(data stored in ACNUC7421 zone)

EMBL: CP000943

ID   CP000943; SV 1; circular; genomic DNA; STD; PRO; 7659055 BP.
XX
AC   CP000943; ABAY01000000-ABAY01000565;
XX
PR   Project:PRJNA18809;
XX
DT   21-FEB-2008 (Rel. 94, Created)
DT   11-SEP-2019 (Rel. 142, Last updated, Version 3)
XX
DE   Methylobacterium sp. 4-46 chromosome, complete genome.
XX
KW   .
XX
OS   Methylobacterium sp. 4-46
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales;
OC   Methylobacteriaceae; Methylobacterium.
XX
RN   [1]
RP   1-7659055
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Chertkov O., Brettin T., Detter J.C.,
RA   Han C., Kuske C.R., Schmutz J., Larimer F., Land M., Hauser L.,
RA   Kyrpides N., Ivanova N., Marx C.J., Richardson P.;
RT   "Complete sequence of chromosome of Methylobacterium sp. 4-46";
RL   Unpublished.
XX
RN   [2]
RP   1-7659055
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Chertkov O., Brettin T., Detter J.C.,
RA   Han C., Kuske C.R., Schmutz J., Larimer F., Land M., Hauser L.,
RA   Kyrpides N., Ivanova N., Marx C.J., Richardson P.;
RT   ;
RL   Submitted (12-FEB-2008) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; f1f1d7fd6ab72975c3ab85a465ae3e38.
DR   BioSample; SAMN00623053.
DR   EnsemblGenomes-Gn; EBG00001173165.
DR   EnsemblGenomes-Gn; EBG00001173166.
DR   EnsemblGenomes-Gn; EBG00001173167.
DR   EnsemblGenomes-Gn; EBG00001173168.
DR   EnsemblGenomes-Gn; EBG00001173169.
DR   EnsemblGenomes-Gn; EBG00001173170.
DR   EnsemblGenomes-Gn; EBG00001173171.
DR   EnsemblGenomes-Gn; EBG00001173172.
DR   EnsemblGenomes-Gn; EBG00001173173.
DR   EnsemblGenomes-Gn; EBG00001173174.
DR   EnsemblGenomes-Gn; EBG00001173175.
DR   EnsemblGenomes-Gn; EBG00001173176.
DR   EnsemblGenomes-Gn; EBG00001173177.
DR   EnsemblGenomes-Gn; EBG00001173178.
DR   EnsemblGenomes-Gn; EBG00001173179.
DR   EnsemblGenomes-Gn; EBG00001173180.
DR   EnsemblGenomes-Gn; EBG00001173181.
DR   EnsemblGenomes-Gn; EBG00001173182.
DR   EnsemblGenomes-Gn; EBG00001173183.
DR   EnsemblGenomes-Gn; EBG00001173184.
DR   EnsemblGenomes-Gn; EBG00001173185.
DR   EnsemblGenomes-Gn; EBG00001173186.
DR   EnsemblGenomes-Gn; EBG00001173187.
DR   EnsemblGenomes-Gn; EBG00001173188.
DR   EnsemblGenomes-Gn; EBG00001173189.
DR   EnsemblGenomes-Gn; EBG00001173190.
DR   EnsemblGenomes-Gn; EBG00001173191.
DR   EnsemblGenomes-Gn; EBG00001173192.
DR   EnsemblGenomes-Gn; EBG00001173193.
DR   EnsemblGenomes-Gn; EBG00001173194.
DR   EnsemblGenomes-Gn; EBG00001173195.
DR   EnsemblGenomes-Gn; EBG00001173196.
DR   EnsemblGenomes-Gn; EBG00001173197.
DR   EnsemblGenomes-Gn; EBG00001173198.
DR   EnsemblGenomes-Gn; EBG00001173199.
DR   EnsemblGenomes-Gn; EBG00001173200.
DR   EnsemblGenomes-Gn; EBG00001173201.
DR   EnsemblGenomes-Gn; EBG00001173202.
DR   EnsemblGenomes-Gn; EBG00001173203.
DR   EnsemblGenomes-Gn; EBG00001173204.
DR   EnsemblGenomes-Gn; EBG00001173205.
DR   EnsemblGenomes-Gn; EBG00001173206.
DR   EnsemblGenomes-Gn; EBG00001173207.
DR   EnsemblGenomes-Gn; EBG00001173208.
DR   EnsemblGenomes-Gn; EBG00001173209.
DR   EnsemblGenomes-Gn; EBG00001173210.
DR   EnsemblGenomes-Gn; EBG00001173211.
DR   EnsemblGenomes-Gn; EBG00001173212.
DR   EnsemblGenomes-Gn; EBG00001173213.
DR   EnsemblGenomes-Gn; EBG00001173214.
DR   EnsemblGenomes-Gn; EBG00001173215.
DR   EnsemblGenomes-Gn; EBG00001173216.
DR   EnsemblGenomes-Gn; EBG00001173217.
DR   EnsemblGenomes-Gn; EBG00001173218.
DR   EnsemblGenomes-Gn; EBG00001173219.
DR   EnsemblGenomes-Gn; EBG00001173220.
DR   EnsemblGenomes-Gn; EBG00001173221.
DR   EnsemblGenomes-Gn; EBG00001173222.
DR   EnsemblGenomes-Gn; EBG00001173223.
DR   EnsemblGenomes-Gn; EBG00001173224.
DR   EnsemblGenomes-Gn; EBG00001173225.
DR   EnsemblGenomes-Gn; EBG00001173226.
DR   EnsemblGenomes-Gn; EBG00001173227.
DR   EnsemblGenomes-Gn; EBG00001173228.
DR   EnsemblGenomes-Gn; EBG00001173229.
DR   EnsemblGenomes-Gn; EBG00001173230.
DR   EnsemblGenomes-Gn; EBG00001173231.
DR   EnsemblGenomes-Gn; EBG00001173232.
DR   EnsemblGenomes-Gn; EBG00001173233.
DR   EnsemblGenomes-Gn; EBG00001173234.
DR   EnsemblGenomes-Gn; EBG00001173235.
DR   EnsemblGenomes-Gn; EBG00001173236.
DR   EnsemblGenomes-Gn; EBG00001173237.
DR   EnsemblGenomes-Gn; EBG00001173238.
DR   EnsemblGenomes-Gn; EBG00001173239.
DR   EnsemblGenomes-Gn; EBG00001173240.
DR   EnsemblGenomes-Gn; EBG00001173241.
DR   EnsemblGenomes-Gn; EBG00001173242.
DR   EnsemblGenomes-Gn; EBG00001173243.
DR   EnsemblGenomes-Gn; EBG00001173244.
DR   EnsemblGenomes-Gn; EBG00001173245.
DR   EnsemblGenomes-Gn; EBG00001173246.
DR   EnsemblGenomes-Gn; EBG00001173247.
DR   EnsemblGenomes-Gn; EBG00001173248.
DR   EnsemblGenomes-Gn; EBG00001173249.
DR   EnsemblGenomes-Gn; EBG00001173250.
DR   EnsemblGenomes-Gn; EBG00001173251.
DR   EnsemblGenomes-Gn; EBG00001173252.
DR   EnsemblGenomes-Gn; EBG00001173253.
DR   EnsemblGenomes-Gn; EBG00001173254.
DR   EnsemblGenomes-Gn; EBG00001173255.
DR   EnsemblGenomes-Gn; EBG00001173256.
DR   EnsemblGenomes-Gn; EBG00001173257.
DR   EnsemblGenomes-Gn; EBG00001173258.
DR   EnsemblGenomes-Gn; EBG00001173259.
DR   EnsemblGenomes-Gn; EBG00001173260.
DR   EnsemblGenomes-Gn; EBG00001173261.
DR   EnsemblGenomes-Gn; EBG00001173262.
DR   EnsemblGenomes-Gn; EBG00001173263.
DR   EnsemblGenomes-Gn; EBG00001173264.
DR   EnsemblGenomes-Gn; EBG00001173265.
DR   EnsemblGenomes-Gn; EBG00001173266.
DR   EnsemblGenomes-Gn; EBG00001173267.
DR   EnsemblGenomes-Gn; EBG00001173268.
DR   EnsemblGenomes-Gn; EBG00001173269.
DR   EnsemblGenomes-Gn; EBG00001173270.
DR   EnsemblGenomes-Gn; EBG00001173271.
DR   EnsemblGenomes-Gn; EBG00001173272.
DR   EnsemblGenomes-Gn; EBG00001173273.
DR   EnsemblGenomes-Gn; EBG00001173274.
DR   EnsemblGenomes-Gn; EBG00001173275.
DR   EnsemblGenomes-Gn; EBG00001173276.
DR   EnsemblGenomes-Gn; M446_R0001.
DR   EnsemblGenomes-Gn; M446_R0002.
DR   EnsemblGenomes-Gn; M446_R0003.
DR   EnsemblGenomes-Gn; M446_R0004.
DR   EnsemblGenomes-Gn; M446_R0006.
DR   EnsemblGenomes-Gn; M446_R0007.
DR   EnsemblGenomes-Gn; M446_R0008.
DR   EnsemblGenomes-Gn; M446_R0009.
DR   EnsemblGenomes-Gn; M446_R0010.
DR   EnsemblGenomes-Gn; M446_R0011.
DR   EnsemblGenomes-Gn; M446_R0012.
DR   EnsemblGenomes-Gn; M446_R0013.
DR   EnsemblGenomes-Gn; M446_R0014.
DR   EnsemblGenomes-Gn; M446_R0015.
DR   EnsemblGenomes-Gn; M446_R0016.
DR   EnsemblGenomes-Gn; M446_R0017.
DR   EnsemblGenomes-Gn; M446_R0018.
DR   EnsemblGenomes-Gn; M446_R0019.
DR   EnsemblGenomes-Gn; M446_R0020.
DR   EnsemblGenomes-Gn; M446_R0021.
DR   EnsemblGenomes-Gn; M446_R0022.
DR   EnsemblGenomes-Gn; M446_R0023.
DR   EnsemblGenomes-Gn; M446_R0024.
DR   EnsemblGenomes-Gn; M446_R0025.
DR   EnsemblGenomes-Gn; M446_R0026.
DR   EnsemblGenomes-Gn; M446_R0028.
DR   EnsemblGenomes-Gn; M446_R0029.
DR   EnsemblGenomes-Gn; M446_R0030.
DR   EnsemblGenomes-Gn; M446_R0031.
DR   EnsemblGenomes-Gn; M446_R0032.
DR   EnsemblGenomes-Gn; M446_R0033.
DR   EnsemblGenomes-Gn; M446_R0034.
DR   EnsemblGenomes-Gn; M446_R0035.
DR   EnsemblGenomes-Gn; M446_R0036.
DR   EnsemblGenomes-Gn; M446_R0037.
DR   EnsemblGenomes-Gn; M446_R0038.
DR   EnsemblGenomes-Gn; M446_R0039.
DR   EnsemblGenomes-Gn; M446_R0040.
DR   EnsemblGenomes-Gn; M446_R0041.
DR   EnsemblGenomes-Gn; M446_R0042.
DR   EnsemblGenomes-Gn; M446_R0043.
DR   EnsemblGenomes-Gn; M446_R0044.
DR   EnsemblGenomes-Gn; M446_R0045.
DR   EnsemblGenomes-Gn; M446_R0046.
DR   EnsemblGenomes-Gn; M446_R0047.
DR   EnsemblGenomes-Gn; M446_R0048.
DR   EnsemblGenomes-Gn; M446_R0049.
DR   EnsemblGenomes-Gn; M446_R0050.
DR   EnsemblGenomes-Gn; M446_R0051.
DR   EnsemblGenomes-Gn; M446_R0052.
DR   EnsemblGenomes-Gn; M446_R0053.
DR   EnsemblGenomes-Gn; M446_R0054.
DR   EnsemblGenomes-Gn; M446_R0055.
DR   EnsemblGenomes-Gn; M446_R0056.
DR   EnsemblGenomes-Gn; M446_R0057.
DR   EnsemblGenomes-Gn; M446_R0058.
DR   EnsemblGenomes-Gn; M446_R0059.
DR   EnsemblGenomes-Gn; M446_R0060.
DR   EnsemblGenomes-Gn; M446_R0061.
DR   EnsemblGenomes-Gn; M446_R0062.
DR   EnsemblGenomes-Gn; M446_R0063.
DR   EnsemblGenomes-Gn; M446_R0064.
DR   EnsemblGenomes-Gn; M446_R0065.
DR   EnsemblGenomes-Gn; M446_R0066.
DR   EnsemblGenomes-Gn; M446_R0067.
DR   EnsemblGenomes-Gn; M446_R0068.
DR   EnsemblGenomes-Gn; M446_R0069.
DR   EnsemblGenomes-Gn; M446_R0070.
DR   EnsemblGenomes-Gn; M446_R0071.
DR   EnsemblGenomes-Gn; M446_R0072.
DR   EnsemblGenomes-Gn; M446_R0073.
DR   EnsemblGenomes-Gn; M446_R0074.
DR   EnsemblGenomes-Gn; M446_R0075.
DR   EnsemblGenomes-Gn; M446_R0076.
DR   EnsemblGenomes-Gn; M446_R0078.
DR   EnsemblGenomes-Gn; M446_R0079.
DR   EnsemblGenomes-Gn; M446_R0080.
DR   EnsemblGenomes-Gn; M446_R0081.
DR   EnsemblGenomes-Gn; M446_R0082.
DR   EnsemblGenomes-Gn; M446_R0083.
DR   EnsemblGenomes-Gn; M446_R0084.
DR   EnsemblGenomes-Gn; M446_R0085.
DR   EnsemblGenomes-Tr; EBT00001740412.
DR   EnsemblGenomes-Tr; EBT00001740413.
DR   EnsemblGenomes-Tr; EBT00001740414.
DR   EnsemblGenomes-Tr; EBT00001740415.
DR   EnsemblGenomes-Tr; EBT00001740416.
DR   EnsemblGenomes-Tr; EBT00001740417.
DR   EnsemblGenomes-Tr; EBT00001740418.
DR   EnsemblGenomes-Tr; EBT00001740419.
DR   EnsemblGenomes-Tr; EBT00001740420.
DR   EnsemblGenomes-Tr; EBT00001740421.
DR   EnsemblGenomes-Tr; EBT00001740422.
DR   EnsemblGenomes-Tr; EBT00001740423.
DR   EnsemblGenomes-Tr; EBT00001740424.
DR   EnsemblGenomes-Tr; EBT00001740425.
DR   EnsemblGenomes-Tr; EBT00001740426.
DR   EnsemblGenomes-Tr; EBT00001740427.
DR   EnsemblGenomes-Tr; EBT00001740428.
DR   EnsemblGenomes-Tr; EBT00001740429.
DR   EnsemblGenomes-Tr; EBT00001740430.
DR   EnsemblGenomes-Tr; EBT00001740431.
DR   EnsemblGenomes-Tr; EBT00001740432.
DR   EnsemblGenomes-Tr; EBT00001740433.
DR   EnsemblGenomes-Tr; EBT00001740434.
DR   EnsemblGenomes-Tr; EBT00001740435.
DR   EnsemblGenomes-Tr; EBT00001740436.
DR   EnsemblGenomes-Tr; EBT00001740437.
DR   EnsemblGenomes-Tr; EBT00001740438.
DR   EnsemblGenomes-Tr; EBT00001740439.
DR   EnsemblGenomes-Tr; EBT00001740440.
DR   EnsemblGenomes-Tr; EBT00001740441.
DR   EnsemblGenomes-Tr; EBT00001740442.
DR   EnsemblGenomes-Tr; EBT00001740443.
DR   EnsemblGenomes-Tr; EBT00001740444.
DR   EnsemblGenomes-Tr; EBT00001740445.
DR   EnsemblGenomes-Tr; EBT00001740446.
DR   EnsemblGenomes-Tr; EBT00001740447.
DR   EnsemblGenomes-Tr; EBT00001740448.
DR   EnsemblGenomes-Tr; EBT00001740449.
DR   EnsemblGenomes-Tr; EBT00001740450.
DR   EnsemblGenomes-Tr; EBT00001740451.
DR   EnsemblGenomes-Tr; EBT00001740452.
DR   EnsemblGenomes-Tr; EBT00001740453.
DR   EnsemblGenomes-Tr; EBT00001740454.
DR   EnsemblGenomes-Tr; EBT00001740455.
DR   EnsemblGenomes-Tr; EBT00001740456.
DR   EnsemblGenomes-Tr; EBT00001740457.
DR   EnsemblGenomes-Tr; EBT00001740458.
DR   EnsemblGenomes-Tr; EBT00001740459.
DR   EnsemblGenomes-Tr; EBT00001740460.
DR   EnsemblGenomes-Tr; EBT00001740461.
DR   EnsemblGenomes-Tr; EBT00001740462.
DR   EnsemblGenomes-Tr; EBT00001740463.
DR   EnsemblGenomes-Tr; EBT00001740464.
DR   EnsemblGenomes-Tr; EBT00001740465.
DR   EnsemblGenomes-Tr; EBT00001740466.
DR   EnsemblGenomes-Tr; EBT00001740467.
DR   EnsemblGenomes-Tr; EBT00001740468.
DR   EnsemblGenomes-Tr; EBT00001740469.
DR   EnsemblGenomes-Tr; EBT00001740470.
DR   EnsemblGenomes-Tr; EBT00001740471.
DR   EnsemblGenomes-Tr; EBT00001740472.
DR   EnsemblGenomes-Tr; EBT00001740473.
DR   EnsemblGenomes-Tr; EBT00001740474.
DR   EnsemblGenomes-Tr; EBT00001740475.
DR   EnsemblGenomes-Tr; EBT00001740476.
DR   EnsemblGenomes-Tr; EBT00001740477.
DR   EnsemblGenomes-Tr; EBT00001740478.
DR   EnsemblGenomes-Tr; EBT00001740479.
DR   EnsemblGenomes-Tr; EBT00001740480.
DR   EnsemblGenomes-Tr; EBT00001740481.
DR   EnsemblGenomes-Tr; EBT00001740482.
DR   EnsemblGenomes-Tr; EBT00001740483.
DR   EnsemblGenomes-Tr; EBT00001740484.
DR   EnsemblGenomes-Tr; EBT00001740485.
DR   EnsemblGenomes-Tr; EBT00001740486.
DR   EnsemblGenomes-Tr; EBT00001740487.
DR   EnsemblGenomes-Tr; EBT00001740488.
DR   EnsemblGenomes-Tr; EBT00001740489.
DR   EnsemblGenomes-Tr; EBT00001740490.
DR   EnsemblGenomes-Tr; EBT00001740491.
DR   EnsemblGenomes-Tr; EBT00001740492.
DR   EnsemblGenomes-Tr; EBT00001740493.
DR   EnsemblGenomes-Tr; EBT00001740494.
DR   EnsemblGenomes-Tr; EBT00001740495.
DR   EnsemblGenomes-Tr; EBT00001740496.
DR   EnsemblGenomes-Tr; EBT00001740497.
DR   EnsemblGenomes-Tr; EBT00001740498.
DR   EnsemblGenomes-Tr; EBT00001740499.
DR   EnsemblGenomes-Tr; EBT00001740500.
DR   EnsemblGenomes-Tr; EBT00001740501.
DR   EnsemblGenomes-Tr; EBT00001740502.
DR   EnsemblGenomes-Tr; EBT00001740503.
DR   EnsemblGenomes-Tr; EBT00001740504.
DR   EnsemblGenomes-Tr; EBT00001740505.
DR   EnsemblGenomes-Tr; EBT00001740506.
DR   EnsemblGenomes-Tr; EBT00001740507.
DR   EnsemblGenomes-Tr; EBT00001740508.
DR   EnsemblGenomes-Tr; EBT00001740509.
DR   EnsemblGenomes-Tr; EBT00001740510.
DR   EnsemblGenomes-Tr; EBT00001740511.
DR   EnsemblGenomes-Tr; EBT00001740512.
DR   EnsemblGenomes-Tr; EBT00001740513.
DR   EnsemblGenomes-Tr; EBT00001740514.
DR   EnsemblGenomes-Tr; EBT00001740515.
DR   EnsemblGenomes-Tr; EBT00001740516.
DR   EnsemblGenomes-Tr; EBT00001740517.
DR   EnsemblGenomes-Tr; EBT00001740518.
DR   EnsemblGenomes-Tr; EBT00001740519.
DR   EnsemblGenomes-Tr; EBT00001740520.
DR   EnsemblGenomes-Tr; EBT00001740521.
DR   EnsemblGenomes-Tr; EBT00001740522.
DR   EnsemblGenomes-Tr; EBT00001740523.
DR   EnsemblGenomes-Tr; M446_R0001-1.
DR   EnsemblGenomes-Tr; M446_R0002-1.
DR   EnsemblGenomes-Tr; M446_R0003-1.
DR   EnsemblGenomes-Tr; M446_R0004-1.
DR   EnsemblGenomes-Tr; M446_R0006-1.
DR   EnsemblGenomes-Tr; M446_R0007-1.
DR   EnsemblGenomes-Tr; M446_R0008-1.
DR   EnsemblGenomes-Tr; M446_R0009-1.
DR   EnsemblGenomes-Tr; M446_R0010-1.
DR   EnsemblGenomes-Tr; M446_R0011-1.
DR   EnsemblGenomes-Tr; M446_R0012-1.
DR   EnsemblGenomes-Tr; M446_R0013-1.
DR   EnsemblGenomes-Tr; M446_R0014-1.
DR   EnsemblGenomes-Tr; M446_R0015-1.
DR   EnsemblGenomes-Tr; M446_R0016-1.
DR   EnsemblGenomes-Tr; M446_R0017-1.
DR   EnsemblGenomes-Tr; M446_R0018-1.
DR   EnsemblGenomes-Tr; M446_R0019-1.
DR   EnsemblGenomes-Tr; M446_R0020-1.
DR   EnsemblGenomes-Tr; M446_R0021-1.
DR   EnsemblGenomes-Tr; M446_R0022-1.
DR   EnsemblGenomes-Tr; M446_R0023-1.
DR   EnsemblGenomes-Tr; M446_R0024-1.
DR   EnsemblGenomes-Tr; M446_R0025-1.
DR   EnsemblGenomes-Tr; M446_R0026-1.
DR   EnsemblGenomes-Tr; M446_R0028-1.
DR   EnsemblGenomes-Tr; M446_R0029-1.
DR   EnsemblGenomes-Tr; M446_R0030-1.
DR   EnsemblGenomes-Tr; M446_R0031-1.
DR   EnsemblGenomes-Tr; M446_R0032-1.
DR   EnsemblGenomes-Tr; M446_R0033-1.
DR   EnsemblGenomes-Tr; M446_R0034-1.
DR   EnsemblGenomes-Tr; M446_R0035-1.
DR   EnsemblGenomes-Tr; M446_R0036-1.
DR   EnsemblGenomes-Tr; M446_R0037-1.
DR   EnsemblGenomes-Tr; M446_R0038-1.
DR   EnsemblGenomes-Tr; M446_R0039-1.
DR   EnsemblGenomes-Tr; M446_R0040-1.
DR   EnsemblGenomes-Tr; M446_R0041-1.
DR   EnsemblGenomes-Tr; M446_R0042-1.
DR   EnsemblGenomes-Tr; M446_R0043-1.
DR   EnsemblGenomes-Tr; M446_R0044-1.
DR   EnsemblGenomes-Tr; M446_R0045-1.
DR   EnsemblGenomes-Tr; M446_R0046-1.
DR   EnsemblGenomes-Tr; M446_R0047-1.
DR   EnsemblGenomes-Tr; M446_R0048-1.
DR   EnsemblGenomes-Tr; M446_R0049-1.
DR   EnsemblGenomes-Tr; M446_R0050-1.
DR   EnsemblGenomes-Tr; M446_R0051-1.
DR   EnsemblGenomes-Tr; M446_R0052-1.
DR   EnsemblGenomes-Tr; M446_R0053-1.
DR   EnsemblGenomes-Tr; M446_R0054-1.
DR   EnsemblGenomes-Tr; M446_R0055-1.
DR   EnsemblGenomes-Tr; M446_R0056-1.
DR   EnsemblGenomes-Tr; M446_R0057-1.
DR   EnsemblGenomes-Tr; M446_R0058-1.
DR   EnsemblGenomes-Tr; M446_R0059-1.
DR   EnsemblGenomes-Tr; M446_R0060-1.
DR   EnsemblGenomes-Tr; M446_R0061-1.
DR   EnsemblGenomes-Tr; M446_R0062-1.
DR   EnsemblGenomes-Tr; M446_R0063-1.
DR   EnsemblGenomes-Tr; M446_R0064-1.
DR   EnsemblGenomes-Tr; M446_R0065-1.
DR   EnsemblGenomes-Tr; M446_R0066-1.
DR   EnsemblGenomes-Tr; M446_R0067-1.
DR   EnsemblGenomes-Tr; M446_R0068-1.
DR   EnsemblGenomes-Tr; M446_R0069-1.
DR   EnsemblGenomes-Tr; M446_R0070-1.
DR   EnsemblGenomes-Tr; M446_R0071-1.
DR   EnsemblGenomes-Tr; M446_R0072-1.
DR   EnsemblGenomes-Tr; M446_R0073-1.
DR   EnsemblGenomes-Tr; M446_R0074-1.
DR   EnsemblGenomes-Tr; M446_R0075-1.
DR   EnsemblGenomes-Tr; M446_R0076-1.
DR   EnsemblGenomes-Tr; M446_R0078-1.
DR   EnsemblGenomes-Tr; M446_R0079-1.
DR   EnsemblGenomes-Tr; M446_R0080-1.
DR   EnsemblGenomes-Tr; M446_R0081-1.
DR   EnsemblGenomes-Tr; M446_R0082-1.
DR   EnsemblGenomes-Tr; M446_R0083-1.
DR   EnsemblGenomes-Tr; M446_R0084-1.
DR   EnsemblGenomes-Tr; M446_R0085-1.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00517; serC.
DR   RFAM; RF00519; suhB.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01712; Methylobacterium-1.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01849; alpha_tmRNA.
DR   RFAM; RF01850; beta_tmRNA.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01867; CC2171.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000943.
