCPEDMR
FT                   TAADNSQIPLWVSPKRGHELLNHLSYHLARILAPRATLHGVFMEIYSIGVLITGEAGSG
FT                   KSELALELLSRGHRLVADDAPEFTQIAPDVLDGTCPEILQDLLEVRGLGVLNVRHMFGD
FT                   TAIKKNKYLRLIVHLTKPITEPTPSGYERLTGDSGTRHVLDLDVPLITLPVMPGRNLAV
FT                   LTEAATRLHILRTKGIDPATMFIARHSNLLERRPP"
FT   gene            complement(813881..814198)
FT                   /locus_tag="Xfasm12_0755"
FT   CDS_pept        complement(813881..814198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0755"
FT                   /product="sigma-54 modulation protein"
FT                   /note="KEGG: xft:PD0636 sigma-54 modulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0755"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11746"
FT                   /protein_id="ACA11746.1"
FT                   /translation="MHIETYGQQIEVTPALREYVETKLKRLQRHFSHHCEIRTQLSMSK
FT                   IDHHVTATINIPGRTLNANASASTMYAAIDLVADKLDRLILKHKEKKCDHHAKEVRDHL
FT                   E"
FT   gene            complement(814232..815623)
FT                   /locus_tag="Xfasm12_0756"
FT   CDS_pept        complement(814232..815623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0756"
FT                   /product="RNA polymerase sigma-54 factor"
FT                   /note="KEGG: xft:PD0637 RNA polymerase sigma-54 factor"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0756"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11747"
FT                   /protein_id="ACA11747.1"
FT                   /translation="MTLKARLRTSIGQQLVMTPQLHQSIRLLQMSNAELQLEITAAIES
FT                   NPLLDWAENQSSETSEAAETEVETEDWQAKESAWDINGSKSNENDDNNPAERLTNENTL
FT                   TDHLLWQLRLSPLSARDYQIGTVLIDAIEEDGYLREPLSTLTATITPLSVDESELLPVL
FT                   RHIQSFDPTGVAARSLAECLTLQLKSLREAIPGRTLALQIVNSPLLEQLPRSGVTGLAR
FT                   ELKRPSQDVQQAVELIRGLDPRPGKKIGDLEVGTYVIPDCVIWRQHGLWQATLLGHGFP
FT                   QVVLHRGYEQLINRCNDANASYLRNQLQEARWLLKGLEARGETLLKVVNSLIRHQAGFL
FT                   EFGQHALRPLTIRELATELALHESTVSRAIAGKYVRTPRGTLALRTFFASGISTDNGGE
FT                   TSSSAIQAIIRRLIETENPRKPLSDAKLAELLKTSGIPVARRTIAKYRDAMNISASHER
FT                   VRVLG"
FT   gene            complement(815665..816387)
FT                   /locus_tag="Xfasm12_0757"
FT   CDS_pept        complement(815665..816387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0757"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="KEGG: xfa:XF1409 ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0757"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11748"
FT                   /protein_id="ACA11748.1"
FT                   /translation="MLVASGLRKRYKHREVVREFGLTLQPGEIVGLLGPNGAGKTTCFY
FT                   MIVGLMNTDAGRIELDGRDITAAPMHARAQLGVGYLPQEPSVFRKLSVTDNIRLVLELR
FT                   QDLKTNQARQHELDSLLNELQISHVADQLGTSLSGGERRRCEIARALAAQPRMMLLDEP
FT                   FAGVDPISVGEIQRIITHLKERGIGVLITDHNVRETLGICNRAYILAEGGVLAQGTPDA
FT                   LLTNPDVRRVYLGEAFHL"
FT   gene            complement(816387..816917)
FT                   /locus_tag="Xfasm12_0758"
FT   CDS_pept        complement(816387..816917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0758"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0639 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0758"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11749"
FT                   /protein_id="ACA11749.1"
FT                   /translation="MNRAPLVKFFLFPLLFTPLSATAKSSDRNQPMTIDSATQEGNMLG
FT                   DGKAHYSGNVVIQQGSLEAHADTADVFLKNGDMDRIVLIGKQASLKQDMDNGSTLHGQA
FT                   DNIDYKVKEGIIILTGNYKVESPKGNNTGQRMIYNTQTGDMRSGNDGTRVRTTIQPKSV
FT                   SQGTLNAAKQEKI"
FT   sig_peptide     complement(816846..816917)
FT                   /locus_tag="Xfasm12_0758"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.970 at
FT                   residue 24"
FT   gene            complement(816895..817464)
FT                   /locus_tag="Xfasm12_0759"
FT   CDS_pept        complement(816895..817464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0759"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF1411 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0759"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11750"
FT                   /protein_id="ACA11750.1"
FT                   /translation="MSWRSILNIMLLLAAIVSGWSAWHQRKHTQATQLRDIAADYTVQD
FT                   FKLVALDTQTGKESLTLLGQQMQHNQIDSTAEVTAPLFMIPDQAGQHWTLQAQTGWINK
FT                   DGTLLRLRQDVKGDSPTDLGQVPTTFRTQSLDIYPNHHLAKTTDAVTITHQGIIQTGVG
FT                   FEVNTKTQQYKLNSKVNTRYEPSAAR"
FT   sig_peptide     complement(817399..817464)
FT                   /locus_tag="Xfasm12_0759"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.907) with cleavage site probability 0.473 at
FT                   residue 22"
FT   gene            complement(817461..818009)
FT                   /locus_tag="Xfasm12_0760"
FT   CDS_pept        complement(817461..818009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0760"
FT                   /product="putative 3-deoxy-D-manno-octulosonate 8-phosphate
FT                   phosphatase"
FT                   /note="KEGG: xft:PD0641 putative
FT                   3-deoxy-D-manno-octulosonate 8-phosphate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0760"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11751"
FT                   /protein_id="ACA11751.1"
FT                   /translation="MPYSPLNTLPADVIQRAKCIRLACFDVDGTLTDGRLYYDHVGHES
FT                   KAFHVLDGQGLKQLEHCGIHVTLITALASLAAKKRAEHLGLPIKIGVQDKRLAVQTLAM
FT                   ESGIGIDAVLFMGDDLVDLPALLTVGLPVAPANAHPWIAERVAWQTRARGGEGAAREVC
FT                   DVLLAAQDKVDALLRKFTP"
FT   gene            complement(818027..819064)
FT                   /locus_tag="Xfasm12_0761"
FT   CDS_pept        complement(818027..819064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0761"
FT                   /product="Arabinose-5-phosphate isomerase"
FT                   /EC_number="5.3.1.13"
FT                   /note="KEGG: xft:PD0642 polysialic acid capsule expression
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0761"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11752"
FT                   /protein_id="ACA11752.1"
FT                   /translation="MEVHFTPVLNTCMAVSSLQHNHLSDTALIASARRVIEIEREALTL
FT                   LNERIGAPFVAACRLILNSHGRVISTGMGKSGHIARKIAATLASTGTPAFFVHPGEAGH
FT                   GDLGMITDSDVILALSYSGESDEVRMLLPVLKRQGNPIIAMTGRPQSTLAQAADVHLDV
FT                   SVTTEACPLDLAPTSSTTTSLVVGDALAVALLDARGFTAEDFARSHPAGHLGRRLLLHI
FT                   TDVMHSGDDLPAVHEEATLSEALLEMTRKRLGMTAIVDNEGRLQGVFTDGDLRRALDSN
FT                   IDVRNARINEVMTRHPKTINADQLAAEAARLMEANKINGLIVVDPQQRAVGALNIHDLL
FT                   HAKIV"
FT   gene            819090..819317
FT                   /locus_tag="Xfasm12_0762"
FT   CDS_pept        819090..819317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0762"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0643 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0762"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11753"
FT                   /protein_id="ACA11753.1"
FT                   /translation="MDAETIRKLIESGLSQARADVRGEDGVHFEATVICEAFRGKGPLA
FT                   RHRMVYASIGDLMGGAVHALQLKTLTPDEE"
FT   gene            819387..820664
FT                   /locus_tag="Xfasm12_0763"
FT   CDS_pept        819387..820664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0763"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /note="KEGG: xft:PD0644 UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0763"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11754"
FT                   /db_xref="GOA:B0U6N8"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U6N8"
FT                   /protein_id="ACA11754.1"
FT                   /translation="MSKIVVAGGTPLYGDVRISGAKNAVLPILCATLLADAPVEISNVP
FT                   YLHDVITMINLLRELGAGVTMNEGIEAKGRSITVDPRWVRQRVVPYDLVKTMRASVLLL
FT                   GPLLACYGAAEVALPGGCAIGSRPVDQHIRGLQSLGAEITVENGYIKASVSQGRLKGGR
FT                   FVFDVVSVTGTENLLMAAAVAQGTSVIENAAMEPEVVDLAECLITLGARVEGAGTPRIV
FT                   VEGVERLKSGQYAVLPDRIETGTFLVATAMTGGRISMQQVRPQTLDAVLGKLTEAGACI
FT                   EIGADSIRLDMQGRRPCSVNLTTAPYPGFPTDMQAQFMALNCVAEGVGVIKETIFENRF
FT                   MHVDELLRLGAKIQIEGHTAIVQGVERLSGAPVMATDLRASASLILAGLVAEGETIIDR
FT                   IYHLDRGYENIEKKLGVLGASIRRMT"
FT   gene            820712..820963
FT                   /locus_tag="Xfasm12_0764"
FT   CDS_pept        820712..820963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0764"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF1416 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0764"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11755"
FT                   /protein_id="ACA11755.1"
FT                   /translation="MLVFLCWLGYTRYVGLAIAEGVQFKDMDWNGDGTVSRQEIAQAFY
FT                   AVAVRHSQENQRHCVTYYWRRSGEQIRVECRTFLEKSN"
FT   gene            complement(821029..821271)
FT                   /locus_tag="Xfasm12_0765"
FT   CDS_pept        complement(821029..821271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0765"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF1417 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0765"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11756"
FT                   /protein_id="ACA11756.1"
FT                   /translation="MLVLTSLMQFALLTGDFEFHLQDAASLQAVAPLPDSTRSASCSIL
FT                   FFPNAGWHTRLEQSLSQHLSKTPKTIFVCTSSTKI"
FT   gene            complement(821342..821656)
FT                   /locus_tag="Xfasm12_0766"
FT   CDS_pept        complement(821342..821656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0766"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF1418 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0766"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11757"
FT                   /protein_id="ACA11757.1"
FT                   /translation="MTSVTFDTLKFANKLKTAGIPHAHAEAEAEALEEVLKTNLQESRN
FT                   GKALARLEANMEKGFAEVDLRFAQINQRFAEVKGEMRLLKWMLGVIVTGIAALIIKAFF
FT                   "
FT   gene            821819..822796
FT                   /locus_tag="Xfasm12_0767"
FT   CDS_pept        821819..822796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0767"
FT                   /product="UDP-3-O-(3-hydroxymyristoyl) glucosamine
FT                   N-acyltransferase"
FT                   /note="KEGG: xft:PD0647 UDP-3-O-[3-hydroxymyristoyl]
FT                   glucosamine N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0767"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11758"
FT                   /protein_id="ACA11758.1"
FT                   /translation="MARRESKREIQGKEDKHARTMRPYITRRNDVMNDTFDYIFGYALS
FT                   TALARYWVNPDGSQGGIVSIDAKIDASVMIGKDAVVFPDANIAERACIAEKVCIGNAVR
FT                   IGKHAMIDHGASIGDRSNIGERSRIYQDSFIGENAVIAARACIGEKVYIGNFVSLAKDS
FT                   IIDDGVNIGERSSIGERTRIRQGSFIRKGCVIRQRSVIAKRAYIDEGVYIGNVVRIGEE
FT                   SMIHRRSHIGSGARIGGSVCIGVYCRIDGSVRIGQQADIGEWVSIDGHARIGNFVRIGE
FT                   GSKIGGRANIAAHVILEKQSIIHSETCIQDASKTSVDMSKDAGI"
FT   gene            822798..823163
FT                   /locus_tag="Xfasm12_0768"
FT   CDS_pept        822798..823163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0768"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0648 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0768"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11759"
FT                   /protein_id="ACA11759.1"
FT                   /translation="MHVEDRFLSLDSYVAPKYVRREMVMSETEFLTAEELVEITGYKNF
FT                   AGQRKWLDKEGWCYVVNASRRPIVGRWFARLRLAGVSPHMATTDIRPLQQPKQSHFATE
FT                   PNFAALRELTEKRKRAL"
FT   gene            complement(823264..823503)
FT                   /pseudo
FT                   /locus_tag="Xfasm12_0769"
FT   gene            complement(823504..827508)
FT                   /locus_tag="Xfasm12_0770"
FT   CDS_pept        complement(823504..827508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0770"
FT                   /product="Phosphoribosylformylglycinamidine synthase"
FT                   /EC_number="6.3.5.3"
FT                   /note="KEGG: xft:PD0650 phosphoribosylformylglycinamidine
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0770"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11760"
FT                   /protein_id="ACA11760.1"
FT                   /translation="MVALPPHYGSSDMIVLKGASALSPFRLARFESHLQTTVPELRIVG
FT                   AWHCYLIQIKSGHTLDMSALHRILQAESVSELPQKHVVSRYVMPRLGTHSPWSSKTTEL