DR   SILVA-SSU; CP000943.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID:  4003784
CC   Source DNA and bacteria available from Christopher J. Marx
CC   (cmarx@oeb.harvard.edu)
CC   Contacts: Christopher J. Marx (cmarx@oeb.harvard.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfmpageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..7659055
FT                   /organism="Methylobacterium sp. 4-46"
FT                   /strain="4-46"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:426117"
FT   gene            176..1660
FT                   /locus_tag="M446_0001"
FT   CDS_pept        176..1660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: mex:Mext_0001 chromosomal replication
FT                   initiator protein DnaA; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA domain; Chromosomal replication initiator
FT                   DnaA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14589"
FT                   /db_xref="GOA:B0UM01"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM01"
FT                   /protein_id="ACA14589.1"
FT                   /translation="MRVDGGLAEGVDPGRGAGGDVAAAWQRVKRRLRAELGEDVFASWF
FT                   ARLELQDVAGGTARLTVPTRFLKSWIESHYLDRVLATFRSEADGIDGIEVGVRGPMAPA
FT                   RAAPGAAASAPKPASPIRTPGAAPAAPATIELPDADRAQRGEGDLSGAPLDARLTFQTF
FT                   VVGRSNALAHAAAERVAGHEGSGPIYNPLYFHAGVGLGKTHLLHAIGHAAKEAGRRVIY
FT                   LTADRFMYGFVNALKTQNALAFKERLRAIDVLILDDVQFIQGRSIQAEFGHTLNALIDA
FT                   GRQVVAAADRPPTELESLDERVRSRLAGGLVVEIGTLDEALRATILQSRLEAVRVSHPG
FT                   FEVSPAVAEYVAKAITANGRDLEGAVNRLLAHATLTGAPVTLETAETAIRDLVKNREPK
FT                   RVKIEDIQKLVASRYNVSRSDILSERRTAAVVKPRQIAMYLSKVLTLRSLPEIGRRFGG
FT                   RDHTTVLHAVRKIEKAIGEDSALSDEVELLKRMLQD"
FT   gene            1863..2984
FT                   /locus_tag="M446_0002"
FT   CDS_pept        1863..2984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: mex:Mext_0002 DNA polymerase III, beta
FT                   subunit; TIGRFAM: DNA polymerase III, beta subunit; PFAM:
FT                   DNA polymerase III beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14590"
FT                   /db_xref="GOA:B0UM02"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM02"
FT                   /protein_id="ACA14590.1"
FT                   /translation="MRVTVERAALLRSLGHVHRVVERRNTIPILSNVLLRSSADGLQLR
FT                   ATDLDIEVTETIPADVVDGGATTVPAHVIYDIVRKLPDGVQVSLETTGETGQMQIRSGR
FT                   SRFMLGALPEADFPDLAAGELPHRFQLQAAELKKLIDKTQFAISTEETRYYLNGIFFHT
FT                   IETEAGLRLRAVATDGHRLARVEMPAPEGSRGMPGIIVPRKAVAEIQKLVEDGGDSVGV
FT                   ELSPAKVRFTFSSGVTLISKLIDGTFPDYQRVIPTGNDKLLTVEREQFAKAVDRVSTIS
FT                   SERGRAVKLAVGGGRLSLSVNNPDSGSATEELDVDYEAAPLDIGFNARYLLDITAQLDG
FT                   DSALFKLADPGSPTLIQDKEGAPALYVLMPMRV"
FT   gene            3158..4306
FT                   /locus_tag="M446_0003"
FT   CDS_pept        3158..4306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: mex:Mext_0003 DNA
FT                   replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14591"
FT                   /db_xref="GOA:B0UM03"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM03"
FT                   /protein_id="ACA14591.1"
FT                   /translation="MAAPDPFRVTRLIARDFRNHASLDLGVGRPFVALVGENGAGKTNI
FT                   LEALSLFAPGRGLRRADFAAMAREGGPGGFAVSLSVEGPHGEHRVGTAWEPPQGREERG
FT                   GRQCRIDGASAPSPTAFAEQLRVVWLTPDLDALFRGPAGDRRRFLDRLVLAVDAGHGSR
FT                   VSALERALRSRNRLLEERPEDGPWLDAIEREVAELAIAVALARRETVERLDRLILATRD
FT                   AASPFPWAGVRLEGDIDDLVAVWPAVDAEDRFRATLRQNRFRDRAAGRTLAGPQASDLV
FT                   VRHGPKDVPAGTASTGEQKALLIGLVLAHARLVAGMSGLAPLVLLDEVAAHLDPRRRAG
FT                   LFDALEALPGQVWMTGADPALFAELGSRGDVVAVAEGQVRPG"
FT   gene            4776..6623
FT                   /locus_tag="M446_0004"
FT   CDS_pept        4776..6623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0004"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /note="KEGG: mex:Mext_0006 ATP-dependent DNA helicase RecQ;
FT                   TIGRFAM: ATP-dependent DNA helicase, RecQ family;
FT                   ATP-dependent DNA helicase RecQ; PFAM: helicase domain
FT                   protein; HRDC domain protein; DEAD/DEAH box helicase domain
FT                   protein; Helicase superfamily 1 and 2 ATP-binding; SMART:
FT                   DEAD-like helicases"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14592"
FT                   /db_xref="GOA:B0UM04"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM04"
FT                   /protein_id="ACA14592.1"
FT                   /translation="MTSRLDEARAALQTTFGYEDFRPGQAEVIGAVLDGRDVLAVMPTG
FT                   SGKSMTYQLPALVERALTVVVSPLIALMHDQVQQMRGFGVAAATLNSSVDEASAKAAWR
FT                   QIRAGDLRLLFVSPERLLMEGLIEALQGAGVRRLAVDEAHCVSQWGHDFRPEYRELARA
FT                   REALGGVQMVALTATADTATRADITERLFPAGRRPEIFVHSFDRPNIRLTFAPKEHPTR
FT                   QISRFLRTRRSESGIVYCSSRKRTEQLAQMLQEEGVNALPYHAGLDQGTRMRNQDAFLQ
FT                   EDGMVMVATVAFGMGINKPDVRFVCHADMPSNVEGYYQEIGRAGRDGLPADTLTLYGLD
FT                   DMALRRRQIEEKDIPDERRRVERRKLDAMIALCEGATCRRQSLLAYFGEASAPCGRCDL
FT                   CRGGVALVDGTVAAQKVLSAIVRTGQRFGAAYVCDLVHGKETDQIRRNGHTKLKTFGVG
FT                   ADKPVAAWRSILRQLFAAGAVAENQDGYGGLAMTEKGEAILFGREPVQLRPDPEPKAPK
FT                   ERRARGAERDDTLGLSSEDEALFQHLRGLRATLARQEGVAAYMIFPDRTLVEMARAKPV
FT                   DLWALRSVHGVGERKREAYGEAFVATIADFLADAAKRAG"
FT   gene            6842..9055
FT                   /locus_tag="M446_0005"
FT   CDS_pept        6842..9055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0005"
FT                   /product="phosphoribosylformylglycinamidine synthase II"
FT                   /EC_number="6.3.5.3"
FT                   /note="KEGG: mex:Mext_0011
FT                   phosphoribosylformylglycinamidine synthase II; TIGRFAM:
FT                   phosphoribosylformylglycinamidine synthase II; PFAM: AIR
FT                   synthase related protein; AIR synthase related protein
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14593"
FT                   /db_xref="GOA:B0UM05"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM05"
FT                   /protein_id="ACA14593.1"
FT                   /translation="MIRNDIAITPDLVRQHGLTDEEYARFKELIGREPTITELGIVSAM
FT                   WNEHCSYKSSRIHLRTLPTKAPWVIQGPGENAGVIDIGDGRACVFKMESHNHPSFIEPY
FT                   QGAATGVGGILRDVFTMGARPIAALNALRFGSPDHPRTRHLVSGVVAGIGGYGNSFGVP
FT                   TVGGSVGFHRRYDGNILVNAMAVGLARADAIFYAAATGVGNPIVYLGSKTGRDGIHGAT
FT                   MASAAFDESSEEKRPTVQVGDPFAEKLLLEACLELMASGAVIAIQDMGAAGLTCSAVEM
FT                   GAKGNLGVELDLDAVPTREAGMTAYEMMLSESQERMLMVLKPGMEEEAKAIFVKWGLDF
FT                   AIIGHTTDTLRFVIKHGGETVADLPIKELGDEAPLYDRPHRTNMHHPVLRAEDVPAPVT
FT                   HGEALRRLMGSPDLASKRWVWEQYDHYILGNTVQKPGGDAAVVRVEDGPKGLALTTDVT
FT                   PRYCEADPVEGGRQAVAEAYRNISAVGGRPLAVTDNLNFGNPEKPEVMGQFVGCIQGIG
FT                   EACRALDFPVVSGNVSLYNETNGVGILPTPTIGGVGVVDDVRRIATLALKREGDALVLI
FT                   GRSQGWLGQSLYLAEICGREEGAPPPVDLAAERRNGEFVRGLIASGLVDTVHDLSDGGL
FT                   AVALAEMAMAGRIGAALPECPLPIPAHAYLFGEDQGRYLLAVEPETVPDLLYSAAAQGI
FT                   DAAVIGVTGADSLTLPGDEIISVEELRAVNEAWLPTYMAGPGA"
FT   gene            9096..9332
FT                   /locus_tag="M446_0006"
FT   CDS_pept        9096..9332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0006"
FT                   /product="BolA family protein"
FT                   /note="PFAM: BolA family protein; KEGG: mex:Mext_0012 BolA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14594"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM06"
FT                   /protein_id="ACA14594.1"
FT                   /translation="MPMDAREIETMIREALPDATVEIRDLAGDGDHYAATVVSAAFKGK
FT                   SRVQQHQMVYGALQGRMGGVLHALALTTGVPQD"
FT   gene            9388..9726
FT                   /locus_tag="M446_0007"
FT   CDS_pept        9388..9726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0007"
FT                   /product="glutaredoxin-like protein"
FT                   /note="TIGRFAM: glutaredoxin-like protein; PFAM:
FT                   glutaredoxin; KEGG: mex:Mext_0013 glutaredoxin-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14595"
FT                   /db_xref="GOA:B0UM07"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004480"
FT                   /db_xref="InterPro:IPR014434"
FT                   /db_xref="InterPro:IPR033658"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM07"
FT                   /protein_id="ACA14595.1"
FT                   /translation="MTDINSRIESEIKSQDVVVFMKGTPQFPMCGFSGQVAQILNYLGV
FT                   PYKGVNVLEDMEIREGIKAYSNWPTIPQVYVKGEFVGGCDITREMFQSGELQQLLSEKG
FT                   IAVKTAAA"
FT   gene            9849..10748
FT                   /locus_tag="M446_0008"
FT   CDS_pept        9849..10748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0008"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: mex:Mext_0014 FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14596"
FT                   /db_xref="GOA:B0UM08"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM08"
FT                   /protein_id="ACA14596.1"
FT                   /translation="MYDVIIVGGGPAGLSAALVLGRCRRTVLLLDAGHPRNAVTPRMNG
FT                   YLGHDGCPPGALRDQGRAELSRYPTVEVRDADVADARRDEEGFTVVLADGRREAARRLV
FT                   LATGLATELPPVEGFRDFWGRGVHHCPYCDGYENRDAPVAVYGRGGCGKGLALELTAWT
FT                   RDLTLCSDGPAEHLSGEDRARLARQGIRLDERPVARVEGEDGRLARIRFRDGAALPCGA
FT                   MFFTPAECVPSPLVARLGCDLTPKGTVPTRDYEQSNVPGLYVAGDASRRVQFAIVAAAE
FT                   GAMAAFAINTELLREDTA"
FT   gene            11318..11755
FT                   /locus_tag="M446_0009"
FT   CDS_pept        11318..11755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0009"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14597"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM09"
FT                   /protein_id="ACA14597.1"
FT                   /translation="MLRAPGADVPQRSGEICVRCRTSIAATVHYFLRKPNRPSPRDLRG
FT                   SCKTFCMEPRRGRNCSARSVFLSILYAYAYPTSHGLRARGTAMPDFDARHLDDTEALAR
FT                   LAEILHPTKALRGQAKARGRRRVREGLADPAKPADKSDEAA"
FT   gene            complement(11759..12640)
FT                   /locus_tag="M446_0010"
FT   CDS_pept        complement(11759..12640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0010"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mex:Mext_0017 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14598"
FT                   /db_xref="GOA:B0UM10"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM10"
FT                   /protein_id="ACA14598.1"
FT                   /translation="MSDGKDQAGDAPGTKAASAEGRLKDVAARARAALPRLRRPRVKLG
FT                   LPVAALIGGLCVGAFGGGAAVALMGKGARAERAAVGLAEWKKLATRLDAQAAESARLAG
FT                   DLKLVKERSGAAQAAAEAARSEAAAQFGQMAERLERIGKVGSDAAAKLAGLSDRIEHLD
FT                   REQQARVAALGERLDRQRAAAPAPVAVAPAPAPKLASAEPTLTGSLPDKPAAKPAAPAA
FT                   PSATTAPAMVDSWVLRDVYDGVAMIENRNRRLIEVGPGDTVPGVGRVEAIERRGKAWVV
FT                   VTSRGLITPQIW"
FT   gene            complement(12759..14810)
FT                   /locus_tag="M446_0011"
FT   CDS_pept        complement(12759..14810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0011"
FT                   /product="Peptidyl-dipeptidase Dcp"
FT                   /EC_number="3.4.15.5"
FT                   /note="PFAM: peptidase M3A and M3B thimet/oligopeptidase F;
FT                   KEGG: mex:Mext_0413 peptidyl-dipeptidase DCP"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14599"
FT                   /db_xref="GOA:B0UM11"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM11"
FT                   /protein_id="ACA14599.1"
FT                   /translation="MAGTPATPPGNPLLDPVWTTPHGVPPFERIEPAHYEPAFAGALAA
FT                   HEAEIAAIAGSAEPASFANTVAALERSGQALKRVGGVFFNLAGSHTNPDLQAVERVMAP
FT                   RLARHHSALFLNGALWARVRAVDGADLSEEEARVLDRYRTLFRRAGADLDPAAKERMAA
FT                   IAARLAELATRFSQNLLADESGFVLPLETEEDLAGLPPFLRAAAARAAAERGKGGHVIT
FT                   LARSLIEPFLVFSTRRDLRERAYTAWIRRGENGGETDNRAIIAETLQLRAERARLLGYP
FT                   NFAAFKLADTMAETPEAALALLRDVWAPARARAAAERGRLQGLIRDEGGNFALAPWDWR
FT                   HYAEKLRRAEHDLDEGEIKPYLPLDGVIAACFDTASRLFGLRFAELAEVPRYHPDVRAW
FT                   EVRDRDGSVVGLFLGDYFARPSKRSGAWMSAFRSQERLTGEVTPIIVNVMNFAKGAEGE
FT                   PALLSFDDARTLFHEFGHALHGLLSSVTYPLLAGTAVAGDFVELPSQLYEHWLEQPQVL
FT                   RAHARHYRTGEPMPEALLQRLLAARTFNQGFATVEYAASAIVDLDLHLSEAAEAGLDVG
FT                   SFEAETLTRIGMPAEISMRHRSPHFAHIFAGGYAAGYYSYLWSEVLDADAFDAFREAGD
FT                   IFDPETAQRLRTFVYGAGNLRDARRAYMAFRGRLPSIDPLLRKRGLAA"
FT   gene            14971..15768
FT                   /locus_tag="M446_0012"
FT   CDS_pept        14971..15768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0012"
FT                   /product="Extensin family protein"
FT                   /note="PFAM: Extensin family protein; KEGG: mex:Mext_0412
FT                   extensin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14600"
FT                   /db_xref="InterPro:IPR009683"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM12"
FT                   /protein_id="ACA14600.1"
FT                   /translation="MTRRPALLLALLAAAPALAQARDAPPLPPPRPDLPAPAPHPATAP
FT                   NPATTSSPATAPAPAPPAAEAAPLPPERPADLPAGPAAPAVPDDTACLSRLERLGARAE
FT                   PLPALADGLCGAPKPLRVVELPDGIQLSPPATLTCRAAEALARWSTEVRVLAERDLGRP
FT                   PRSLRISTSYECRGQNHDPDAKLSEHAFANAIDVMGFTFEGREPIGIGTQAEGTPEGRF
FT                   QAAVRARACAFFRTVLGPGSDAEHGNHLHLDERERNAGHRLCQ"
FT   sig_peptide     14971..15036
FT                   /locus_tag="M446_0012"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.710 at
FT                   residue 22"
FT   gene            15830..16843
FT                   /locus_tag="M446_0013"
FT   CDS_pept        15830..16843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0013"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein;
FT                   ErfK/YbiS/YcfS/YnhG family protein; KEGG: mex:Mext_0411
FT                   ErfK/YbiS/YcfS/YnhG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14601"
FT                   /db_xref="GOA:B0UM13"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM13"
FT                   /protein_id="ACA14601.1"
FT                   /translation="MRRVLAVCVANVLVLGAAAAAPALDRDAVNGARFEAGAHRKPAGK
FT                   RPDPVLIKAQVLLDRARFSPGAIDGRDGDNLRGALKAFAEAKGMPASGHLDGRLWEALA
FT                   GSSQDPVLTDYALTKADAEGPYAEEIPAKMEDQAELKALSYTGPAEMLAERFHMSRALF
FT                   DALNPDKDLGRAGTVVTVAAVPPLATDRPGKGLPEEPKVARIVVGKEALQVRAYGGDGA
FT                   LLAVYPASVGSEEKPAPEGRFKVEGVTLNPTYTYDPKYAFKGVEATRKFTIKPGPNNPV
FT                   GLVWIELSAESYGIHGTPEPEKIGKSESHGCIRLTNWDARDLALHVARGATVEIGE"
FT   sig_peptide     15830..15892
FT                   /locus_tag="M446_0013"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.776 at
FT                   residue 21"
FT   gene            complement(16852..17955)
FT                   /locus_tag="M446_0014"
FT   CDS_pept        complement(16852..17955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0014"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: syw:SYNW2120 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14602"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM14"
FT                   /protein_id="ACA14602.1"
FT                   /translation="MRRAIIHIGTPRTGSSSLQTVLFRHRAALREAGILYPDLTPRAAP
FT                   LPHLSHQHLGAALAGRRPLGERRELLDALASRLAASRAEAVVISYEGLCLFPSWHPAPG
FT                   LLCDLLRRHGYEPEILLTVRAQAAYLQSQHLWRLQFLAERRPFAAAFAADLGHRRYDYL
FT                   YGLDGWARAARGRVSVVPYRDRRADAPLIVRVAAELGLADRLLPLMSADDLACRANRSL
FT                   DPVSAEVARRLAASGIARRGEQARAVTARIEALAAERGLGGAFQALDAGMLERAAAHYR
FT                   ATNELLARRVWATGWDDRIEAPHILPATELAGRPLDRATEGEVEAIRRLVIAELGLGTG
FT                   GRLARALARAGEEVAISVRRLPILAPR"
FT   gene            complement(18197..19237)
FT                   /locus_tag="M446_0015"
FT   CDS_pept        complement(18197..19237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0015"
FT                   /product="phytanoyl-CoA dioxygenase"
FT                   /note="KEGG: swi:Swit_3963 phytanoyl-CoA dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14603"
FT                   /db_xref="GOA:B0UM15"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM15"
FT                   /protein_id="ACA14603.1"
FT                   /translation="MALHLSHVVLAPFYATQILTGAKSFRTNPVLGSVRLNRRGLHVWR
FT                   VRLAAAMTARRRAALAPLVTEEDRRQLAAQGYIEVRDFLAPDHFADLVREVTSLPLPAK
FT                   QFREGNAVTRRVPLTPATLRGLPACRRLLAMPAFQGRLRYVASFDAEPEVYIQTIFSRL
FT                   DGSADPQGDLHMDTFHPTMKAWLFLHDVPADEGPFTYVRGSATRSRRRLAWERRRSIDA
FT                   CDPAAGGGGAFRIRPDELPRLGLAEPVRFAVPGNTLVVGDTCGFHARGAAARPSLRVEI
FT                   YAASRRNPFLPFVGLDPWALPGLRGRKIALFWGLLALAERLGLGRSQWRPAGRVRAGDP
FT                   VREEAR"
FT   gene            complement(19693..20427)
FT                   /locus_tag="M446_0016"
FT   CDS_pept        complement(19693..20427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0016"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mex:Mext_0410
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14604"
FT                   /db_xref="GOA:B0UM16"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM16"
FT                   /protein_id="ACA14604.1"
FT                   /translation="MSRLVSALGSAAVGLALAAAAHPAAAAAIARAVGLGTGAPVPLDR
FT                   LLWLAQRHLLLALGGFALAGGLGLGLGILAVRSRDARLRGAIDALAAAAQAVPPVVVIG
FT                   LALPILGFGAPPTLLALAAYGLMPVMRATIDALATVPAEVRDAALAVGLTPAQLFRQVD
FT                   LPLAAGPILAALRVVMVVAVATAAVGALAGAPTLGTPIVVGLQNQNGLALLQGAAAAAA
FT                   LAFLADAAMLAAEALLRPVPPR"
FT   sig_peptide     complement(20347..20427)
FT                   /locus_tag="M446_0016"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.909 at
FT                   residue 27"
FT   gene            complement(20424..21575)
FT                   /locus_tag="M446_0017"
FT   CDS_pept        complement(20424..21575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0017"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mex:Mext_0409
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14605"
FT                   /db_xref="GOA:B0UM17"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM17"
FT                   /protein_id="ACA14605.1"
FT                   /translation="MSAVPLPGARRVLPLAAAALALAALLGLPLLTLAPNRLVPGTPVG
FT                   TGWTGPAAGFLALAAAALLAGRGRGPAALALAAGLAALAVLALGLGAAAAGHLAGRPPA
FT                   ARASLASGAWIAAAAIGLLAVEAARALGIRAAGLAVAALALLGTVLALRAGLLDGVSLV
FT                   VEGRARAGTLRAALGEHLALSAGALALGGGASVPLALLRLRGGAGARLIDAVLNGVQVV
FT                   PALALFAALVSLLSGLLALLPSLRGLGLAAIGPTPAILGTAAYLALPLVRSLAEGLASP
FT                   DPEVIETARALGLRPVQILARVRLPLGAPILLGGLRVAAVQAIGLTTLGGLVGAGGLGA
FT                   VVFDGMAQFAPDLILLGAAPVVALSLAADRALAALRPARGASA"
FT   sig_peptide     complement(21477..21575)
FT                   /locus_tag="M446_0017"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.896) with cleavage site probability 0.516 at
FT                   residue 33"
FT   gene            complement(21891..22832)
FT                   /locus_tag="M446_0018"
FT   CDS_pept        complement(21891..22832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0018"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system; KEGG: mex:Mext_0408
FT                   substrate-binding region of ABC-type glycine betaine
FT                   transport system"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14606"
FT                   /db_xref="GOA:B0UM18"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM18"
FT                   /protein_id="ACA14606.1"
FT                   /translation="MKTPAKSSAARPRPGPNRRLLLLGLGGALAGGRASADGEAVTVAS
FT                   KGDAEGTLLGQIIAQTLRGLGIPVVARLQLGPTRIVRTAITAGEIDAYPEYTGNAAFFS
FT                   GTETDPAWKSAATAIAAARRFDAPHGLVWLTPARANNSWQIAVRGDLARRERLSGMADF
FT                   AGAVRRGLIELAASAEFVESPAALAAYEKAYGFVLPRERIITLPGGDTSVTLRAAAQGI
FT                   SGVNAGMVYGTDGAIAALDVVVMEDPLGAQIVYEPAPVFRAPVLARHPAIAPALDGIFS
FT                   RLDLPTLRRLNGAITVEGGTPEAVARRYLAEG"
FT   sig_peptide     complement(22722..22832)
FT                   /locus_tag="M446_0018"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.946 at
FT                   residue 37"
FT   gene            23055..23444
FT                   /locus_tag="M446_0019"
FT   CDS_pept        23055..23444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0019"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   mex:Mext_0407 response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14607"
FT                   /db_xref="GOA:B0UM19"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM19"
FT                   /protein_id="ACA14607.1"
FT                   /translation="MSTDTSDQILNGARVLVVEDEAAISMLLEDMLLDFGCDIVGPAAR
FT                   LSTALEMAEKESFAVAILDVNVAGEPIYPVAEAVVRRGLPLVFSTGYGGAGIREPFRDR
FT                   PVVQKPFSQQDLKRTLIQAIQGHPG"
FT   gene            complement(23401..23631)
FT                   /locus_tag="M446_0020"
FT   CDS_pept        complement(23401..23631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14608"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM20"
FT                   /protein_id="ACA14608.1"
FT                   /translation="MRSGFGCEACGSPAVRFPAVLHEDAPVQCDRCGCTLMAWGAFKRR
FT                   VEAEANRVARAQEPEPRLSPDGPGSPGSGCA"
FT   gene            complement(23723..24124)
FT                   /locus_tag="M446_0021"
FT   CDS_pept        complement(23723..24124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0021"
FT                   /product="protein of unknown function UPF0102"
FT                   /note="PFAM: protein of unknown function UPF0102; KEGG:
FT                   mex:Mext_0406 protein of unknown function UPF0102"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14609"
FT                   /db_xref="GOA:B0UM21"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM21"
FT                   /protein_id="ACA14609.1"
FT                   /translation="MTRAEAGPARRAAQRRRATYLRGHGAERLALLALLVKGYRPLARR
FT                   YSAAGGEIDLVVRRGAVVAFVEVKARPTLDEAAAAIDARKRRAFSRAARAWMARNPWSA
FT                   GLTLRADAVFVAPRRWPRHLVSAFALEMS"
FT   gene            complement(24111..25154)
FT                   /locus_tag="M446_0022"
FT   CDS_pept        complement(24111..25154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0022"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: mex:Mext_0405
FT                   uroporphyrin-III C/tetrapyrrole (corrin/porphyrin)
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14610"
FT                   /db_xref="GOA:B0UM22"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM22"
FT                   /protein_id="ACA14610.1"
FT                   /translation="MTDDATTDQATTDQAMSDPAKSDPAATDDAMSDRADESARRPAAP
FT                   GRGPAVFTAFGLAAEAESLAPGLHVVATPIGNLKDVTFRALATLAAAHAVLAEDTRVTR
FT                   TLLAHYGITTPLLSYHEHSGESVRERMIARMKAGEALALVSDAGTPLVSDPGFKLVQAA
FT                   IAEGITVTPVPGPSAALTALMAAGLPTDRFFFEGFLPQKAGARRTRLAALAEVPGTLVL
FT                   FESPHRLPEMLADAAEILGGGRAAAVARELTKLFETVRRGELGGLAAEFAASGPPKGEV
FT                   VVVIGAAVESAPGPEADADLDARLSAALARHSIKDAAALVADETGLRRRDVYARALALA
FT                   RRGDDQG"
FT   gene            25318..26532
FT                   /locus_tag="M446_0023"
FT   CDS_pept        25318..26532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0023"
FT                   /product="extracellular ligand-binding receptor"
FT                   /note="KEGG: mex:Mext_0404 extracellular ligand-binding
FT                   receptor"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14611"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM23"
FT                   /protein_id="ACA14611.1"
FT                   /translation="MAALRVGWPGWRAACAVLALGLSACGGSGVSPVVATRPGAEATAP
FT                   AAPAPGTPDASAIGQGSVTVALILPLTGPGAAAGAAMRNAAELAVAEFQNPDLKVLVKD
FT                   DRGTPDGARDAAASALAEGAEIVIGPLFAGSVQAAAGAVRAAGKPVVAFSTDVSVAGRG
FT                   VYLLSFLPQPEVDRVVEEVTGAGRRSFAALIPETTYGNVVEAQFREAVARKGGRVVALE
FT                   RFPAGNPAAAVARIAPLVTGPGAQADVLFLPDTPEGLTATAGALTRAGFNPARVKPVGT
FT                   AIWNDPRVFAIPALQGGWFAAVEPGGYANFAQRYRTRFGGEPVRVASLAYDAVSLAAAL
FT                   NRQYGSQRFAETTLTNPSGFAGTDGTFRFKAEGPSERALAVFEIRGGSSAVVSPAPRAL
FT                   GPSGT"
FT   sig_peptide     25318..25425
FT                   /locus_tag="M446_0023"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.846) with cleavage site probability 0.638 at
FT                   residue 36"
FT   gene            complement(26600..27796)
FT                   /locus_tag="M446_0024"
FT   CDS_pept        complement(26600..27796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0024"
FT                   /product="oxygen-independent coproporphyrinogen III
FT                   oxidase"
FT                   /EC_number="1.3.98.3"
FT                   /note="KEGG: mex:Mext_0403 oxygen-independent
FT                   coproporphyrinogen III oxidase; TIGRFAM: oxygen-independent
FT                   coproporphyrinogen III oxidase; PFAM: Radical SAM domain
FT                   protein; HemN domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14612"
FT                   /db_xref="GOA:B0UN69"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:B0UN69"
FT                   /protein_id="ACA14612.1"
FT                   /translation="MPGAARRHIPRMIDHPTRDVGFGVYLHWPFCAAKCPYCDFNSHVR
FT                   HAPPDEAAWRAAFAREIAHAAALAPGRTVTSVFLGGGTPSLMQPATVGALLDAVAAAWT
FT                   VAPGAEITLEANPTSVEADRFRGYRLAGVNRVSLGVQALDDGALRRLGRLHSAAEALAA
FT                   VETASRHFARFSFDLIYARPDQTPAAWAAELRQAIARAAEHLSLYQLTIEEGTPFHGLA
FT                   AAGRLVPPDEDTARALFDVTQEVCGAAGLPAYEISNHARPGAESRHNLLYWRYGEYAGI
FT                   GPGAHGRLVLPGGRTGTVTERAPEAWLARVAREGHGIVRTEALTQAEEGDEFLVMGLRL
FT                   AEGIDPARFARLAGRPLDRRRLDGLLAEDLVRVTQAGRIAATPKGAPVLNAVVAELAA"
FT   gene            complement(27958..28272)
FT                   /locus_tag="M446_0025"
FT   CDS_pept        complement(27958..28272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0025"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="PFAM: protein of unknown function UPF0153; KEGG:
FT                   rpe:RPE_3812 protein of unknown function UPF0153"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14613"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:B0UN70"
FT                   /protein_id="ACA14613.1"
FT                   /translation="MSDPTFACQACGACCAYSAEWPRFSTEDDAALAAIPAAYVDDPAG
FT                   RMRCLGDRCSALEGRVGVAVRCRVYAVRPEVCRTCEPGDPECLLARRRHGLPVPADPAS
FT                   "
FT   gene            complement(28269..28523)
FT                   /locus_tag="M446_0026"
FT   CDS_pept        complement(28269..28523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0026"
FT                   /product="conserved hypothetical protein; putative signal
FT                   peptide"
FT                   /note="KEGG: mex:Mext_1186 conserved hypothetical protein;
FT                   putative signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14614"
FT                   /db_xref="UniProtKB/TrEMBL:B0UN71"
FT                   /protein_id="ACA14614.1"
FT                   /translation="MFEMWVESMLLAVEAQGVIAQRLVKLAACDAEAVAESHQMVSEKV
FT                   SALIEATGTLLTGGGMGAVVARYREHVAANALRLAPPAE"
FT   gene            complement(28599..29018)
FT                   /locus_tag="M446_0027"
FT   CDS_pept        complement(28599..29018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0027"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   mex:Mext_2575 thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14615"
FT                   /db_xref="GOA:B0UN72"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:B0UN72"
FT                   /protein_id="ACA14615.1"
FT                   /translation="MADTEDTTNGLARGELTVRTIAMPADTNANGDIFGGWVMSQMDQA
FT                   GGIAGVERAQGRVVTVAVEAMSFIRPVRVGDVLCVYTRVAHVGRTSMRIQIEAWARRFR
FT                   TQLREKVTEATFTFVAIDDEGRPRPVPPAAKAERP"
FT   gene            29309..29635
FT                   /locus_tag="M446_0028"
FT   CDS_pept        29309..29635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0028"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14616"
FT                   /db_xref="UniProtKB/TrEMBL:B0UN73"
FT                   /protein_id="ACA14616.1"
FT                   /translation="MLKSDLKKCWTKQSLPAKARFVNILTMCFRSRGRLHGITVDGDDG
FT                   WDWAARWRLDRGRRAVLIDDAYRDRQVCSVQLDTSGKRLVPDGCGFSGTFEFDEGMSAV
FT                   SFAE"
FT   gene            29749..30942
FT                   /locus_tag="M446_0029"
FT   CDS_pept        29749..30942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0029"
FT                   /product="peptidase C14 caspase catalytic subunit p20"
FT                   /note="PFAM: peptidase C14 caspase catalytic subunit p20;
FT                   SH3 type 3 domain protein; KEGG: rsp:RSP_4069 caspase-1,
FT                   P20"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14617"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR029030"
FT                   /db_xref="UniProtKB/TrEMBL:B0UN74"
FT                   /protein_id="ACA14617.1"
FT                   /translation="MRRIGVWLVLWVCALLGSEAAAADRLAFVVGVDTYPNLGPGAALE
FT                   RPVADARAVGAALESIGFRVTLLTAGVTQETFLRRFSVFADQVQPGDTALFYFAGHGIA
FT                   LQGTNYLIPSDIPAIEPGQELLARNRALAEADLSAALRERGARVVVMVIDACRDNPFPR
FT                   SGTRSVGLTRGLVRTEPAEGVFSLYAAGAGQQALDRLPGSDPSPNSVFTRVFVAQIRRP
FT                   GVNLIDLGETVRDEVVRLAETVPHKQVPAYYNEVRGARFLSLSGSDPAPAEPPRPAPAP
FT                   VPLPAPPPPLPAPVPSAGPAPPRVALPAPAPEPPREMRVGLFSHPIRLDPSGDNWLALR
FT                   SRPSASEGVRLMKLGPDALFTVLGRQGAWLNVRLRGGETGWVHGDYVGCCRRAPVTP"
FT   sig_peptide     29749..29817
FT                   /locus_tag="M446_0029"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.521 at
FT                   residue 23"
FT   gene            31077..31490
FT                   /locus_tag="M446_0030"
FT   CDS_pept        31077..31490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0030"
FT                   /product="DNA-directed RNA polymerase, omega subunit"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, omega subunit;
FT                   PFAM: RNA polymerase Rpb6; KEGG: mex:Mext_3197 DNA-directed
FT                   RNA polymerase, omega subunit"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14618"
FT                   /db_xref="GOA:B0UN75"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UN75"
FT                   /protein_id="ACA14618.1"
FT                   /translation="MARVTVEDCIDKVENRFELVLLAGHRARLLSSGAPLTVDRDRDKN
FT                   PVVALREIADETITPDDLKEQLIHSLQKYVEVDEPEPEAVPLLSSSPAAAAVAPQAASG
FT                   DDNDIQFDRMSEEDLLRGLENLAPPTETEDEGD"
FT   gene            31719..33920
FT                   /locus_tag="M446_0031"
FT   CDS_pept        31719..33920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0031"
FT                   /product="(p)ppGpp synthetase I, SpoT/RelA"
FT                   /EC_number="2.7.6.5"
FT                   /note="KEGG: mex:Mext_3196 RelA/SpoT family protein;
FT                   TIGRFAM: RelA/SpoT family protein; PFAM: amino acid-binding
FT                   ACT domain protein; TGS domain protein; metal-dependent
FT                   phosphohydrolase HD sub domain; RelA/SpoT domain protein;
FT                   SMART: metal-dependent phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14619"
FT                   /db_xref="GOA:B0UN76"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:B0UN76"
FT                   /protein_id="ACA14619.1"
FT                   /translation="MMRQYELVERVKAYNPAADEAMLNRAYVYAMRAHGSQMRASGDLF
FT                   FAHPLEVAAILTDLRVDDATIVAAVLHDTVEDTAATLEEINRTFSPEIGTLVDGLTKIK
FT                   RLDLVSKQAAQGENFRKLLLAIAADVRVLLVKLADRLHNMRTLQHMPPEKRVRIAQETL
FT                   DIYAPLASRMGMQELREELEDLSFRNLKPDVYATISRRLDDLTAKSERLVESIERDLVQ
FT                   RLAAKGIVAKVKGRQKRPYSIWSKMERKSVAFEQLSDIFGFRVIVDSVDTCYRALGVVH
FT                   TTWPMVPGRYKDYISTPKQNDYRSIHTTVIGPKSQRVELQIRTAEMEEVAEYGIAAHAL
FT                   YKDGSPHLATESGAYQWLRRTIELLAEGDSPEEFLEHTKLELFQDQVFCFTPKGRLIAL
FT                   PRGATPIDFAYAVHTELGNAAVGAKINGRIAPLLTELQNGDEVEIVRADGQTPPAAWES
FT                   LVVTGKARAAIRRATRSAVRRQYAGLGRQILDRAFERAGKNFSDEKLRGALPRLARTSA
FT                   EDVFAAVGRGEMFSGDVVKAVYPDYKDERRSQPAPSAPRPHVNGAGRLSLDKDQTVRLT
FT                   WPGKGGEDAIPIRGLDRDLPVRFAPEGGAVPGDRIVGILTAGEGVTIYPIQSPALADFD
FT                   NEPDRWLDVRWDVDGGTHQRFPARIALQSINEPGSFAQIAQVIADHDGNIDNISMKRRS
FT                   QDFTDVLIDLSVWDLKHLNAIISELRAKRVVSKVERVNG"
FT   gene            33980..34570
FT                   /locus_tag="M446_0032"
FT   CDS_pept        33980..34570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0032"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /note="TIGRFAM: orotate phosphoribosyltransferase; PFAM:
FT                   phosphoribosyltransferase; KEGG: mex:Mext_3194 orotate
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14620"
FT                   /db_xref="GOA:B0UN77"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR006273"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UN77"
FT                   /protein_id="ACA14620.1"
FT                   /translation="MTPDDLLEEFRAAGALLEGHFILSSGLHSAVFLQKMAIFSDPVRT
FT                   ARVCAGLASVIRDRYGAVDLVVSPAIGGIVPGYETARALGARAIFVERDPGGPFQLRRG
FT                   FSIPAGSRAVMVEDIVTTGLSSRECLAALRDQPGEVVGAACLIDRSGGRADLGAPLVAL
FT                   ATLDIPNYPADQLPPDLAAIPAVKPGSRATTPG"
FT   gene            34760..35410
FT                   /locus_tag="M446_0033"
FT   CDS_pept        34760..35410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0033"
FT                   /product="protein of unknown function DUF88"
FT                   /note="PFAM: protein of unknown function DUF88; KEGG:
FT                   mex:Mext_3193 protein of unknown function DUF88"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14621"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:B0UN78"
FT                   /protein_id="ACA14621.1"
FT                   /translation="MTYQRSALFIDGANVYATTKALGFDIDYRKLLADFRSRENLIRAF
FT                   YYTALIEDQEYSSIRPLIDWLDYNGYRVVTKPAKEFTDSTGRRKIKGNMDIELTIDALE
FT                   LSPYIDHMVLFSGDGDFKPLVAAMQRRGVRVTVVSTIQTQPPMVSDDLRRQADDFVDIV
FT                   HLIPRIGRDQSDRPTRPMRPHPDAGGERGPARSPVSLEQRYGIRQNEEEADEE"
FT   gene            complement(35525..36481)
FT                   /locus_tag="M446_0034"
FT   CDS_pept        complement(35525..36481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0034"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; dTDP-4-dehydrorhamnose
FT                   reductase; NmrA family protein; Male sterility domain;
FT                   KEGG: mex:Mext_2034 NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14622"
FT                   /db_xref="GOA:B0UN79"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0UN79"
FT                   /protein_id="ACA14622.1"
FT                   /translation="MTAAPLIALTGATGFIGRHLLRDLTGRGYRVRVLLRRPVALPPGA
FT                   SGAVVGDLARPQNMAAALAGVDAVVHSAGLAHAMSGAPEDDYRTFNTEATRGLAQAAAK
FT                   ARVRRFVFLSSIRAQCGPSAPGILTEADAAAPTDAYGRSKLAAEEALAAVEIDFAALRP
FT                   VLVYGPGVKGNMAALLALAARPVPLPLGGLRGRRSLVSVETLADAVEAVLRAPGSLRRP
FT                   LIVAEPDPLTVPEMLAALRAGFGRPPGLMPVPAPLVAAALRLAGRGELGERLAGSLVAR
FT                   AEALAGLGWTAPRGSREGLTALARAVAGGEAAHTTSG"
FT   gene            complement(36513..37517)
FT                   /locus_tag="M446_0035"
FT   CDS_pept        complement(36513..37517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0035"
FT                   /product="glycosyl transferase family 4"
FT                   /note="PFAM: glycosyl transferase family 4; KEGG:
FT                   mex:Mext_2033 glycosyl transferase family 4"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14623"
FT                   /db_xref="GOA:B0UN80"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="UniProtKB/TrEMBL:B0UN80"
FT                   /protein_id="ACA14623.1"
FT                   /translation="MPLPAPVTALLVAAPGAAALILALRPLLRRYALARPNARSSHRVP
FT                   TPQGGGVAVIGAALLVGAALWPLPVGREAACLAAATLGLALVGAVDDLRPLPALPRLAL
FT                   QALAVGALLAATPVRLWPGIPAGLEWGLSLLAGLWFVNLVNFMDGLDWMTVAEAVPLLA
FT                   ALLAFGACGVLPPEATLVAGALLGGVLGFAPFNRPVARLFLGDVGSLPLGLVMAWLLYR
FT                   LAAEGGLAAAILLPLYFLADATLTLLRRLRRGEPVWQAHRTHFYQRATTNGYGVPEVVG
FT                   TVFGLNLALAGLAGATLAWPSWPAALSALAVAGGLVALVLRAFATPRAIPVTP"
FT   sig_peptide     complement(37458..37517)
FT                   /locus_tag="M446_0035"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.961) with cleavage site probability 0.806 at
FT                   residue 20"
FT   gene            complement(37700..39727)
FT                   /locus_tag="M446_0036"
FT   CDS_pept        complement(37700..39727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0036"
FT                   /product="methylmalonyl-CoA mutase, large subunit"
FT                   /EC_number="5.4.99.2"
FT                   /note="KEGG: mex:Mext_0290 methylmalonyl-CoA mutase, large
FT                   subunit; TIGRFAM: methylmalonyl-CoA mutase, large subunit;
FT                   PFAM: methylmalonyl-CoA mutase; cobalamin B12-binding
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14624"
FT                   /db_xref="GOA:B0UN81"
FT                   /db_xref="InterPro:IPR006098"
FT                   /db_xref="InterPro:IPR006099"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006159"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:B0UN81"
FT                   /protein_id="ACA14624.1"
FT                   /translation="MGEQATRTAQRDKPWIIRTYAGHSTAADSNALYRKNLAKGQTGLS
FT                   VAFDLPTQTGYDPDHELARGEVGKVGVSIAHLGDMRTLFRDIPLAQMNTSMTINATAPW
FT                   LLALYLAVAEEQGAPIAALQGTTQNDIIKEYLSRGTYVFPPAPSLRLTKDVILFTTKHV
FT                   PKWNPMNVCSYHLQEAGATPVQELSYALAIAIAVLDTVRADPDFDEASFEEVVGRISFF
FT                   VNAGLRFITEICKMRAFSDLWDEITRDRYGIKDPKKRIFRYGVQVNSLGLTEQQPENNV
FT                   HRILIEMLAVTLSKRARARAVQLPAWNEALGLPRPWDQQWSMRMQQILAYETDLLEFDD
FT                   IFDGSRVIDAKVEELKARTRAELERIGALGGAVAAVETGALKRALVESNAQRIAAIERG
FT                   EQVVVGVNRFETGEPSPLTAGDGAIFTVSETVEMEAQGRIRAWRAERDAQAVARALDEL
FT                   DAAARSGANIMPVSIACAKAGVTTGEWGARLRAVFGEYRAPTGVTPETVTSGAAEEARL
FT                   LIADLGERLGETPKLVVGKPGLDGHSNGAEQIALRARDVGFDVSYDGIRQTPDEIVAKA
FT                   RERGAHVIGLSILSGSHVPLVREVKARLRREGLDHVPVVVGGIISPEDELVLKNMGVAA
FT                   VYTPKDYAIDAIMVGLAKVVERALAAREAQGPVPNREQVF"
FT   gene            40013..41308
FT                   /locus_tag="M446_0037"
FT   CDS_pept        40013..41308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0037"
FT                   /product="crotonyl-CoA reductase"
FT                   /note="TIGRFAM: crotonyl-CoA reductase; PFAM: Alcohol
FT                   dehydrogenase zinc-binding domain protein; Alcohol
FT                   dehydrogenase GroES domain protein; KEGG: mex:Mext_0288
FT                   crotonyl-CoA reductase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14625"
FT                   /db_xref="GOA:B0UN82"
FT                   /db_xref="InterPro:IPR010085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0UN82"
FT                   /protein_id="ACA14625.1"
FT                   /translation="MGAGAAVRPIPGGSGQLKDLYEIGEIPPLGHVPSRMYAWAIRRER
FT                   HGPPEDSMQVEVVPTWTIGDDEVLVLVMAAGVNYNGVWAGLGEPISPFDVHKAPFHVAG
FT                   SDASGIVWAVGAKVKRWKVGDEVIVHCNQDDGDDEECNGGDPMFSPSQRIWGYETPDGS
FT                   FGQFCRVQSRQLMRRPQHLTWEESACYTLTLATAYRMLFGHAPHTVRPGQNVLIWGASG
FT                   GLGVFGVQLCAASGANAIAVISDESKRDYVMSLGAKGVINRKDFKCWGQLPKVNSAEYT
FT                   EWLKEARKFGKAIWDITGKGNDVDIVFEHPGEATFPVSSLVVKRGGMVVFCAGTTGFNI
FT                   TFDARYVWMRQKRIQGSHFAHLKQAAAANQFVIDRRVDPCMSELFPWDKIPHAHTKMWR
FT                   NQHAPGNMAVLVNAQKAGLRTFDDVLELSGSR"
FT   gene            41427..41822
FT                   /locus_tag="M446_0038"
FT   CDS_pept        41427..41822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0038"
FT                   /product="DoxX family protein"
FT                   /note="PFAM: DoxX family protein; KEGG: mex:Mext_0428 DoxX
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14626"
FT                   /db_xref="GOA:B0UN83"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:B0UN83"
FT                   /protein_id="ACA14626.1"
FT                   /translation="MRATLDRYAPVMLSVLRIMAALIFMAHGTQKVLGFPPHPNPPGLT
FT                   TLPGIAGILELVGGAHLALGLLTRPVAFILSGEMAFAYFIGHAPRSFFPTLNGGDAAIL
FT                   YCFVFLYLVFAGPGPLSLDAARHRAGA"
FT   gene            complement(42036..43145)
FT                   /locus_tag="M446_0039"
FT   CDS_pept        complement(42036..43145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0039"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="SMART: regulatory protein LuxR; KEGG: mes:Meso_3054
FT                   transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14627"
FT                   /db_xref="GOA:B0UN84"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B0UN84"
FT                   /protein_id="ACA14627.1"
FT                   /translation="MTDVRDDRLADAIDLFYEAALNPERWPAVLEAYGRAVGADGAVML
FT                   PGPAAPLAASVSEDMAEVVEAGVRDGWLAENPRIARGIQALKDPRGVITESQIFTPREL
FT                   DHIPFNADYVGRHGYRWFAGLYMVAEGERSVILSAERRREREMFSHREIAQIRRAVPHL
FT                   QRAGQIALRIAEARAGAALDAFETLRCGGLLLDASGTVLRMNAHAERQLGRGIAVVKGA
FT                   LLAQDRAANAALGRLIASAIRAGRPHEGAAEGPVAVPRPEGPPLILHAAPLAGAAQDLF
FT                   QRARAVILVVDSAAGGRPGEALLRQAFGLTAAEARLARDLAEGGELAAVAAAHGITIAT
FT                   ARSQLKAVFAKTRTHRQPELVALLGRMRL"
FT   gene            43426..44028
FT                   /locus_tag="M446_0040"
FT   CDS_pept        43426..44028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0040"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="KEGG: mex:Mext_0296 3-isopropylmalate dehydratase,
FT                   small subunit; TIGRFAM: 3-isopropylmalate dehydratase,
FT                   small subunit; PFAM: aconitate hydratase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14628"
FT                   /db_xref="GOA:B0UN85"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/TrEMBL:B0UN85"
FT                   /protein_id="ACA14628.1"
FT                   /translation="MEKFTVLEGVAAPLRIVNVDTDRIIPKQYLKTIKRTGLGKGLFSE
FT                   MRYRDDGSENPDFVLNQPAYRNAKILVVGDNFGCGSSREHAPWALADFGIRCIVSTSFA
FT                   DIFFNNSAKNGILLITVAPEDLEKLFDDAERGANATLTVDLERQEIRGPDGGVLHFDID
FT                   PARKHTLLNGLDEIGLTLEKAPAIEAYERALADRPWA"
FT   gene            44126..45322
FT                   /locus_tag="M446_0041"
FT   CDS_pept        44126..45322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0041"
FT                   /product="lytic murein transglycosylase"
FT                   /note="TIGRFAM: lytic murein transglycosylase; PFAM:
FT                   Peptidoglycan-binding domain 1 protein; KEGG: mex:Mext_4736
FT                   lytic murein transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14629"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR011970"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031304"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:B0UN86"
FT                   /protein_id="ACA14629.1"
FT                   /translation="MTLRLRLTAATLLCLGGFALPGAARADFRSCLAGLGQEAGGRGIS
FT                   PAAFQAATAGIVYDDKVIELSQAQPEFKTPIWDYMAALVDDERVEDGRAAMRQHAAALA
FT                   EAEARFHVDRYTIAAVWGVESNFGKNLGKMPLIQSLATLACSPNRRAGYFRGELMATLK
FT                   IIDRGDIAPDRLTGSWAGAFGQTQFMPSTYQRLAVDLDGDGRRDVVDSVADAVGSTANF
FT                   LRAAKWQNGLPWGYEVRLPRGFSVAAAGRKNKRPIAHWASLGVARVDGRPLSGEGPAGI
FT                   IAPAGVDGPAFLVTRNFDAIYSYNAAESYGLAIAVLSDRLRGRAGIQTAWPTDDPPLSR
FT                   AERRTLQSALASRGYDVGEPDGRVGAKTRDAIKDIERQLGWPQTGRPGAKVLEALRRG"
FT   sig_peptide     44126..44206
FT                   /locus_tag="M446_0041"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.926 at
FT                   residue 27"
FT   gene            complement(45341..47500)
FT                   /locus_tag="M446_0042"
FT   CDS_pept        complement(45341..47500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0042"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; KEGG: mex:Mext_3063
FT                   diguanylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14630"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B0UN87"
FT                   /protein_id="ACA14630.1"
FT                   /translation="MWDNLGSSESEFAAIIAARMHRAVNGEDVFSVAAEVIHQQTTAID
FT                   LDGYMMSMSGRCARRVFGSGAASRRGGLAEAGPWLVAGGETGPVRQRAEEGGTILRQRL
FT                   VSDSLLLGGLVLAGPDLGPADERRCAVLARLTADALSGLHQRRLSQLVLESLEQSEEAV
FT                   SFYDEEEGIVFTNDAYHRIFPHYPDRRALRGAHHLDLYRLDLDAGIIDDPLARADPETY
FT                   LAERARKSRLLTDRQREIQRVGGRTYIYTRTRSRTGATLSRRTDITEQALTEARLRERE
FT                   AELRTLAFQDSLTGLFNRAYLREKVEQLERALAEGRVAGLCVLMIDLNGFKAVNDTYGH
FT                   DCGDRVLRIVGARLSGILPPEAVLMRLGGDEFLVLLEQAAEEPELAAMAEAIIAAVTEP
FT                   IRDGDLALSVGASIGIAAVRGPQTEIDAIIGRADLAMYEAKSLRCSGYRFFHSGLREQR
FT                   LAQLALIEDVRGALRRGEFALHYQPQFRTQDGGLAGFEALARWTHPRHGPIPPSTFIPI
FT                   MEENGLIEALGTWILDTACAEARTWPTDLRLAVNVSPLQVRSGRFSLTLAEALLRSGLP
FT                   PHRLELEITESVLLADEARSRAELERWKALGARIALDDFGRGYSGLGYLTAFPIDKIKI
FT                   DRAFLAGFDAQRPDAAAGVILHAIIRLGRVLGKTVTVEGVESPDQLAHLRRERCTEVQG
FT                   FLLGRPMPAAEVPGFIAQRAAPSAA"
FT   gene            complement(47789..49168)
FT                   /locus_tag="M446_0043"
FT   CDS_pept        complement(47789..49168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0043"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   pap:PSPA7_3647 probable MFS transporter"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14631"
FT                   /db_xref="GOA:B0UN88"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B0UN88"
FT                   /protein_id="ACA14631.1"
FT                   /translation="MRTIGESRAATELGAAPETGAVPGTGTAPGTGARPGTGFAPGTGA
FT                   RPGTGFAPGTGAWTPRRALLRRPLVITFGLMLIAFNLRPALSSVGPLLGRIREETGMGG
FT                   ALAGALITLPVLCLGVFGRLGPPVMRRLGADAGVLAFLIVMAAGLVLRGLDGIPALFAG
FT                   SVVAACGIGVVNVLLPAIVKRDFPDRPGLMMGLYTAVLCLGAAAGAGLTVPAGRLLDSG
FT                   WRGPMMIWALPALLAALAWLPLVRAAPRRPGGGAARRISGLWRDPLAWQVTGFMGLQSS
FT                   LAYIVFGWLPAALMDRGLDPVAAGLVASVSAMAQCLLALAVPPLAARRRDQRPWVLLVI
FT                   GLAVAGFVLLLVGPAALVWLSALLLGLGLGGCFGLALTLIVLRSPDPQTAADLSAMAQG
FT                   VGYSLAALGPFLIGLAHEASGGWGLPALLYLGIGLGGIVLGRQAARDRLVRAHERRAPA
FT                   G"
FT   gene            complement(49299..51134)
FT                   /locus_tag="M446_0044"
FT   CDS_pept        complement(49299..51134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0044"
FT                   /product="heat shock protein Hsp90"
FT                   /note="PFAM: heat shock protein Hsp90; ATP-binding region
FT                   ATPase domain protein; KEGG: mex:Mext_1028 heat shock
FT                   protein HSP90"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14632"
FT                   /db_xref="GOA:B0UN89"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037196"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UN89"
FT                   /protein_id="ACA14632.1"
FT                   /translation="MSETLERHAFGAEVGRLLDLVVHALYSEREIFLRELVANAADAVD
FT                   RRRFGALTDPALSLPADAKVRIRPDKAARTLAISDPGIGMSKEDLAQNLGTIARSGTRA
FT                   FSQSLADAKPDERPSLIGQFGVGFYSAFMVADRVEVTSRKAGSDEAWTWASEGQGEYTL
FT                   SPATRAEPGTDVVLHIKADADEYLEPLRLETIVRKWADHITVPITLLRDGEEVSGNEGT
FT                   ALWRKPKSEVSEEAYTAFYRHVTHNFDAPWATLHWRAEGALDFTALLFIPGMKPFLAVE
FT                   EERESRVRLHVRRMFITDEAGLLPSWLRFVQGVVDTEDLPLNVSREMLQATPVLARIRR
FT                   AVTGKVMAELKSRAKDAESYATFWQAFGPVLKEGIWEDAEHRDDIAALLRFRSTAVEGW
FT                   TSFADYVSRMKPNQEAIYILVGDDAAALARSAQIEGFRARGIEVLLLSDHVDAFWPERL
FT                   DKFDGKPIRSITQSADDLSAFAPEGEAAGEAADLTELLPKLKEILKDDVAEVRASQRLV
FT                   ESAVLLSASSGGPDLQMQRLLRRAGRGFGAGLPVLELNPRHALVRRIAERARAGEDVGE
FT                   AAQTLLDLAHVQGGDPPRDPVAFARRVAAALAAQA"
FT   gene            complement(51254..51925)
FT                   /locus_tag="M446_0045"
FT   CDS_pept        complement(51254..51925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0045"
FT                   /product="Exonuclease RNase T and DNA polymerase III"
FT                   /note="PFAM: Exonuclease RNase T and DNA polymerase III;
FT                   SMART: Exonuclease; KEGG: bja:blr4117 DNA polymerase III
FT                   subunit epsilon"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14633"
FT                   /db_xref="GOA:B0UN90"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B0UN90"
FT                   /protein_id="ACA14633.1"
FT                   /translation="MWTSLRRRLDRARLRDPAFAFLFEPPPPDEAVALDCETTGLDPRR
FT                   DEIVAVAAIRIRGDRILTSESLRATVRSDRPSSPEAIKVHRLLNAEIREAEPLDAVLPA
FT                   LLRFIGGRPIVGYYTEFDVRMLDKSVRRQFGIRLPNPRIDVSSLYHAAKYRDAPDYVKI
FT                   DLSFARILEDLGLPALPQHDAFNDALMTAMIYLQLRDLLARRVAIRREAAGPVETVAFG
FT                   A"
FT   gene            complement(51927..53744)
FT                   /locus_tag="M446_0046"
FT   CDS_pept        complement(51927..53744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0046"
FT                   /product="putative CBS domain and cyclic
FT                   nucleotide-regulated nucleotidyltransferase"
FT                   /note="PFAM: cyclic nucleotide-binding; CBS domain
FT                   containing protein; protein of unknown function DUF294
FT                   nucleotidyltransferase putative; KEGG: bja:blr4116
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14634"
FT                   /db_xref="GOA:B0UN91"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005105"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR018821"
FT                   /db_xref="UniProtKB/TrEMBL:B0UN91"
FT                   /protein_id="ACA14634.1"
FT                   /translation="MQTFDVLNPPFDRLTAEEADGLRRHVDIGYYRPGAVIVARGKPAE
FT                   LLHVVIKGAVETRIDDAPLAVLRAGDTFDARAVVHGEAGEDFVAAEETLCFLIPREVIV
FT                   RLVHANRAFAAFFYAEISRKLDELTAWKPREGVDAVLRTRIRDARHGPAVFLPADATLE
FT                   EAARQMLAADVDAVFIEAGGRTGLLTGHKVTRAAVIEKRPFDTPVRDLAKFDLTAVEAD
FT                   QVLLDALLVMTRHGHRRIAVRENGRYTGWLRDIDLLGAFAGNAQLVPSRIDRAERPEEL
FT                   REPAQDIAVQAEQLHRQGVRVDAIAQVISDLNRRLYAKLFALLAPPAIREAGCLFLMGS
FT                   EGRGEQTYRTDQDNGLILARRVPEDDLATFRAAFSEALGELGFPPCPGEIMVRNPLWSQ
FT                   EADGFVNQLRLWTLAGDPDAAMNLAIFADAAAVAGDPAPLQRAKNYLVEAVRGETRLLA
FT                   QIANLINIVGEGGHGGLFDAVFARIGLRRGELDLKRAGLFPLVHGVRVLAIEAGLAPTG
FT                   TAERIRALVERGVLEEGFGRDLASALRAFMALRLERQLAAAHRGQVGDPVTLATDAMPT
FT                   LERDLLREALRIVRQFREVIHVRYSLGQF"
FT   gene            complement(54051..54524)
FT                   /locus_tag="M446_0047"
FT   CDS_pept        complement(54051..54524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0047"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   reh:H16_B1770 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14635"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B0UN92"
FT                   /protein_id="ACA14635.1"
FT                   /translation="MTPDPTVGLYFEDLAAGQIHRSAELTVTAEAITRFAAEFDPQPFH
FT                   LDEAAAAASFFQGLAASGWHTAALTMRLLVEGGLPLAGGIIGAGMDELRWPRPLRPGET
FT                   IRLESEVLELRASRSRPRQGLAKVRTTTLNQDGAPVQVLVANLVVQRRAGGPA"
FT   gene            complement(54542..55924)
FT                   /locus_tag="M446_0048"
FT   CDS_pept        complement(54542..55924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0048"
FT                   /product="MATE efflux family protein"
FT                   /note="TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE; KEGG: mex:Mext_3795
FT                   MATE efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14636"
FT                   /db_xref="GOA:B0UN93"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:B0UN93"
FT                   /protein_id="ACA14636.1"
FT                   /translation="MDDRTRRLLRGPIGPTLLRLAVPNVLVMLVQAGVGLLETAFVARL
FT                   GTDALAGMALVFPLVMTVQMISAGAVGGGILSAVARTLGAGRREAAEAVAWHALAIALG
FT                   LGLLTTAAALLGGPSLYRAMGAEGATLAAAASYGGVVFAGAALVWLFNALAAVIRGTGN
FT                   MALPAGVTCAGAVVLVPLSPALIFGLGPLPGLGIVGGAVAILAYYAAGSAVLIAALCSG
FT                   RLVLRLRRPPPLARGPAREILRVGAASALVSLTTNLTIAAATGFVARFGPSAVAGYGTG
FT                   ARLEYLLVPLVFGLGAPISAMVGTGIGAGDRVRALRVAWTGAAIAVGLTEAIGLAASLR
FT                   PDAFLGLFATDPVMREVGARYLRLVGPFYGFAGLGLALYFAAQGAGRIAWPLVAGLTRV
FT                   TVAVGGGWLGSRAGAGLAGIFLAQALGLAALGLINAGAVAAGAWFRTRPPVAGPLAIRP
FT                   GA"
FT   gene            56045..56560
FT                   /locus_tag="M446_0049"
FT   CDS_pept        56045..56560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0049"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG: mlo:mlr2509
FT                   probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14637"
FT                   /db_xref="GOA:B0UN94"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0UN94"
FT                   /protein_id="ACA14637.1"
FT                   /translation="MRPERDGSEAAGPAAVACSNAGLRRATRRLGQLYDEALAPAGLKA
FT                   TQFGLLAQVRQLGRPTMKDLAAAMVMDLSALGHTLKPLARDGLVALEVDPADRRARRVV
FT                   LTAAGRDRFRAAARLWREAQARFEATLGPDKAAQLRVLVDEIASAEFGASFAGRPGGTE
FT                   AGEAVREE"
FT   gene            complement(56918..58372)
FT                   /locus_tag="M446_0050"
FT   CDS_pept        complement(56918..58372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0050"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: nwi:Nwi_3027 major
FT                   facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14638"
FT                   /db_xref="GOA:B0UN95"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B0UN95"
FT                   /protein_id="ACA14638.1"
FT                   /translation="MAAGATTTLADEAVRTDIPARMDRLPWSRFHLLLVIALGITWVLD
FT                   GLEVTIVGAIGPVLQDPRALGLSVQEIGAAASFYVVGAVAGALVFGWVTDRYGRRVVFF
FT                   TTLVVYVGGVVASALAWNFWSFALFRLVTGLGIGGEYAAINSAIDELIPAKYRGRVDLI
FT                   VNGSFWVGAAAGAAGSLLLLDPDIVAPHLGWRLGFGIGGVLGLFILVLRRYVPESPRWL
FT                   VVHGRQEEAERTVAEIERKVEAETGAPLAEPDGILEVHPKASFGFGEIFGSMLGPHRGR
FT                   SLLALVLMSAQAFLFNAVFFTYGLVLAKFYGIPETGAGLFLVPLAIGNFLGPLLLGHYF
FT                   DTIGRRRMITGTFAVSGLMLAVTALVFGLDLFTAWTQTFAWIAIFFVASAAASSAYLTA
FT                   SEIFPLETRALAIAVFYALGTAAGGVMAPWLFTRLIESGHHAALAAGYGGAALLLLVAA
FT                   LTEWKLGVDAEGKSLESIAAPLSKAR"
FT   gene            complement(58880..59719)
FT                   /locus_tag="M446_0051"
FT   CDS_pept        complement(58880..59719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0051"
FT                   /product="aminotransferase class IV"
FT                   /note="PFAM: aminotransferase class IV; KEGG: mex:Mext_3905
FT                   aminotransferase class IV"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14639"
FT                   /db_xref="GOA:B0UN96"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:B0UN96"
FT                   /protein_id="ACA14639.1"
FT                   /translation="MPWLDGAFVEGPTLPLDPADRGLTLGDGVFDTALVRDGRVIFEAA
FT                   HVARLVASAAALGFPLDPAAVTAGMHAMAAGRERAALRTTATRGSGPRGLRPPPAPRPR
FT                   LLVTAAPLADPGTAFAPLALRTTGIRRNDTSPTSRHKTLGYLDAVLAAEEAARAGADEA
FT                   LFLNTRGRVACAGTGSLFALIGGALVTPPLADGVLAGIIRGWILARAPDLGIAAEERSL
FT                   RPEDLAGAEALFVTNSLRLIAPVRALDGRACRDGLQDGRIRRLADALREEVASHSPP"
FT   gene            complement(59706..60311)
FT                   /locus_tag="M446_0052"
FT   CDS_pept        complement(59706..60311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0052"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /note="TIGRFAM: glutamine amidotransferase of anthranilate
FT                   synthase; PFAM: glutamine amidotransferase class-I; KEGG:
FT                   mex:Mext_3906 glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14640"
FT                   /db_xref="GOA:B0UN97"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B0UN97"
FT                   /protein_id="ACA14640.1"
FT                   /translation="MILVIDNYDSFVFNVVRYLQELGAAVEVARNDALDLGSIRARAPE
FT                   ALVISPGPCSPAEAGVSLEAVRALSGEVPILGVCLGHQCIGAAFGGRVERALRPLHGQA
FT                   SPIRHGGTGLFQGLPSPMRVGRYHSLIVAPRPALERSLAVDAVSEEGEVMALSHRRHPT
FT                   YGIQFHPESVLTEHGHALFSNFLRLARAWRAAPADAVA"
FT   gene            complement(60537..61919)
FT                   /locus_tag="M446_0053"
FT   CDS_pept        complement(60537..61919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0053"
FT                   /product="para-aminobenzoate synthase, subunit I"
FT                   /EC_number="4.1.3.27"
FT                   /note="KEGG: mex:Mext_3907 para-aminobenzoate synthase,
FT                   subunit I; TIGRFAM: para-aminobenzoate synthase, subunit I;
FT                   PFAM: Anthranilate synthase component I domain protein;
FT                   Chorismate binding-like"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14641"
FT                   /db_xref="GOA:B0UN98"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR005802"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:B0UN98"
FT                   /protein_id="ACA14641.1"
FT                   /translation="MWTRPLPLLDPIAAASRLRGRRGLALLDSAMRHPDLGRYSYVAAD
FT                   PFREIRVRDGRTLLDGVPAEGPPLAAIRRALAPYRAERRPDLPPFQGGAIGYLAYDFGR
FT                   ALERVAAPPRRAGLCDDLALNLYATILAFDHGEGTCALVATGFPETEPDARARRARADL
FT                   DAWEAALAAPEPAPARRAVPPLAWESNFTRDGYAAAVERVRDYIRAGDIYQANIAQRFA
FT                   AALPPDFDAFALYRRLRARNAATFAAYLELGALTVASSSPERFLRLDGRRIETRPIKGT
FT                   APRAADPAEDRARAEALLASDKERAENVMIVDLLRNDLSRISEPHSVAVPVLCGLETYA
FT                   GVHHLVSVVTGRLRAGADALDLLAATFPGGSITGAPKLRAMDIITEIEGDARELFCGSI
FT                   GWIGFDGSLDTNIAIRTVFMEAGRAVLQAGGGVTLLSDPLAEYEETLTKAERVFAAFPE
FT                   AG"
FT   gene            complement(61992..63008)
FT                   /locus_tag="M446_0054"
FT   CDS_pept        complement(61992..63008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0054"
FT                   /product="putative periplasmic substrate-binding
FT                   transmembrane protein"
FT                   /note="KEGG: azc:AZC_1950 putative periplasmic
FT                   substrate-binding transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14642"
FT                   /db_xref="GOA:B0UN99"
FT                   /db_xref="UniProtKB/TrEMBL:B0UN99"
FT                   /protein_id="ACA14642.1"
FT                   /translation="MIGRRLVRLAAGAALALGLAASPLRAEVSEVRISKGYGVLYLPLF
FT                   VMQEKKFLEAQAARAGLGDVKVTWLTLDGGNVINDAMIAGSLDIAGTGAPGFLALWSKG
FT                   RGSPKTEVIGVSGMSTTALDLNVNKPEIKSLADFTPKDKIAIPGIKTSLAAVVLQMAVA
FT                   KQFGPENYGKLDSSTVGLPHPEAVAALLSGRTEIVAHFASPPFTQVERADPKVRTILKA
FT                   SELFGPITLDVVFALRRFTEQNPKMTQAFLDALDQSCAFIKDNKAETAEIFARASKVKV
FT                   TPEEVAQMLEDPDSRFSATPNGIMEFATFMHRAGIIKTKPATWSDLFIPALRERAGS"
FT   sig_peptide     complement(62928..63008)
FT                   /locus_tag="M446_0054"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 27"
FT   gene            complement(63053..63931)
FT                   /locus_tag="M446_0055"
FT   CDS_pept        complement(63053..63931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0055"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bra:BRADO1410 putative ABC
FT                   transporter; permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14643"
FT                   /db_xref="GOA:B0UNA0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B0UNA0"
FT                   /protein_id="ACA14643.1"
FT                   /translation="MSTVSTLGLDQRPDIVRETSASGAVAVEQRLSLPELLYRQGWLRK
FT                   CVVLAALAILWEVYGRWLDNPLLFPTFGATVEAFGSAILSGEIPRKALISLETLAIGYG
FT                   IGIGLAALLTTIAIGSRIGTDLLETLTAMFNPLPAIALLPLALIWFGLGQGSVVFVLVH
FT                   SVLWAIALNTHAGFRSVSNTLRMVGLNYGLRNLSLVRAILIPAAFPSILTGLKVGWAFA
FT                   WRTLIAAELVFGVSSGSGGLGWYIFENRNALETTNVFAGLFTVILIGLFVENVIFANIE
FT                   KRTIRRWGMQH"
FT   gene            complement(63958..64728)
FT                   /locus_tag="M446_0056"
FT   CDS_pept        complement(63958..64728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0056"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bbt:BBta_6692 putative ABC transporter (ATP binding
FT                   subunit)"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14644"
FT                   /db_xref="GOA:B0UNA1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0UNA1"
FT                   /protein_id="ACA14644.1"
FT                   /translation="MNVRPSLVPEPLLTVQGVTLQYKTTDHLVTATYRVDFEVLPGDRY
FT                   ILLGPSGCGKSTLLKAIGGYLTPVEGEIRLKGRRVTEPGPDRMMVFQEFDQLLPWKTVR
FT                   QNVAFALTASGRAAGAEANDRAMAYIEKVGLAKFADSYPHMLSGGMKQRVAIARGMAME
FT                   PDILLMDEPFAALDALTRRKMQDELLRLWEDTRFTVLFVTHSIEEAIKVGTRILLLSPH
FT                   PGQVKAELNSLAPAELGTAAQGALEARINDMLFA"
FT   gene            64843..65520
FT                   /locus_tag="M446_0057"
FT   CDS_pept        64843..65520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0057"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: bra:BRADO1408 putative
FT                   two-component response regulator (OmpR family)"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14645"
FT                   /db_xref="GOA:B0UNA2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B0UNA2"
FT                   /protein_id="ACA14645.1"
FT                   /translation="MRILLVEDTRDLGEAIATRLRALGHAVDWERDGADGDAALQVQAY
FT                   DLVILDVNLPGLDGFSVLRRLRARRGRSPVLVLTARSEVDDRVGALDLGADDYLVKPFD
FT                   FRELEARVRALLRRHSGHADNAIAVGNLVLDRAARSARVAGQPLDLTRREWTLMEILAA
FT                   RPGRIFGKAELLERVTSFEEDASENAVEQIVARLRRKLAQAGAEPEIRTLRGLGYQVVW
FT                   PQT"
FT   gene            65517..66905
FT                   /locus_tag="M446_0058"
FT   CDS_pept        65517..66905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0058"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; Two-component sensor kinase domain
FT                   protein; KEGG: azc:AZC_1954 ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14646"
FT                   /db_xref="GOA:B0UNA3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B0UNA3"
FT                   /protein_id="ACA14646.1"
FT                   /translation="MIARTPSLFLRLVGVLGLVLAVGAALLLAAAWTSARLAADEAYDR
FT                   LLVGAALQIAETIASDGREVSVDPPFSAFETLGLAPRDRIFYKVLDPSDRLLTGNADLA
FT                   VTVDRGRLGEGPILLDGTHRGEPVRVVVAGRYVPDAARAGFAAVVVAQTREARSALAAE
FT                   LTAKASLLVVAMSALALGAVIVAVRAALRPLAAIEGVLAGRGPNDLDPLDVAVPREIHL
FT                   LVGSINHFMGRLSGHMAIMRRFIADAAHQIRTPLAALSAQVDLLSAEDDPKRRRAQVSR
FT                   VQARTAELGRLTNQLLNHAMVIHRARAVPLAPVDLAGIARQTLIDAIPLSGGRLVDIGY
FT                   DGPDEALPIRGDPIALREALANLIHNALKHGAPHRLTVRTRREPGRVSVEVVDDGAGIP
FT                   AAEWGRVREPFQAATGGGIGSGLGLAIAAEVAAAHGGEMRFESRSDEGFAVVLSFPAAE
FT                   EAPR"
FT   sig_peptide     65517..65633
FT                   /locus_tag="M446_0058"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.840 at
FT                   residue 39"
FT   gene            66902..68035
FT                   /locus_tag="M446_0059"
FT   CDS_pept        66902..68035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0059"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: hch:HCH_01635 ABC-type Fe3+ transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14647"
FT                   /db_xref="UniProtKB/TrEMBL:B0UNA4"
FT                   /protein_id="ACA14647.1"
FT                   /translation="MRRSRGLSAGLSAGLSAALSAAFLGLAPAAGHEVTRFPAPEWPRV
FT                   ELTIRAAADLDVMEPLIRDFQALSPDVTVIYVEYETAELYGEAAAACGAGRASGFSADL
FT                   VISSSVDHLVKLANDGCARAYRSAETARLPPYAVWRDEVFGFTTEPAVIAYRVDLVPPE
FT                   DVPRSRLELVDLLRDKAAAYAGRIGSYDIAASGIGYLFATYDARSAATYGRLVEAFGRA
FT                   HLRVACCTSTLIADLEAGRLAIGYNLLGSYVYAAMRRGAKLGLVVPRDYALVLVRGALI
FT                   PVSAVHAAEGFAFLDYLLSARGQRLSREKAFFFGLDGPLPPGVDGPPSLAATGAFRPIA