FT                   LHGAGQPIARIERGTRIDLLGWSANAAACPAIAKQLYDPMTQSLLESEDEVKTLFNVPE
FT                   PRPLERIALIDLEHANTRLGLALTADEIDYLRTRYTELNRVPSDVELMMFAQANSEHCR
FT                   HKIFNATWTIDDKEQPYSLFQMIKHTHQHTPQYTLSAYADNAAVIEGHPTAHYRPDPIT
FT                   GEYRHEAVRPGAFQIKVETHNHPTAIAPFPGASTGAGGEIRDEGATGRGGKPKAGLSGF
FT                   SVSHLRIPTLPHPWETPRTLNPRMASALDIMLEGPLGSAAFNNEFGRPNLLGYFRSFEL
FT                   CASKTLTRAYDKPIMLAGGLGAIDRIHIKKLRLQPGDVIIVLGGPAMLIGLGGGAASSV
FT                   TSGTSTEALDFASVQRDNPEMQRRCQEVIDHCVALGTNNPIRSFHDVGAGGLSNAIPEL
FT                   LHDSEVGGVIDLAKIPSDDPSLSPLELWCNESQERYVLGISAAHLQAFAAICTRERCPF
FT                   AAVGVATATEQLIVGYGVTLPAALHVTEQQTPQRANRTETSPTPNTLASPVREAFAIDL
FT                   PMDVLFGKAPKMHRNTAHPPPPQWPTLDSTQLDLHHAGLRVLAHPTVAAKNFLVTIGDR
FT                   SIGGLTAREQMIGPWQLPLADCAITLAGFSSYAGEAFAIGERAPLALLNSAAAARMAVG
FT                   EAITNLCAAPVESLSMVKLSANWMAAAEYPGEDALLYDAVKAIGIELCPALDISIPVGK
FT                   DSLSMQSRWQADGATHTCISPVSLVISAFTPVADARRQLTPLLHHQTNSELWLIALDGG
FT                   KQRLGGSVLAQVHADSAALPAFGGECPDLDTPETLRAFFALMNDARNAGLLLAYHDRSD
FT                   GGAFAALCEMAFASHLGLDITCDNSTEHLFHHLFNEELGAIVQVADEHRTAFADLVEHH
FT                   GLKAYTQRIAHPTTAPSIRVMHNDQCLAQWTWETLFDAWWSTTHAMQRLRDNPECADEE
FT                   REIARTFTAPGLKPTLSFDPAADVAMPFISTGIRPKVAILREQGINGHIEMALCFERAG
FT                   FHSVDIHMNDLITGRVHLDEFVGLAACGGFSYGDVLGAGRGWATSILERTALRAQFATF
FT                   FTRTDRFALGVCNGCQMLSQLKSMIPGAEHWPRFVRNRSEQFEARTALLEVIQSPSIFL
FT                   SGMAGSRLPVAVAHGEGYALFDTPADQAAAHVALRYIDGHGQAATHYPLNPNGSPNGIT
FT                   GLTTTDGRITILMPHPERTPRTINLSWSPNEWGEDAPWLRLFRNARAWVG"
FT   gene            complement(827669..828457)
FT                   /locus_tag="Xfasm12_0771"
FT   CDS_pept        complement(827669..828457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0771"
FT                   /product="chitinase"
FT                   /note="KEGG: xfa:XF1424 chitinase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0771"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11761"
FT                   /protein_id="ACA11761.1"
FT                   /translation="MYRLIAALLLGIVTLTACAQPSQPSSNKTSTTPTNATPANVQQRV
FT                   TAALNTLDPDFKPDYIGAAPFPGFREVVVSGQILYVSDNGRYLIQAQPYDIQNKKFAVS
FT                   EGLLSYRRTQLATVPQSQRIVFAPKNPQYTISVFTDIECGYCRKLHSEIAELNKQGIAV
FT                   EYLAFPRMGLGSQDYKDMVSVWCATDRKQALTEAKAGKQIQNKNCNNPVALEYSLGQRI
FT                   GVNGTPAIFAPDGTQLGGYLPPEKLRALLDKLAAATAKGG"
FT   sig_peptide     complement(828398..828457)
FT                   /locus_tag="Xfasm12_0771"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 20"
FT   gene            complement(828589..829563)
FT                   /locus_tag="Xfasm12_0772"
FT   CDS_pept        complement(828589..829563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0772"
FT                   /product="integrase/recombinase"
FT                   /note="KEGG: xft:PD0652 integrase/recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0772"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11762"
FT                   /protein_id="ACA11762.1"
FT                   /translation="MTLRTTNQRRQLARQQPPLLPKDATTIAHCLDALWIKHGLSRHTL
FT                   NSYRRDLEGLARWNNGRAGPLATLTPPALLDYLTWRTQQHYSPLSNARLLSVLRTFFSY
FT                   AVECGWRNDNPSTLLAHPVLPHPLPKALTESQIEALLAAPSIETPEGLRNRAMLELMYA
FT                   AGLRVSELITLPVAMLNRRQGVLRITGKGGKERLVPLGEESQHWLQRYLEQARPSLAAD
FT                   KPIPADSDGDVPLFINTNLKRLSRQQFWRWIKHYAALAGIAPNKVSPHVLRHSFATHLL
FT                   NHGADLRALQMLLGHRSISTTQIYTLIARQHLQQLHAQHHPRG"
FT   gene            complement(829821..830714)
FT                   /locus_tag="Xfasm12_0773"
FT   CDS_pept        complement(829821..830714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0773"
FT                   /product="ion transporter 33.9 kDa"
FT                   /note="KEGG: xft:PD0653 ion transporter 33.9 kDa"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0773"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11763"
FT                   /protein_id="ACA11763.1"
FT                   /translation="MPLLFDSQMTPITNSGWRRHWFEIVYRHDTPPSRNFDLLLMSAIL
FT                   GSVIVVMLDSVLTLQAHWKYFLYTLEWLFTLIFTADYLIRLVVVQQRLRYVLSIWGIID
FT                   LLSILPTYLSLFMPGTQSLLIVRVLRLLRLFRILKMTHYVEESGELIQALWRSRRKVML
FT                   FLCTVMTIAMIAGATMYVIEGPQHGFTSIPTGMYWAIVTMTTVGFGDITPQSTLGRFVT
FT                   SALILIGYSIIAVPTGIYTAELTQGLLRSEEEHRHDMRTCPHCGLQGHDYDARYCRNCG
FT                   GILPETLHEPNPATQQ"
FT   gene            830782..832017
FT                   /locus_tag="Xfasm12_0774"
FT   CDS_pept        830782..832017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0774"
FT                   /product="succinylornithine aminotransferase"
FT                   /note="KEGG: xft:PD0654 succinylornithine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0774"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11764"
FT                   /protein_id="ACA11764.1"
FT                   /translation="MSAVSESVLSLSRYYLPVYRPCQVVLVRGQGSRVWDEQGRDYLDL
FT                   AAGIAVCCLGHCDPDLVAALVEQAGRLWHTSNVFYSEPSLRLAQELVDVSRFAERVFLC
FT                   SSGTEANEAAIKLVRKWSAAQGRLPEHRTIVTFRGSFHGRTLGAVTATAQPKYQEGYEP
FT                   LPGGFRYVDFNHIEALEAAMVGGDVAAVMLEPIQGEGGVMPVVPGYLAQVRALCDRYGA
FT                   LLVLDEIQCGMGRTGTLFAYWQEEVVPDIVTLAKGLGGGFPIGAMLAGPKVAEVMQFGA
FT                   HGTTFGGNPMAAAVARVALRKLVSVEIAANVQRQSVALRAGLEEISEAFGGVFTQVRGR
FT                   GLMLGAVLAPLYAGQASAILEVAAEHGVLLLQAGPDVLRFVPALNVSDEELADGLVRLR
FT                   AALGDYVSRFGG"
FT   gene            complement(832234..833598)
FT                   /locus_tag="Xfasm12_0775"
FT   CDS_pept        complement(832234..833598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0775"
FT                   /product="glutamate-cysteine ligase precursor"
FT                   /note="KEGG: xfa:XF1428 glutamate-cysteine ligase
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0775"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11765"
FT                   /protein_id="ACA11765.1"
FT                   /translation="MSSPSHITEIPITNRAQLVEVLASGEKPASQWRIGTEHEKFGFRL
FT                   DDLCPPTFDDERGIEALLTGMTRFGWTPVQEHDRTIALLRGDTSITLEPAGQLELAGAP
FT                   LETIHQTHIETETHLREVNKIANTLQLGFLGMGFHPKCTRAQMPWMPKGRYAIMRAYMP
FT                   KVGQLGLDMMTRTCTVQVNLDYASETDMVKKFRVSLALQPIATALFANSPFTEGKPNGY
FT                   LSYRSHIWTDTDPDRTGMLDFVFEDGFGYERYVDYLLDVPMYFSYRTGIYHDASGQSFR
FT                   DFLQGRLPALPGILPTLRDWSDHMTTAFPEVRLKKYIEMRGADSGPLPTLCALPAFWVG
FT                   LLYDNTALDAAWDLIKDLTLQERHALRNGVPRHALALPFRNSTVRTLALQTLDISRAGL
FT                   RRRAQHNANGQDETIFLNVLDEIAHTGQTAAQRTLQRYDNTWNHDINPIFNEYAY"
FT   gene            complement(833818..834477)
FT                   /locus_tag="Xfasm12_0776"
FT   CDS_pept        complement(833818..834477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0776"
FT                   /product="GTP-binding protein"
FT                   /note="KEGG: xfa:XF1430 GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0776"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11766"
FT                   /protein_id="ACA11766.1"
FT                   /translation="MPPNAQHSPQTCDPKQMSSPLEYAKYLLSAHTIHQLPSDDGSEVA
FT                   FAGRSNAGKSSVLNTLTRQNALARVSKTPGRTQQLVYFTVTPQRYLVDLPGYGYAKVPK
FT                   ELQIHWQTFIDSYFHQRQALRGLVVVMDIRHPLKEYDLQMLAYARQRGLPAQALLTKAD
FT                   KLGRGQQAQTLQKVRNELTKHFADHIDIQTFSSKSRQGVEQLHTVIETWLGLARSG"
FT   gene            835060..835293
FT                   /locus_tag="Xfasm12_0777"
FT   CDS_pept        835060..835293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0777"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xfa:XF1433 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0777"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11767"
FT                   /protein_id="ACA11767.1"
FT                   /translation="MIRIESKDKNAYAIIEESDGNTWNFEITQELTKELACCLFGKPVM
FT                   TPLIEVVYRIRDLPSDTGSKALTVTKEVFICF"
FT   gene            complement(835389..836405)
FT                   /locus_tag="Xfasm12_0778"
FT   CDS_pept        complement(835389..836405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0778"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF1434 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0778"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11768"
FT                   /protein_id="ACA11768.1"
FT                   /translation="MCDSKRKNPSSIMRIIACVISIDLWRVYGQFQTNRFYFGNAVVFT
FT                   LLVLLSLGAQAKPSDNEVVVQSISQEEQNAALEYWTPERMAATQAMQAQAIKMINDDPG
FT                   NISESKHISTPAGTEILTAGLLFFRVNGEDSSCTANVVQAATKSVIATAGHCVQSPANE
FT                   PHERIDHLVFLLNYNHGHWDGRFPVRNIYTVNGWSQQGIDGFDFAFLSVAHNNYGSRPG
FT                   DLVIQTPIKFAAPATQGIFSLYGYPNAIDEGEHLVKCSERAVFYPDPHGGGPRVRSLPY
FT                   CHNFSEGASGGPALQNLPDGTYQTGNVEGYVDKVGAATFTYWEAAAHGAWDRAQHDQ"
FT   gene            837155..837802
FT                   /locus_tag="Xfasm12_0779"
FT   CDS_pept        837155..837802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0779"
FT                   /product="thiol:disulfide interchange protein"
FT                   /note="KEGG: xft:PD0658 thiol:disulfide interchange
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0779"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11769"
FT                   /protein_id="ACA11769.1"
FT                   /translation="MSVFGRLLSLLLAFVPLSICAAVNHLPVVGEDYVEIPDGRPFAPL
FT                   AGKIEVVEIFGYTCPHCAHFDSKLQAWGARQAKDVRFTLVPAVFGGVWDPFARAYLAAD
FT                   VLGVAKRSHAAMFEAIHEKGSVPIQNVGPDELAVFYAGYGVQSDRFVATFNGPEVEKRF
FT                   QAARAYALKVRPVGTPTIVVDGRYMVTGHDFDDTLRITDYLVSRERAASHGR"
FT   sig_peptide     837155..837220
FT                   /locus_tag="Xfasm12_0779"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.933 at
FT                   residue 22"
FT   gene            837905..838687
FT                   /locus_tag="Xfasm12_0780"
FT   CDS_pept        837905..838687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0780"
FT                   /product="thiol:disulfide interchange protein"
FT                   /note="KEGG: xft:PD0659 thiol:disulfide interchange
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0780"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11770"
FT                   /protein_id="ACA11770.1"
FT                   /translation="MKNRFAMMLMALLPVLVACQAKDGSADTVQSAVPAPSAPLSSSTA
FT                   TNTPTTPPPEAARPVEASRVPSGPKPVAGTDYVVIQDGQQFQPVPGKVEVVEVFGYICP
FT                   ACFQFQPQIAPWKAGLASDVNFVYVPAVFGGPWDDYARAFYAAETLNLQEKTHQQLYKA
FT                   IHVDRTLKGERGRDTVQDIANFYAKFGVNPEQFVNTMSSFGISAKVNRAKQFAKHSQVT
FT                   GTPSLIINGKYLVKGRTYDDMLRIADHLIEGERKVLGK"
FT   sig_peptide     837905..837970
FT                   /locus_tag="Xfasm12_0780"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.969 at
FT                   residue 22"
FT   gene            838703..839473
FT                   /locus_tag="Xfasm12_0781"
FT   CDS_pept        838703..839473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0781"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0660 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0781"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11771"
FT                   /protein_id="ACA11771.1"
FT                   /translation="MNDSDQCILRVLTANIQAASSTRRYSDYVTRSWSHALPIGRKRIN
FT                   LDAIAQLAGERDIVGLQESDPGSLRSGFTNQTCYLAQRAGFHYWSHQPNRRIAGVASSA
FT                   NGLLSRLKPRQIHNHALPGWIRGRGVLLAKFGNGGFDSLVVAVVHLSLGVRSRMAQLVF
FT                   IADLLAEYPNTILMGDFNCRADCSEMQVLYRRTRLQPPGVVIPTFPSWCPERAIDHILV
FT                   SEGFYICKTEAVPAAFSDHLAVSMDLVIPQRILR"
FT   gene            complement(839581..840195)
FT                   /locus_tag="Xfasm12_0782"
FT   CDS_pept        complement(839581..840195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0782"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0661 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0782"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11772"
FT                   /protein_id="ACA11772.1"
FT                   /translation="MNALIDNRVLALAGVVQALQQVRQIAETGQSETSAVRTAIDSVLR
FT                   IDAESPEAVYGGIRDLTQGLQLLHDYFGNQLHDQLLPRLTLAVLQLERRFIRDTSIVAA
FT                   VSAGITQAAHQVEQTGDSAHPEVLSTLGALYANTISHLRPRIIVQGNPHYLGQAGVVAE