FT                   LGPALLAVQDRARRARFLAEWRHSIGLDRAAPARGGP"
FT   sig_peptide     66902..66997
FT                   /locus_tag="M446_0059"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.893 at
FT                   residue 32"
FT   gene            complement(68149..68843)
FT                   /pseudo
FT                   /locus_tag="M446_0060"
FT   gene            complement(69473..69937)
FT                   /locus_tag="M446_0061"
FT   CDS_pept        complement(69473..69937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0061"
FT                   /product="PEBP family protein"
FT                   /note="PFAM: PEBP family protein; KEGG: smd:Smed_4277 PEBP
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14648"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:B0UNA5"
FT                   /protein_id="ACA14648.1"
FT                   /translation="MAFTLTSPAFANGALLPSRYARHGENLSPPLAWSNPPPDTRSFVL
FT                   ILEDPDAPAPSFRHWVIYDIPHERRHLPEGGSSGAAVEGLPHAVNGFRNAHYDGPAPPP
FT                   GDPPHTYRFRLLALGIAHLGLDGQPSAAQVWDVARENILSEAELTATFRR"
FT   gene            complement(70165..71475)
FT                   /locus_tag="M446_0062"
FT   CDS_pept        complement(70165..71475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0062"
FT                   /product="Erythromycin esterase"
FT                   /note="PFAM: Erythromycin esterase; KEGG: mes:Meso_3528
FT                   erythromycin esterase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14649"
FT                   /db_xref="GOA:B0UNA6"
FT                   /db_xref="InterPro:IPR007815"
FT                   /db_xref="InterPro:IPR014622"
FT                   /db_xref="UniProtKB/TrEMBL:B0UNA6"
FT                   /protein_id="ACA14649.1"
FT                   /translation="MADPAAEADLVRLLRERLVPLPPPSEPGFGALADRFAAARVVLLG
FT                   EATHGTREFYEARAALTLRLVAEHGFRIVAFEADWPDAAGIDRYLRGAAETPFPDGGFA
FT                   RFPTWMWRNREVLALAEGLRSVNAGRPPGDQVRVRGLDVYSLGASMAAVLDYLDRVDPA
FT                   AARQARERYGCLSPWHAKPERYGREVMFGAKHPCEDAVAAILRDLQEKRAAYAADDPDS
FT                   YLDAAQNARIVRAAEQYYRIMYRGSVESWNIRDRHMFDTLQHLMGRHAKAVVWAHNSHI
FT                   GHAGATAMGWEGEFNIGELAKTAYGEDAVLVGFATDRGTVAAAHDWDEPMEVMTVRPVR
FT                   EDSHEALFRAAGLPRAVLDLREPRAAALREAWAAPRRERAIGVVYRPRTELQSHYFEAV
FT                   LPDQFDAVLWFEETAAVTPLDRAPPRRGESETYPSGL"
FT   gene            complement(71513..72196)
FT                   /locus_tag="M446_0063"
FT   CDS_pept        complement(71513..72196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0063"
FT                   /product="phospholipase/Carboxylesterase"
FT                   /note="PFAM: phospholipase/Carboxylesterase; KEGG:
FT                   dra:DR_0657 serine esterase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14650"
FT                   /db_xref="GOA:B0UNA7"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B0UNA7"
FT                   /protein_id="ACA14650.1"
FT                   /translation="MPEAAAHAQGILMARPDAAAGPGLPAGTNAIGLGGTRDGLVQVPG
FT                   VAPPGRRPPLLVMLHGAGASSADVLPMVASCAEQHAVVVLVPDSRGATWDLIQRGYGPD
FT                   VAFLDAALGRLFARQAVDPARIAVAGFSDGASYALSLGLANGSLFGDVLAFSPGFCAPA
FT                   RREGTPRIFLSHGREDPVLPFARCGDRVAGALARDGYDVAYRPFSGGHAVPSPLVAEAF
FT                   RRFLA"
FT   gene            72491..72784
FT                   /locus_tag="M446_0064"
FT   CDS_pept        72491..72784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0064"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mex:Mext_1230 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14651"
FT                   /db_xref="UniProtKB/TrEMBL:B0UNA8"
FT                   /protein_id="ACA14651.1"
FT                   /translation="MTQTKPEPRPNLKSFDAYADRNGQDFGQDSPLDVANPEDLQRRMN
FT                   EEPDWEAEVVRIASDRARLDAVSGGSVGTVEATEAETPPENLRKLSDPSSRG"
FT   gene            complement(72852..73253)
FT                   /locus_tag="M446_0065"
FT   CDS_pept        complement(72852..73253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0065"
FT                   /product="transcriptional regulator, MucR family"
FT                   /note="PFAM: ROSMUCR transcriptional regulator; KEGG:
FT                   xau:Xaut_1838 transcriptional regulator, MucR family"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14652"
FT                   /db_xref="GOA:B0UNA9"
FT                   /db_xref="InterPro:IPR008807"
FT                   /db_xref="InterPro:IPR041920"
FT                   /db_xref="UniProtKB/TrEMBL:B0UNA9"
FT                   /protein_id="ACA14652.1"
FT                   /translation="MSDEYATELDPITMAADIIAAYVSHNSVPVAELPALIQAVYDQLG
FT                   RLGQPPAPEPERPVPPIPIKRTVTPDAIISLEDGRPYKSLKRHLSTRGLTPEQYRDKWG
FT                   LPPDYPMVAANYAAQRSELAKASGLGRRR"
FT   gene            complement(73371..73664)
FT                   /locus_tag="M446_0066"
FT   CDS_pept        complement(73371..73664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0066"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14653"
FT                   /db_xref="UniProtKB/TrEMBL:B0UNB0"
FT                   /protein_id="ACA14653.1"
FT                   /translation="MIRLLKHVLIEFGPDRDAEIDAAVAAILATFPEAQIALAPGLLDD
FT                   DLLLEVRIPIARMAEWPLVAGRAQPPSSASASASAHDPADPASARPHHLSSE"
FT   gene            complement(73814..74038)
FT                   /locus_tag="M446_0067"
FT   CDS_pept        complement(73814..74038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0067"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14654"
FT                   /db_xref="GOA:B0UNB1"
FT                   /db_xref="UniProtKB/TrEMBL:B0UNB1"
FT                   /protein_id="ACA14654.1"
FT                   /translation="MSDDAARPGAAGRSARAPGALVLRAARGRSAQMRLAAALLTILAL
FT                   GLLMLAPATVALPVSALLLLAWPLLDRGR"
FT   gene            complement(74161..75255)
FT                   /locus_tag="M446_0068"
FT   CDS_pept        complement(74161..75255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0068"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:bll5531 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14655"
FT                   /db_xref="UniProtKB/TrEMBL:B0UNB2"
FT                   /protein_id="ACA14655.1"
FT                   /translation="MRQILLASLLVLPLGVAAAEAPSPDATARFLAGMPAPPGAMLARL
FT                   ETDPAWKQHAGAFTAAFRTVETRQLGKIRAWSQANLTARRGTVYYLFSGPDFLYADSFF
FT                   PDASTYVLAGLEPVGSVPDPAKLPRGSLASVTRSLRTSLHTVLNFSFFRTLSMRDDLRA
FT                   SPATGTLPVLYVFLARAGKTIRGVEFVHLDPQGTLNAGAAAGAGTPGVRITFARPGGPD
FT                   QTLYYFSANLDNDGFPKSGLAPFCERLGIGDGLVKSASYLMHDGHFSEVRRFLLRQTST
FT                   LLQDDTGVPAAMFGPEWELRPYGRYTGPIGLFAGRYQPRLAELFRRQPPRPLGFGIGYR
FT                   YRPDESSLILATKREAQVLRPTLE"
FT   sig_peptide     complement(75199..75255)
FT                   /locus_tag="M446_0068"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.877 at
FT                   residue 19"
FT   gene            complement(75252..76595)
FT                   /locus_tag="M446_0069"
FT   CDS_pept        complement(75252..76595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0069"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   bja:bll5532 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14656"
FT                   /db_xref="GOA:B0UNB3"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:B0UNB3"
FT                   /protein_id="ACA14656.1"
FT                   /translation="MTEPPTASRPAATITTLAATSIVVADMVGVGVFTSLGFQVKDISS
FT                   GFGLLLLWVIGGAVALCGAFCYAELAAMFPRSSGEYNFLTRCYGPALGFQAGWLSATVG
FT                   FSAPVALAAMAFGQYARAILPEAPPLLLGLGVVWAVAAVHLRGARHSTAFQVGFTLLKL
FT                   ALILAFILAGFARGGGQPISFAPSQLDPAEVLSASFAVSLVFVMYAYSGWNAATYIVGE
FT                   IREPQRSLPRALLLGTGTVILLYVALNAVFLSTTPVAELAGQIDVALIAGRHIFGEEGG
FT                   RVVGALICAGLIPTIGAMTWIGPRVTVAMGEDFAPLAPLARRSAGGVPRAAIVLQAGIA
FT                   SLLLLTRSFEAVLDFVQVCLLLCSFLTVLGLVRLRIVRPDLTRPYRAWGYPVTPAIFLG
FT                   VTLFMMIHLLAVRPLESLAGLLMMLAGLLLFGLAAAQPQGDARKALSQ"
FT   sig_peptide     complement(76518..76595)
FT                   /locus_tag="M446_0069"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.783) with cleavage site probability 0.767 at
FT                   residue 26"
FT   gene            76800..78167
FT                   /locus_tag="M446_0070"
FT   CDS_pept        76800..78167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0070"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bja:blr5533 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14657"
FT                   /db_xref="UniProtKB/TrEMBL:B0UNB4"
FT                   /protein_id="ACA14657.1"
FT                   /translation="MGGQMGSGTGRRLPGEAGPETLVGAWLRAGHRATSLRGAVAVCGP
FT                   VPWPDGPGDAVPSPGAGLLPFRRPTTPAARWRRRNRHVAAAALLAFLGETAACRSLVEP
FT                   SAAPAPLAAAPAPPERSAVLERSATRERAAVESPSAPEERPARAGEVATPAPARRPGFA
FT                   GTTELVAFATAPFPYDGAVPERGPFLDVVRDGARGHRTARGQVLWESETFNDSRVLMHV
FT                   PAGFDPNRPAVLVLYYHGHGAILGRDVLLRQRLPAQVTGAGVNAVLLAPQFAVDARDSS
FT                   AGRFWEPGGFGRFLDEAASRLAERTGAPRGLFATMPVVLVAYSGGFAPAAWSLRDAAGA
FT                   RRVRGVVLLDALYGEADTYAAFAARGGGRFLVSAYTRFTEARNAELERGLARRGVSVGR
FT                   QLPETLAGGATFLPAGPDVTHADFVTQAWAEDPVADILRRLPLDRPSDASLAALGR"
FT   gene            78247..78963
FT                   /pseudo
FT                   /locus_tag="M446_0071"
FT   gene            complement(78979..79770)
FT                   /locus_tag="M446_0072"
FT   CDS_pept        complement(78979..79770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0072"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   acr:Acry_0767 conserved hypothetical protein 245"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14658"
FT                   /db_xref="GOA:B0UNB5"
FT                   /db_xref="InterPro:IPR005226"
FT                   /db_xref="UniProtKB/TrEMBL:B0UNB5"
FT                   /protein_id="ACA14658.1"
FT                   /translation="MTPISLGAADLALAAALVVLDAGLSLALRLDLHRQIALAAARMVV
FT                   QLIGVGYLLRLVFALDDPRATLVLVLAMSLVAAREVAARPEQRFRGLVTEGIGLGGVLL
FT                   ATAATCGLALATAIRPTPWYDPRYAIPLAGIVLGSVLNAASLTLDSLLGGVRRERAAIE
FT                   AQLGLGVPFAEAVAGPVRTAVRRGLLPVINQMSAAGIITLPGIMTGQILAGMDPVEAVK
FT                   YQILLLFLLAGASGLAALATALLARRALTDDRQRLRLDRLA"
FT   gene            complement(79767..80438)
FT                   /locus_tag="M446_0073"
FT   CDS_pept        complement(79767..80438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0073"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: acr:Acry_0768 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14659"
FT                   /db_xref="GOA:B0UNB6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0UNB6"
FT                   /protein_id="ACA14659.1"
FT                   /translation="MSIAARGRTDAPAPGPGREREGPRGLQVEALRSPLAGPFDLSVAP
FT                   GEIVTIAGPSGAGKSLFLRMIADLDVNCGRVRLDGRCRAAMPAPEWRRLVPYVAAESGW
FT                   WGETGAAHFAPGRRGAAASLAARLGLPAGCLDGPVATLSTGERQRLALIRALVLTPPAL
FT                   LLDEPTGPLDPVATASVEAVLRERAAAGTIVLMVSHDSAQSGRLAARRLRMAGRRLEAV
FT                   A"
FT   gene            80661..81881
FT                   /locus_tag="M446_0074"
FT   CDS_pept        80661..81881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0074"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mex:Mext_0020 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14660"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR018721"
FT                   /db_xref="UniProtKB/TrEMBL:B0UNB7"
FT                   /protein_id="ACA14660.1"
FT                   /translation="MSGNGVIGAAERESVLERQRTLKMARSAHAYVRGNTLKFYEWLGT
FT                   LARGTLPEGPPVWICGDCHLGNLGPLADAEGRVEIQIRDLDQTVIGNPTHDLVRLGLSL
FT                   ASAARGSNLPGVVTARMLDEMVRGYALGLAGPAAREGAQEAAQEAAQEPEVVRVVRRRA
FT                   LGRRWKHLARERLKDVEPAIPLGRKFWALEPTEREAIEALFRSEGVRDLVLALNRRSPQ
FT                   AEVRLIDAAYWMKGCSSLGFLRYAALVRIAEPEGRSLALVDLKEAVRAAAPPAPGVRMP
FT                   EDPAERVVAGARALSPALGERMLPARLLGRPVVLRELLPQDLKLDVDQFSREEAVAAAH
FT                   YLARVVGRAHGGQMPEADRAAWREEVLRDRRQADGAPSWLWSSVVELAGRHEVGYLEHC
FT                   RRYAEAA"
FT   gene            complement(81863..82093)
FT                   /locus_tag="M446_0075"
FT   CDS_pept        complement(81863..82093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0075"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14661"
FT                   /db_xref="UniProtKB/TrEMBL:B0UNB8"
FT                   /protein_id="ACA14661.1"
FT                   /translation="MIRRTLLCRALARSAALLAGGAAILAGGAARAAEIRVVSAGGFAA
FT                   ACRALAPDMEPLGTGRRGPADAGRRGQAASA"
FT   sig_peptide     complement(81995..82093)
FT                   /locus_tag="M446_0075"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 33"
FT   gene            complement(82184..82588)
FT                   /locus_tag="M446_0076"
FT   CDS_pept        complement(82184..82588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0076"
FT                   /product="alkylhydroperoxidase like protein, AhpD family"
FT                   /note="TIGRFAM: alkylhydroperoxidase like protein, AhpD
FT                   family; PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   mlo:mll1719 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14662"
FT                   /db_xref="GOA:B0UNB9"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:B0UNB9"
FT                   /protein_id="ACA14662.1"
FT                   /translation="MATVRLWSDGEAEADPRVKAVFDDIRATRGSPFINNFWRGLANQP
FT                   AVLERIWRSLKQVMAADGALDPLTKELIYIAVSTANGCSYCIHSHTAAARAKGMSEAQH
FT                   GELLAVIGMASETNALVTAMQIPVDPEFQA"
FT   gene            complement(82622..83068)
FT                   /locus_tag="M446_0077"
FT   CDS_pept        complement(82622..83068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0077"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: esa:ESA_01819 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14663"
FT                   /db_xref="InterPro:IPR020378"
FT                   /db_xref="UniProtKB/TrEMBL:B0UNC0"
FT                   /protein_id="ACA14663.1"
FT                   /translation="MRSLDEVFDRLPHSAFRRRFGLGAAERDVLRRIGWAGMTAHARDF
FT                   VARRLAPARPDRDGKQTPFRGHPVFVAQHATATCCRGCLAKWHRIPPGRPLTPAEQDHV
FT                   VAALARWLRAQAPELGQAQELGQAPGAGSAPDASVDALPLFRQR"
FT   gene            complement(83466..84094)
FT                   /pseudo
FT                   /locus_tag="M446_0078"
FT   gene            complement(84300..85157)
FT                   /locus_tag="M446_0079"
FT   CDS_pept        complement(84300..85157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0079"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: mag:amb1529
FT                   universal stress protein UspA and related
FT                   nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14664"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:B0UNC1"
FT                   /protein_id="ACA14664.1"
FT                   /translation="MVMRCILVPLAADLDPSPALDAAGRLARRLRAHVTVAYLAPTVEQ
FT                   VLAPLAGLPASSLTVSAIKEGQRLAAAQARERVAAWCGREGIPLADAPERLDATFLRWT
FT                   EVEGDADHALTMLGRIHDLVVVGRPRAGTPFTEAAFDTALFAVGRPVLMVGEAVPDDLL
FT                   RHVVIAWNGSLEATHLVAQSIALLHEADRVTVIEAETARSGETRLADLGAYLHWHGIQA
FT                   DSARVRLAPGETEGEGILAEAARRGATLLAMGAFTHSRVRQLLLGGVTRHVVARAEIPV
FT                   LMAH"
FT   gene            complement(85246..86385)
FT                   /locus_tag="M446_0080"
FT   CDS_pept        complement(85246..86385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0080"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: bbt:BBta_7848
FT                   putative ABC transporter (permease protein)"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14665"
FT                   /db_xref="GOA:B0UNC2"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:B0UNC2"
FT                   /protein_id="ACA14665.1"
FT                   /translation="MGPMRSALTIFWLGTKELRSVLRDTVMLGLVIYSFSLAILMQAQS
FT                   SSQEVRNASVGIVDEDRSALSRRIAGAFLPPVFRRPQPLAERDIVPAMNAGRYTLVLDI
FT                   PPNFERDLLDRRPAALQLDIDATAMVQAGLGASYAQQIILEEISGFLARAGRAGPAPVT
FT                   LASRVAYNPNTETPWFTSVMGIINNVTMLAIILAGAAIVREREHGTLDHLLVMPVRPFE
FT                   IAMAKVWANGAVILVAVAASVEIVVRRLLHVPIAGSVPLFLTGTAVYLFFATAVGLFLG
FT                   TLARSMPQLGLLYLLVYLPLAMLSGSNTPLESMPAWLARILQASPTVHYVAFAQAILYR
FT                   GAGFGVVWPRLVLIALMGGLFLVLALRRFRLAADAAARG"
FT   gene            complement(86389..89124)
FT                   /locus_tag="M446_0081"
FT   CDS_pept        complement(86389..89124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0081"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; ABC-2 type
FT                   transporter; SMART: AAA ATPase; KEGG: bra:BRADO7121
FT                   putative ABC transporter (protein fusion consisting of two
FT                   ATP-binding domains and permease)"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14666"
FT                   /db_xref="GOA:B0UNC3"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0UNC3"
FT                   /protein_id="ACA14666.1"
FT                   /translation="MTRAAPDAGPVARVEGLSHRYGKRRALDAVTLSLPAGCVVGLIGP
FT                   DGVGKSSLLAILAGARRIQQGRARVLGGDIADPAHRAAICPRVAYMPQGLGRNLYPDLS
FT                   IRENILTFARLFGQAGPEREARIGALLAATGLAPFADRPAGKLSGGMKQKLGLCCALIH
FT                   EPDLLILDEPTTGVDPLSRRQFWILIDRIRESRPGLSVLVATAYMQEAERFDWLVAMNA
FT                   GRIVATGSAAALKRATGTHDIEAAFVALISDGAPPAPRAPAPPRPQGAGEPIITARGLT
FT                   CRFGAFTAVDRVNFSIGRGEIFGFLGSNGCGKTTTMKMLTGLLPPSEGEALLFGRPLDP
FT                   GDLATRKRVGYMSQAFSLYAELTVRQNLDLHARLFGLPAAAARARVAELIAECGLADHA
FT                   DHAAEDLPLGLRQRLSLAVAIVHAPDLLILDEPTSGVDPIARDQFWDLLTDLARRRGVT
FT                   IFVSTHFMNEAERCDRIALMDAGRVLATDTPAGLIRARGAASLEEAFIACLEEAAAERG
FT                   AAAGPPAWIAPREAPRAGPARAFSLRRLRACAIRETLELLRDRVRLGFAILGTSFLMLV
FT                   FGFGISTDVNSLTFAVLDRDHSHASRAYLSALRGSPYFEERAPLADDAELARRLASGEI
FT                   AAALEIPPHFGRDLAHGRPTEVGAWIDGARPFVAQTIRGYLSALNESALEDRLLRVPPR
FT                   PGPPAEVALRFKYNQSFNSVYAMVPAQIALQLALIPAILMALAVVRERELGSITNLFVT
FT                   PVTRLEFLVGKQLPYVALAMLNFGLMLAMAELVFRVPLKGSLATLAAGTLLYVTATTAY
FT                   GMLVSTFARTQIAALFGTAILTVVPATMFAGMLVPVSSLAGGARVIGGLFPMTYYLPLS
FT                   VGTFTKGLGLADLAPNLVALALFVPALTGLALLMLPRQER"
FT   gene            complement(89121..90434)
FT                   /locus_tag="M446_0082"
FT   CDS_pept        complement(89121..90434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0082"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   bra:BRADO7122 putative HlyD-family secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14667"
FT                   /db_xref="GOA:B0UNC4"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:B0UNC4"
FT                   /protein_id="ACA14667.1"
FT                   /translation="MTTSPPAEASPEVSVRPDGPASAARSLVPVPPPPAAAPRPVPRIP
FT                   AARRALRFAVLAALLLGAGGGGYAWWRAHQPWLPAGFAQGNGRLEADEIDISTKFAGRL
FT                   AQVLADEGDLVRAGQVVAVMDTRDLQAQMGQAEAMAGQAAQAVEEADRTLAQQETAIRS
FT                   SEATVARAQRALDEANANLQQEQSRLRLAKQELARTSTLVGKGFATHETLDTRQQVVDV
FT                   ALAAEAAARARIGAAEHALAAAREAAAGAVAARDAAAARVGATRHALDAARHSVDFYRV
FT                   NIADNSLTAPRDGPIQYRIANVGEVLAAGGKVLTMLDAGYVYMDLYLPTAEAGRVTLGA
FT                   EGRIVLDAYPDHVIPAKVVFVASRAQFTPKTVETRDERDKLMFRIRLRVDPERLKGREA
FT                   LVRAGLPGIGYVRTDAAAAWPARLAPSAPPSLPLASAR"
FT   gene            90746..90961
FT                   /locus_tag="M446_0083"
FT   CDS_pept        90746..90961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0083"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14668"
FT                   /db_xref="UniProtKB/TrEMBL:B0UPQ4"
FT                   /protein_id="ACA14668.1"
FT                   /translation="MRRFTVDFRKVVSDDTGHERCVLQWTCVVRGFSEAQAIREAKLML
FT                   CHSLGVADWRVRADSCQAREIADKVA"
FT   gene            complement(91153..92223)
FT                   /locus_tag="M446_0084"
FT   CDS_pept        complement(91153..92223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0084"
FT                   /product="PHA synthase subunit PhaC"
FT                   /note="KEGG: eba:ebA6212 PHA synthase subunit PhaC"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14669"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B0UPQ5"
FT                   /protein_id="ACA14669.1"
FT                   /translation="MTAWLDEMRRQTGRMADALGYGPQETPWRSVADLPGAQLRAYHAR
FT                   EREDGPVLLICPAPFKRPYIWDLMPPVSVVRRCLARGLRVYLVAWRDPAAPEDRWGLAD
FT                   YADRIPSEALAAIAAETGGAAPILAGHSLGGTLAAICAARHPGAVAGLVLLDAPLAFGE
FT                   AGGPLARAAREIPDLAGLRATLGDPVPGSVITALSLQAAPEVFRLQPALDLAACLGDPL
FT                   ALAVHARVARWALDEFALPGPFFEDVLAQLYREDRFLAGTLRVGAHRVGLAGVRAPILA
FT                   VLNPSGLIVPPESLRRGLAAVAGPPAELLTYEGEPGPMLQHLGPLVGPAAHARLWPGIL
FT                   DWILRRAAAPGAADPA"
FT   gene            complement(92379..94193)
FT                   /locus_tag="M446_0085"
FT   CDS_pept        complement(92379..94193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0085"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter transmembrane region; ABC
FT                   transporter related; SMART: AAA ATPase; KEGG: xac:XAC3744
FT                   ATP binding transporter 1"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14670"
FT                   /db_xref="GOA:B0UPQ6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B0UPQ6"
FT                   /protein_id="ACA14670.1"
FT                   /translation="MRPEAGAAGIAEEGAGPAHLQSGGRFILRHLRAWRWHFGLLFLLV
FT                   VACASCGVGQQVGLKLLVDALAGPPELGRAALAALALFLVLIALEAALARLTGWLTCRT
FT                   TVGVGVDLRAELFDHLGGQAMRYFAENLAGSLGQRITATAGNVGALVNTLVWRIVPPVV
FT                   DVAGAVVVFASLDGFLTLALVALILVVTGGLIWFGARGRPLHRAYSGEAATIAGDLVDT
FT                   ITQMWTVKAFSARSRERARLEAGFRREAAAQRRSWLYLEKARLIHDVALWVLAAGILSW
FT                   TLVLWSRGGASAGSVVLVASLTLRILHSSKDMALSLVDLAQHFGFIEETLAVIAKPCTV
FT                   RDAPAAPALRSRGGAITLANVTFAYGPGRPALREVSLTIPAGQKVGIVGPSGAGKSTLV
FT                   QLLQRLHDVDEGEIRIDGQPIAGVSQDSLRAALAVVPQEIGLLHRSVMDNIRFARPEAS
FT                   AEAVCAAARAASCDGFVRRLPEGYDTIVGERGARLSGGQRQRIGIARALLKRAPILLLD
FT                   EATSALDTETEMAIQAALVRLMRDHTVIAVAHRLSTLTAFDRILVVNEGRIVEDGTVRD
FT                   LRQAGGLFAQMWHLQAEGLSGEAVMDAA"
FT   gene            complement(94183..95361)
FT                   /locus_tag="M446_0086"
FT   CDS_pept        complement(94183..95361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0086"
FT                   /product="beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase"
FT                   /note="KEGG: psa:PST_2889
FT                   beta-glucosidase/6-phospho-beta-glucosidase/beta-
FT                   galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14671"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B0UPQ7"
FT                   /protein_id="ACA14671.1"
FT                   /translation="MICPPMICPPTRAPAPGSPFGSVFLGGFECSTHRRADGRRLDLLA
FT                   ATGHDRHALADYRALARHGLLAARDGLRWHRIEAEPGRYDWSSALPLLEAAREAGMRVI
FT                   WDLCHYGWPDDLDIWSEAFVSRFAAFAAAAARQVRAVSGAPPFLCPVNEISYWAWAGGE
FT                   VGRIGPCATGCGAALKRQLVRASLAATRAVREVEPEARFPHAEPAIHVVGGPEAGSAAA
FT                   AAAYREVQYEALDMASGRLAPDLGGGPDALDVVGLNFYPDNQWVHGGGTVPLGHHAYRP
FT                   FRALLAEAHARYGRPLLVAETGAEGSARPAWLHYVCGEVRAARAAGVPVLGICLYPILD
FT                   YPGWENERPCAVGLLSAPDEAGARRTDGPLAREIREQRARFAGSAQEETDAA"
FT   gene            95754..96992
FT                   /locus_tag="M446_0087"
FT   CDS_pept        95754..96992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0087"
FT                   /product="glycosyltransferase"
FT                   /note="KEGG: psa:PST_2891 glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14672"
FT                   /db_xref="GOA:B0UPQ8"
FT                   /db_xref="UniProtKB/TrEMBL:B0UPQ8"
FT                   /protein_id="ACA14672.1"
FT                   /translation="MRLTSSITGAAPGLLDDQPVEPPLLPPEGAARGLLVCFSHLRWAF
FT                   VWQRPQHLLTRAARHFDVLFVEEPVFEPGGSDRLRVEAVAPGIDVAVPVVDPARACAAD
FT                   PIQAQLIGDHLRRREAAARVFWYYTPAAISVSAELPRDLTVYDNMDELSAFRGASPDLI
FT                   AQEAELLSRADLVFTGGRSLYEAKRGAHPSVHCFPSSVDAAHFRQARDAARPDPGDQAA
FT                   IPHPRIGFFGVIDERLDRDLLGALADLRPDWQVVMIGPVVKIDPESLPRRANIHWLGSK
FT                   PYAALPDYLHHWDLGLMPFARNEATRFISPTKTPEFLAAGLRVVSTPILDVLRDYGEAG
FT                   LVAIADSPRSVALSIEALLAQPRQAWLERVDRHLAGGSWDRTYEAMHALMRAGLRRREA
FT                   ASPALLHSAASPA"
FT   gene            97022..98194
FT                   /locus_tag="M446_0088"
FT   CDS_pept        97022..98194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0088"
FT                   /product="UDP-galactopyranose mutase"
FT                   /EC_number="5.4.99.9"
FT                   /note="KEGG: dge:Dgeo_2530 UDP-galactopyranose mutase;
FT                   TIGRFAM: UDP-galactopyranose mutase; PFAM:
FT                   UDP-galactopyranose mutase-like"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14673"
FT                   /db_xref="GOA:B0UPQ9"
FT                   /db_xref="InterPro:IPR004379"
FT                   /db_xref="InterPro:IPR015899"
FT                   /db_xref="UniProtKB/TrEMBL:B0UPQ9"
FT                   /protein_id="ACA14673.1"
FT                   /translation="MYDWLIVGAGFAGSVLAERLASRRGERVLIIDRRNHVGGNAYDRL
FT                   DEAGVLIHQYGPHIFHTNAEAVVAYLSQFTAWRPYEHRVLAQVDGMLVPIPINLDTVNR
FT                   LYGLSLTSEELEAWFAARAEPVTEIRTSEDVVVSAVGRDLYEKFFRGYTRKQWGLDPSE
FT                   LDRQVTARVPTRTNRDDRYFTDTFQAMPAQGYTRMFERLLAHPNIHVMTNADYRSVRDV
FT                   IPHRRVIYTGPIDEYFDFRFGRLPYRSLRFVHVTRDADCHQPVAVVNYPQGEAYTRITE
FT                   YKHLTGQEHPRTSLTYEYPCAEGDPYYPVPRAENQALFKRYERLARAEPDVWFVGRLAT
FT                   YRYYNMDQIVGQALATFRRLDEALGGPAQRIQPAPRATPRRPAAALPPAE"
FT   gene            98272..99786
FT                   /locus_tag="M446_0089"
FT   CDS_pept        98272..99786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0089"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afw:Anae109_3225 glycoside hydrolase family 5"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14674"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B0UPR0"
FT                   /protein_id="ACA14674.1"
FT                   /translation="MTDDRALDPDCSLADGPSPSPRPDPAPARTAGARGGRLPWIRVAG
FT                   PGIPYFETETGAAWTPVGQNDAISWHELEGLFGRRDLAAAEAHLRHLADHGVTCLRLML
FT                   EYAQVRHRYIERPVGRFVPAMVRLWDDLFALCETVGLRILLTPFDTFWMWLHWHRHPYN
FT                   RRHGGPLAEPSRFLLDPQVREAIKNRLAFAVARWGGSGALFAWDLWNEIHPAHAEGSAE
FT                   GFAPFIADLSRHVRALETRLYGRAHPQTVSLFGPELGWRPHLGLEEPIFRHPDLDFATL
FT                   HIYAEGTIDDPRNTVEPAIAMGRIVREGLAQIRDGRPFLDSEHGPIHSFKDRRLTLPEP
FT                   FDDEYFRHMQWAHLASGGAGGGMRWPNRHPHSLTAGMRAAQRGLSGFLPLIDWRRFRRR
FT                   NLSGDLGDPGPGAALFACGDAEQAVIWCLRADSLAPDGRLRRDAAPLGIRLALPGLRAG
FT                   RYALTAWDTRAGRPCGRREVTARDGVATEIEPPPFVTDVALAVRRV"
FT   gene            complement(99870..100403)
FT                   /locus_tag="M446_0090"
FT   CDS_pept        complement(99870..100403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0090"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="PFAM: cyclic nucleotide-binding; KEGG: syw:SYNW2108
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14675"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:B0UPR1"
FT                   /protein_id="ACA14675.1"
FT                   /translation="MRKVLYLFGILTDEDVAWIARTATRRALRDGEVLIAEGDRTRSLI
FT                   LILDGVLAVTAEGHGEIARLGVGEVVGEVSLVDSAPASATITARGPGAALFLDREVLQR
FT                   RLDADIGFAARFYRALAMFLADRLRAARPPRPGIGLADDGALSPDELDPAIMDTVFVAG
FT                   ERFNRMIGLLDARP"
FT   gene            complement(100415..103360)
FT                   /locus_tag="M446_0091"
FT   CDS_pept        complement(100415..103360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0091"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ava:Ava_1128 ABC transporter, transmembrane region"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14676"
FT                   /db_xref="GOA:B0UPR2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022515"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B0UPR2"
FT                   /protein_id="ACA14676.1"
FT                   /translation="MSEPLAKGGLALVGPAGAQAPLPAAPVPAQAPLPAAPVPAEAPAQ
FT                   PLDGRRPERLASLGAPLVVASGHADLFALRSRDGAVAGPRRHLLRIESGGIILPVPADA
FT                   GAGGERLEIIAVGTPGTAVREAAQAEIGPLCEGWVLGLAALVAGPHPAWDIREAASGEA
FT                   LEPGERRRGPARALRWVVVEEGSAAIAGQAPAYRPGDPPAPLGAGLWAQAGPEGCRLSP
FT                   CAAPEGDLLALAVDRFHRAAAAALHGEAAGQPTRDAARLARRADLDAARAAELFGRLGS
FT                   IVVRRDAPPAAVDPEDPLMAACALVAGTMAAPLTRPAGRVRTARDYRDVVEIARASRLR
FT                   VRRVLLRAEWWRQDAGPLLAWRGEAGAPVALLRERRAYLMVDPATGERRRVDAALAAEL
FT                   GPEAAGFYPTLPGRALSFRDLLAFAARRARGNLASVAVPAVLMGLLTLVVPLITQALVN
FT                   SAIPRSELDQITVCAIALAVTALAAAAVQAAESLAMLRLEGLIDWTLQAAMIDRLLRLR
FT                   AALFRDHTVGDLVDRAMGIDAVRRLLTGRTLRSLLAGMFGLFSIALMLVYDPVLALIAV
FT                   ALALLRGVLILAASGLRLYHESRAFNGQGRVQGFVLQLFAGIGKLRVAGATVRALAVWS
FT                   RLFTEQKGHFLAAQRIANGLSIAETALPTLATLAIFAAASTLGSTLTQNLGAFLGFFAA
FT                   FGQTMGAIGAFAAGLSEALVAIPHLTRMRPLLAAEAEIADDRKPPGDLSGAIEVSRLTF
FT                   RYGASGPPVLDAVSLRIAAGEYVAIVGPSGSGKSSLLRLLLGFEAPESGAVFYDGKALD
FT                   TLDVSAVRRQLGVVLQNGRLTTGSLYENICGGVQLPLEQAWEAARMAGLEGDIRAMPMG
FT                   MHTVVAEGVNTLSGGQRQRLLIARAIARRPRILLFDEATSALDNRSQAVVSASLGALNV
FT                   TRIVIAHRLSTVREADRIVVLAEGRIVQSGTFDDLAAAPGLFADFARRQLL"
FT   gene            complement(103357..105540)
FT                   /locus_tag="M446_0092"
FT   CDS_pept        complement(103357..105540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0092"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter transmembrane region; ABC
FT                   transporter related; peptidase C39 bacteriocin processing;
FT                   SMART: AAA ATPase; KEGG: pth:PTH_2380 ABC-type
FT                   bacteriocin/lantibiotic exporters, contain an N-terminal
FT                   double-glycine peptidase domain"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14677"
FT                   /db_xref="GOA:B0UPR3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022514"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B0UPR3"
FT                   /protein_id="ACA14677.1"
FT                   /translation="MSAAALRRLLPWPGRGRPPATPTVLQMEAVECGAAALAMVLAHHG
FT                   AFVPLEQLRVACGVSRDGSKASNIVKAARGFGLAAKGFRKEPTTLHDLPMPCIIHWNFN
FT                   HFVVLEGIRGEHAFINDPAMGRRRVTMQELDLAFTGVALAMEPTEEFRRIGRKPQGFRL
FT                   LLRELGASRAAVGLLVAVSLALIVPGILIPGFTKIFIDEILIQNTPGWLTPLLIGMGLT
FT                   ALFRAGVTALQLSLMTRLQTKLAVVMTSRFLWHVLALPMEFFAQRHAGDIANRVSTNEQ
FT                   IARLLSGGLVSNALSLTSLVFFAAAMAVYDLLLAVIGVALSLLNVLALHLIGRRREDLS
FT                   RSLAMERGKLLGSTIGAVRTIETLKASGLEDEAFGHWAGIQARALNAEQELGATSAWLD
FT                   TVPTLLSGLTTAAILGIGGLRVTEGSLTLGGLIAFQSLMASFSEPITALVGQIGSIQII
FT                   KGGLERLDDVYNYPVERPEPDPALPPPPPRLVGRVELVGVSFGYAILEPPLLQDVSITI
FT                   EPGSRVALVGLSGSGKSTLGRLICGLNRPWSGEVRLDGRRLADIPPEVFAQSVAYVDQD
FT                   IVLFEGSVRDNLTLWDPTVPEPDLSLALKDAAVHGEVATRPGNYDGHVLEGGANFSGGQ
FT                   RQRIEIARALVQNPSVLVLDEATAALDPVTEKIIDDNLRRRGCTCIIIAHRLSTIRDCD
FT                   EIIVLERGRIAERGRHEELLAREGAYAALLAQS"
FT   gene            complement(105547..106815)
FT                   /locus_tag="M446_0093"
FT   CDS_pept        complement(105547..106815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0093"
FT                   /product="membrane-fusion protein"
FT                   /note="KEGG: pth:PTH_2381 membrane-fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14678"
FT                   /db_xref="GOA:B0UPR4"
FT                   /db_xref="InterPro:IPR022275"
FT                   /db_xref="UniProtKB/TrEMBL:B0UPR4"
FT                   /protein_id="ACA14678.1"
FT                   /translation="MSSSPQRAFRPIALERAASPEQLDHLVRITKPADWILAGTVALLL