FT                   IRAMLLAALRSAVLWRQLNGNLLDFLLAKRAMAAATERALR"
FT   gene            complement(840192..841331)
FT                   /locus_tag="Xfasm12_0783"
FT   CDS_pept        complement(840192..841331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0783"
FT                   /product="tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /EC_number="2.1.1.61"
FT                   /note="KEGG: xft:PD0662 tRNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0783"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11773"
FT                   /db_xref="GOA:B0U6Q7"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U6Q7"
FT                   /protein_id="ACA11773.1"
FT                   /translation="MNTPRIIVAMSGGVDSSVAAWRLNSQREAIAGLFMRNWTDDGNGQ
FT                   CHAEEDRRDAVAVCGILGIAFHFRDFSHEYWQEVFTHFLAEYANGRTPNPDVLCNREIK
FT                   FKHFLETARELGADRIATGHYARIEHYRQRWHLLRGADRSKDQSYFLHQLGQEQLAATL
FT                   FPIGDLEKQQLRQLAHQTGLPTHAKKDSTGICFIGERNFREFLKQYLPAQPGEIRDPQE
FT                   QRIAEHPGVFYFTLGQRQGLNIGGVRNRPPSPWYVIGKDLATNVLYVDQHRDSPFLQSR
FT                   WLRSEPAHWVSGSPPAHTFTCTAQTRYRQADEPCKVTVRNDGSLDVDFTRTQWAVTPGQ
FT                   SLVLYDGNECLGGAVIATTDAPLERKRARNLSKTENVLQ"
FT   gene            complement(841328..841786)
FT                   /locus_tag="Xfasm12_0784"
FT   CDS_pept        complement(841328..841786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0784"
FT                   /product="dNTP pyrophosphohydrolase"
FT                   /note="KEGG: xft:PD0663 dNTP pyrophosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0784"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11774"
FT                   /protein_id="ACA11774.1"
FT                   /translation="MPLTQEHWQPNVTVATVVAHNQHLLLVEETINGILMLNQPAGHLE
FT                   PGESLLQAALRETLEETGWKVRLTSLIGSYLWTSATGYTYLRFAFSAEPLTYYPQHPLD
FT                   VGIVRALWLTPSELQAATAPLRSPLVWQVIADYLSGQQAPLDLVRYVP"
FT   gene            841966..842286
FT                   /locus_tag="Xfasm12_0785"
FT   CDS_pept        841966..842286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0785"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0664 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0785"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11775"
FT                   /db_xref="GOA:B0U6Q9"
FT                   /db_xref="InterPro:IPR003769"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR022935"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U6Q9"
FT                   /protein_id="ACA11775.1"
FT                   /translation="MSQKTVHDQDNALLLETGNTKVAPPPRYQVLLLNDDYTPMDFVIV
FT                   VLQQFFAMDLKKATQVMLHVHTRGRGVCGFYTREVAESKVAQVNEFSRIHQHPLLCTMK
FT                   QA"
FT   gene            842419..844695
FT                   /locus_tag="Xfasm12_0786"
FT   CDS_pept        842419..844695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0786"
FT                   /product="ATP-dependent Clp protease subunit"
FT                   /note="KEGG: xft:PD0665 ATP-dependent Clp protease subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0786"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11776"
FT                   /protein_id="ACA11776.1"
FT                   /translation="MFSKDLEQTIGQCYKRTREACHEFMTVEHLLLSLLDNPLAHAVLK
FT                   ACGADVTRLKRDLEQAIEVSITRLDADDGRDTQPTLGFQRVLQRAVYHVQSSGKKEVTG
FT                   ANVLVAIFGEKDSHAVYFLNQQDISRLDIVNYLSHGITRMGEESDVGQAAENEAKGESE
FT                   ANKGDALAEYAINLNEHARNGRIDPLVGRKDEIERTIQVLCRRRKNNPLYVGEAGVGKT
FT                   AIAEGLAKRIVDRSVPEVLADAVIYSLDLGALVAGTKYRGDFEKRLKGVLSALRKTPNV
FT                   VLFIDEIHTIIGAGSASGGTMDASNLIKPALASGELRCIGSTTFQEYRGIFEKDRALAR
FT                   RFQKIDIVEPTAGEAFEILQGLKPKYEAHHGVTYADDALRAAVDLSVKHIGDRLLPDKA
FT                   IDVIDEAGARQRLLPEKERKELIDIEEIETIVTKMARVPAKQVSVSDKDILKHLERNLK
FT                   MVIFGQEPAIEMLSSAIKLARSGLGNPDKPIGNFLLAGPTGVGKTEVTKQLAHHLGIEL
FT                   VRFDMSECMEPHSVSRLIGAPPGYVGFDQGGLLTEKIVKTPHCVLLLDEVEKAHIDVFN
FT                   ILLQVMDRGVLTDTNGREASFKNVILVMTTNAGASQSSRRTIGFTKQDHTSDAMEVICR
FT                   SFSPEFRNRLDAIVQFQPLGFSHILRVVDKFIIELEMLLQEKRVVLSATPIARDWLAQH
FT                   GFDPLMGARPMARVIQEKIKRPLADELLFGKLLNGGRVGIDVRDNELIVETYSEPELLF
FT                   PATVE"
FT   gene            complement(844749..844949)
FT                   /locus_tag="Xfasm12_0787"
FT   CDS_pept        complement(844749..844949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0787"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF1444 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0787"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11777"
FT                   /protein_id="ACA11777.1"
FT                   /translation="MLVQVFEQWYYIIPLTATARLLHLRGSRFTRLKVKILVDIAVYNR
FT                   ARINSHFIQPCNNRLASFKHD"
FT   gene            complement(845038..845256)
FT                   /locus_tag="Xfasm12_0788"
FT   CDS_pept        complement(845038..845256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0788"
FT                   /product="initiation factor IF-1"
FT                   /note="KEGG: xft:PD0666 initiation factor IF-1"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0788"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11778"
FT                   /protein_id="ACA11778.1"
FT                   /translation="MSKDDCIEFEGTVSETLPNTTFRIKLESGHEVTAHISGRMRKNYI
FT                   RILTGDRVKIEMTAYDLTKGRIIYRMK"
FT   gene            complement(845373..846107)
FT                   /locus_tag="Xfasm12_0789"
FT   CDS_pept        complement(845373..846107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0789"
FT                   /product="Leucyltransferase"
FT                   /EC_number="2.3.2.6"
FT                   /note="KEGG: xft:PD0667 leucyl/phenylalanyl-tRNA-protein
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0789"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11779"
FT                   /db_xref="GOA:B0U6R3"
FT                   /db_xref="InterPro:IPR004616"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR042203"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U6R3"
FT                   /protein_id="ACA11779.1"
FT                   /translation="MHSQPYLLSPAPNNTPFPPAEHALREPNGLLAIGGDLTPQRLLAA
FT                   YRSGIFPWFTEGQPPLWWSPDPRTVFHSDSIHLSRRFRRSLRTSTWRVRADTMFAAVID
FT                   ACASTPRRGQDGTWITANMREAYLTLHQHGYAHSVEVFDGTMLVGGIYGVAIGRMFFGE
FT                   SMFSTHNGASKIALASLAYFLHTHSVPLIDAQVENQHLLNLGAERWPRRDFLTYVRRLI
FT                   TQTELPACWSVLFGEKLSRDLV"
FT   gene            complement(846119..847255)
FT                   /locus_tag="Xfasm12_0790"
FT   CDS_pept        complement(846119..847255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0790"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0668 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0790"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11780"
FT                   /protein_id="ACA11780.1"
FT                   /translation="MMNLEVRWLNALDEIAADIWDSLHDGSNPFLTHAFLSGLEQYGCL
FT                   RPSWGWEPLHLTLWDNSTLVAAAPGYLKYNSHGEFVFDHAWAQAYALQRQAYYPKWLCG
FT                   IPYSPVTGPRLLALDTAKRQALLTAVQARVTQDNLSSAHINFHTDEEEITFGTTDDGWL
FT                   ARSDVQYHWCNIAGWPDFDTFLATMDHKHRKNIRQERAKVARTGVRIQSIHGDEATPIE
FT                   LKAMHHFYVNTFHQYGNVPALTLPFLTHLAKTIPRQLVLFMATLNGKLIGGSLCLRGAK
FT                   TLYGRHWGGAALPGLHFETCYYQGIDYCLREGLTRFEPGAQGKHKIARGFLPTEVRSRH
FT                   WISDPRFRIPLAHWCATERIAITAHMHELIAHSPFRKD"
FT   gene            complement(847684..848649)
FT                   /locus_tag="Xfasm12_0791"
FT   CDS_pept        complement(847684..848649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0791"
FT                   /product="thioredoxin reductase"
FT                   /note="KEGG: xft:PD0669 thioredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0791"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11781"
FT                   /protein_id="ACA11781.1"
FT                   /translation="MSDYPASAKHSRLLILGSGPAGWTAAVYAARANLQPVLITGLQQG
FT                   GQLMTTTEVDNWPGDAHGLMGPDLMERMQAHAERFETEVIFDQIYKADLSTRPFTLFGD
FT                   SGLYTCDGLIIATGANAKYLGIPSEEAFKGRGVSACATCDGFFYRDQDVAVIGGGNTAV
FT                   EEALYLSNIARKVYLIHRRDKLRAEKIMQNKLFSKAATGKIELIWNNAVEEVLGNDAGV
FT                   TGVRIRSTQDSSTRDIDVQGLFVAIGHHPNTDLFAGQLAMNNGYLQIHSGTAGNVTQTS
FT                   VEGVFAAGDVADQHYRQAITSAGFGCMAALDAERFLDKGN"
FT   sig_peptide     complement(848560..848649)
FT                   /locus_tag="Xfasm12_0791"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.760) with cleavage site probability 0.746 at
FT                   residue 30"
FT   gene            848800..848904
FT                   /locus_tag="Xfasm12_0792"
FT   CDS_pept        848800..848904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0792"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF1449 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0792"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11782"
FT                   /protein_id="ACA11782.1"
FT                   /translation="MERQLGDYTRFFIDMSAAETKFNVIYYQLLMQHS"
FT   gene            848918..851272
FT                   /locus_tag="Xfasm12_0793"
FT   CDS_pept        848918..851272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0793"
FT                   /product="cell division protein"
FT                   /note="KEGG: xft:PD0670 cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0793"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11783"
FT                   /protein_id="ACA11783.1"
FT                   /translation="MAKQVPERSKPNAGKPSIRKVWSVNGHRLKRHKLLRDLVLIMIAP
FT                   VLVYLMASLFTYSKDDPGWSQSGSAIVHNIGGKAGAWIADVLFQLCGFVAFLLPVALGV
FT                   VSWIALFGSDQEEQAEGHLEPALRLVGIVGFLIAATGLFHLHLFQSDVARAGGILGKQV
FT                   CNSLQAGFGVFGTNLFVLMLLLISVTLATGLSWFALMERIGRVVLAVPPLLQKSKRRAD
FT                   EWQHARALREERDEVRKIDAVQRAKRDPMKIELPPEPIVEKSERAKRDTQIPMFLGVNK
FT                   RGSDLPSLALLDNPKPQIKGYSDETLEALSRQIELKFKDFRIDVQVVGAYPGPVITRFE
FT                   IEPARGVKVSQISALDKDIARGLSVKSVRVVEVIPGKSVIGLEIPNVNREMIFLSELLR
FT                   SKEYDKSPSSLTLALGKNIAGRPTVADLARMPHLLVAGTTGSGKSVAVNAMVLSLLFKA
FT                   SHNDLRMLMIDPKMLELSVYQGIPHLLAPVVTDMKEAANGLRWCVAEMERRYKLMSAVG
FT                   VRNLAGFNKKVKDAEEVGQPLMDPLFKPNPDLSEVPRPLQKLPFIVIFIDEFADMMMIV
FT                   GKKVEELIARLAQKARAAGIHLILATQRPSVDVITGLIKANIPTRIAFQVSSKIDSRTI
FT                   LDQSGAETLLGHGDMLYLPPGTAMPERVHGAFVSDDEVHRVVEYLKASAPVQYVDGVLD
FT                   EIQTMDDGVVIGPAGFPESASGGGDETDPLYDEALRIVTETRRASISSVQRRLRIGYNR
FT                   AARLIEAMETAGVVSPPEHNGDRAVLVPPPR"
FT   gene            851457..853367
FT                   /locus_tag="Xfasm12_0794"
FT   CDS_pept        851457..853367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0794"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0671 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0794"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11784"
FT                   /protein_id="ACA11784.1"
FT                   /translation="MMRLLFFLLLSPICIVTVAHARNAPAAAQTDGNFSYLRYRVDYAV
FT                   RADASSVQTNEYDIRLNTQAAVEQFSQVRLGYSEKMQKLEILEAYTITAAGIRQDVAPT
FT                   KIYTQESYSSASAAMYADYKVKVVVFPNLAPGARVVYRLRRTQLTPYFPGYFGFWETFS
FT                   VFTRYDDAVVTLRAPRKLSMHVWVRGVHGFTRPRFQGDQARWEWRYRRSVPLQSQTWSA
FT                   AQWEFSPTIMVSTFKDWSQLGHAYHVKAGKAAVVTPRVRALADQITAGSAGRRAQATAL
FT                   YNWVARNIRYVAVYLGNGGLEPNRADVILEQHYGDCKDHAVILEALLAAKGIQSTPVLI
FT                   GADGGPTLPPIAVLGRFNHAINYVPEFNLYLDSTNPYARFGQLPASDLGVPVVHSADGY
FT                   VTRTPPHDVWANTYVARTEYRFAQDGSLSGETMLDLGSDGEIATRAMFVELNAQNRRRI
FT                   EESILAQSGFDGDGMLELLGMPHDLQSPFSYRYRFLARDYVDFSMAGGFALPYMPGAES
FT                   VRNIYTTTPAETNQTPFYCNESLHEETYVLRFPANVPIIAIPGSHRFRNRAGEYSVDWY
FT                   RDGQTITAMHRLRHLALRGPEKLCLPGDYQAFRQLYQQVRRGFREQVLYGDLRRIETVA
FT                   H"
FT   sig_peptide     851457..851522
FT                   /locus_tag="Xfasm12_0794"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.981 at
FT                   residue 22"
FT   gene            853912..854556
FT                   /locus_tag="Xfasm12_0795"
FT   CDS_pept        853912..854556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0795"
FT                   /product="periplasmic chaperone"
FT                   /note="KEGG: xft:PD0672 periplasmic chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0795"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11785"