FT                   VSALTWSVVGRVPTRAAGEGILVSVGGRVVDAVSAASGRLAAIEVAAGDRVVQGQPVAR
FT                   IAQTDIEERHRAAVEVHREREREHATLRAKVKDELAAKARNFAKLEEAFDQIVHATDQR
FT                   IEYLSTEVRNLETLLGKGITTRRVVEDRRRELTEARQRREDAQNEVLKLRTQKTDLETQ
FT                   RERELQDSQFRLNDTRRQMEQLAGELGRNTQVLSPIDGRVLEVKVSPGSVLTVGMPVIA
FT                   VESEGKALEAVVYIPADKGKTVKPGMETRLEPSTVKREEYGTLVGSVVSISDFPITPQG
FT                   MAAVLHNDRLVSRFSQEGAPYAALVRLQPDPATASGYAWAVGRGPDLRLTSGTLVRAEI
FT                   TTRQHRPLDLVVPMLKRLTGLAG"
FT   gene            107063..107590
FT                   /locus_tag="M446_0094"
FT   CDS_pept        107063..107590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0094"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14679"
FT                   /db_xref="UniProtKB/TrEMBL:B0UPR5"
FT                   /protein_id="ACA14679.1"
FT                   /translation="MRSALGADRRRARPARPPRPAALAALLLLALPPGAVARVLSDGDL
FT                   ASVARIKPLFTAVLSDVARSAQSPDLSAPDGDCLRSTLRSLMQISDELKGYESLITIEG
FT                   EITDFGDDESLRSVLRFAVENALKILDTERRRLGELSDTCSRSPLAAGKTRQALQFIDS
FT                   TQAILRAVQPRL"
FT   sig_peptide     107063..107176
FT                   /locus_tag="M446_0094"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.985 at
FT                   residue 38"
FT   gene            107692..109647
FT                   /locus_tag="M446_0095"
FT   CDS_pept        107692..109647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0095"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: pde:Pden_4198 radical SAM domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14680"
FT                   /db_xref="GOA:B0UPR6"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR023984"
FT                   /db_xref="UniProtKB/TrEMBL:B0UPR6"
FT                   /protein_id="ACA14680.1"
FT                   /translation="MTFSEQVLLVVPPVLYPGIPTLGPSVLVPALRRAGLSARVHYANL
FT                   AFAARFGFDLCARIAGSRTLIGEAIFLGAAFPEKAEALERILALLRQDAEADAKLRQLV
FT                   RPAAPEDEEVARVVAAIPDFIAETARRLVAGAPRIVGFSTMVQQTMASIALAREVKRLR
FT                   PDIVTVLGGANAAEPIGSALIELTGVFDAVFSGESDIEFPRFCRRLVDEGTLPATRIIR
FT                   GRGIPRLDDVPAPDYDDYFAELAPLKATDPVAATAPHFLIFESSRGCWWGDKKTCTFCG
FT                   YNFPGTQYRAKSPERVVSELEGLIGRYGVGKFYASDNIMAKDFPKGVLDALAERGTPCA
FT                   LSYEVKSPIRPEDLDRFVRAGIFEIQPGIESFSTRILKSMDKGVSGIDNIRVLRDATTR
FT                   SLRVIWNILTAIPGETRADYEEMLPLLPLLEHLRPPTRWGPIRISRYSPYHNEPERFGI
FT                   TGLRAWQAYYELYGDYAERIALHFFGEYRTEFMDAPDLVAALDRQVQAWTEAWAAPGGP
FT                   PRLSLQRLGGGWLQVTDTRRCAKVGACLLAPDLARVLDSVQMPVSEPRVPEADRERLGH
FT                   LVSLGFVLRHEQRYVSLVTEPALGEALIAEREQSLARRAAAESPASPLPAFSLGALRVG
FT                   TERPVLVPEHGETLRL"
FT   gene            109718..110083
FT                   /locus_tag="M446_0096"
FT   CDS_pept        109718..110083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0096"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14681"
FT                   /db_xref="InterPro:IPR023811"
FT                   /db_xref="UniProtKB/TrEMBL:B0UPR7"
FT                   /protein_id="ACA14681.1"
FT                   /translation="MNREKGHPVQATVTCIRGTCNAGHRVGDVLPVSARNTAGMCGYLY
FT                   HAAHPAILMLQFGGAVPWGPADRVVLNCPDPVNLLTVELRRLPEGVPGEAPAAEAAPAS
FT                   AEAAPVRLGRVVCRVEG"
FT   gene            110083..111204
FT                   /locus_tag="M446_0097"
FT   CDS_pept        110083..111204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0097"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: saq:Sare_4565 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14682"
FT                   /db_xref="GOA:B0UPR8"
FT                   /db_xref="InterPro:IPR017795"
FT                   /db_xref="InterPro:IPR033964"
FT                   /db_xref="UniProtKB/TrEMBL:B0UPR8"
FT                   /protein_id="ACA14682.1"
FT                   /translation="MGAATRFEAAARTLRAVAAAAGFPPAAREEAVACARLLAASWADE
FT                   PLAAPPPWSGLGADASGFDASLVLDGTRREVRVTVEAQGRPATPARYLAAARALSEHLA
FT                   ERHGADLSRLASLLPLFARPDPRAAGVLWHGAVLAPGRAPWFKVYLHLMAPGRARARAT
FT                   AEAALDRLGLAPAWPGLAARLAPEDEPLFLSLDLVPGPEARVKLYVRHGWAGPETLAAP
FT                   HDPAFSGEVLAFVRGLAGDGPIRRGALTAFHLRPGRAEPSHVTTHLRLYPHCARSDAVL
FT                   AARLTRALDRLGLPAAPYRAALAALAPGGLDGEEGLHGWASLQRHGARPAVSVYVSPRL
FT                   YLARFGPVALDPERLWPSPVPAAALREDACASP"
FT   gene            111189..113339
FT                   /locus_tag="M446_0098"
FT   CDS_pept        111189..113339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0098"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: rca:Rcas_2450 radical SAM domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14683"
FT                   /db_xref="GOA:B0UPR9"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="UniProtKB/TrEMBL:B0UPR9"
FT                   /protein_id="ACA14683.1"
FT                   /translation="MRVALIFPPATDPRAPHLGLPCLAAVLREAGIRTDLIDADIGGLT
FT                   ALLGAESVAASLARLRRGGARDGGAARLLARGEALVEAVPRALATLRDPERFYDVHAFH
FT                   AARETILDGLDLVSAAAPRPVRYDLCPIRYEVEGVDEQSLGDLIAVTADPDANLFEAHW
FT                   RSDLFPALDADRPDLVGISIVNRQQILPGLTLARRLRARGLFVVLGGTVFTKFVSELLA
FT                   RPDFFAHFADGVIAYEGETAILELAAQLDGARDFAKVPNFLHVAEGRVRMGPTHVEDVD
FT                   ALPTPDFAGLPLAGYLAPAPILPILVGKGCYFNACKFCDIPFINHVSRKPYRIRRPERI
FT                   AQDILTLNARFGCRHFEFTDEALPPRLLDGVADALGAEAASRGLSFTGYARLEPGFTAP
FT                   LCAKLARMGFRKLFFGLESGDQATLDHMRKGIRLENVRPVLGHCREAGIHFHVFSIIGF
FT                   PEETEASARRTLGFFEDHADLIDHPGNSFDLHPFGLELRTRYFAEAEALGLGLPREALA
FT                   KDFVIGLRGGWDNSRGLSEARVIDLVERYNTVLRRLFARFHNAPMHLWPGFEEYALLYA
FT                   SRYPEGAFPYRTALPEAGVPFRLTWNPAAALLRRDGRVQVASRWKAVELDERAFRALGA
FT                   ERVRTMQDLIRDCVAAGLVRPDDAPEERLRGALHDLIGHRLLQLVLAQPGPAESRADRR
FT                   HASELCAMEPQAPEAELAGSTW"
FT   gene            113336..113770
FT                   /locus_tag="M446_0099"
FT   CDS_pept        113336..113770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0099"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14684"
FT                   /db_xref="UniProtKB/TrEMBL:B0UPS0"
FT                   /protein_id="ACA14684.1"
FT                   /translation="MNLDSSVAYQLSKEYYCFVVPSKIGRGRMSEQNQQPNGLVITDGG
FT                   GNYYYLRPEILAQTKMPDEDVQKLKSGLAASSAGKDEELSGAALEAVAGGAGIGGGIQL
FT                   PGVVQIPSFNIGSLTASLTHSKPGLPDLGKVMSSTVMCPW"
FT   gene            113841..115958
FT                   /locus_tag="M446_0100"
FT   CDS_pept        113841..115958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0100"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: rca:Rcas_2450 radical SAM domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14685"
FT                   /db_xref="GOA:B0UPS1"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034466"
FT                   /db_xref="UniProtKB/TrEMBL:B0UPS1"
FT                   /protein_id="ACA14685.1"
FT                   /translation="MARVALIYPPGGDPRAPRLPLPALAAALRPAGVAVDLFDLDLEGV
FT                   LALLRPERLRRAAAALAARPRPEPDSALGRLAALAPDLPDTIEDALATIRDPVRFADPW
FT                   RLNAARERIYDALDLVSAAAPRRLRYQTEVLRYEVEGVDPSRLSDLLAVTADPAANLFE
FT                   EHWSEEVFPRLEAGGAYDLVGISLTLRWQLIPGLSLARRLRARGHRVVLGGTAIAKVGE
FT                   ALAGCPAFFAAFAEAVVTREGEAAMLALLDALAGDGDLGRVPNLLYRAGDRVVATPTRV
FT                   EDYAANPTPDFDGLPLDRYLSPHLVLPVMLGKGCYHDECSFCDIPFINRISPKRYRLRR
FT                   PETVAEDIDHLAERHGCRHFLLADEALPPRVLGRVAEALEARGRTDCVFSGYARLEPGF
FT                   TRDLCDRLARVGMRRLYFGLESADQDTLDRMRKGIRVEHAAPVLRHCREAGIRFHVFSI
FT                   VGFPGETEASARRTLAFFEENAELFDDPGCTLDVHELEILTDTPYFADPDAYGIRFLVP
FT                   TEGRDFLFGVGTAWESTPGLTRPQIAALLDEAGARLGPLLARCHAWPPVLWPAPEEWAL
FT                   CAAGAWFGRDLPDRLDLPGPADPRRLRLAWNPAAWVRREGGLCRIASRRGALVLDAEWF
FT                   RRLGETPGFRTSAEILRDLAGPGASPDDLRRTRDTLTALLRQRLLELHPEPEPATEAQI
FT                   PRPRLPEAACA"
FT   gene            115951..116352
FT                   /locus_tag="M446_0101"
FT   CDS_pept        115951..116352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0101"
FT                   /product="uncharacterized conserved protein"
FT                   /note="KEGG: scl:sce8752 uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14686"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:B0UPS2"
FT                   /protein_id="ACA14686.1"
FT                   /translation="MPDALAPDRPGAAGWFGPRPVEPLTACGETVAVVRKKALLRLLAR
FT                   REAARLGLRATPEQVRETESQFRLCFGLAAAEDLAGWLAESGLDPAGFAEAMRDFTLVR
FT                   LLEESLAPEIDRLAAAQVAVGTARLRPGA"
FT   gene            116357..117265
FT                   /locus_tag="M446_0102"
FT   CDS_pept        116357..117265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0102"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6342 putative protein; putative
FT                   signal peptide; putative O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14687"
FT                   /db_xref="InterPro:IPR023809"
FT                   /db_xref="UniProtKB/TrEMBL:B0UPS3"
FT                   /protein_id="ACA14687.1"
FT                   /translation="MARAGRSWLQVNVGLSRERGSALPAARALLGEIGDALPGWRRTRL
FT                   LSAFLFQRKPPDLRLRFRGDRDRLLAELRPILARHVAEGRVTRHFVSVYEPEARLFGGA
FT                   QAMEAVHGFWEADSRLWIAVDRLIAEKALTIPYPSLLTAILNETAWRSLGDGAEVWDTW
FT                   CNLLVLLRAPAEGAPAGDAPPLPASPPIHLDGLRTSAGPAEAAILDAYGEAAGQLAAGL
FT                   LRSWERGRLACGLRALLATAALFTLNRHGFGQARAVPLVRAVAASWDGRSLLRGALPEP
FT                   HPGAFHPARHPDRGAIRQGAG"
FT   gene            117262..119850
FT                   /locus_tag="M446_0103"
FT   CDS_pept        117262..119850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0103"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce9070 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14688"
FT                   /db_xref="InterPro:IPR006827"
FT                   /db_xref="UniProtKB/TrEMBL:B0UPS4"
FT                   /protein_id="ACA14688.1"
FT                   /translation="MSAVRGLGPAILRVAGWPIETLAPLRAAALTNRVDAWIARDEALL
FT                   REGAALAGEVRAALRGAEDPARRGALLDLARALRRSARPLPAAAVGRLWGDPSLGEAVR
FT                   GAAASRLAHAAERAGIDAAHAAELARAGAALEAVAREERFRRALCLASPSVFRRLTDPP
FT                   GDARGRRRLAASLHRYLMRAVGRATPNGLWAGIVLEDAGGGEDVGGGEDARWCARGPLA
FT                   VAPAPAVTRVAPVLHLFARILEARGRARPWIDATAWRLNPTLRRAGAAWLFGTVAEGIW
FT                   VTRQVADHAPLGHLRAALAPGEEAAPDAIADALRRRDPALPDETARAWVEAWIGAGILS
FT                   PSTALPGFYADPWQALDGIVAALPAGEAESWRAVRAALARIAAEIEAGIETLSAEALRA
FT                   RLDAARAPVAALLAGYGLALPDGADVLALDRTAPFRFALSRDLAAAIEARIRAAWAFDR
FT                   FGLGAVEAEIETERLFGPIAPGCTVPLGDFLAPEAEAEAGLGRRARTWEERAAAPPGSD
FT                   LARRAREAFGRWERVLAPDPAARRLALPEPEPEPEPGPGGEPLPAGSALLLVDADGRLR
FT                   LGGITPEPAFFHGRFAALLGAALDGSDAFLDWLRGALRGIEARHPVRFCDIAIRNHRAP
FT                   NVTARPASARRALDPLAGGGEALRGLGIGRDARGRPALHAAGLPERLVPAARTAASLAG
FT                   LDRIAWLLSSVSLCLGRPSLMAPIPPLAREVAEWRHLPRLLLGETVLGPERWTPREAVG
FT                   AGLAAARGAERFVIWRRFAREAGLPALLYAFAGRGETEVLLAADSPLAIDLLGQDLAAH
FT                   GPALRLQELLPDPSGFVVRDEAGRRYLAELAVAWAGDDAFWAGLAPAAEA"
FT   gene            complement(119917..122865)
FT                   /locus_tag="M446_0104"
FT   CDS_pept        complement(119917..122865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0104"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mex:Mext_1370 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14689"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR031482"
FT                   /db_xref="UniProtKB/TrEMBL:B0UPS5"
FT                   /protein_id="ACA14689.1"
FT                   /translation="MLAALLAAGGGAARAEAPTAPVGVIQLDERRAPVILGRDGAPAED
FT                   AEIVDESALRFYAAQRQSDRVQAEIARLRRRYPNWKVPADLDSIRPSPPEEAPMWDLFT
FT                   AGRFNDLRAAIAARQASDPGWQPSDDLARKLNRGTLRSEVKAAAREGAWPEVIARVRAV
FT                   PEAMRDLDIDIAWLVAEAYARGGDPGQAASLYRGILAGQKESALRLATIQKAMATLPIG
FT                   QVEPLLALGQPAADGSNEFAALRLDVTRARIAAILHDEPVGRIEPADLAALSDHVRKLG
FT                   EPDQFSLLGWYAYKRRQFREALDWFKGAIARGGRATVATGLALSLREVGQERDAEEVAF
FT                   AWREGSVTNTALYMDLLERRLTQSPVAPLEAPRLDRFAKLVLATGSGEGAQALGWYAYN
FT                   ACQFDAAAEWFERASAWKPREAAILGYALSLTRQKRNREFLEIVNRYDGLFPKVVGLLF
FT                   TAQDEGADPGPCAPPRSGPAPQRAALTRPAAPRVPKPTAAAPETVLPVRRGEFPQAVAP
FT                   ENPLRFTAQPAGEKGGERDALRDLRAGPPPLVARRVPGVGPMPYERYGYALLPSWNGSD
FT                   RASPQDGLPPPAVGTIAQAEGAAAPAGPARPTQTRDGRSLRPLRRAARRDAVSAASGSP
FT                   MTSPRPSLAAASLRMVALAAAAASLAACTASGSGRRVLRGAESATSFSSLNGSARSQAL
FT                   VHLPGAEAGQSIQVDGYSQGLRQRISFGPRGGGGEGWIDLALRRRGAVDGPAMAKPTRS
FT                   GIAAELAALAGGSGYRISSRPARNAYGPMGFAQNERCVYAWQWIEAVPSLGAAFPPAAS
FT                   PVTASLRIHQCRRAGTPSEALIENLARLRLGSDGPVPADAPPRRRPASRRVLAAAPAAV
FT                   PPAAAVPPAMAAAPVAPRPAAPDRAATPTYLAPPAGPPAAASLAPPAVPRPGPAGATLA
FT                   QPRFITDTLPTPGIGRMPEAAPAPRPPARAEPISGELPAQAYRGPAPPPFGW"
FT   sig_peptide     complement(122818..122865)
FT                   /locus_tag="M446_0104"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.888) with cleavage site probability 0.887 at
FT                   residue 16"
FT   gene            complement(122895..124076)
FT                   /locus_tag="M446_0105"
FT   CDS_pept        complement(122895..124076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0105"
FT                   /product="Cellulase"
FT                   /EC_number="3.2.1.4"
FT                   /note="PFAM: glycoside hydrolase family 8; KEGG:
FT                   mex:Mext_1369 cellulase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14690"
FT                   /db_xref="GOA:B0UPS6"
FT                   /db_xref="InterPro:IPR002037"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:B0UPS6"
FT                   /protein_id="ACA14690.1"
FT                   /translation="MRSFLRLAATILILGSAALGGARPGLAQQPGAAEPPPRARDAKNR
FT                   DGESRTGENRTGEPASLHNALGNGAAWRAYKARFVTDQGRVVDTANGRISHSEGQGYGM
FT                   LLAVAAGDRDAFQRIWDWTRANLMVRDDSLLAWRWEPDKRPGVADMNNATDGDLLVAWA
FT                   LIEAADAWQDEGYRLAARRIAVDIGRRTVLFRSEGAALLLPGMAGFSAEDRADGPVINL
FT                   SYWIFPALARLPAVAPEFDWARLSAAGLDLALRARFGEAALPVEWTSLRGGEPKAAAGF
FT                   PPVFSYNAVRVPLYLAMAGIAERRYYAPFVKAWAEVGASGLPVVDTASNDVVGRMQEPG
FT                   YLAVAALTACAAGTASLPPALPDPTSPQNYYPATLQLLALAAVNMRYASCLGR"
FT   sig_peptide     complement(123993..124076)
FT                   /locus_tag="M446_0105"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.976 at
FT                   residue 28"
FT   gene            complement(124073..126649)
FT                   /locus_tag="M446_0106"
FT   CDS_pept        complement(124073..126649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0106"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mex:Mext_1368 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14691"
FT                   /db_xref="GOA:B0UPS7"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR018513"
FT                   /db_xref="UniProtKB/TrEMBL:B0UPS7"
FT                   /protein_id="ACA14691.1"
FT                   /translation="MTAQPRLPDLLPIPAAPVGAALRRIAGTSLIGLALLLPQGAGAQS
FT                   FLGRGAPQVLSVPDAAGAAPGRPAEAAPAPEGAAVPAPALLPQRPLPAGRSGLRLSGEE
FT                   SGLQWSVYLTEAEAREHLRFRIGYLAAISVVPETSSLTLSINDAVVGRTAIRAPSAVRV
FT                   VEFDVPPGLLRPGYNAVAVAAVQRHRVDCSLPATYELWTQVDPSWTGFVLPPGTGTAQS
FT                   LRDLAAVPPDPRGVVPIRVMLRSRPTFETFERIIGLVQRVALAGGYSHVAVEFGSAQQG
FT                   PSGLNLVVASPDELREVANVEAGEVASGQPLTVLPAQATRATTLIVPGTAPADLDAAAE
FT                   AVTASAAHEPVGSPQGLRALALARGAEIRGGETLRLADLGLQNREFSGRLFRAGFDVVL
FT                   PSDVIAADYGKVVLTLEGGYAAGLDPEAQVIVDVNRRNAASAPLPRAEGEVFRDAQIGL
FT                   PLGRWRPGRNRVDVTALLPAASDRACSDAEADRKRFLFLGETKVAFPRLARALRLPDLA
FT                   ATAGGGAPYRDAPRRPRLVVPAPDRASMSAAATIAVRLALAAGRPIDFELATERAAERR
FT                   GPTVVVGPVRTLDPDLLRTVGLDPQQVQQIWQGRAAQAGAEIPQPAGQGGGLSLDRLRS
FT                   DIPPACALPAAPSRSIAVAQRGRSSARAQAADLVTSWGASLRGAGAGEDGLAGIGARLG
FT                   AVLQEAVAAASRWLDAQVREAEIEVDARTSLIAGQGLMGRDPDATLTVFTAPTPAALQA
FT                   SVTCLTAPSVWDRLEGRVAVLDGNDGAVRTYAARHAILVETAPRSFENLRLIVAGWFSS
FT                   NPNAFALIILASAAALGLSTSAMLRGVGRTGTGRRGDPDRGTGAPR"
FT   gene            complement(126657..129092)
FT                   /locus_tag="M446_0107"
FT   CDS_pept        complement(126657..129092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0107"
FT                   /product="cellulose synthase catalytic subunit
FT                   (UDP-forming)"
FT                   /EC_number="2.4.1.12"
FT                   /note="KEGG: mex:Mext_1367 cellulose synthase catalytic
FT                   subunit (UDP-forming); TIGRFAM: cellulose synthase
FT                   catalytic subunit (UDP-forming); PFAM: glycosyl transferase
FT                   family 2"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14692"
FT                   /db_xref="GOA:B0UPS8"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR003919"
FT                   /db_xref="InterPro:IPR005150"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B0UPS8"
FT                   /protein_id="ACA14692.1"
FT                   /translation="MPVILARALWLTSAMAVLALLVQPVGTQVQLEMSLGAMGLMGLIW
FT                   LFLRGRVARSVFLAIGSLVVLRYLYWRVSSTLPPVSDVPGFVCGMILLVAELYCFYILM
FT                   ISLVVNADPIARATPDAADDDALPTVDVFVPSYNEDSDVLATTLAAAKSLDYPAHKLTV
FT                   WLLDDGGTEQKCSDPNRAKAVEARTRRSVLQKLCAELGVNYLTRRRNLHAKAGNLNNGF
FT                   QHSQGEIVVVLDADHVPFRSFLRDTIGHFAQDPKLFLVQTPHAFLNPDPIERNLGTFDR
FT                   MPSENEMFYAETQRGLDKWNGSFFCGSAALLRRRALEEAGGFSGITITEDCETAFELHS
FT                   RGWTSVYVDKTLIAGLQPDTLTSFIGQRSRWCQGMLQILLLKNPLLKRGPTSIQRLCYL
FT                   SSMTFWFFPVPRLIFMVAPLLYIFLDLKIVVANVDEAIAYTATYIAVNLMMQNYLYGRL
FT                   RWPFVSELYEYVQGLFLIKATASVILSPRKPHFNVTAKNVTLDRDQLSPLAMPFLAVFL
FT                   VLLLGAGVATYRYLYEPGITNLMLVVGLWNLFNLITAGAALGAAAERRQTETTPSLAVE
FT                   RPAVLTLNGLAIDVAVERISRERARVRMDAIVPMRRDGDASVGTLGVAPRADLPEATAR
FT                   AAITARVVGVALAGEESVCDLVFEDMTPCAYLVLADLMYGDAEAMRRFQQRRRGHKNLL
FT                   AGSLQFVAWGIAGPCRALSYFLSDLAARDARKDPAEVPVPQTIRMHRRLAETPRRSFVE
FT                   PARPRPAAPEAQPPVPANPVDATPAWLRMMLEAENATLAQNRGRRRSDLDPSSQPSLG"
FT   sig_peptide     complement(129009..129092)
FT                   /locus_tag="M446_0107"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.877) with cleavage site probability 0.441 at
FT                   residue 28"
FT   gene            complement(129234..129992)
FT                   /locus_tag="M446_0108"
FT   CDS_pept        complement(129234..129992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0108"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mex:Mext_1366 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14693"
FT                   /db_xref="InterPro:IPR031485"
FT                   /db_xref="UniProtKB/TrEMBL:B0UPS9"
FT                   /protein_id="ACA14693.1"
FT                   /translation="MSAHHLIKCCIVALVGSIAVPEIGFAADWYTGAEQVVPQDDWIVA
FT                   VDAAATVTSNSSAFGAVTATIATANTLVESGPRVRLQSVDGVYSYPGAGAGRTVHGVQA
FT                   EGSALLGYEWIWQQAAVAGYIGFNVRHNELSIPDPRNPVVGTGVGAKVAADIYLNPTVD
FT                   TLFAANASYSTLFRAYYARLRAGFAVADGVFLGPEGTFLGDQFFNQWRVGAHLTGFFVG
FT                   PMKFSLGAGYVFDRIQKSGYYTSVEARAAF"
FT   sig_peptide     complement(129912..129992)
FT                   /locus_tag="M446_0108"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.933) with cleavage site probability 0.930 at
FT                   residue 27"
FT   gene            complement(130412..132877)
FT                   /locus_tag="M446_0109"
FT   CDS_pept        complement(130412..132877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0109"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; histidine kinase
FT                   A domain protein; KEGG: mex:Mext_1365 response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14694"
FT                   /db_xref="GOA:B0UPT0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B0UPT0"
FT                   /protein_id="ACA14694.1"
FT                   /translation="MHKSGMLSLRATMAALCALSAVAAGLTALRVATPEHAPAPRQGQI
FT                   ARDGARLVADRLASAVLAVSRDVALAAENALLQPQADPAAIRAYFARWRALHPEYADIL
FT                   LADRTGLIRATASGRFAGAHVSGATWFARGLAGTVIADASERSRAGIEAPRNTILGAPV
FT                   PGPDRTAIGILAVQLTPEWIGSVVDAARADLGEAGRALQLSILNGTGRPLLQSEGAAGA
FT                   PAGGPEAVASLPDAEGAGLGWLVAARAPGEAGPTWQSQAGSLLLADVVALAALLGWMVG
FT                   GHATRGLARLRGAARDERPGLGAERFWMRDLGDLAGTLAEVTARAQSRDRLLHETRAAL
FT                   ARARNRLRFIHAVTGATCWEVDFASGQVAWTDAAADRDAGASERVCALDEILSRVAGDD
FT                   RALVEGAMRGALAAEGVTRDVAVRILPGDGDARERRLILRIAKAARDEVSCTRLHVLSR
FT                   EVAAALPAPGPGLAAENAGALPAPERRRDPLTREIVDSIVHDINNVLTVVLTSVGAARA
FT                   GHIPDESVRRWLEAAFRGAARGASTTRRVLALSRREAPPAGEIDLAPILDDVLAFLRGT
FT                   VLAGTPVAVSKAADLPRLHCAERDVEIALLNLAVDIRACLTEGDAVAIVVGASRDAAGA
FT                   PIRQQAGVQIGVSIGGRLAEGSGIAAVRQLMEEIGGAISVGPSEVTLWIPGSDLAPAQA
FT                   RPGARARARRVLLAEADPLVRSVTADALAGLGHAVTLAATADQAFQALAERRDFDLLLC
FT                   DHLLPGAKGLHLAAVVSRTHPAMEIVIMGARGQLPANAQVFGSLHKPFGLTELVRALDE
FT                   APAASVRAA"
FT   sig_peptide     complement(132806..132877)
FT                   /locus_tag="M446_0109"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.977 at
FT                   residue 24"
FT   gene            133523..134695
FT                   /locus_tag="M446_0110"
FT   CDS_pept        133523..134695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0110"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   mex:Mext_2307 alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14695"
FT                   /db_xref="GOA:B0UPT1"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR027399"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0UPT1"
FT                   /protein_id="ACA14695.1"
FT                   /translation="MRALVWHGTEDIRCDTVPDPKIEDERDAIIKVTTCAICGSDLHLY
FT                   DHVMPGMEKGDVMGHEFMGEVVEMGRGVNGALRKGERIVVPFTIICGECDQCKRGYFSV
FT                   CERSNRNKSIAEKAFGHTTAGLFGYTHLTGGYQGGQAEYVRVPFADKTHIKVPDNLSDE
FT                   QVLFLGDIFPTGWQAAVQADIQPTDTVAIWGAGPVGQMTLRSAVLLGAKQVVCIDSVPE
FT                   RLEMARAGGAVTIDNAQESVIERLNELTNGKGPEKCIDAVGMEAHSPRALEQVYDRLKQ
FT                   AVMLESDRASVLREMIYVCRPAGILSIPGVYGGLVDKLPVGALMNKGLTIRTGQTHVNR
FT                   WTDDLVKRVADGQIDPSFVITHRVGLEQGPEMYKTFRDKKDNCIKVVLRP"
FT   gene            134779..135384
FT                   /locus_tag="M446_0111"
FT   CDS_pept        134779..135384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0111"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mex:Mext_2308 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14696"
FT                   /db_xref="UniProtKB/TrEMBL:B0UPT2"
FT                   /protein_id="ACA14696.1"
FT                   /translation="MSDAMSQRDRGRAPVPYSLPSYLTSDPRRRPDPATRELAHGLGWF
FT                   SIGLGLTELACGGAIARWLGMPRAAPVIEAYGVRELLQGAGILGSRDPTPWISARVAGD
FT                   ALDIATVLPGLVGHNPRKDNVLIALVALAGVTAIDVICAQNLSGAPLAPSRKVRQDYRS
FT                   RSGFRRPAQAMRGAARDFKPPPDMIRPEAMRPWTLTNA"
FT   gene            135406..136494
FT                   /locus_tag="M446_0112"
FT   CDS_pept        135406..136494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0112"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sus:Acid_0874 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14697"
FT                   /db_xref="GOA:B0UPT3"
FT                   /db_xref="UniProtKB/TrEMBL:B0UPT3"
FT                   /protein_id="ACA14697.1"
FT                   /translation="MLPAFERASGALVMGLVLADIFLTVLYARIGTGLIADRVAHLTWA
FT                   IFRAVDQVGQKRGAVLSFCGPVILIVYVLLWALGLTLGAGLIIHPALGTAVRASSGETP
FT                   ADFMTALYAGGSSMAIVGASDFKPVTDAYRVLYLVNSLVGMSVTSLVLTYVMQVYSALR
FT                   QRNALGLKLHLLAGETADAAELLARLGSQGQLDSGYSHLADTAAAMAEMKETHHFYPVL
FT                   FYFRFRQPFYSVSAQAFIVLDTVSLIRSGIADRQAAWLKEAAAVDAIWRVAMLLVVTLE
FT                   TTFLPGDLPAPADVTSAESEAWRTRFAAALRRLSAAGVETMRNEAGAETYLALRAQWQP
FT                   HIARLAPAMAYRIDEFEPGGEQ"
FT   gene            complement(136871..138268)
FT                   /locus_tag="M446_0113"
FT   CDS_pept        complement(136871..138268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0113"
FT                   /product="MmgE/PrpD family protein"
FT                   /note="PFAM: MmgE/PrpD family protein; KEGG: ppr:PBPRB0047
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14698"
FT                   /db_xref="GOA:B0UPT4"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="UniProtKB/TrEMBL:B0UPT4"
FT                   /protein_id="ACA14698.1"
FT                   /translation="MPTLLERAASFLASLDPASLDGAARAAACEALTDCVGVALAGSRE
FT                   PVARNLRTWARARAAGRSATVLGTRLRLDPENAALCNAVAGHALDFDDTSWTTIGHPSV
FT                   VVAPVALAVGEEIGASGLAAVGAYLAGVEVAHRLAETVMPEVSRNGWHTTAALYAVGAA
FT                   AAACALRRPGEAATIHALAIALTRSGGLRANFGTQAKPLHAGLAARSGLEAVSLAMAGV
FT                   TASAEAFEGADGFAACFAGPAARARIDPGAVRFGEPFDLVARGLAYKRYPCCSGAHPAL
FT                   DLILDLRRAHGIAAEHVREIRVGTSLLAERELVCHAPRTPAEARFSLEFALAAALVRGR
FT                   VALDTFDDATLADPALRRVMERVRMTVSPSLARLGFIGTAPVEMEIEVEGGRVISGSRD
FT                   LAVGNPERPLSEADRRAKFLACAGRALAPSAAESAYLALRDLADLPGLEPLLDTLAGSP
FT                   SPPAPVT"
FT   gene            complement(138284..139036)
FT                   /locus_tag="M446_0114"
FT   CDS_pept        complement(138284..139036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0114"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: azc:AZC_1839 polar amino acid uptake family ABC
FT                   transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14699"
FT                   /db_xref="GOA:B0UPT5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:B0UPT5"
FT                   /protein_id="ACA14699.1"
FT                   /translation="MPPAWTPDQPIVQLIDVHKSFGALEVLKGISLEVRKGEVICIIGP
FT                   SGSGKSTLIRCINALVPITSGTIRVEGIEVADPKLDKLALRRKVGMVFQQYNLFPHKTA
FT                   LQNVMMAPIHVLGQDRREVEARARALLAKVRLSGKEDTYPGELSGGQQQRVAIARSLAM
FT                   RPDVMLFDEVTAALDPETVKEVLVTIRELAEEGMTCLLVTHEMAFAREVADHIYFTDRG
FT                   VIVEHGPPAQFFAAPRDPRTRSFLSQIL"
FT   gene            complement(139045..139902)
FT                   /locus_tag="M446_0115"
FT   CDS_pept        complement(139045..139902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0115"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: azc:AZC_1838 polar
FT                   amino acid uptake family ABC transporter permease protein
FT                   2"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14700"
FT                   /db_xref="GOA:B0UPT6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B0UPT6"
FT                   /protein_id="ACA14700.1"
FT                   /translation="MSGEPRPRALPVLLPVLLPPRPPAPPRLRLRPHHGVALGLAMLLA
FT                   AQAAPAQAPSGAAPLPALDVLIKWAPLLLTGFAFNIAISLLAMLLGTAAGLWLGLALLA
FT                   ETRALRGVAWLATQVFRNAPWLVLLFFVMFLVPFQVTVFGLRIPLPDWVKATGGFALPV
FT                   MANVAEIVRGAVRSIPTTQWEAAEALAFTRRQTMWRIILPQCLKRMLPPWMNLYALVAM
FT                   ATVQASIVGVSEMLTLTAQVHAAEGGRPELFAPLYGFALICFFLYCYPIDRWTARLERR
FT                   FHVA"
FT   gene            complement(139899..140645)
FT                   /locus_tag="M446_0116"
FT   CDS_pept        complement(139899..140645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0116"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: azc:AZC_1837 polar
FT                   amino acid uptake family ABC transporter permease protein
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14701"
FT                   /db_xref="GOA:B0UPT7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B0UPT7"
FT                   /protein_id="ACA14701.1"
FT                   /translation="MSGIPDWFQRLYDTTGFNLTVFYDPYDWGRYVAGLRMTLLLSVST
FT                   ILISLVLGALGALLQGGPSRLLRGLVHGFVVVFRNTPPLVQIFFFYFGLGTLLPATQTA
FT                   SGLREPLLSNVQWAIVSLSLFAAAFNVEIFRSGIEAVPRTTVEAAEALGYTRAKAYLHV
FT                   VLPLALRICLPALNNNLINLLKTTTLAYAIAVPETLYAVKQIWSESQNVLEMMLVLLAT
FT                   YGILVGILVWLMHRWERALRIPGYGR"
FT   gene            complement(140693..141511)
FT                   /locus_tag="M446_0117"
FT   CDS_pept        complement(140693..141511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0117"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   KEGG: azc:AZC_1836 polar amino acid uptake family ABC
FT                   transporter periplasmic substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14702"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:B0UPT8"
FT                   /protein_id="ACA14702.1"
FT                   /translation="MRQKVRALALAGVALATLSGARAAEGVDAIKQRGKLIVGVKADYR
FT                   PFGFRDPSGNIIGLEPDLAADIAKRLGVELELVPVVSSNRIEFLQQGKVDLLIATISDK
FT                   PERRRVVQAIDPQYYSDYVNILLPKKGGITEWGQLKGKPVCATSGAWYNKDVARTYGAE
FT                   IVAFDGSEKPLFALKQGNCVGYLYDQTFIQGRLGEDEWKADYAMPLKGILEAPWIMAVA
FT                   SGNASLQAVMETATKDWMRTGFIVDEEKKWGIAPTDYARAMHDKYKNATN"
FT   sig_peptide     complement(141440..141511)
FT                   /locus_tag="M446_0117"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.774 at
FT                   residue 24"
FT   gene            complement(141689..142858)
FT                   /locus_tag="M446_0118"
FT   CDS_pept        complement(141689..142858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0118"
FT                   /product="Sarcosine oxidase"
FT                   /EC_number="1.5.3.1"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   pfl:PFL_2333 N-methyltryptophan oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14703"
FT                   /db_xref="GOA:B0UPT9"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B0UPT9"
FT                   /protein_id="ACA14703.1"
FT                   /translation="MSRTYDVAVIGLGAMGSATLFQLARRGAAVIGLDRFAPPHAMGSS
FT                   HGETRITRQAVGEGRDYVPFVLESHRIWRQLEAETGETLLNACGVLVMGPGRGPTSHHG
FT                   KPDFVGRSRDAALAFGIPHEMLTGAEVARRFPQFLNLAGDEKAYYEPGGGYVLPERCIA
FT                   AQLRRAEALGAEIRTGTEVLGLEQDASGVTLRTRDGAIRAARAVVSAGAWTAPLLGSAF
FT                   ARLLTVRRQVLHWFALDDVGAYGPGAPVFVWMHGASDVDYLYGFPPGPGDHRLKVATEQ
FT                   YATRTTADSIDRAVSPEESAEMYRLHVAGRLAGATPRVAEAAACLYTITPDRGFIIDRH
FT                   PDHDRVTVVSACSGHGFKHSAGIGATVAESLTEGRSAIDLAPFRLGRFQ"
FT   gene            142991..143995
FT                   /locus_tag="M446_0119"
FT   CDS_pept        142991..143995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0119"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bbr:BB0088 LysR family regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14704"
FT                   /db_xref="GOA:B0UPU0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0UPU0"
FT                   /protein_id="ACA14704.1"
FT                   /translation="MDTLPDLGALRVIRAVAETGSITAAARRHGLTQSAVSQVVRRVEA
FT                   AIGAPLFDRARRPLVPTAAGRILAARVQDLSRDLEDLLAVLRSAAAQPERIDLRLGLVD
FT                   SFAGTVGAHLVRDLLDGTAALTLTAWSGLAFSHAEALLRRAIDAAITCDPMDGLSGIER
FT                   YPVFREPYLLAVPRGLAGELAPLGLREVLARHRLVRHSERSFVGQQVERHLSRLGLRPP
FT                   RAFEFDTSDALVAMVAMGMGVAVTTPLCLLQGIAHAPGIEVLPLPKPGFSRDLLLVTLR
FT                   GEIPRLAPRIAARAQAVLREQAMPRLDALVPWLGAGAPALFPPTDGAGAPSPA"
FT   gene            complement(144058..144471)
FT                   /locus_tag="M446_0120"
FT   CDS_pept        complement(144058..144471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14705"
FT                   /db_xref="UniProtKB/TrEMBL:B0UPU1"
FT                   /protein_id="ACA14705.1"
FT                   /translation="MRSRLPPLAALAMIAALAMIAACEQASAGPPTIAGLYIRRAPSRG
FT                   EMRIERAGPRWTISIVAGGLPRGPATAADCSIVADGDLKGTRLTARIRDDDPAVERLIE
FT                   MRLSPGRAVITFGQVEGPCGMGSDVSGTYTKAR"
FT   sig_peptide     complement(144385..144471)
FT                   /locus_tag="M446_0120"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.956 at
FT                   residue 29"
FT   gene            144841..145464
FT                   /locus_tag="M446_0121"