FT                   /protein_id="ACA11785.1"
FT                   /translation="MIWMMLMFSRFRYIFFAVALLSGPVCAGARVDLSAFTRGLKTLQG
FT                   HFSQEVIDTQGRVKERSNGTVALSLPNLLRWECDAPYKQLVVADGKRVWLFDPDLNQAS
FT                   VLLQDNEERNSPLIALIDPIQLDRKYDVSEEVAMRDGLRWLSLRPRGGTEASFQSASFG
FT                   FSQTQLARMELVDNLGQRTVIAFSGWQRNPVFAVNTFRFTPGKNVDVIGDR"
FT   sig_peptide     853912..853995
FT                   /locus_tag="Xfasm12_0795"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.886 at
FT                   residue 28"
FT   gene            854702..856069
FT                   /locus_tag="Xfasm12_0796"
FT   CDS_pept        854702..856069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0796"
FT                   /product="ATPase"
FT                   /note="KEGG: xft:PD0673 ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0796"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11786"
FT                   /protein_id="ACA11786.1"
FT                   /translation="MTRQRFPTLQHDLLGVVPLLQPLAERMRPRTLHEMVGQKRLLAPD
FT                   RALHRAVASGNVHSMILWGPPGCGKTTLSLLLAHYIDAEFRAVSAVLSGLPEVRQILAE
FT                   AAQRFSEGRRTVLFVDEVHRFNKMQQDAFLPHIERGSIIFVGATTENPSFELNSALLSR
FT                   CRVHVLEAVSSQDIVVALQRALQDTERGLGGQKIEVSEASLLEIAKAADGDVRRALTLL
FT                   EIAAELAQDEDEQITADLLSQVLADRSRRFDKRGEQFYDQISALHKSVRSSNPDAALYW
FT                   LLRMLDGGCDPIYLARRLTRMAIEDIGLADPRAQSMALEAWDIYERLGSPEGDLAFAQL
FT                   VLYLASTAKSNAGYVAFNVAKEDIRQTGTQDVPLHLRNAPTRLMKSLGYGIEYQYDHDA
FT                   ENGVALEQTCFPDALGERIYYQPVSRGLEIKLKEKLDWLRAARAQIQADKPQRPRA"
FT   gene            856230..856631
FT                   /locus_tag="Xfasm12_0797"
FT   CDS_pept        856230..856631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0797"
FT                   /product="integral membrane protein possibly involved in
FT                   chromosome condensation"
FT                   /note="KEGG: xfa:XF1454 integral membrane protein possibly
FT                   involved in chromosome condensation"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0797"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11787"
FT                   /db_xref="GOA:B0U6S1"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0U6S1"
FT                   /protein_id="ACA11787.1"
FT                   /translation="MNAVVWWQSLLLVMLGGAFGSGLRFVIGSCLLQRFGAGFPWGTLA
FT                   VNLIGSFVAGFLLIWVDKRGSAGWPWRMLLIVGLIGGLTTFSSLMMECLVFVRSERSLM
FT                   VGLYLCITLLFGLLFVFLGARLGAFVCDD"
FT   gene            857307..858802
FT                   /pseudo
FT                   /locus_tag="Xfasm12_0798"
FT   gene            858814..859443
FT                   /locus_tag="Xfasm12_0799"
FT   CDS_pept        858814..859443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0799"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /note="KEGG: xfa:XF1456
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0799"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11788"
FT                   /protein_id="ACA11788.1"
FT                   /translation="MGGVFDRTLSVQHEGSNNAAFMPMTEVDVVSGCMREYGMTSVLLS
FT                   LGSNVRPRYYLRQAEAALHAFFGEVLFSPVYRTLAVGFDGPDFLNSAAMVHTAMSLSDL
FT                   HAWLHALEERYGRDRAVPRFGNRTLDVDVVFYGDLIVKEPGGEYCIPRRELKHSFVLKP
FT                   LVDVAPDFVDPVSGRTLAQLWAVHPHVDACFQVVDLEVPGDDRDMI"
FT   gene            complement(859454..860191)
FT                   /locus_tag="Xfasm12_0800"
FT   CDS_pept        complement(859454..860191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0800"
FT                   /product="pteridine reductase"
FT                   /note="KEGG: xft:PD0677 pteridine reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0800"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11789"
FT                   /protein_id="ACA11789.1"
FT                   /translation="MSDPSKVALITGGARRIGKAIVHHLHAHGYRVAVHAHQSGHELHA
FT                   FLTELERTRPSSTLALLGDLHENAVPETLIARCAGHFGRLDVLINNASNFYPTPLGEVT
FT                   PAQWDDLFAINAKAPFFLAQAATPLLRKHRGAIINLTDLHGTQPLRQHAVYTAAKAALE
FT                   MLTRSLALELAPQVRVNAIAPGAILWPTQGIAEAAKQALLARTPLARTGTVEEIAEAVL
FT                   WLLESANFITGHTLRLDGGRTLT"
FT   gene            860272..861456
FT                   /locus_tag="Xfasm12_0801"
FT   CDS_pept        860272..861456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0801"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0678 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0801"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11790"
FT                   /protein_id="ACA11790.1"
FT                   /translation="MCADAPAPLPEALAHSEQLAAYIRQQMIQSGGAIPFSRFMELALY
FT                   APGLGYYSAGASKFGEAGDFITAPELGSLFATTVANALAPVLQQLGALACVLELGGGSG
FT                   AFAEMLLKRLMELHRLPQRYAILEPSAELRQRQQLHLKRTLPPSLFALVEWVDAPFSEQ
FT                   WDGVVFANEVIDALPASRFTIRDGQVYEATVLLDAQQRFVSGQQPADALLHQAVRNIER
FT                   DLSVRFADGYCSEVLPQLPYWVQAVVGGLKRGVLLFVDYGYPRAEYYRPERDTGTLRAF
FT                   YRHRVHDDWYRWPGLQDVTASVDFTALAEAGTAAGFDMAGYCTQANFLLSHGLDRLLAH
FT                   AEEGVDEVAKLLLRNQVKRLTLPTEMGERFQVMGFAREVEFDHAFLKGDLIWRL"
FT   gene            861444..861860
FT                   /locus_tag="Xfasm12_0802"
FT   CDS_pept        861444..861860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0802"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xft:PD0679 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0802"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11791"
FT                   /protein_id="ACA11791.1"
FT                   /translation="MAAMNLLLRPRWRPLLWLSLWIAAILVVIIASVLPQKDLPQVPAG
FT                   GDKVEHLLAYFLLAWGAAVLFVRPLIVLAVGMGLVLLGIGIEVAQGMFTVDRLPDVADA
FT                   LANTMGVVLGMLMRLTPLDGVLVWLDTCLFGSRR"
FT   gene            complement(861880..862884)
FT                   /locus_tag="Xfasm12_0803"
FT   CDS_pept        complement(861880..862884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0803"
FT                   /product="Glucokinase"
FT                   /EC_number="2.7.1.2"
FT                   /note="KEGG: xft:PD0680 glucose kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0803"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11792"
FT                   /protein_id="ACA11792.1"
FT                   /translation="MIPTPTRDAPNIPSFLAADVGGTHVRVSVVAAAPTCASPPQLFDV
FT                   RTYRCADYPSLSTILNDFLGTRSAVRDCVIASAGFQRSDGTVITTNLPWPLSPHRLRAD
FT                   LNLAEVSLVNDFEALAYATEDMEAAQLLHLTGPAKAQDGPRLLLGPGTGLGAALWIPNN
FT                   GRPIVLPTEAGQAALPSTTELEMQLVRHMLNNRTHVPIEHALSGPGILNVYRALCALQS
FT                   VLPQHASPDAISHAAAAGTDMLSSQTLEVFCDFLGSIVGDLVMMYGAQGGVYLAGGILP
FT                   QLREPLLRSHFVERFLNKGPMGEALQHVPVRLIEHGQLGIVGAARWYLNKKAT"
FT   gene            863234..863496
FT                   /pseudo
FT                   /locus_tag="Xfasm12_0804"
FT   gene            863588..864877
FT                   /locus_tag="Xfasm12_0805"
FT   CDS_pept        863588..864877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0805"
FT                   /product="glucose/galactose transporter"
FT                   /note="KEGG: xft:PD0681 glucose/galactose transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0805"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11793"
FT                   /protein_id="ACA11793.1"
FT                   /translation="MMPARFPSSTVSIAIVGVLFFIIGFLTWVNGPLITFVHLVFDLNE
FT                   VDAFLVLMVFYLSYFFLALPSAWILKCTGLKKGLALSLLLMAVGAVVFGEFSTQRYYAG
FT                   ALAGLFVIGSGLALQQTAVNPYISILGPIESAARRIAVMGICNKVAGILAPLVIGSLVL
FT                   HGVGDLSMQVATADPATKEQLLAAFAAEIHTPYLIMAGLLAVLAVGVLFSPLPELQPAD
FT                   VNRVLSGDTTQKTNIFQFTHLWLGVLCMFVYVGVEVMAGDAIGTYGHALGLPLDQTKLF
FT                   TSATLGAMLLGYMIGLSVIPKMISQERYLSLSAVLGVLFSIGAALTHGYVSVAFVAALG
FT                   FANAMMWPAIFPLAINALGRFTETGSALLIMGISGGAIIPQLFASLKQYLDFQLVFAGL
FT                   MVPCYLYILFYSLIAGAIKGRSVQRLALGK"
FT   gene            864881..865957
FT                   /locus_tag="Xfasm12_0806"
FT   CDS_pept        864881..865957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0806"
FT                   /product="transcriptional regulator LacI family"
FT                   /note="KEGG: xft:PD0682 transcriptional regulator LacI
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0806"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11794"
FT                   /protein_id="ACA11794.1"
FT                   /translation="MRRPTIKDIAERADVSLKTVSRVMNNELSVMPVTRARVLRAIADL
FT                   NYEPDLSPSARNLRSAMPCVIGLVYDNPNPYHIINIQNGVLAACRETGFSLQIYPCDST
FT                   SPLLVEELTEWVQRSCQAGLVLTAPMSERPELIAGLIARGIKFVRIIAATEDPCDGPCV
FT                   YIADRKAAYEITEHLIQLGHQRIGFLWGGAQHRSSGERYAGYEAALKDYGIDLDKRLVV
FT                   PGDYTFDDGFRGACRLLALRDQPTAIFGSNDEIAAGMLAAARSVGINVPHHLSITGFEN
FT                   SPFASHSSPTLTTASQTTDEIARHAARLLIGQLRMDTCDDQSMLLQNRGFVPQLVVRAS
FT                   TAPVRQTPFIKTPSHDLS"
FT   gene            865954..866994
FT                   /locus_tag="Xfasm12_0807"
FT   CDS_pept        865954..866994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0807"
FT                   /product="Glutamine--fructose-6-phosphate transaminase
FT                   (isomerizing)"
FT                   /EC_number="2.6.1.16"
FT                   /note="KEGG: xfa:XF1464 glucosamine--fructose-6-phosphate
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0807"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11795"
FT                   /protein_id="ACA11795.1"
FT                   /translation="MTLPIPLLEPEQTLMFREAAQAAAVIATQFERNAATIATLVRALR
FT                   ADPPPFVVTCARGSSDHVATYAKYLLETQLGLVTASASLSVGSIYAASLQLRGALYLVI
FT                   SQSGKSPDLLRNVEAAKAAGARVVALVNVEDSPLASLADTVLPLCAGPEQSVAATKSYL
FT                   ASLSAVLQLVAVWKAESGLLAALDGMSDALRTAWECDWTGLIDGLVNARNLFVLGRGFG
FT                   LATAQEAALKFKETCGLHAEAYSAAEVKHGPMALVGSGFPVLVFAQSDGTEAAVRALAH
FT                   EFRGRGSLVWLAAPDGDLPVGVAAHPVCAPLLSIQSFYRVINTLALCRGYNPDLPPHLK
FT                   KVTETV"
FT   gene            866994..868151
FT                   /locus_tag="Xfasm12_0808"
FT   CDS_pept        866994..868151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0808"
FT                   /product="N-acetylglucosamine-6-phosphate deacetylase"
FT                   /EC_number="3.5.1.25"
FT                   /note="KEGG: xfa:XF1465 N-acetylglucosamine-6-phosphate
FT                   deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0808"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11796"
FT                   /protein_id="ACA11796.1"
FT                   /translation="MGASSGVAGFINGRVLTDTGFRHDLAVLLRGGCIQALLPHDDPRV
FT                   TEGAQWVDLRGGLLLPGFIDIQVNGGGGVLFNNARDVDGLATIARAHRRYGTTGLLPTL
FT                   ISDTVEVMAEAIAATRAAIAQGVQGILGIHLEGPYLNPLRKGIHDHTQFRVPQLHELMR
FT                   CTALDNGVTLVTLAPEQVPVEMIRVFVERGAIVFAGHTAATYEQVRAGIAAGVTGFTHL
FT                   YNAMSQLVGREPNVVGAALEDPNTWCGIIVDGVHVHPASLRVALAAKPRGKVLLVTDAM
FT                   PPVGSDSVHYDLYGETITVMDGVVRNAAGALAGAALDMATAVRNTVHWLGVDLAEAVRM
FT                   ASTYPAQCIGLGDRLGRIAPGYQADLVWVDDDVQVQGTWIAGVGA"
FT   gene            868810..869724
FT                   /locus_tag="Xfasm12_0809"
FT   CDS_pept        868810..869724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0809"
FT                   /product="acetyl-CoA carboxylase beta subunit"
FT                   /note="KEGG: xft:PD0685 acetyl-CoA carboxylase beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Xfasm12_0809"
FT                   /db_xref="EnsemblGenomes-Tr:ACA11797"
FT                   /protein_id="ACA11797.1"
FT                   /translation="MDCLARMSWLSKLMPSGIRTENTANKKRGVPEGLWEKCSGCGVAL
FT                   YRPELEEHLQVCPKCGHHMPIRARMRLSALFDPLSTTEIAGRLGPTDVLKFKDQKKYAE
FT                   RIKATQKSSGEYDALIVMYGLLKQKSLVAAAFDFAFMGGSMGSVVGERFARAVEAAIEH
FT                   KCPFVCFSASGGARMQEGLFSLMQMAKTSAMLGRLRQARLPYISVLTHPTTGGVSASFA
FT                   MLGDINIAEPQALIGFAGPRVIEQTVREKLPEGFQRSEFLLAHGGIDQICDRRELRDRL
FT                   ADLMALMMRYPRPDSPSQAMRGQ"
FT   gene            869727..871067
FT                   /locus_tag="Xfasm12_0810"
FT   CDS_pept        869727..871067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Xfasm12_0810"
FT                   /product="phosphomannomutase"
FT                   /note="KEGG: xfa:XF1468 phosphomannomutase"
FT                   /db_xref="E