FT   CDS_pept        144841..145464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0121"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14706"
FT                   /db_xref="UniProtKB/TrEMBL:B0UPU2"
FT                   /protein_id="ACA14706.1"
FT                   /translation="MHLGAKMRAVLFALAVIFLVQDRGAAAEISQDGIFSKEFIAFFFE
FT                   IRRYNNFTSEPSAETANQPDGARPPSGAEARSVFDVCDDYDLDKLRYYILNRDRKYIDR
FT                   FNLASDPDDLTYRDYSISYVKRIISRINKLTHQKVRKGGAAIAYIRLDTEGVIVEARVT
FT                   DFLGDPAAVKEAYAVVTPGRKLGEPPSFVDRDSLRFTVPIVFVQ"
FT   gene            145623..147227
FT                   /locus_tag="M446_0122"
FT   CDS_pept        145623..147227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0122"
FT                   /product="Hemolysin-type calcium-binding region"
FT                   /note="PFAM: Hemolysin-type calcium-binding region; KEGG:
FT                   bja:bll3109 putative Ca binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14707"
FT                   /db_xref="GOA:B0UPU3"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="UniProtKB/TrEMBL:B0UPU3"
FT                   /protein_id="ACA14707.1"
FT                   /translation="MTPSKAANLKNIVSRPTPVGTEDDDQDAVLLADDARRGPAGLGTS
FT                   PTTLALVATFGNGTATVFGDSLDNTVTLSRNAAGQILVNGGAVPITGGTATVANTGLIQ
FT                   VFGQGGNDVLTLNEANGALPRANLFGGAGNDVMTGGSGNDMLFGQAGNDTLLGKGGADL
FT                   LFGGAGNDVLTGGDGDDQVFGEAGDDRMIWNPGDDTDLFEGGDGTDTAEVNGGNGAETF
FT                   ALTANGTRVRFDRLDPAPFSLDIGTTERIVVNMNGGDDRFSATGNLAALIGVTVDGGSG
FT                   NDTILGSNGGDLLLGGDGNDVVDGQQGSDVAMLGAGDDTFQWDPGDGSDVVEGQAGSDT
FT                   LLFNGANIAETIDLAANGGRAVLRRDIASVTMDLNDVETVDVRALGGADRITVDDLSGT
FT                   DVTRVVLNLAGAGGGGDGQADTVVINGTAGDDVIQLIAGSDGIRVLGLAAEIDIVGFDP
FT                   SDRLLINGLGGDDVIEASGLTATGMLLTADGGAGNDVLIGGPGPDTLLGGEGDDVLIGG
FT                   PGLDVLDGGLGSNVVIS"
FT   gene            147328..147873
FT                   /locus_tag="M446_0123"
FT   CDS_pept        147328..147873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0123"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14708"
FT                   /db_xref="UniProtKB/TrEMBL:B0UPU4"
FT                   /protein_id="ACA14708.1"
FT                   /translation="MRHFPSTPPRHRCDRRPVAGRGRLRRREPELRAPWFKTDPDPRGH
FT                   GLDGIAADQREVRITIVIPSGDRALRQWLTFTRTPRSRRAAACIEQLIRPGGQREGETW
FT                   SVSPHQIPPTEFRAIEVRRPDGSDTRIEPGDLAAMVPHEGLEEEVRAEFRDMRTRTRFR
FT                   AASPALAFPARRSISRRR"
FT   gene            148661..149677
FT                   /locus_tag="M446_0124"
FT   CDS_pept        148661..149677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0124"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   sal:Sala_1765 aminoglycoside phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14709"
FT                   /db_xref="GOA:B0UPU5"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B0UPU5"
FT                   /protein_id="ACA14709.1"
FT                   /translation="MAASPAEAETVISEFLNRCGLVTLGEPTRLVPLTGGVASDIFRVE
FT                   VGERTFVVKKALARLRVAQEWNAPVSRNKSEVGWFIEARRAVPHAVPDIIAHDPDLGVF
FT                   AMTYLDPARHPIWKDELRDGRARPAFASAVGQTIATIHNATAHSAEAARRFANDETFHA
FT                   IRLEPYLEATARRHGDLAEELFALSRATIQSKVVMVHGDVSPKNILAGPAGPVLLDAEC
FT                   AWYGEPAFDLAFCLNHLLLKCVWKRPHATDYLACFDALASSYLSRVCWEAPESVEVRAA
FT                   RLLPALFLGRIDGKSPAEYITAEADRELVRRVARHLIVSRPRQLSQIRQDWAREVLN"
FT   gene            149674..150975
FT                   /locus_tag="M446_0125"
FT   CDS_pept        149674..150975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0125"
FT                   /product="Phosphopyruvate hydratase"
FT                   /EC_number="4.2.1.11"
FT                   /note="PFAM: enolase; KEGG: vei:Veis_2870 phosphopyruvate
FT                   hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14710"
FT                   /db_xref="GOA:B0UPU6"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:B0UPU6"
FT                   /protein_id="ACA14710.1"
FT                   /translation="MTSMTITSVHGRRLWDSRGRPTVEVEVTVGGHAVGRAIAPAGAST
FT                   GSGEAIDLRDGGEAFGGLDVRRAIGNVNGPIARALVGMDASDPPAIDAAMIALDGTPDK
FT                   SRLGGNATVATSMAVLHARARAVGLPVWKLLAGSRQVRIPLPEIQIFGGGAHAERRVDI
FT                   QDFMVMCPGAGSFAEALDWTAEIYRAAGALMRRAGKLQGVADEGGYWPVFASNEEALDT
FT                   LMLALEAAGFRPGADVAISLDVAASEFGRAGAYVLALDGRTLDTAGMIDMLGSWLDAYP
FT                   IVSIEDPVAEDDVDGFKAFTASYGRHCQIIGDDFFVTDAKRVTRAAGDRSANAVLIKPN
FT                   QAGTLAETHAALLAAKEAGFGTIVSARSGETEDTTIAHLAVGWDAGQLKVGSFSRSERM
FT                   AKWNEVLRIEECLGDDAVFAGWSALPFKEAAPSS"
FT   gene            151321..152013
FT                   /locus_tag="M446_0126"
FT   CDS_pept        151321..152013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0126"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fra:Francci3_2783 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14711"
FT                   /db_xref="GOA:B0UPU7"
FT                   /db_xref="InterPro:IPR010451"
FT                   /db_xref="InterPro:IPR023375"
FT                   /db_xref="UniProtKB/TrEMBL:B0UPU7"
FT                   /protein_id="ACA14711.1"
FT                   /translation="MTAGPSTWPIDPNGVSYPPPPWHLQGTAFVSLWRVEASRLPAGWL
FT                   ARDVRPVIMMGRALLGTAFAVYEPTGVLAYNEAMAAIQVGYGWQLALSVPEIWVDHPAS
FT                   IAGARAMWSIPKQEAVFRVRRSVSPGAVSFEARVTAGAERELAKLVFRNRIAIPGRWPL
FT                   RMTIVQRSLRHEDHEDIRVTKALIRASVSFGAATWSFARGGPLDFLSGSIPLVNFRLSR
FT                   MALRIGRS"
FT   gene            complement(152155..152541)
FT                   /locus_tag="M446_0127"
FT   CDS_pept        complement(152155..152541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0127"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: xau:Xaut_2891
FT                   rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14712"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B0UPU8"
FT                   /protein_id="ACA14712.1"
FT                   /translation="MTTKSAKDLVAEANREVETLSAEEALARLGQPDTVFVDVREGEEV
FT                   AKSGKIAGAVHVPRGFLEFQADPASPTHKAELGGGRRLVLYCGSGSRSALAAQTLKTMG
FT                   LGRVAHVAGGFSALEKAGAPVERG"
FT   gene            complement(152553..153464)
FT                   /locus_tag="M446_0128"
FT   CDS_pept        complement(152553..153464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0128"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   xau:Xaut_2892 beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14713"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B0UPU9"
FT                   /protein_id="ACA14713.1"
FT                   /translation="MSDQTTAPLRGRPIVTGFHDAPTGSIQYVVADPETTRCAIIDPVL
FT                   DFDPKSGATATRSADTLLAHIEREGYALEWILDTHPHADHFSAAGYLHDRTGVPTAIGE
FT                   KVVEVQRLWKGLYNLPDGFRTDGSQWSRLFADGEHFRIGTLDVEVMFTPGHTLASIAYR
FT                   VGDAAFIHDTLFMPDSGSARADFPGGNAHALWRSIQRIMALPDETRLFTGHDYRPGGRE
FT                   AAWESTVARQRAENTHLTETGTEEAFVRMREARDRELPMPKLILHSLQVNIRGGRLPEP
FT                   EANGRRYLKIPLNALDGAAWGE"
FT   gene            complement(153484..154290)
FT                   /locus_tag="M446_0129"
FT   CDS_pept        complement(153484..154290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0129"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   xau:Xaut_2893 protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14714"
FT                   /db_xref="GOA:B0UPV0"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:B0UPV0"
FT                   /protein_id="ACA14714.1"
FT                   /translation="MPGLLTSGLATGSGGVVGVILGLVGGGGSILAVPLLTDVVGVSSP
FT                   HVAIGTSALAVSVSAAGNLVPQWRAGNVKWRCAAAFSLAGILGALAGSASAKAVDGQSL
FT                   LALFGVVMLVVGGLMLRKRRGEGDPDVRLTRRSAPVLLPWLLGIGFSVGLFSGFFGIGG
FT                   GFLIVPGLMLATSMPLPMAIGTSLVAVSAFGAATAASYAASGLIDWPLAGLFILGGVLG
FT                   GLVGARLGKRLAGHKRALTLTFAGLVILVGLSIVARGGLPLLGAAT"
FT   gene            complement(154290..154739)
FT                   /locus_tag="M446_0130"
FT   CDS_pept        complement(154290..154739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0130"
FT                   /product="protein of unknown function DUF395 YeeE/YedE"
FT                   /note="PFAM: protein of unknown function DUF395 YeeE/YedE;
FT                   KEGG: mex:Mext_1142 protein of unknown function DUF395
FT                   YeeE/YedE"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14715"
FT                   /db_xref="GOA:B0UPV1"
FT                   /db_xref="UniProtKB/TrEMBL:B0UPV1"
FT                   /protein_id="ACA14715.1"
FT                   /translation="MAKIASACAAGLLFGFGLLVSGMANPAKVLAFLDVTGRWDPSLAL
FT                   VMAGAVAVSAAGDWVARRRGRPVLESQLAIPTRRDLDPRLIAGAAVFGLGWGLAGLCPG
FT                   PALTILTVVPGPAATFVAAMVIGMLLVRLVPSAGSKPAAVQGADA"
FT   sig_peptide     complement(154665..154739)
FT                   /locus_tag="M446_0130"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.704 at
FT                   residue 25"
FT   gene            complement(154742..155167)
FT                   /locus_tag="M446_0131"
FT   CDS_pept        complement(154742..155167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0131"
FT                   /product="protein of unknown function DUF395 YeeE/YedE"
FT                   /note="PFAM: protein of unknown function DUF395 YeeE/YedE;
FT                   KEGG: mex:Mext_1143 protein of unknown function DUF395
FT                   YeeE/YedE"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14716"
FT                   /db_xref="GOA:B0UPV2"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:B0UPV2"
FT                   /protein_id="ACA14716.1"
FT                   /translation="MNGFTPLGASFGGVMIGASAALFLLLNGRIAGISGILGGLLAPPS
FT                   RETGWRVAFLAGLVLAPLVYACLGGSLPPVTVDASFPLLVLAGLLVGFGARLGAGCTSG
FT                   HGVCGIGRGSPRSLVATGIFMAVAILTVLVARRLLGG"
FT   sig_peptide     complement(155105..155167)
FT                   /locus_tag="M446_0131"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.871) with cleavage site probability 0.800 at
FT                   residue 21"
FT   gene            155332..155790
FT                   /locus_tag="M446_0132"
FT   CDS_pept        155332..155790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0132"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sme:SMa1058 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14717"
FT                   /db_xref="UniProtKB/TrEMBL:B0UPV3"
FT                   /protein_id="ACA14717.1"
FT                   /translation="MIPGTVERVPLHTGARDNRRIATDLEASVRWHAEHPQAIGHRLRE
FT                   LDAEWDIERTLEANAATLALTGTVLGMTADRRWLALPLAVTAFLLQHAVQGWCPPLPVL
FT                   RRLGFRTAREIEVERNALKALRGDFGPIGPGPGDHDTRASHALMAARL"
FT   gene            complement(155828..156715)
FT                   /locus_tag="M446_0133"
FT   CDS_pept        complement(155828..156715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0133"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   rpc:RPC_4909 ErfK/YbiS/YcfS/YnhG"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14718"
FT                   /db_xref="GOA:B0UPV4"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:B0UPV4"
FT                   /protein_id="ACA14718.1"
FT                   /translation="MMRRVPRLPALIALASALGACTASMGAPAPVAQARPQIAPDALRR
FT                   YAAITDEPFPVEAVDPRDLKARDVRQVVDDPTKERPGTLVVDPYGRFLYLVMEGGKAMR
FT                   YGVGVGKAGFEFTGEATVARKASWPRWTPTPDMIRRDPTRNGRWAGGMPGGERNPLGAR
FT                   ALYLFKDGKDTLYRIHGTTEPWSIGEAVSSGCIRMLNQDVIDLHRRVPTGTKVVVLGSR
FT                   GTAHAARQATPEATGSLGSSASAGPTLDDGLDHPRLDRLDRGARDGVREDVVAPSGVAE
FT                   LARLQGIGFAYVHP"
FT   sig_peptide     complement(156611..156715)
FT                   /locus_tag="M446_0133"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.504 at
FT                   residue 35"
FT   gene            complement(156712..157344)
FT                   /locus_tag="M446_0134"
FT   CDS_pept        complement(156712..157344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0134"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: rpb:RPB_4361 DsbA
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14719"
FT                   /db_xref="GOA:B0UPV5"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B0UPV5"
FT                   /protein_id="ACA14719.1"
FT                   /translation="MDRRTLLALLPAVALAPVLSSPPGAAQAVAEGIDANAILNDPEAP
FT                   VSGNPKGDLTIVAFLDYNCPFCKKSEPDLIRLVKSDGRIRLVHKDWPILGDASVYGAQL
FT                   ALAAKYQGRYDAVHRALMAIPGRKIPKERMLEVVSASGVDMARLEEDRKARQGEMAALL
FT                   QRNLDQADALGLQGTPVFLIGPLKVAAALDYDGFKEAATQARAKGRP"
FT   sig_peptide     complement(157258..157344)
FT                   /locus_tag="M446_0134"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.527 at
FT                   residue 29"
FT   gene            complement(157377..159167)
FT                   /locus_tag="M446_0135"
FT   CDS_pept        complement(157377..159167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0135"
FT                   /product="cytochrome c biogenesis protein transmembrane
FT                   region"
FT                   /note="PFAM: cytochrome c biogenesis protein transmembrane
FT                   region; Thioredoxin domain; KEGG: rpc:RPC_4907 cytochrome c
FT                   biogenesis protein, transmembrane region"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14720"
FT                   /db_xref="GOA:B0UD44"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR022910"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="InterPro:IPR035671"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036929"
FT                   /db_xref="UniProtKB/TrEMBL:B0UD44"
FT                   /protein_id="ACA14720.1"
FT                   /translation="MPNVLAHLVLALVVWAGSSLWSPGQCQDAATRQGPFSLAVTRDAD
FT                   LSLHLRWTIAPGTYLYRDRIAAAAPSGQWLPVTTEPGEIKDDPNFGPTEVYHGSAGAIV
FT                   PGAALAGAREVRITYQGCADKGICYPPVTRRVDLAALSAADAPPRGGGAAPGRAAMPAI
FT                   HASNASRSGVPPGGPASLLTGNLIGVLSGMFGLGILLAFTPCVLPMVPILSGMLVRSGQ
FT                   ALTPERGLVLSGSYVLAMAAAYASLGLAAAWLGRNLQVALQTPVALGLMATALAALALS
FT                   MFGLFDIQAPRWWRDRAGAASPAKGGSVLGAALLGFSAALVVGPCVTPPLAAALLSVAQ
FT                   TGSVLRGALALFALGLGMGAPLVLVGTFGAGILPRSGPWLVRAKHAFGFVFLALAVSLV
FT                   TRLLPDGLSLLLWGALAIGFGLSVAAIATSGIPARVGRTAGIVAVAYGCALVIGAAAGG
FT                   TDPLRPLAGFGTARAGRAAEARTVSSVAAFETALRAARGEGKPVLVEFAADWCTVCRTN
FT                   ERTVLADAAIRERLKAVWVIRADVTRDDADTRALMQRFQVVGPPTLILMRPDGAEVREA
FT                   RTEGELTVEDLTRGLALVGA"
FT   gene            159274..159936
FT                   /locus_tag="M446_0136"
FT   CDS_pept        159274..159936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0136"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: rpc:RPC_4906 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14721"
FT                   /db_xref="GOA:B0UD45"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B0UD45"
FT                   /protein_id="ACA14721.1"
FT                   /translation="MRILVVEDDPILSDGLRAGLALSGAAVDCVATCADADAALTASQF
FT                   GAVILDLMLPDGSGLDVLRGLRGRGDRTPVVLLTARDAVADRIAGLDGGADDYLGKPFD
FT                   LDELSARIRAVVRRASGRAAAGLEHGGIRLDPGSLTVTVDGAPVTVSRREFMVLAALME
FT                   RPSVLRSKAELEERLYGWQEEVESNAVEVHVHNLRTKIGKHAIETVRGLGYRMRAPA"
FT   gene            159933..161249
FT                   /locus_tag="M446_0137"
FT   CDS_pept        159933..161249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0137"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: rpd:RPD_4242 ATP-binding
FT                   region, ATPase-like"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14722"
FT                   /db_xref="GOA:B0UD46"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B0UD46"
FT                   /protein_id="ACA14722.1"
FT                   /translation="MRSLRVRLFAILLLATGLIWLSAVAWIYLGSRREVEQVLDNRLQE
FT                   AARMVSSLVGAVGGTGADGTPRTFPAPTAYERQLSCQIWSLDGRMVARSSGAPERRLTD
FT                   APAGFSEREVDGETWRVFTVEDGEKGVRVMVGDRLGLRERLVTDLIMGLITPALLVVPL
FT                   LGMLIWASLGRGLRPLRLMARNLAARDADDMSAIDAGQAPTEVRPLADALNGLFLKVEA
FT                   ARRHEREVTAFAAHELRTPLAGLKTQAQVAMAATDPEVAKAALHQILAAVDRTTRLVRQ
FT                   LLDTARLDASGETRPLTEVDVGALVAETVEGLRAPPGIRTVVDPGLRGYTMWADPESLR
FT                   LAVRNLHENAVQHMQAGLVEWAARPGGGGVVVRDEGPGIPEEELPHAMKRFFRGRHKSA
FT                   TGSGLGLAIAEMASRRSGLSLRLRNRPDRQGLEAEIVRG"
FT   sig_peptide     159933..160010
FT                   /locus_tag="M446_0137"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.993 at
FT                   residue 26"
FT   gene            complement(161390..161905)
FT                   /locus_tag="M446_0138"
FT   CDS_pept        complement(161390..161905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0138"
FT                   /product="protein of unknown function DUF336"
FT                   /note="PFAM: protein of unknown function DUF336; KEGG:
FT                   nha:Nham_3668 protein of unknown function DUF336"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14723"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="InterPro:IPR038084"
FT                   /db_xref="UniProtKB/TrEMBL:B0UD47"
FT                   /protein_id="ACA14723.1"
FT                   /translation="MCGRKAIIRRAVFVAFASVFLARPAAAEEALVTYKSVSPDIAFEI
FT                   AQAALRRCREDGLQVAIVVMDRFGAPLVLLRDRFAGLPAATTASSKAYTALSFRSSTAE
FT                   FAKGIETKRLDAGLGRLPNVVAMAGGLPIEAGGGIVGAVGVSGAPGGDKDDACAAAGIE
FT                   AVRDKLDF"
FT   sig_peptide     complement(161822..161905)
FT                   /locus_tag="M446_0138"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 28"
FT   gene            complement(161892..162347)
FT                   /locus_tag="M446_0139"
FT   CDS_pept        complement(161892..162347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0139"
FT                   /product="Domain of unknown function DUF1791"
FT                   /note="PFAM: Domain of unknown function DUF1791; KEGG:
FT                   rpa:RPA4476 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14724"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:B0UD48"
FT                   /protein_id="ACA14724.1"
FT                   /translation="MRQPARRLILFLLAGLAAAPVSAAEGRGGHRVVFQVDTADPATMN
FT                   LTLNNATNVVDHYRAKNEQVEIDIVAFGPGLAMYRADKSTVADRIAHFADYGFPAKVQF
FT                   SACNNTKTAMERAEGHPITLLPQATIVPSGVVQIMERQEQGWSYVRP"
FT   sig_peptide     complement(162276..162347)
FT                   /locus_tag="M446_0139"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.986 at
FT                   residue 24"
FT   gene            complement(162361..162828)
FT                   /locus_tag="M446_0140"
FT   CDS_pept        complement(162361..162828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0140"
FT                   /product="Domain of unknown function DUF1791"
FT                   /note="PFAM: Domain of unknown function DUF1791; KEGG:
FT                   nha:Nham_3670 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14725"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:B0UD49"
FT                   /protein_id="ACA14725.1"
FT                   /translation="MSRFGLPRRLLLGAALAPVAAQAAGTVGGGPAPEVSAFAEHRLAL
FT                   QLSEREPHRQDLVLSVANNVLKAYGPDKVAIEVVAFGPGIDILRAESPHRAGVDSLVSQ
FT                   GVRFDICMNTVETVARATGQRPALNPHAIPVEAGVVQLMTLAEAGYILVRP"
FT   sig_peptide     complement(162757..162828)
FT                   /locus_tag="M446_0140"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.987 at
FT                   residue 24"
FT   gene            complement(162825..164603)
FT                   /locus_tag="M446_0141"
FT   CDS_pept        complement(162825..164603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0141"
FT                   /product="5'-Nucleotidase domain protein"
FT                   /note="PFAM: metallophosphoesterase; 5'-Nucleotidase domain
FT                   protein; KEGG: nha:Nham_3671 twin-arginine translocation
FT                   pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14726"
FT                   /db_xref="GOA:B0UD50"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR030998"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="InterPro:IPR041829"
FT                   /db_xref="UniProtKB/TrEMBL:B0UD50"
FT                   /protein_id="ACA14726.1"
FT                   /translation="MTRDFDGSNAGLPRRRLLQAGAALALPFLWRRALAQDAGAGLYDL
FT                   EPFGNGRLLHMTDTHAQLRPILFREPSVNIGIGAMRGRPPHLVGEAFLKRFGIAPGSRE
FT                   AYAFTYLDFEEGARRYGRLGGFAHLKSLVARLRAEAPGGRAMLVDGGDLWQGSGLSNAR
FT                   KGADMVEAANLLGIEAMTGHWEFTYGQDGVRANLDRFKGEFLAQNVFLTEEAAFNEAPA
FT                   FDSASGRVFKPATVKAFGDRRVAIIGQAFPYVPIAHPKRFTPDWTFGIRDAELQTLVDD
FT                   LRTKEKVDAVVLLSHNGMDVDLKLASRVSGIDLILGGHTHDAVPEPVAVTNSRGKTLVS
FT                   NAGSNGKFLAVVDLDLAPGSLRGIRYRLLPVFADLLKPDAEMEALITSLEAPHAAAFGR
FT                   RLATAGDMLYRRGNFTGTMDHLLCDALRAQLDAQISLSPGFRWGTTTLAGGDITAADLL
FT                   AQTATTYSEVYVQPMTGAQIHSIMEDICDNLFNPDPYYQQGGDMVRVGGLSYRCEPGAE
FT                   SGKRLSNLTLTGGGPLDPAKTYKVAGWASVNPQEGKPVWEVLEAHLGRSGKATLSADKP
FT                   VEVGGVADNPGYGKAA"
FT   sig_peptide     complement(164496..164603)
FT                   /locus_tag="M446_0141"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.686) with cleavage site probability 0.685 at
FT                   residue 36"
FT   gene            complement(164600..164908)
FT                   /locus_tag="M446_0142"
FT   CDS_pept        complement(164600..164908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0142"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:bll1010 hypothetical protein between SoxB
FT                   and SoxA [Chlorobium tepidum TLS]"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14727"
FT                   /db_xref="UniProtKB/TrEMBL:B0UD51"
FT                   /protein_id="ACA14727.1"
FT                   /translation="MVSAFARAALVALLLPAPAVLAAGAQEANDAYAAAKALSDKAAAN
FT                   KNQWPATATALAAAKAAAEAGRYDEALARAREAEALARASIDQTEREKTAWKNAVIR"
FT   sig_peptide     complement(164840..164908)
FT                   /locus_tag="M446_0142"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.845 at
FT                   residue 23"
FT   gene            complement(164917..165777)
FT                   /locus_tag="M446_0143"
FT   CDS_pept        complement(164917..165777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0143"
FT                   /product="sulfur oxidation protein"
FT                   /note="KEGG: nha:Nham_3673 sulfur oxidation protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14728"
FT                   /db_xref="GOA:B0UD52"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR025710"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B0UD52"
FT                   /protein_id="ACA14728.1"
FT                   /translation="MSAALAPAAGFALALGLTASGIAGAPAAEMADPKADLKAFQAYFY
FT                   EKFPDVKHEDFVNGPYSMDAGMRKQWEEKEEFPPYDFAIDKGKELFETPFKNGKTFADC
FT                   FENGGIGIRQTYPRFDAKLGEVVTLEYAVNLCLTENGEKPYSYVKDEMAAVTAYMAFTS
FT                   RGKPFAIEVPNDPRALAAYEAGKQYFYTRRGQLNFSCASCHVQNPGNRIRAEVLAPAFG
FT                   ITAALPIYRSEWGGMGTATRRYMSCNSQVRGTPLAPDDVLYRDVDYFLSFMSNGLPISG
FT                   PGARP"
FT   sig_peptide     complement(165682..165777)
FT                   /locus_tag="M446_0143"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.434 at
FT                   residue 32"
FT   gene            complement(165774..166085)
FT                   /locus_tag="M446_0144"
FT   CDS_pept        complement(165774..166085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0144"
FT                   /product="Sulphur oxidation protein SoxZ"
FT                   /note="PFAM: Sulphur oxidation protein SoxZ; KEGG:
FT                   nha:Nham_3674 sulfur oxidation protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14729"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR014880"
FT                   /db_xref="InterPro:IPR030995"
FT                   /db_xref="UniProtKB/TrEMBL:B0UD53"
FT                   /protein_id="ACA14729.1"
FT                   /translation="MPSTIRVRATASGDQTDVQSLIQHPMDSGYVKDAKGELIPPHYIE
FT                   TVTFEHGGKVVFTAFWGPAVSKDPYLKFKFSGAKKGDDLKVTWTDNLGKTDSSVAKIG"
FT   gene            complement(166114..166602)
FT                   /locus_tag="M446_0145"
FT   CDS_pept        complement(166114..166602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0145"
FT                   /product="putative exported protein of unknown function
FT                   with sulfur oxidation protein precursor SoxY domain"
FT                   /note="KEGG: bbt:BBta_0696 putative exported protein of
FT                   unknown function with sulfur oxidation protein precursor
FT                   SoxY domain"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14730"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR016568"
FT                   /db_xref="InterPro:IPR032711"
FT                   /db_xref="InterPro:IPR038162"
FT                   /db_xref="UniProtKB/TrEMBL:B0UD54"
FT                   /protein_id="ACA14730.1"
FT                   /translation="MAAYDSNMFDRRFVLRAAGLGSVIAAASFCLPLRASANPDAAYPA
FT                   DAFKQKGEADAVKKLFGQAATASDKVKLDAPEIAENGAVVPVSVSTDLPDVTSIAILVA
FT                   ENPSALAAVYKFAPGTLPTVASRLKMAKTTPVIAVVEAGGKLYSATREVKVTVGGCGG"
FT   sig_peptide     complement(166495..166602)
FT                   /locus_tag="M446_0145"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.979) with cleavage site probability 0.570 at
FT                   residue 36"
FT   gene            complement(166616..166963)
FT                   /locus_tag="M446_0146"
FT   CDS_pept        complement(166616..166963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0146"
FT                   /product="cytochrome c class I"
FT                   /note="PFAM: cytochrome c class I; KEGG: bja:bll1014 sulfur
FT                   oxidation protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14731"
FT                   /db_xref="GOA:B0UD55"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR030999"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B0UD55"
FT                   /protein_id="ACA14731.1"
FT                   /translation="MRRHPCTALLVATLVLARAGAALAQGDAAEGKAIAFDRGRGNCLS
FT                   CHAIPGGDLPGNIGPSLAGLKQRYPNREDVVAIIRDETLRNPETVMPPFGRNLLLSDRE
FT                   IRSIVEYLYSY"
FT   sig_peptide     complement(166889..166963)
FT                   /locus_tag="M446_0146"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.967 at
FT                   residue 25"
FT   gene            complement(166984..167652)
FT                   /locus_tag="M446_0147"
FT   CDS_pept        complement(166984..167652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0147"
FT                   /product="cytochrome c, class I"
FT                   /note="KEGG: acr:Acry_3042 cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14732"
FT                   /db_xref="GOA:B0UD56"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B0UD56"
FT                   /protein_id="ACA14732.1"
FT                   /translation="MSRPLDALLALGALLALAGPAAAGGKPLYGYGTRPSQAQIDAWNI
FT                   DVRGHDGLGLPAGKGSVDQGSEVFAEKCAACHGTFGEGVDRWPKLAGGEGTLTADRPEP
FT                   TVGSYWPFAATLYDYIDRAMPFPNPRSLTPDEVYALTAYILNLNNLVPGDFVADKDSLP
FT                   KVRMPNRDNFTWEDPRPDTRAEPCMAKCRDPKAITITSTAEGKTLTPRTTGALDDMQPK
FT                   "
FT   sig_peptide     complement(167581..167652)
FT                   /locus_tag="M446_0147"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.964 at
FT                   residue 24"
FT   gene            complement(167636..168949)
FT                   /locus_tag="M446_0148"
FT   CDS_pept        complement(167636..168949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0148"
FT                   /product="oxidoreductase molybdopterin binding"
FT                   /note="PFAM: oxidoreductase molybdopterin binding; Mo-co
FT                   oxidoreductase dimerisation domain; KEGG: acr:Acry_3041
FT                   oxidoreductase, molybdopterin binding"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14733"
FT                   /db_xref="GOA:B0UD57"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR005066"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008335"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR030835"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:B0UD57"
FT                   /protein_id="ACA14733.1"
FT                   /translation="MTNRADGRTPRGGAPTLPLARSLGRSLGRRTFLRLAAAGAGGAAL
FT                   PVPARAGEAGPPPEYPWSQSLGAGVVDRPYGQPAAQEAGVIRRNVPWLTAGTQSSISFS
FT                   PIQDLQGILTPNGLFFERYHAGRADVDPEQHRLMIHGLVERPLLLSMGDIVRYPSVSRI
FT                   HFIECPANGGMEWRAAQLNSLQFTHGMISCAEWTGVTLSTLLDEVGVKPEGKWVMFEGA
FT                   DGAHMNRSLPLSKCLDDCLIAYGQNGEALRPEQGYPLRLVVPGWEGNVSVKWLRRIKIG
FT                   DQPWYSREETSKYTDLMPDGKSRGFTWAIDAKSVITFPCPEKPLTKPGLYEVRGLAWTG
FT                   NGKVKRVDVSVDGGANWQAAALHEPVLSKALTRFSLPWQWDGTPALLESRVIDETGYVQ
FT                   PTIAELRRIRGVNSVYHNNSIQTWQVKPDGSVFDVQTA"
FT   sig_peptide     complement(168794..168949)
FT                   /locus_tag="M446_0148"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.916) with cleavage site probability 0.913 at
FT                   residue 52"
FT   gene            169160..169486
FT                   /locus_tag="M446_0149"
FT   CDS_pept        169160..169486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0149"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; KEGG: ajs:Ajs_3418
FT                   transcriptional regulator, TrmB"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14734"
FT                   /db_xref="GOA:B0UD58"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0UD58"
FT                   /protein_id="ACA14734.1"
FT                   /translation="MQATTIDETTLDAFAAQAAEAVRLLRLLGNEHRLMIACLLIVHGE
FT                   LSVGQLVEELRLSQSALSQHLARMREDGVLTFRREAQTLYYSIKDPNAVAVIGLLKQLY
FT                   CKDL"
FT   gene            169489..170487
FT                   /locus_tag="M446_0150"
FT   CDS_pept        169489..170487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0150"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   ade:Adeh_2278 beta-lactamase-like"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14735"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B0UD59"
FT                   /protein_id="ACA14735.1"
FT                   /translation="MIRRAALILAVLLAGSASASDYAPIGKPLAVAQVPGKPIYYSLGN
FT                   TGVPSQANEGNTSNGGFVVTDDGVVVYDALGTPSLGWALLEQIRTITDKPVRYVVVSHY
FT                   HADHIYGLQAFKDHTGAVVIAQERAAQYRDNDETADERADARLRQRQGALAPWVDEHTR
FT                   IVPPDLTFAERATLTLGGKRFVLLYAGPAHSASDMMMMVEPDGVLFAGDIVQNGRIPHM
FT                   NSDDVDTGRWLTALKQVEGLKPRFIIPGHGEPSTEAAKAIAFTAGYITDVRRVMKNAVD
FT                   SWTDFDAAYKAADWSAYDKLPAFAANNRGNAYRIFLELEGANFTDGKKSEP"
FT   sig_peptide     169489..169548
FT                   /locus_tag="M446_0150"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 20"
FT   gene            complement(170492..171529)
FT                   /locus_tag="M446_0151"
FT   CDS_pept        complement(170492..171529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0151"
FT                   /product="protein of unknown function DUF395 YeeE/YedE"
FT                   /note="PFAM: protein of unknown function DUF395 YeeE/YedE;
FT                   KEGG: bja:bll3505 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14736"
FT                   /db_xref="GOA:B0UD60"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:B0UD60"
FT                   /protein_id="ACA14736.1"
FT                   /translation="MEPHVIRAVLGLVIGCVLGYAARRGRFCTLGALEDAVYGQDTRRL
FT                   RAWALAIAVAMVGVHGLRLYGLELHRTLYASSQLAIGPLILGGLTFGFGMALVGNCAFG
FT                   NLLRLGGGDLKALIALLVAAVSAVMAMRGLTAVVRVMAVDPLFVSIPGGRLQLLPDLLG
FT                   VGSPASMALAAACAALLTVYAFADGAFRNDRTLAAAAVVIGTCVTAGWWATGFAGFDAF
FT                   GTGRPTSLSFARPIGDALLFAMVASGMQVDFGIASVLGVLVGAFVEARQARRFRWEAPD
FT                   DPGELRRHIVGAFLMGTGGITALGCTIGQGVTGIATLSVGSAIALASIALGGRAGLYYL
FT                   VERRG"
FT   gene            complement(171893..172315)
FT                   /locus_tag="M446_0152"
FT   CDS_pept        complement(171893..172315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0152"
FT                   /product="putative signal transduction protein with EFhand
FT                   domain"
FT                   /note="PFAM: Calcium-binding EF-hand-containing protein;
FT                   KEGG: rle:RL1893 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14737"
FT                   /db_xref="GOA:B0UD61"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:B0UD61"
FT                   /protein_id="ACA14737.1"
FT                   /translation="MTLATLVRVTALTAILAAGASSSATAQTPTAPMSTPGQSAQPPQP
FT                   GMPGMMGGMGGMGGMGQGGMCGMGMMGHMMGGMNRGMMDDGLRMRMMFAIADTDGDGSL
FT                   SFDEVTAIHRRIFNAADTNKDGKVTLEELQKFLRGQ"
FT   sig_peptide     complement(172235..172315)
FT                   /locus_tag="M446_0152"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 27"
FT   gene            complement(172424..173188)
FT                   /locus_tag="M446_0153"
FT   CDS_pept        complement(172424..173188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0153"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpc:RPC_3041 transcriptional regulator, AraC
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14738"
FT                   /db_xref="UniProtKB/TrEMBL:B0UD62"
FT                   /protein_id="ACA14738.1"
FT                   /translation="MSSDPHRDGPAEAAPVASWQEAVAEGLARLGWSQSARIDPIASDI
FT                   AIVVVDAFLERDLTVDLAGASTFSLSIVLEGSGRLSARGVSPVEAEAGTAVLFACNGPA
FT                   SGEDLFRGGRRFRIVDLRFEESFLLRTGDARLTDLAERRDEATDGVAAAPFLVGFPAPA
FT                   SLAYGLFGCARFPEFRFGLPKWPMITRNRPLGSPVRRDSGLPRSGKRKLEIGFGLPGQC
FT                   LQGLSGAGRQALVAAELNGIRGEPLGCVPRLC"
FT   gene            173324..175322
FT                   /pseudo
FT                   /locus_tag="M446_0154"
FT   gene            175322..176065
FT                   /locus_tag="M446_0155"
FT   CDS_pept        175322..176065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0155"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="KEGG: mes:Meso_0337 major facilitator superfamily
FT                   MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14739"
FT                   /db_xref="GOA:B0UD63"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B0UD63"
FT                   /protein_id="ACA14739.1"
FT                   /translation="MRLGAGTAVGLEAPLVPVPAAIGGMSVARSVVMGIARVGLPAVMR
FT                   EAGQPLDRIGLVSLTLLPRVLEGLWSGAVERDRLPPAGRRRMSASVACGAVLSALALAA
FT                   GAGIGPAAFAPLLVCLIAAALANAAIGSACDGFAVETLPAGHRGRGNAAQAGVSFLGLP
FT                   VGGALLLDLIAAAGRTAASLVRATPVLGLSQPFLVRASAPRRSASTGPASRRRASCRAR
FT                   RGRPARAAARPAPPCPQPERPWRPA"
FT   gene            176062..176478
FT                   /locus_tag="M446_0156"
FT   CDS_pept        176062..176478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0156"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rpc:RPC_3030 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14740"
FT                   /db_xref="UniProtKB/TrEMBL:B0UD64"
FT                   /protein_id="ACA14740.1"
FT                   /translation="MTDFGTPPASGDFDLSRWPVARYRMPDRVPDAEAEARVAEFDALL
FT                   ARDERFVLVFHGPEMPKDSSRFMKAYRAWFKARKDAQKRLCAGAVRVEPDAARRGSFAV
FT                   KAMSLMNKAFLPYPYRVVASDAEADAQARAWLAA"
FT   gene            176463..179945
FT                   /locus_tag="M446_0157"
FT   CDS_pept        176463..179945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0157"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter transmembrane region; ABC
FT                   transporter related; SMART: AAA ATPase; KEGG: pde:Pden_1425
FT                   ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14741"
FT                   /db_xref="GOA:B0UE57"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:B0UE57"
FT                   /protein_id="ACA14741.1"
FT                   /translation="MARRVSAPEPSAPSSPPAGGLGATFARLAGLLRTRPRAMAAAIAL
FT                   GLLAALLGLAWQLGVTRLIRDALEPAPDRARMGWTVAGIAALVVAGRLAFLGSTALSHS
FT                   IAVDVQRDLRLALAEHLARVPAAVFERYGGKALRRLVLDDVESIEDGIAHLVPEATATF
FT                   TAPLIVLVGLFALDWRLALAAALPILLGLAAMRATTRGSADITRAYYERSAEMAARAAE
FT                   HVAGLPTLRLFDEDDRALARLRDMNRALARLRDMTGRYLAVIGDWVRRVLRASALLQVC
FT                   VTSGLLIVLPLGLWLLARGDLPVAHLVLFVVFAPSLGGLVTRLPNFAFRFAQQGEVLAR
FT                   LDALLAEAPLPLPAAPVSPADRTVRFEGVGFRRGERKVLDGIDLVLEPGTVTALVGASG
FT                   AGKTTLANLLLRAQDPHEGRITIGGVDLRDMAPDTLHALVGTVPQHPWLFTGTVAENLR
FT                   LAAPEATPRAMAEALARARAADFVAGLPGGVEAVLAGGGRRSRGASASASASPGRSCAT
FT                   RRSWCSTRRPQRPTRSTSARSSAPWAPSPAAGRCSSSPTASPRSSMPTGSWCSTRAASR
FT                   RAATMPGCSREVAATPATGRFRTAAPRAPAALAFRRMHTMPQPAERPVSWWRDLTRRME
FT                   PRMRVRYRIGLALLATDAGLAAVPLLTAAWVVHGLAAGTWTDGRSLAATALVAGAFLAR
FT                   IAVMPVGFARGFESDYGAVAELRLDLFAHLRRLGLGALARVGAGGLADLVTNRFRWIEE
FT                   EAGYGLGRQVGQAALSLVLVAALGAVHPLFLAAALVLAGLAVLAYRGLDRALARLARDQ
FT                   ASLVAETAERMVEFLAGLPVLRAMGQVDAQRGAYRRQVEALHAFYQRAIGTVAPQVSAA
FT                   RILLDLAVLALVGVAVALFTNGAIDAPGLAVALLVLLLLLAPLDASLGEGFMMRLVGDA
FT                   HARAAAILAQPALEDGTEPVRPGEIRFEGVRFGYGPGRPVLDGFDLALPAGQVTAVVGP
FT                   SGAGKSTLLALIARAFDPEAGRITVGGQDIRAVPLDRHLARLGVVPQDVILFADTLAGN
FT                   LRLARPGASQAECRAAAERACCGDLVAHLPQGFDTVLGEGGRDLSGGERQRVAITRAIL
FT                   KDAPIVLLDEATSALDAESEHGVGEGLRALFRDRTVLMVAHRLQTIRGPTTSW"
FT   gene            179945..180064
FT                   /pseudo
FT                   /locus_tag="M446_0158"
FT   gene            complement(180211..181016)
FT                   /pseudo
FT                   /locus_tag="M446_0159"
FT   gene            181108..181319
FT                   /pseudo
FT                   /locus_tag="M446_0160"
FT   gene            181497..182807
FT                   /locus_tag="M446_0161"
FT   CDS_pept        181497..182807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0161"
FT                   /product="Thioesterase"
FT                   /note="PFAM: Thioesterase; KEGG: rpc:RPC_3033 thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14742"
FT                   /db_xref="GOA:B0UE58"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR012223"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B0UE58"
FT                   /protein_id="ACA14742.1"
FT                   /translation="MEAAAEALLPLLDSVRHRPLALVGWSLGCKIAFALARRLEETGTV
FT                   ARLLMLGACPSPDRPVPASLLPRPGESWAEPLRRLGGTAEAVLAHDGMLGTLRDSLEGD
FT                   FAMATGYRSEAVVAAPILAVAAEADALVSMEAVEAWEARTSAGFTLHRLPGGHFALRDE
FT                   GPALARLLAGRLAGPPSGPAAEDPRAWFPLTPSPPRGRPQVVCFHHAGGNAGFFRPWLD
FT                   VPALAGVAVCPVELPGRGGRFGEAPRADLAGVARALSDLLAAHLDWSRPVILFGHSLGA
FT                   LIAYETALRLEGSGLVPAHLVVSARRAPDVPTPQPWRHTLADDALLAELARIGGTDAAI
FT                   LAHWELMALMLPAIRADFTLTDPYHRPQPEALDCPILAIRGQDDAEIGEADMAGWEAVT
FT                   RSGCARWHPAGGHFYLADPPVRSALAERLARLAAAAG"
FT   gene            182929..183485
FT                   /pseudo
FT                   /locus_tag="M446_0162"
FT   gene            complement(183671..183877)
FT                   /pseudo
FT                   /locus_tag="M446_0163"
FT   gene            184010..184492
FT                   /locus_tag="M446_0164"
FT   CDS_pept        184010..184492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0164"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14743"
FT                   /db_xref="UniProtKB/TrEMBL:B0UE59"
FT                   /protein_id="ACA14743.1"
FT                   /translation="MQRFLPAAAFHQKEIAMTRSLGIGRGGARPGAGRKPSPRPVPATG
FT                   PGLVVEEVAAVGERLETIAAALRITVAHLQRDQRDALLYGQARCRCQAIGLLFAKARAG
FT                   NLSAIRKILQLTASTAAEPVRLRQLGKQEAAQEAAKTAGAGSERGEDLIPAEWRSH"
FT   gene            complement(185004..186239)
FT                   /locus_tag="M446_0165"
FT   CDS_pept        complement(185004..186239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0165"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   mca:MCA1810 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14744"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B0UE60"
FT                   /protein_id="ACA14744.1"
FT                   /translation="MTGSSVLLRFGVPALAAGLFGFTAWSVSAKYDPRPITEPVIAAPA
FT                   NSYAQGVSAAGIIEPASEVVAIATERSGVVSRVEVVAGAGVTAGRPLFSVDDREVRAVV
FT                   ARHEGALAAAEALLSSADLNIAMQRHKISQAAAELENAQAESSRAELDRLRYASLARGS
FT                   WVSRQRYEAAIADAGKAAAAVAAAEAAVAAAKQQSKVLTAKRLEAEANVAQSKAALEQA
FT                   RVDLDRTVVKAPIDGKILKVNVRVGEYAQAGALSSPLMIMGSADLLHVRADVDEADSWR
FT                   INAGSPAVARLRGNPKISAPLSFVRIEPYVVPKRSLTGASTERVDTRVLQVIYALQVSD
FT                   FPAFVGQQVDVFIKTDSPQGVAELRRDPAEVARPLPACPQSLATHRGCRIPGQADAPWQ
FT                   QAQGTQIGQPAD"
FT   sig_peptide     complement(186159..186239)
FT                   /locus_tag="M446_0165"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.984) with cleavage site probability 0.517 at
FT                   residue 27"
FT   gene            complement(186241..186963)
FT                   /locus_tag="M446_0166"
FT   CDS_pept        complement(186241..186963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0166"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: eli:ELI_11040 ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14745"
FT                   /db_xref="GOA:B0UE61"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0UE61"
FT                   /protein_id="ACA14745.1"
FT                   /translation="MGSASAIVRCSGITKTFTAGEDLVTVLHGIDFELPAGELTMLVGP
FT                   SGCGKTTLISIIAGILSPTSGEVSICGASVTRMGDRERTAFRRRTIGFIFQQYNLLPAL
FT                   TVAENAAIPLVAAGMPMRRALERAIPILTRLGMAGHVGKTPNQLSGGQQQRVAIARALV
FT                   HEPRLIVCDEPTAALDADTGRSVLELLKAAALAEDRAVIVVTHDSRIYSFADRITAMED
FT                   GRIRSARVAQARMGSEVA"
FT   gene            complement(186968..188110)
FT                   /locus_tag="M446_0167"
FT   CDS_pept        complement(186968..188110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0167"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   mca:MCA1808 ABC-transporter permease protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14746"
FT                   /db_xref="GOA:B0UE62"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:B0UE62"
FT                   /protein_id="ACA14746.1"
FT                   /translation="MNGVAVRMLIRDHAKYLGLVFGIAFSTMLMSNQVAIFIGLMLRTA
FT                   SQIIDVRETDIWVMDPRVEYIDVVEGMADMQLHRVRGVEGVDWAVPLHKSLPVAHTREG
FT                   VLQQVILLGVDDATLVGVAPHLVLGAVEDLRQPDAVIVDRAGYQFMWPGEALALGKEFE
FT                   INDRRAVVVAISEASAPFATFPVVHTKYSSALGFDGRSRKQLSFVLARARAGQDPRALA
FT                   RRIAAETGLKALTWRDFAWATVEYYMKRTGIPVNFGITTALGFIVGAVVVGQTYYLFVL
FT                   ENLRHFGALKAMGVGNLTIVRMVLLQAVVVASIGYAIGIGFCAVFFEVLSRTAIDFRGF
FT                   ALPWEVAAGTAGAVFVIIAVASLASIRRVLVVDPAIVFRG"
FT   gene            complement(188623..189342)
FT                   /locus_tag="M446_0168"
FT   CDS_pept        complement(188623..189342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0168"
FT                   /product="4'-phosphopantetheinyl transferase"
FT                   /note="PFAM: 4'-phosphopantetheinyl transferase; KEGG:
FT                   gvi:gll1951 phosphopantetheinyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14747"
FT                   /db_xref="GOA:B0UE63"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:B0UE63"
FT                   /protein_id="ACA14747.1"
FT                   /translation="MFPPNEVRVWRARVGRQPAGWLPLATGTLSEEERARQARFVRERD
FT                   AELFALGRAMLRRVLAASMDVAPRAVTFEAGPFGKPRLAAAHRAPFRFNPTHSGDLAVV
FT                   AITVGREVGVDVEAVRPLKDLEGLVRATFSAREQRDILAAPEAGRLASFFAAWARKEAV
FT                   VKALGHGLRFPLDAFDVEVSPEAPPALLASREAALVPSAWIMHALPPMAGYASALAVER
FT                   AMNSAVTCEEWTCAASP"
FT   gene            complement(189506..190273)
FT                   /locus_tag="M446_0169"
FT   CDS_pept        complement(189506..190273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0169"
FT                   /product="Oleoyl-(acyl-carrier-protein) hydrolase"
FT                   /EC_number="3.1.2.14"
FT                   /note="PFAM: Thioesterase; KEGG: xau:Xaut_1005
FT                   oleoyl-(acyl-carrier-protein) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14748"
FT                   /db_xref="GOA:B0UE64"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR012223"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B0UE64"
FT                   /protein_id="ACA14748.1"
FT                   /translation="MTLDKTWFHAAAPRPGVRLRLVCFHYAGGAAQMFNTWQRRIAPEI
FT                   EVCAVQLPGRWSRLKEAPLRSVPAMAKAVADVFEPLLDRPYAVFGHSLGAAVGFELIHA
FT                   LAERGSRLPVHFFASARHAPHLPSAVPSLHRLPEAQFIAVLRDRYAALPREILEDPEML
FT                   PIFLNVLRADLEAIETYRYVPRAALSVPITAMGGTRDPAVAQAQLEAWADLTTAGFAVR
FT                   MFDGDHFYLRPKEDEVIAALQKTLEPELIACCG"
FT   gene            complement(190270..201207)
FT                   /locus_tag="M446_0170"
FT   CDS_pept        complement(190270..201207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0170"
FT                   /product="Beta-ketoacyl synthase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR;
FT                   phosphopantetheine-binding; KR domain protein;
FT                   Beta-ketoacyl synthase; Acyl transferase; KEGG:
FT                   sen:SACE_2630 modular polyketide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14749"
FT                   /db_xref="GOA:B0UE65"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042104"
FT                   /db_xref="UniProtKB/TrEMBL:B0UE65"
FT                   /protein_id="ACA14749.1"
FT                   /translation="MNEPIAIVGMACRFPGGAGDPASYWNLLKEGRDAVVEVPKERWDA
FT                   AEIYDEDPSGLGKTYAKWGGFLQEPIDRFDAGFFNIPPDEARFLDPQQRLLLEVSWEAI
FT                   ENAGEDPTRLRGSRAGVFVGISYPEYLHLQLNPHAIQEGGLYVGLGGVFSAAAGRVSYV
FT                   LGLQGPSVAIDTACSSSLVAIHQACLALRSRECEMALAGGVNLILTPHFTDMLSKMRAL
FT                   AKDGRCKTFDAAADGYVRSEGCGVLVLRRLADALARQDRIVAVVRGSAVNQDGASQGLT
FT                   VPNALAQEALIRQALEAASLRPADIDYVEAHGTGTPVGDAIEARALGAVFSGSRAEPLT
FT                   IGSVKTNLGHLESAAGVASVMKVALALQNELIPRNLNLATLNPSLALDRIPAQVPAQPL
FT                   AWRRGERRRAAGISGFALQGTNAHVVLEEAPEAVLPEPPEADRPLHLLALSAKSEGALR
FT                   DLARRYLAMRWAPSLADICHTANLGRAHFDLRMAVTGASVDDVRGRLRTLVESDFETVP
FT                   AGVTIPVQPAPARATGVVFLFSGGGAQYPGMGRRLYATQPTFRRALDRCAEIVSAYREV
FT                   PLLSVMFGDRTDLLDRMDYMQPALFAYEWAMTALWRSFGIEPAAVMGHSLGEYAAAAVA
FT                   EVFSLEDALRLICRRGLLMHEVERSQGEGAMASLAVGERAASEALSTVAGRVSIAALNG
FT                   PQNTVVSGERAAVRRLVEEFQGRGIKAKLLAVSNASHSPLMEPILEAFEEVADLVAYGR
FT                   PSLQLISNLTGGEASAEIVCDSGYWTRHIRQPVRFHDGMQTLRRLGYTRFLEVGPHPVL
FT                   LGMGQDCFPEVDDDTAWLPSARRDADEWEEMLASLGALYVRGHDVDFQGFDRDYPHRRK
FT                   LSLPTYPFDRKSYWNDVSSGSRAAPAGDRETGAHPWIGKTLASASRPGEVTCEAEIDTT
FT                   RFAFLADHAVLGRIVFPAAGFLELVAEAVTVRWGKGAACVLRDVHFATPLVLDPAKRYR
FT                   LQCVLTAGPAPGVEAEFAVLGCEGELTAPWTSHASGRIEILGAEPAAAAAAPDALRARC
FT                   PEVLTADHCFATFAAQGIAYGPGFRGVTRVLRGRREALGEVVWPEELAAGPRPAYILHP
FT                   AILDACIQVLSQCVDGAKDGDAARVGLPVQIDSVAWTGTLPAGRLLSHAVLREQSETRY
FT                   SGDVTILDADGRTIASVQGLTVSLVAQGQLRRMLGRSLHGLQHEVTWVPQEAARPASTP
FT                   SSGQTWLVFADRGGVAESLRARCEGAGITLVEVAHACTALSAASGDLDADACASVVRER
FT                   LGAGALAFDKVVFLWGLDESFSCNPTPDALAADQRLGYASLLAVAQELVRTGRERPLYV
FT                   VTRGVYADAPGAAPALSQAPLWGLAKVIQIEHPALDCVAIDLGEDPSPLFDEIASDARD
FT                   DRQVRYAGGTRLVARLTAKAAGATAPAADIDAAKTYLIAGAFGGLGVETARWLIAEKVV
FT                   RSLVLVGRRAPSPAVSQEIEAWRAQGVQVLVRMTDLANLGEVEELFAELDSGAIPPLGG
FT                   VIHAAGSLRDAALADQTWDDYADLLPAKVFGAWNLHRASLRLRQPLGLMVLFSSASSLF
FT                   GFAGQSNYAAVNAFLDALAHHRSGLGLRTIGINWGVWARIGRVADLAEGSLREAGIIAL
FT                   DPEEGMALLEAILRDGGARQVGALAVDWPRFLRTLHGEAGVPRFLEAYGRTPARGAQPK
FT                   GDVVQRVLGLPASERRTVLAQVVQAEVAQILGRGRDESLDPRIGFSELGMDSLMTVQLR
FT                   NRLKKQFGEHARIAASLAFDHPNIEALSEYLDAELARRGAPAAPAAAPAEPARAAAPDE
FT                   DAVAIVGLGCRFPGGASDPQAYWSLLSEQRCGIVPVPRERWDNDAVYDPDPDAEGRTYA
FT                   RTGGFLQEPVDSFDAGFFRIVPGEARLLDPQQRLMLEVTWEALEDGGIVPTELRGTSTG
FT                   VFVGLSYSDYALLVQRAGVTGGGLYAGTGSSASFAAGRISHFLGLQGPCLTLDTACSSS
FT                   LVALHQAAQSLRRGECTLAVAGGVNLMLAPDNTILLSRARALSRAGQCRAFDEAADGFV
FT                   RGEGCGVVILKRVRDALANGDRIYAVIRGSAVNHDGASSGLTVPNGSAQEALIRNALRV
FT                   AGVQPNEVDYVEAHGTGTPLGDPIEVRALGAALGGDRSRPLLLGSVKTNLGHLEAAAGI
FT                   ASIIKVALSLDNELLVPQLPVERVNPNIALDEIPAQVLVAPLAWKRDDAPETGTAKRRI
FT                   AGVSGFALQGTNVHVVLEEGPAATARERTAAGEAEPPAGAACLLGVSAQSGAALRQQAA
FT                   RYAEALDRAEAGSLLDFCWSANTGRAQFPWRAAVVARTREEMSRKLVALAAGEPAPPAE
FT                   PKRIAFLFTGQGSQYLGMGRQLYQTFPVFRDALDRCAALLRRERSVDLLDVMWGGGPDG
FT                   GEERLHQTEYTQAALFSLQYGLVELWKSCGVSPAAVLGHSVGEFAAAVTAGVLGWEDGL
FT                   LLIADRGRLMQRGTEPGAMVAIAAPSDAVHEVVARHAGRVGVAAVNGPRSIVVSGEAAD
FT                   VREVARHFEAQGVPVKPLQVTRAFHSPLMDPILQPFEARASEVAFARPQIRFVSSLTGA
FT                   EATDEIRTARYWTDQLRQPVLFGAGAQALVRDSQEWHVVEIGPRPTLLALAQDCVPDPA
FT                   RHLWTPTMGSKRPGAADERETEDASFLHALGQAYASGAPVRWRGVDFGAAPRRVRVPTY
FT                   PFQRKRFWIETRPGRRDPAPSGTVAAARPLLGTRLESPVLSDKAVHEVELAAESFDFVR
FT                   DHVVASAATGPVFPAAGFIEMMLEAGREASPATPVGLEAVAFENPAMLRPGESHRLQCV
FT                   VSPRAAGDRTSGEIEIHFKDGPWTRCATGRFGPGAAARADAVDIEDVRRRCRSAPSADL
FT                   YAVFDRMGLRYGPALRRIEGLWKGDGEALARIRGPGSDAVGEATPRFVLDPAVLDCGMQ
FT                   SFASCLPEGVLGETLILPVRIGALRCFGALGDARAVWSYARLVSQSGTGRRSYTGDVWI
FT                   LDDAGAVLAEIRGLTVMEASLGTARDLTYGVRWERTPAAAQALLGGTTLVYAEDGADQA
FT                   RRIVEGRLGPRAAGWHVAQSLAEARSLVADQGVRSVVFVAGDAPLLDPRRGYGPCLELI
FT                   RALSRAQGSRAGAAERPRLLVVTRNAQGTGLEAAPLSVSQAPLIGLARVARLECPEIAV
FT                   RLIDVEAGSAEWVEEVLADPAESEVAIRGGVRYVPRLTRLADLGTAPDRPLCDPGKSYL
FT                   VTGGLGALGLDVAQWLAEQEGARTLVLIGRSDPGPEVRDRIDALRSRTGARIETVALDV
FT                   ADADGLRDWLTRHVRTRTLGGIVHAAGTLADATLERQDWDKFEAVARPKVLGAWNLHAA
FT                   TQDLAVPLDFFACFSSAASLLGNAGQANYAAANAFLDLLMHERARLGMPGLSVNWGNWD
FT                   GKGLAAALRGDHGPAGAGAAGRTLMDSGLALRVFGRLLRGRVAQAGAFDIRWAEILKGS
FT                   QRVNAGTFLAEFNEAEADVPDTSSAAPRTLADIVAESALAERAEAVGRFLQEELSEVLG
FT                   ARVDPRAGLVEQGMDSLAAVEFRNRLKGRVGYAVAIPPTVIFDYPTLDALAAYLLARFE
FT                   DQEPRRGADEPRPAVRALPEAGLGGPGLADDEVEDELRALIEAELKVLEGTGADAAEEL
FT                   S"
FT   gene            complement(201249..203141)
FT                   /locus_tag="M446_0171"
FT   CDS_pept        complement(201249..203141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0171"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase;
FT                   phosphopantetheine-binding; KEGG: gsu:GSU1103 acyl-CoA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14750"
FT                   /db_xref="GOA:B0UE66"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B0UE66"
FT                   /protein_id="ACA14750.1"
FT                   /translation="MEYAKVTLPDLLQIAADTTPDAPAVVFRDRRMSYGQLFERARRLA
FT                   GGLLGIGIKPGDHVGMMLPNWPEFLEVYFAASWIGAVIVPLSVQLRSLELEYVIGHAEI
FT                   TVLVVPDRFDGADYVRLIDDLRPKLPRIRHAVVVPAAGEAAEAGPGWIPYEALLSGPRG
FT                   ERAAADPDRVAMILYTSGTTGAPKGVMLSHQNMIWTAMNENRALEITNRDSLLLVVPFF
FT                   HVFGAVVGIACAVAAGAAMVILDRFDAEEVLATIEEERCTVLYGTPTMFVLELNAPRFD
FT                   AFDLTSLRTGMIAAAPCPVEVVKDIMHRMHCNVAVSYGLTETSPALTVTRFDDPPAIRA
FT                   ETVGRALPGIELRVVDETRRPVPLGTTGELACRGYAVMKGYYKDPRQTAEIIDADGWLY
FT                   TGDLATLDAEGYVRIVGRKKDLIKQGGMAIFPSDIENYLYEHPAVEQVAIVGVPDEVLG
FT                   ERCRAYVKVRAGHDLTGEDVAAFCRDRIADYKIPRDVVFVETFPLTASGKIKKSVLREM
FT                   ARKGAARACTGSIVERVRDAAGPYDRKRIVREFLEAELAEVLNGRDRPARAAPVGARGV
FT                   GFRDMGLKSLQAIQLRQRLSEALGDTIELSATVAFEFPTVEELSQHLLDAIAAA"
FT   gene            complement(203653..213183)
FT                   /locus_tag="M446_0172"
FT   CDS_pept        complement(203653..213183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0172"
FT                   /product="Beta-ketoacyl synthase"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR;
FT                   phosphopantetheine-binding; Alcohol dehydrogenase
FT                   zinc-binding domain protein; Alcohol dehydrogenase GroES
FT                   domain protein; KR domain protein; Beta-ketoacyl synthase;
FT                   Acyl transferase; KEGG: sen:SACE_2875 modular polyketide
FT                   synthase-"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14751"
FT                   /db_xref="GOA:B0UE67"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042104"
FT                   /db_xref="UniProtKB/TrEMBL:B0UE67"
FT                   /protein_id="ACA14751.1"
FT                   /translation="MSLENGAAGPAGSQALARQQLAVLKGLRAQVDTLERQRDEPIAIV
FT                   GMGCRFPGGAHDPDSFWDLLRGGRHGMVPIPKDRWDADAFYDPEPGRPGKTYVRTGGYL
FT                   HWNVDQFDAAFFRISPREAQYIDPQQRLLLEVTWEALENAGCDPTRLAGSATGVFMGVM
FT                   NFDYSKMLSVPSRVEEQSLYVASGNGHSVVAGRVSFVLGLQGPSVSLDTACSSSLVSVH
FT                   LACQSLRSGECDLALAGGVNLILGPYGTLCFSQAKALSLTGFSRTFDAGADGYAQSEGC
FT                   GVLVLKRLSDAVRQNDRILAVVLGSAVNQDGASGGLTVPNGPAQEAVMRTALKRAKLRP
FT                   ADIDYLEAHGTGTKLGDPIEVRAAGNVLREGRSADQPVMLGSVKTNIGHTEVAAGVAGI
FT                   MKVVLALQNDEIPPHLHFKELNPHIAIDDVPARIVTEPAPWRRGGRRRAAGVSAFGFSG
FT                   TNAHVVLGEAPPPAERPAGPERTAHLLALSAANDAALRDLAARHVAQLERTEPDLGDYC
FT                   FTANAGRCHFGRRAALVAGTRPELVGKLKDVVEQAAGGAAETEQPKVAFLFTGQGSQYF
FT                   GMGRQLYETQPSFRNAMDACAGLLASHLDVDLLDVMWGRASPELIHQTRYTQPALFALE
FT                   YSLAQLWQSWGIRAGAALGHSVGEYCAATVAGVLSLEDGLTLIAHRARLMQERCTPGDM
FT                   CAVEADAAEVGALIERWEGRVSVAAINGPAATVISGERDAVAAAAAALEGRNVRVKRLT
FT                   VSHAFHSALMDPMLEEFEGIAAGLTHHASRVRLISNVTGEAISGQEMARPGYWSRQVRG
FT                   TVRFSEGMRTLEQAGCRCFLEIGPHPVLIGMGQTCLSDPDSRIWRASLRRGQDDCREML
FT                   EAAAHLYTAGVNLDWESYDRDFGRRKLSLPTYPFQRQRYWMANDKPARLVLAGSRRHPL
FT                   LASSVESAVAPGTTIAIAELEPGAPEYLADHRVYGRVLVPAAAFLEIALAAGAESLRAD
FT                   ELAISDVVFEQACILEEGAGRQLQCVLTREEGSDAHDFQLLGKGQGWSRHASGRIAAVA
FT                   GEDSLALKPDQDLDAIRARCAEDLVGEQCYERFQTTGIAYGPAFQGLDRVSRGPKEALA
FT                   RLSLPEAARASPETGYHLHPVILDSCFQLLAHSIPDDGPAGIAYLPVGIETLRVRKLPS
FT                   DGELNGHVVLRDGGEGKAFTGDARILGARGEVLAEILGLRVVQAAKESVLKSLGVADQD
FT                   LLYELRWLPRPLDAPADPGAGRIWVFAGSGPAGEDLCAALAGEGRRVERLPLDGDDEGL
FT                   LAAMRRMLDTEGAPDKAIFVPGPGARGGATRLDDLAADAVGRAQRDAYLPVLRAVQLLV
FT                   KQDGTRAFYLVTEEAVQGEGILVSPLRGLFTTLRLEHPEAKWISVDFEDRIDPAALRAE
FT                   VGAVPAEEQIAYAREAGGLRRSVARLARRDRAGGLSLPAESYLLDCAERGAIDNLRVVP
FT                   MTRRPLGRGEVEIAVKATGLNFRDVLGVMGMYPGDPGPLGQDAAGVVSAVGEDVVDFAV
FT                   GDRVLTILAGSFASHIATLPQVVMRIPDGMSFEEAATIPVVFLTAHYALNRLGRMRAGE
FT                   RVLIHAGAGGVGMAAIQLARNAGAEIFVTVGSPEKADLMRSLGIRHVFSSRSLDFHDDV
FT                   LRATGQEGVDLVLNSLAGEFIPKSLGLLREGGRFLEIGKVGIWSEAEALAFRPGISSFT
FT                   IALDELTSQPELVGGLFREVMADFAAGRLTPLPRRSYPLLDVKDAFRFMAQGKHTGKIV
FT                   VSHATASGEAGACRAGATYLITGGLGGLGLTVARWMVEREGARELVLVGRSGPSDAALE
FT                   ALRGLEEQGARILVRSVDVADPDAVADLLRQMEREGCPPLAGIVHAAGLRDDGVLEQQS
FT                   WDKYERVMAPKVLGAWNLHRAAQRAGCALDFFVCFSSAASLLGNSGQANYAAANAFLDA
FT                   LMAYRRSRGLAGLSINWGAWSEVGLAADLVRSNAIATGMGAISPEEGVALFGQLLRQRG
FT                   GQVGVLPMDWNEVLRRSAGEVPPFLSEIVKPRDGARKRPDAAGAKLLSQLAAAPSAERG
FT                   SVLTAFVQGELALVLGMQGEQKLDPRKGFKDLGVDSLMAVELRNRLRKGIGDRVKLPAT
FT                   LVFDYPTVEALAGFLGDALAALPDAKAPAADAKAPAADAKAPAAPSATAPAAQGPAAQD
FT                   PAAQRAPVARPGAAEPIAIVGMGCRFPGGSSDPDRFWQLLTEGRDAVIEVPKDRWDADA
FT                   LFDPDPDAVGKTYAKWGGFLQERIDLFDAPFFDVPAHEAKFMDPQQRLLLEVTWEALEN
FT                   AGIPPADLLGSDTGVFVGVSNMDYARLQDDPRTIQEAGLYSGTGTGLSYASGRVSYLLG
FT                   LQGPSVTLDTACSSSLVAVHQACQSLRLRESTLAIAAGVNLLLSPQSTIALSHARALAP
FT                   DGRSKAFDASANGFSRGEGCGAVLLKRLSDAVADGDRILAVIRGSAVNQDGASSGLTVP
FT                   NGRAQEALIRQALRQAAVAPAEVSYVEAHGTGTSLGDPIEMRAIGAVLGEGRDAGHPLY
FT                   VGSVKTNLGHLEPAAGMAGLLKVVLSLQHHAIPAHLHFRTLNPYISLDDIPARIPTELT
FT                   PWRSDGESRIAGVSAFALQGTNAHVIVEEYRDGADASPAADRSPCEVLALSAKSEPALQ
FT                   RLASDYAAFLSSNPDVSLRDVCHTAQRGRGHFGHRLAVVGSTAEELVAALRAQSARRFS
FT                   PASDPGKVAFLFTGQGAQYFGMGQQLYAWLPAFRSAMDRCAEIVSPLLGCSLLDLLWSG
FT                   ADERRLHRTEYTQPCLFALEYALAEAWRACGVRPSAVLGHSVGEYVAATVAGVMSLEDG
FT                   LTLVAARGRLMGQLCETGQMIAVAAGLPELEGWLAEAGGKVAVAAVNGPNSTVLSGETD
FT                   SIAVLGEALRGRGLRVRPLTVSHAFHSPLVEPMLREFGAVAARIAYRAPEIRMVSNLTG
FT                   RSIGGEGMDWAEYWQRQTRGAVLFGDGVAELDRLGCRVFVEIGPHPVLTAMGQECLPSP
FT                   EAALWVGSLRKDHDDPREWLGAVGQLYARGVQIDWTGGTGTAPARKLALPTYPFQRSRY
FT                   WVDGKSAAPAATAPVQVEEVAPTRADGFLWEQLTLAPPASRKEILTDHISSLLEDILGS
FT                   GSRDRFDLETNFMDLGVDSLVAVAFKNRIQKSFGSHLKIPAMMVFDHPTIDGAADYLLA
FT                   RIRA"
FT   gene            complement(213180..214109)
FT                   /locus_tag="M446_0173"
FT   CDS_pept        complement(213180..214109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0173"
FT                   /product="putative dialkylrecorsinol condensing enzyme"
FT                   /note="KEGG: azo:azo0293 probable dialkylrecorsinol
FT                   condensing enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14752"
FT                   /db_xref="GOA:B0UE68"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B0UE68"
FT                   /protein_id="ACA14752.1"
FT                   /translation="MTRKVLCLFYSNSGQTEMIIDHLLEPLRRDGEVDLHLERIRPATA
FT                   YPFPWSFLSFFSVFPEAVREVAGAIEEPSFPRDETYDLVVLAYPVWFLSVATPMMSFLK
FT                   SEKARVLAGTDVVTVVTCRSMWSQAQISMQEQLARLGSKLIGHVTFKDRSGNRPVTFVS
FT                   TPLWLITGRKSVSRYIPEAGVAPEAIRSAGRFGRAMLAHLGLDPGPGEAVPPLRQSEAL
FT                   TTTATSEAVGKSIFRASALLIATCSTPNGPTRKPLVAVFVALLFAIALTFLPTWVLLVR
FT                   LGQRAGLVCRTRQIVRFAGEQVQTGGTA"
FT   gene            complement(214120..215265)
FT                   /locus_tag="M446_0174"
FT   CDS_pept        complement(214120..215265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0174"
FT                   /product="3-Oxoacyl-(acyl-carrier-protein (ACP)) synthase
FT                   III domain protein"
FT                   /note="PFAM: 3-Oxoacyl-[acyl-carrier-protein (ACP)]
FT                   synthase III domain protein; KEGG: dar:Daro_2368
FT                   3-oxoacyl-(acyl carrier protein) synthase III"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14753"
FT                   /db_xref="GOA:B0UE69"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:B0UE69"
FT                   /protein_id="ACA14753.1"
FT                   /translation="MHHAYITNTSLFLPNRPVGNDEMEAVLGIAGSKPSALRPLILEKN
FT                   GIKARHYAIDPETGRATHTNAEMTAAAVRGLFAGEPEGLESLDFLACGTSSPDQVRPSH
FT                   AVMVHGLLRSPPCEVASFEGMCVVGAQSLKSAQLMVATGEAESAVATGSEAASSFMRGS
FT                   FFTPEFRERQIQLEKNPILAFEKDFLRWMLSDGAGAVLVRSKPDPARVSLRIEWVDVVS
FT                   YAGEHDVCMYHGAVKDEDGRLVGYRNLPPETWHKASVFAFKQDVELLNEHMLALGARAY
FT                   RTVKDRRRLDEDKVTYFLPHISSYFFKEQMLKHMGEYGLNIPESKWFMNLERVGNVGSA
FT                   SPYAMLDELFKSGRLRPGDQVLLFVPESGRFTMSYILLTAV"
FT   gene            complement(215355..217058)
FT                   /locus_tag="M446_0175"
FT   CDS_pept        complement(215355..217058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0175"
FT                   /product="Histidine ammonia-lyase"
FT                   /EC_number="4.3.1.3"
FT                   /note="PFAM: phenylalanine/histidine ammonia-lyase; KEGG:
FT                   ava:Ava_3988 phenylalanine/histidine ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14754"
FT                   /db_xref="GOA:B0UE70"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR022313"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:B0UE70"
FT                   /protein_id="ACA14754.1"
FT                   /translation="MNSNQQIIVSGSRLSVDQIVEVGLHKRNLFLTCDPQLRRTINDAA
FT                   DFVYRAVANEEVVYGINTNFGGMANQVLSLNEVEDLQQNLIWGLKCGVGKKLPAAQVRS
FT                   AMFIRANMLAKGVSGARAELIERYLVFLNAGITPVVRDLGSIGASGDLVPLAQIAGCLI
FT                   GLGPSFRVERDGEEMDALSALSMLNLQPLKLRAKEGLALVNGSSMMSSIGAHCVHDTRH
FT                   LTRLALHVHAMLIQALNASSESFDPFIHQNKPHPGQIAVAAAMRHLLRGSKSLKPNGHR
FT                   KADGSGSLLQDRYSVRCLPQYLGPIVDGLHAIEGQIEVEANSVDDNPLIDLENERLLHG
FT                   GNFFAEYVALGMDQLRTYMALLAKHLDVQIAFAVAPEFNSGLPASLVGDQDNRIKFGLK
FT                   GLQICANSIVPKLLHLSNGISVLFPTHAEQFNQNINSQGFNSATLASESVSLFKQYLAI
FT                   SLVFGIQAMDLRARATGGGFDGRRYLSPTLLPLYETVRALLGRPASDERPLVFRNDEQD
FT                   LSDHVAAIVADLSRPGGEIIGAMAAEFAPGAGPAFGSPATRAGGRVAVAP"
FT   gene            complement(217688..218215)
FT                   /pseudo
FT                   /locus_tag="M446_0176"
FT   gene            complement(218339..220606)
FT                   /locus_tag="M446_0177"
FT   CDS_pept        complement(218339..220606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0177"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; copper-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; YHS domain
FT                   protein; E1-E2 ATPase-associated domain protein; KEGG:
FT                   oan:Oant_3233 heavy metal translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14755"
FT                   /db_xref="GOA:B0UE71"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR007029"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B0UE71"
FT                   /protein_id="ACA14755.1"
FT                   /translation="MIVDPHTAKHRAQHNGRPYYFCSAGCQAKFAADPARYLDPASSAA
FT                   KADPVPEGTIYTCPMHPEVRQVGPGACPICGMALEPLLVSADTGPSAELVDMTRRFWVG
FT                   LVLTLPVFALEMGGHLTGLVDRLGQQNSNWLQLVLATPVVLWAGSPFFERGWASVKSRN
FT                   LNMFTLIALGTGVAWLYSVVATAAPGVFPAALRGHGGAVPAYFEAAAVITVLVLLGQVL
FT                   ELRARESTSGALRALLDLAPKTARRLRADGSEEEVGLDTVQVGDRLRVRPGEKVPVDGS
FT                   VIEGRSSVDEALVTGEAMPVSKDVGAAVIGGTLNQSGALVIEARNVGRDTMLARIVQLV
FT                   AEAQRSRAPIQRLADQVAGWFVPVVMAVAALAFVAWFALGPEPRFTYGLLAAVAVLIIA
FT                   CPCALGLATPMSIMVGVGRGAQAGVLIKNAEALERMETITTLVVDKTGTLTEGKPAVTQ
FT                   VVPAEGFTDAEILRLAASVERASEHPLAVAIVAAAEKQGLALAPVSDFDSPTGRGALGT
FT                   VEGRKIRLGNAKFLGEAGIPTAALDLQADRLRQDGATAIFMSVDDRVAGAIAIADPIKA
FT                   TTPEALRALRAEGIRVVMLTGDNRTTAQAVARTLGIDEVEAEVLPDQKSAVVKAHQARG
FT                   QVVAMAGDGVNDAPALAAADVGIAMGSGTDVAIESAGITLLKGDLNGIVRARRLSRATM
FT                   SNIRQNLFFAFIYNAAGVPVAAGVLYPFLGILLSPIIAAAAMALSSVSVIGNALRLRTA
FT                   HL"
FT   gene            220942..221370
FT                   /locus_tag="M446_0178"
FT   CDS_pept        220942..221370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0178"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="TIGRFAM: Cu(I)-responsive transcriptional regulator;
FT                   PFAM: regulatory protein MerR; Transcription regulator MerR
FT                   DNA binding; KEGG: bpt:Bpet2542 transcriptional regulator,
FT                   MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14756"
FT                   /db_xref="GOA:B0UE72"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011789"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:B0UE72"
FT                   /protein_id="ACA14756.1"
FT                   /translation="MNIGQAAQASGVSAKMIRYYESIGLVPPAGRRESGYRDYGPADLH
FT                   RLGFIRRARDLGFSVERIRLLLELWSDQGRSNAEVKAIALTHINELEERAKQLQEMAGA
FT                   LRALANACDGDGRPDCPIIQGLEAGGAAACHGALPARH"
FT   gene            complement(221405..221833)
FT                   /locus_tag="M446_0179"
FT   CDS_pept        complement(221405..221833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0179"
FT                   /product="protein of unknown function DUF305"
FT                   /note="PFAM: protein of unknown function DUF305; KEGG:
FT                   pde:Pden_0926 protein of unknown function DUF305"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14757"
FT                   /db_xref="InterPro:IPR005183"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:B0UE73"
FT                   /protein_id="ACA14757.1"
FT                   /translation="MTTTRALLATALLATGLAGAALAQNPHGDMGKMPMGGSTAMHDQM
FT                   QKMMADMQSAPGDAPSTKDFKEADMAMMHTMSIAYTGDPDVDFRTHMIPHHKGAIDMAK
FT                   VALKHAKDASTKQMAQKIIDDQEKEITDMQAWLKQHGK"
FT   sig_peptide     complement(221762..221833)
FT                   /locus_tag="M446_0179"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 24"
FT   gene            complement(221861..222241)
FT                   /locus_tag="M446_0180"
FT   CDS_pept        complement(221861..222241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0180"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xau:Xaut_3407 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14758"
FT                   /db_xref="UniProtKB/TrEMBL:B0UE74"
FT                   /protein_id="ACA14758.1"
FT                   /translation="MRLIPAKFLALAGLLASAPVLPALAHAPKTGSHGGPQTDAGPYHV
FT                   ELVASGTTLELYLRSHADQPVTTAGFKGTAILVVDGKPQRITLEPQGDRLTGTSPVSLP
FT                   AALKGAVQLTTPNGSTASGKFN"
FT   sig_peptide     complement(222164..222241)
FT                   /locus_tag="M446_0180"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 26"
FT   gene            complement(222276..225419)
FT                   /locus_tag="M446_0181"
FT   CDS_pept        complement(222276..225419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0181"
FT                   /product="heavy metal efflux pump, CzcA family"
FT                   /note="TIGRFAM: heavy metal efflux pump, CzcA family; PFAM:
FT                   acriflavin resistance protein; KEGG: mex:Mext_2831
FT                   acriflavin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14759"
FT                   /db_xref="GOA:B0UE75"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B0UE75"
FT                   /protein_id="ACA14759.1"
FT                   /translation="MFTFLVSQSLKNRLLVLAAAAVLVLSGAFTVGRLPVDVFPDLNRP
FT                   TVTIMTEAEGYAPPEVEQLVTYPIETRMNGLPGVSRVRSVSGVGLSIVYVEFDWGTDIY
FT                   RNRQQIAERLALLQDQLPRGAIPQMGPISSIMGQILLVAVTSDKASAMEVREVADFTIR
FT                   PRLLTLPGVAQVIPIGGEVRQFRVAPNPAAMRALGVSNAQLETTLQSFGTNAGGGFTDQ
FT                   YAREYLIRNIARTMSLDDLRNVVVATVNNAPVSLRQVAEVWFAAKVKRGDAGYMARPAV
FT                   IVSVEKQPDVDTVTLSRSIEQALKELTPSLPGGIKADQILFRQANFIETSIRNVERVLL
FT                   EAVAVVAVVLFLFLLNVRTTAISLLAIPVSILSTAVVFHLFGLSINTMTLGGLAIAIGD
FT                   LVDDAVVDVENIFRRLGENRRAGNPKSVFQVVVEASNEVRSGIVYATMIIILVFVPLFA
FT                   LSGIEGRLFAPLGQAYIISILASLITSITLTPVLASWLLPGLKNLEAHDSRFLKALKRG
FT                   NAALLKVAFLQQHLLIGGVATAVLAAGVAAWQLPRAFLPPFNEGSFTVNMTFNPGISLA
FT                   ESNRVGLIAEKLLLEIPGVSAVGRRTGRAELDEHAEGVHASEIEVELHEGTERPKAQLV
FT                   ADIRQRLAVLPVSVNVGQPISHRLDHMLSGVRAELALKIYGEDLDALRRIANGLQDRLS
FT                   KIPGLADLQVEKQVRIPQLEIRVDYTRAALYGVQPAAVVDQISRLSNGRVVSTVVDGLR
FT                   RFDVLIRLPEDQRTTAGLGDLLLETPSGWVPARQVADIRETDGPNQILRENARRRIVVQ
FT                   ANTTGASDMTTIVAAIRLAVAQEPMPPGFFTSLEGTFQAQEEATRTIAALSALSLALIF
FT                   AILCSRYRSAALALIIMGNVPLALIGSVVALWLVGQPLSVASMIGFITLTGISARNGIL
FT                   KISHYLNLALHEDVPFGKDLVIRGSLERLTPVLMTALSAGVALVPLLYDATAPGKEILH
FT                   PVAVTIFGGLISATLLDTFLTPILFLRFGRTPLERLRAAPVPTASSAAGAPAPPREAF"
FT   sig_peptide     complement(225327..225419)
FT                   /locus_tag="M446_0181"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.549 at
FT                   residue 31"
FT   gene            complement(225434..227185)
FT                   /locus_tag="M446_0182"
FT   CDS_pept        complement(225434..227185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0182"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; KEGG: mex:Mext_2832 efflux transporter, RND
FT                   family, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14760"
FT                   /db_xref="GOA:B0UE76"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B0UE76"
FT                   /protein_id="ACA14760.1"
FT                   /translation="MPPHIPAALPALAVALALLTGPACAHEGHDHGASPPPVSKTMAPR
FT                   GEAASAAFELVAVPKNGTLHLYLDRFATDEPVRGATLTVETPTGSVDATAAADGTYQLL
FT                   APWLQKPGHFDLMITVTAGEDVDVLPLALDLRDPHAQPAAPAGPVGTTEALSAAVGQTV
FT                   PAVAQGLKARLIEKDPVLVAVAGGAFLLGILATLLARGHRRVPVIAVLAITATVLLSAT
FT                   AFAHGDGDHGHPESQAALMPSAAHGAAGADLAQRLPDGSVFVPKPTQRLLELRTVMTAV
FT                   GSYRRTVGLPGRIIPNPNASGVVQSSVGGRLSQPPSGQFPRLGTPVKKGDVLAFVTPPV
FT                   QRVDVSDMRQRQGELDQQIATVQRRVERYTKLASSGAVSQVQLDEAQDELKGLHDRRAA
FT                   LDKVRTEPEALVAPVSGVIAEASAVAGQMANPGQMVFQIVDPKSLWVEALSFDALGGAE
FT                   NATARLADGRSLTLTYQGSGLADRNQAIPVQFAISGDTGGLRVGQFVTVLAATTAELQG
FT                   LALPRAAVVRTGNGQDVVYAHTTAERFEARPVRVEPLDGSRVLIAAGVGAGTRVVTQGA
FT                   ELLDQVR"
FT   sig_peptide     complement(227108..227185)
FT                   /locus_tag="M446_0182"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 26"
FT   gene            complement(227953..228130)
FT                   /pseudo
FT                   /locus_tag="M446_0183"
FT   gene            complement(228242..229379)
FT                   /pseudo
FT                   /locus_tag="M446_0184"
FT   gene            complement(229376..229774)
FT                   /locus_tag="M446_0185"
FT   CDS_pept        complement(229376..229774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0185"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG: bja:bsr2863
FT                   two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14761"
FT                   /db_xref="GOA:B0UE77"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B0UE77"
FT                   /protein_id="ACA14761.1"
FT                   /translation="MSVLILVVDDEPDVADLFRQQFRRELRAGRFALAFAHSAEAALAR
FT                   VGAAGEETLILILSDINMPGMTGLELLPRMRSARPDVPVIMITAYGDAETRRRATEGGA
FT                   AGLLTKPIDFLTLRVEVDRRLSEVGRAA"
FT   gene            complement(229786..232359)
FT                   /locus_tag="M446_0186"
FT   CDS_pept        complement(229786..232359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0186"
FT                   /product="GAF sensor signal transduction histidine kinase"
FT                   /note="PFAM: GAF domain protein; ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein; KEGG:
FT                   bja:bll3106 two-component sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14762"
FT                   /db_xref="GOA:B0UE78"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B0UE78"
FT                   /protein_id="ACA14762.1"
FT                   /translation="MRRRHENEPAKGRRANERKGCAKALTTATPSVADLQKRVDVLACE
FT                   LRAALERQTATAEVIEFINSDTKDLASAFAMILDKMHILCGVCHGSLQLYDGEKFRAVA
FT                   THGMVKAFADRLREGFTPGPHHPSQQLLQGARFTQVPDCAESDDPTVRAAFELDGIRTV
FT                   LLTPLRKDGRLIGQIAAARRDGNPFTENEITLLENFGAQAVIAVENARLLNEAQAKTRD
FT                   LEASLQQQTAVGDVLKIISSSTFELQPVLDTLVETAARLCEADMAFILRREGEIYKAGA
FT                   AVGYSEDYIEFLKSHPIPVDRGTVTGRAAMERRTVHILDVAADPEYTLRTATALAHQHT
FT                   ALGVPLLRENEPIGVIVIARQRVEPFTQAQIDLVTTFADQAVIAIENARLFNEVQGKTR
FT                   DLEEALQQQTATSEVLQTISRSVFDLPTILNTLLHSATRLCRTETSALYLLHEGRLHLE
FT                   ASTANRPEWVAYKRAHPQPLTRDVPSSRAAVTGQIDHVPDILQDPELTSASELHRIGGY
FT                   RATLNVPLVREGSVIGVLSLARDEPGPFAPRQIAVAKTFADQAVIAIANARLFNEVEAK
FT                   SRELQASLDNLCATQDRLVQSEKLASLGQLTAGIAHEIKNPLNFVNNFAALSAELIDEL
FT                   NEVLAPPALDGPVREEVDELTGLLRGNLEKVVQHGKRADSIVRNMLLHSREGSGERRRV
FT                   DVNALVEESLNLAYHGARAEKPGFTVTLARDLDPGAGGADLYPQEIARVLLNLISNGFH
FT                   AVTKRKAETEAAGYEPTLLVATCDRGDKIEITIRDNGTGIPDAVRAKMFNPFFTTKPAG
FT                   EGTGLGLSLSHDIVVKQHGGSIEVETEPGAFTAFRILLPRGGPTQ"
FT   gene            complement(232578..232808)
FT                   /locus_tag="M446_0187"
FT   CDS_pept        complement(232578..232808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0187"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14763"
FT                   /db_xref="UniProtKB/TrEMBL:B0UE79"
FT                   /protein_id="ACA14763.1"
FT                   /translation="MRAKPHDIDALRTVLIQEDLDPESYSLSGGTPDERSVLSRQGAQW
FT                   GAFYSERGTRSDLHVTRPSRTHARSSREPSR"
FT   gene            complement(232910..233773)
FT                   /locus_tag="M446_0188"
FT   CDS_pept        complement(232910..233773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0188"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG: rso:RSp0548
FT                   ISRSO8-transposase orfB protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14764"
FT                   /db_xref="GOA:B0UE80"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B0UE80"
FT                   /protein_id="ACA14764.1"
FT                   /translation="MKFRFIDDHQGTWPVRTLCRALRVWPSGYDAWRSRPESTRAAENR
FT                   VLLEEVRRLHARRHGRYGSPRMHAALRAEGRGVSRGRIERLMRRHGIRATAAGRDRPGT
FT                   TDSRHGLPVAPNLLEQRFTASAPNQIWLADITYVPTGEGWLSLAAVLDLATRKVVGWAM
FT                   REHLRTELAAAALLMAVQRQRPAPGLIQHTDRGCQYASGEYRRLLDAAGLKASMSRRGN
FT                   GLDNAPMESFFHTLKVELVHQRRWATRDEARRELFSDSEGYANRQRIHAALGYTTPEQA
FT                   ERQMVS"
FT   gene            234003..235202
FT                   /locus_tag="M446_0189"
FT   CDS_pept        234003..235202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0189"
FT                   /product="transposase mutator type"
FT                   /note="PFAM: transposase mutator type; KEGG: rpc:RPC_3939
FT                   transposase, mutator type"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14765"
FT                   /db_xref="GOA:B0UE81"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:B0UE81"
FT                   /protein_id="ACA14765.1"
FT                   /translation="MTDEMMSLRGLLEKSADADLLREMIGFAAERLMELEVGGLTGAAH
FT                   GEKSAERLVQRNGYRDRDWQTRAGTVELRIPKLRKGSYFPAFLEPRRMAEKALTAVIQE
FT                   AYIQGISTRSVDDLVQAMGGTGVSKSQVSRLCQEIDERVGAFLDRPLEGEWSYLWIDAT
FT                   SVKVRQAGRIVSVAVIVAVGVNSDGRREALGMDIGPSEAETFWTGFLRKLARRGLRGVK
FT                   LVISDAHTGLKASVAKVMNATWQRCRVHFMRTVLAHAGRSGRRVVSAFIATAFAQDDAE
FT                   AARQQWRRVADQLRPKVPKLAALMHEAEPDVLAYMGFPAAHRVKLHSTNPLERLNGEIK
FT                   RRTEVVGIFPNEAAITRLVGALLLEQNDEWAVQRARYLTLESIAPISDDPLVSLPTLAA
FT                   "
FT   gene            235984..237222
FT                   /pseudo
FT                   /locus_tag="M446_0190"
FT   gene            237235..239574
FT                   /locus_tag="M446_0191"
FT   CDS_pept        237235..239574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0191"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   azc:AZC_0051 putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14766"
FT                   /db_xref="GOA:B0UE82"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:B0UE82"
FT                   /protein_id="ACA14766.1"
FT                   /translation="MLMHSPFAISPSTILVDARALQDRDYRYRGVGQHSTVILRALRFC
FT                   VWGDRRPRMVALIDPSLEHLADEHALLFDEISATGYPAVTGSLFLSLSSMTHDPVWASK
FT                   YLLDPNIFRVSLFYDLIQLQFPNRYLPNLEGQLSFLTNLLWLKKYDCFSAISKFCVGEL
FT                   TNIVNIPADRIFVSYVAVRQGLEPAPSSTVRPFEERKHVLFAGGGDPRKNPDCAVIAHA
FT                   RSRRLREAKIDLVLFGNYNPETRLKLRTLHASNGGDPHSISFLNHLTDEDLQQFYANAV
FT                   LTVVASKAEGFSIPIVESNAAGTPVLASDVGAHPELFPNPAHRFNPDDPDGLRKKLDEL
FT                   CTDAHSWSVIKDAQDGLWRRFTVEAVGEAFLRGLAGAYRGRIAAPSVHRGTARPSLSLL
FT                   SPLPPAASGVADYSAATFKALARKADLHVYTSVPGVAPCSWFASLNSITQARFSARQRD
FT                   ATVAVIGNSHFHTSEFEYLLENGCAAIAHDARMINYYVQLRGMESAIKIATQECGHAVE
FT                   ESTVRDWLHNQDRLPILFMSEIARCAKPLMVHSPMTANIIEEHYRERPVLLPFAQYNSL
FT                   DLTAATPSRRREIRQKLGWSDDEVVLCTFGYVSDDKAPEELIWATKILNDWKIPATLKF
FT                   CGQPHYDTGVRAVQLVEELGITEKVSFERKFVPQDLYREYIFAADIGVQLRTYFMGGLS
FT                   GALNDCIAAALPSIANDHLAEAMIAPSFVRRIPDKLSPILIAEAVLDILDSRQNQERPI
FT                   DEATFCARERSPDVYAEKLLAALGFA"
FT   gene            239575..240741
FT                   /locus_tag="M446_0192"
FT   CDS_pept        239575..240741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0192"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   azc:AZC_0050 putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14767"
FT                   /db_xref="GOA:B0UE83"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:B0UE83"
FT                   /protein_id="ACA14767.1"
FT                   /translation="MAEILVDISQFVEFPARSGIQRVVSKLLVAWGEDRLFRWVRFDPA
FT                   ARRFIQIPPRMLDLLRHELFLADDVSGEIGKRLTLELASQPGWPVEVSDSQIVFVPEVF
FT                   YSQERVKFYRELREARRIRDAYLVFDFMPWLKPSHFAIAKGFGPASMPYIQLLHEAHLR
FT                   LFISRNTREEYVNRVRRAAAASQDAVVRLGADGLGGARQAFSTDRKRVCCVGAFDGKKG
FT                   QDLVYDAFNDVETDLELHFAGKLLPSMIEKYRRIVETTNTKVWVHDDLSDSALVELVSG
FT                   ARASIFVSENEGFGLPALESLFIGVPLIASASLPALEDVPEYGQIQLGAVNKATVAGAF
FT                   HRIADDQEARRLAAEIALLGLPTWTDFAANCRGRLLSLMHGASYTPAL"
FT   gene            240767..241873
FT                   /locus_tag="M446_0193"
FT   CDS_pept        240767..241873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0193"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: jan:Jann_1557 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14768"
FT                   /db_xref="InterPro:IPR025282"
FT                   /db_xref="UniProtKB/TrEMBL:B0UE84"
FT                   /protein_id="ACA14768.1"
FT                   /translation="MNASVDKQSAHDAGVTADAARHTPRFEPTPTITDQHLLTHGNEFQ
FT                   CVRLISDIIDKNPSNFHDQLYQLLTSREFHDAFMRTRMARQSLVGEIFASLLGREPDPS
FT                   GFDTYSQELTVKSPGQVIAGLLKSDEFKARHRADFSGIDADTLVAAAYTAILEREADPA
FT                   GVEMYGNALRSGMSAHALLSEFIAMQPAQAAFRQAVVEGLYKSLLGRAPDPVGLEGHSQ
FT                   ALATDTPSKVIEDILGSQEFLERERRMPGKTDAATLVGAVYTAILGRDPDPRGIEIYGE
FT                   ALRNGMTVHALLAEFVGMLQRADASPPSNAARDTALEVCTMAREMMIARLVSQGCNLQL
FT                   GASVQAGGDLAKLGRKTANALLSLQMLA"
FT   gene            241915..242451
FT                   /locus_tag="M446_0194"
FT   CDS_pept        241915..242451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0194"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14769"
FT                   /db_xref="UniProtKB/TrEMBL:B0UE85"
FT                   /protein_id="ACA14769.1"
FT                   /translation="MVETGRPGLTFASGGFDPGLDLALLILKPVEGSSRNSTTACRGGS
FT                   MEGPTMSSTGAAKSGSVERVKLRARCGFSCARPRRAGRSGTRSRPRQPRCGLYPRVTSA
FT                   GGPEQVSASTLARGPRGRGGLPGGRVLVAQVAEAADRVAHANPSGRSGLYGGQEPGQPA
FT                   AGSPAELDDAPGAEP"
FT   gene            242543..243679
FT                   /locus_tag="M446_0195"
FT   CDS_pept        242543..243679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0195"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: azc:AZC_0734 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14770"
FT                   /db_xref="GOA:B0UE86"
FT                   /db_xref="InterPro:IPR005331"
FT                   /db_xref="UniProtKB/TrEMBL:B0UE86"
FT                   /protein_id="ACA14770.1"
FT                   /translation="MVDEQMVENALVIPKLFLIHIPKTAGTNIFVSLSEQVPAEMICPV
FT                   RFNDLHVVPKSLLNKWTYFVLHCGFSHIRVIDGHLITATFIRDPVERFISMLRFLRRQK
FT                   DNPSGLMTILNSINDYDFIMSSETENFATHLANDATFRLSQTEFAASEYDPGVNIADLA
FT                   ESKLGVASENLEKLDYIGLSECFDFSFMNLCGILGISASQKGRKINASAEQRPSIYSDE
FT                   AVLTRIKYLTRFDNEIYQRGSKIFYDKNGGMKFELSAISGVLQERAGMKYVVHAKNGHV
FT                   LIGPYIDLPAGRYKLEFQILEAELNSNTGYLRFDATAGMGSHLLAVHEEAVTDSRISNK
FT                   TIIFDFQLLEFSSNIEFRVATEGVTAAVSRHILVKRIF"
FT   gene            243725..243904
FT                   /pseudo
FT                   /locus_tag="M446_0196"
FT   gene            complement(244425..245393)
FT                   /locus_tag="M446_0197"
FT   CDS_pept        complement(244425..245393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0197"
FT                   /product="oxidoreductase molybdopterin binding"
FT                   /note="PFAM: oxidoreductase molybdopterin binding; KEGG:
FT                   azc:AZC_3136 twin-arginine translocation pathway signal
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14771"
FT                   /db_xref="GOA:B0UE87"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR022867"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:B0UE87"
FT                   /protein_id="ACA14771.1"
FT                   /translation="MHIKARHGWEIPEHLATPEALFFDRRALLGGLGLAAAALAGPARA
FT                   AVPGEGTGARRTADLYPAKRNAAYTLDRPLTEERYSADYNNFYEYSTAKTVTPASNALK
FT                   VDPWTIRIDGLVEKPFEIGFEDLVRKMPLEERLYRHRCVEAWSMAVPWTGFPLAALVAL
FT                   ARPTGEAKYIQMQTFLDKAMAPGQRQFFYPWPYTEGLTLAEANHDLAFLATGVYGRPLL
FT                   NQFGAPLRLAVPWKYGFKSVKSINRITFTAERPKTFWEALQASEYGFWANVNPAVAHPR
FT                   WSQASERVLGTDQRVPTLLFNGYAEQVAGLYKGLEKERLYV"
FT   sig_peptide     complement(245256..245393)
FT                   /locus_tag="M446_0197"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.964) with cleavage site probability 0.962 at
FT                   residue 46"
FT   gene            complement(245520..245819)
FT                   /locus_tag="M446_0198"
FT   CDS_pept        complement(245520..245819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0198"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14772"
FT                   /db_xref="UniProtKB/TrEMBL:B0UE88"
FT                   /protein_id="ACA14772.1"
FT                   /translation="MGVTKPTVLPSARLSAADVIDSGDTLALRFSGQGGDVFVLVPVEE
FT                   VAGVAAALAAGTAQALRVRAATLQGRPLPLARTMLPPAGAGLAPARAGSPPAAE"
FT   gene            245953..246189
FT                   /locus_tag="M446_0199"
FT   CDS_pept        245953..246189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0199"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14773"
FT                   /db_xref="UniProtKB/TrEMBL:B0UE89"
FT                   /protein_id="ACA14773.1"
FT                   /translation="MPAKNSKHIAYTVAVSAPADEAGSVALQVYVAMAPDAPRALAAVR
FT                   AVAAPDAAVELSGTLSDRLTARLKLRPGEVRPI"
FT   gene            complement(246217..247917)
FT                   /locus_tag="M446_0200"
FT   CDS_pept        complement(246217..247917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0200"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   mex:Mext_3653 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14774"
FT                   /db_xref="GOA:B0UE90"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B0UE90"
FT                   /protein_id="ACA14774.1"
FT                   /translation="MRVPSPSHPDRPWLRAYPEGVPAEIATDQLGTLADLFARSTARFA
FT                   DRPAIRCFGADLTYADLRAGAEAFAGWLQAQGIRKGDRVALMLPNVPAYPIALFGALIA
FT                   GATAVNVNPLYTARELTHQIGDAGARVLIVLENFAGVVAEALPALPGLERVVVAGPGDA
FT                   LGLRGRLIDLASRHLKKAVPPYSLPAGRFVAFRASLAAGRRGAGFTPVDIAPDDLAFLQ
FT                   YTGGTTGISKGAMLTHRNVTANIEQSRLWFGMRDDEGPGRVMVTALPLYHIYGLTCCFF
FT                   FMTRLGACCLLVPNPRDIAGFVKLLRTNRFTNLSGVNTLFNALLNHPDIGQVDWSALEY
FT                   ANAGGMAVQAVVARRWKALTGKPIIEGYGLSETAPVVSINRRDLTEWSGTIGYPVPSTE
FT                   VSVRDPAGQEVAAGEAGELCVRGPQVMPGYWRRPDETARVMTPDGFFRTGDVAVLQPDG
FT                   QLRLVDRMKDMILVSGFNVYPNEVEDVLATHPGVLEVAVVGRPLPETGETVVAHVVRRD
FT                   PDLTADALRAFARKNLTAYKVPREFVFHGTLPKSNVGKVLRRELRDGAD"
FT   gene            complement(248127..248789)
FT                   /locus_tag="M446_0201"
FT   CDS_pept        complement(248127..248789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0201"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mex:Mext_3652 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14775"
FT                   /db_xref="GOA:B0UE91"
FT                   /db_xref="UniProtKB/TrEMBL:B0UE91"
FT                   /protein_id="ACA14775.1"
FT                   /translation="MIFSGRTLVAALVPLAAALAAVGLAALTGFSQARAEAAGYGAWVY
FT                   GFFLDQFPLYAVAIIYGVARILAVTAEALDRSAARRLAGAVLGTALLLGLSLYPTFGGA
FT                   VLRAGFMVGGMSFLNGVPLAAARALGALAALLPFGAGLALAGLVGGRRRKPGWLPALAA
FT                   RALALWWALGLLGLGRAAGLAAWPQRPLDGAQALLAAGLVLAAFLPHAVLAGLRRPG"
FT   sig_peptide     complement(248682..248789)
FT                   /locus_tag="M446_0201"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.527 at
FT                   residue 36"
FT   gene            complement(249220..249510)
FT                   /locus_tag="M446_0202"
FT   CDS_pept        complement(249220..249510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0202"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14776"
FT                   /db_xref="UniProtKB/TrEMBL:B0UE92"
FT                   /protein_id="ACA14776.1"
FT                   /translation="MAASGVGLAMYGAPQFGLIRAGFTYRDSAWIAAKSGGGNDYLYGS
FT                   VATATWPVPTSLTTLDIGHYAGGSQLNGYLRRLLYIPHLLSATELSNIVVI"
FT   gene            complement(249540..250472)
FT                   /locus_tag="M446_0203"
FT   CDS_pept        complement(249540..250472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0203"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14777"
FT                   /db_xref="UniProtKB/TrEMBL:B0UE93"
FT                   /protein_id="ACA14777.1"
FT                   /translation="MVALGRLGALTPAGVSLDLNPLTGLAMVSGVKSSLEDAITFARAG
FT                   TAWDYDVGGLLRQAAAGMPRLSYHPHSGLPLGLLIEPPSADLWDRTEDFENDAWTKTGL
FT                   QLYVGSVSGLDGRSIGTRMVDTGSSRGLITRNIAVGSGDAAYSAAFTARAIPGGVRSIE
FT                   ATIHFHGGSGNQGGSAVYDLLLGKVVSGTGASCGMVPAPFGAWRCILAACNTHGHTGIT
FT                   VGLGRWARDPDNGYDVLSISMEAREEATSPMRSGAGLSTRAAGRHPSPWATGSTRSRAP
FT                   SSPSSSPTAARIRISRCSPCAVRAAHSWG"
FT   gene            complement(250499..252109)
FT                   /locus_tag="M446_0204"
FT   CDS_pept        complement(250499..252109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0204"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ecx:EcHS_A2080 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14778"
FT                   /db_xref="InterPro:IPR005181"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:B0UE94"
FT                   /protein_id="ACA14778.1"
FT                   /translation="MAPPPVLPEDVFRAANPANNPSSDVYDPPKGDIIALLRWMLDAVT
FT                   ACSAATGVDPTIVSTLRTSLTNEIARAQREEGARSRAQLRALLGTVAALDLPPRGPTPV
FT                   SWVDDSAHARSIAIPDPANTLPLYPIMGQSNAFGATTGAVVSTSNPYPGRVLMPEGGLH
FT                   TYGGVANLADMQEGIDLVAHETIASGFATHLVRDLDAAIPNTNFRVASFISALGSRSYP
FT                   QLTEGSDQFTFGMRAISQIYQQQRRKGCRVLVPGVLWVQGENDNTGGWGDHYDGMLDQL
FT                   QQRLETRIQQITGQIEPVILYLAQTNSINTWDSILGQRVQEAQIRAAARNPLLCLVGPM
FT                   YSFAVNPADHVHKTSRGAYEMGQMFGRAVFMRQYGSARAVALTPLDVWRATPPAGVAAR
FT                   ISATFRVPVEPLVLDASGNVIAVSGMAAVPSGTGGGYGFDVYDDLGNVVPISAVSVGVP
FT                   STQYAGPPRLDIDLAVAPTARRLRVNYAQRRDDARPDTSDGPLTGARGCLRDSAAHTSI
FT                   VGGGPQYNWCVQFSRLIAA"
FT   gene            252218..252484
FT                   /locus_tag="M446_0205"
FT   CDS_pept        252218..252484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14779"
FT                   /db_xref="UniProtKB/TrEMBL:B0UE95"
FT                   /protein_id="ACA14779.1"
FT                   /translation="MSSEANRDRRTGRSTSITVPDGQDGASLRGGAVTGRRRNDLISAR
FT                   EVLAVAPRGAAQHPRHAADGQKIRVDDELGHQVTATPIRHAAE"
FT   gene            252506..252700
FT                   /locus_tag="M446_0206"
FT   CDS_pept        252506..252700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0206"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14780"
FT                   /db_xref="UniProtKB/TrEMBL:B0UE96"
FT                   /protein_id="ACA14780.1"
FT                   /translation="MFERNHKYHLPAGASAPPSTVSMATGSIRAPAADASTTSKVCART
FT                   ACADPTFAEVGPSFGALAG"
FT   sig_peptide     252506..252580
FT                   /locus_tag="M446_0206"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.826) with cleavage site probability 0.719 at
FT                   residue 25"
FT   gene            complement(252873..252948)
FT                   /locus_tag="M446_R0001"
FT                   /note="tRNA-Met8"
FT   tRNA            complement(252873..252948)
FT                   /locus_tag="M446_R0001"
FT                   /product="tRNA-Met"
FT   gene            253334..254944
FT                   /locus_tag="M446_0207"
FT   CDS_pept        253334..254944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0207"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; KEGG: azc:AZC_3540
FT                   putative sensory box/GGDEF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14781"
FT                   /db_xref="GOA:B0UE97"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B0UE97"
FT                   /protein_id="ACA14781.1"
FT                   /translation="MSAKTRSTTARSTRARSTWGEGELYEGLCLLVIAGFWGLIGAKSG
FT                   VFQAFGRFMLESGLTDLFTFMLLMGLTMVGVTVRKSLKLRRVMRERDAAAAHAEAVARH
FT                   DALTGLANRRLLLEAIDRLMRSSATAVSGAVLLIDIDRFKPVNDLYGHAAGDAVLCAVA
FT                   DRLRSLAPSQGLAARLGGDEFALLVIGETGSEALARLAEQVIAAIARPVEWAQAELKVG
FT                   ATVGITLISREDVDAHGIMHAADLAMYQGKKEGRGTYRFFQSAMDLELKERALLESELR
FT                   TAIETGEIEPFYQPVVALPNQELVGVEVLARWRHPTRGLLTPNQFIAAAEETGMIAELS
FT                   YRLLRQSCLDARSWPSHLRLAVNIAPQQFQDRWLAERILAILTETGFPPNRLEVEITES
FT                   ALVQDLEATRATLTSLQNLGVRIALDDFGTGYSSLYHLRELRFDKLKIDRSYVDSITMS
FT                   DERAKLVDAIIKLGTSLGLTTTAEGIETAASVEWLSGQGCDFGQGYLFGAPMPKDAIDR
FT                   LLGAPADEQKAFLEGRSAA"
FT   gene            complement(254960..255118)
FT                   /locus_tag="M446_0208"
FT   CDS_pept        complement(254960..255118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0208"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14782"
FT                   /db_xref="GOA:B0UE98"
FT                   /db_xref="UniProtKB/TrEMBL:B0UE98"
FT                   /protein_id="ACA14782.1"
FT                   /translation="MITPPKQSPLLALAYPVAFLAGALLIGTLTSRWILAEPAPALVAS
FT                   AAASAEP"
FT   sig_peptide     complement(255008..255118)
FT                   /locus_tag="M446_0208"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.676) with cleavage site probability 0.412 at
FT                   residue 37"
FT   gene            255319..256857
FT                   /locus_tag="M446_0209"
FT   CDS_pept        255319..256857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0209"
FT                   /product="Mg chelatase, subunit ChlI"
FT                   /note="KEGG: rpc:RPC_0317 Mg chelatase-related protein;
FT                   TIGRFAM: Mg chelatase, subunit ChlI; PFAM: magnesium
FT                   chelatase ChlI subunit; ATPase associated with various
FT                   cellular activities AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14783"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0UE99"
FT                   /protein_id="ACA14783.1"
FT                   /translation="MVTRVATVAFEGIEARAVDVQVQIAAGAVAFTVVGLPDKAVAESR
FT                   ERVRAALIASGLALPAKRITVNLAPADLPKEGSHYDLPIALGVMGAIGALPADALAGYC
FT                   VLGELALDGGITAVAGVLPAAMAANGRGLGLICPAASGPEAAWAGGDMDVLAPCSLIQL
FT                   ANHFKGSQVMARPRPAVAQPGRPLGDLREIKGQEGGKRVLEIAAAGAHNLLLSGPPGAG
FT                   KSMLAARLPSILPPLGPRELLEVSMIQSVAGELKDGALSNRRPFRAPHHSASMAALVGG
FT                   GAGARPGEASLAHGGVLFLDELPEFSPQVLDSLRQPLETGSVMIARANHRVSYPARFQL
FT                   VAAMNPCRCGHATEPGFACRRGPNERCVAQYQARLSGPLLDRIDLRIEVPAVTAADLIL
FT                   PPPQEGSAEAAARVAAARGRQEHRYAEAGLPPGTTNASCPPGVIEEAARPDPDGQKLIR
FT                   DAADAMRLSARGFHRVLRVARTLADLDGEARVRRAHLAEALSYRGRTHPRPEAA"
FT   gene            256987..259113
FT                   /locus_tag="M446_0210"
FT   CDS_pept        256987..259113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0210"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: mex:Mext_4428 PAS sensor protein; TIGRFAM: PAS
FT                   sensor protein; PFAM: response regulator receiver;
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; PAS fold-4 domain protein; PAS fold
FT                   domain protein; SMART: PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14784"
FT                   /db_xref="GOA:B0UEA0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B0UEA0"
FT                   /protein_id="ACA14784.1"
FT                   /translation="MGDGAGPAGTATTAQIGALARSEAGLVRAGSDALGATGLVLALLV
FT                   LATAWYARRLARWRREREVEHLHDRIWHLAESEERYRNLVEAQIELIVQRDAEGRITFA
FT                   NEGFARLLGTSPEALLGTTREATIAESLAAETRPDGSRTADLAIAPAAGGPPRWFAVVE
FT                   SAVVGRDGRPEVLRAGREITERVEAVRSLDEARSRAEAASVAKSRFLATVSHEFRTPLN
FT                   GILGMADLVLETPLSPEQETYIRAIKTSGEALLTLIDGILDFSKIEAGRLDLACEPFDP
FT                   AALVESVVELLAPRAQDKGLEIAADLADDLPPRVLGDGDRVRQILLNLAGNAVKFTEAG
FT                   GVGITAERVGEDLVLAVHDTGPGIPEERLPLLFEEFEQGDGSASRRHEGTGLGLAITRR
FT                   LVDRMGGRIETTSRPGAGSCFRVVLPLRALDGERPRPPALTGRRILVAAASAVEGPFLR
FT                   ARLTRSGAEVVSADGEAAAREALRARPFDAVLADRALGDEAVRRIAGAAKRAGVPRSIV
FT                   LLSPFDRRDFGSPAAAGFDRYLIKPVRARSLYARLCEATRPQGGELREGAPAERRGPPP
FT                   GRARVLLAEDNPINALLARKALERLDAAVTWVPDGAEALRHLEAAAAGAAEGFDLALLD
FT                   IRMPGLDGLEAARRLRAFERARGAAPARLVALTANAGAEDEAAARAAGFDGFLSKPLDL
FT                   AALPPLLAGAARAA"
FT   gene            259170..259451
FT                   /locus_tag="M446_0211"
FT   CDS_pept        259170..259451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0211"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mex:Mext_1026 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14785"
FT                   /db_xref="GOA:B0UEA1"
FT                   /db_xref="UniProtKB/TrEMBL:B0UEA1"
FT                   /protein_id="ACA14785.1"
FT                   /translation="MAEPVPSPDRSRDATLAGGIAALAVAVVLVANLAPSPRPAPAAPR
FT                   QQAASPAEDPTCREWTDDCTLCIRDGDAIGCTTPGIACTRGRMVCTRR"
FT   gene            complement(259491..260342)
FT                   /locus_tag="M446_0212"
FT   CDS_pept        complement(259491..260342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0212"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; KEGG: mex:Mext_2384
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14786"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0UEA2"
FT                   /protein_id="ACA14786.1"
FT                   /translation="MNLLVFGLGYTARHFVERERARFSRIAATAQAPRPDAPEGVIARV
FT                   FSPVRADPAILDDVARSDAVLVSIPPQDGDPVLRAYAEALAAGPARWIGYLSTIGVYGD
FT                   QGGAWIDEATPPAPTHERTRDRVAVEEAWRALGARTGKAVQVFRLSGIYGPGRNAFVKL
FT                   REGRAQRIVKDGQVFNRIHVDDIATVLAASLDRPRAGAVYNVTDDEPAPPQDVTAHAAA
FT                   LAGLPLPPEIDFETASLSPMARSFYGENKRVRNRLIREELGVALRFPTYREGLAGLVAE
FT                   AG"
FT   gene            complement(260339..261526)
FT                   /pseudo
FT                   /locus_tag="M446_0213"
FT   gene            complement(261544..262236)
FT                   /locus_tag="M446_0214"
FT   CDS_pept        complement(261544..262236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0214"
FT                   /product="Glutathione S-transferase domain"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   mex:Mext_2386 glutathione S-transferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14787"
FT                   /db_xref="GOA:B0UFD3"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:B0UFD3"
FT                   /protein_id="ACA14787.1"
FT                   /translation="MATLHHSPFCPHSRFVRLVLAEMGMEPVLAEERPWERREEFLMLN
FT                   PAGTTPVLVEEGGLAVPGSGVIAEYLDETRGLGLSGRRLLPEAPAARVEVRRLLDWFLA
FT                   KFDQEVTGYLVTEKIHKRFMTPDLGGGPPDMNAIRAARTNVRYHLKYIGYLIARRNWLA
FT                   GDHLTYADLAAAAHLSCVDYLGDVPWDEDEMARTWYARLKSRPSFRGLLADRVPGMAPA
FT                   DHYADLDF"
FT   gene            262525..263328
FT                   /locus_tag="M446_0215"
FT   CDS_pept        262525..263328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0215"
FT                   /product="undecaprenol kinase"
FT                   /EC_number="3.6.1.27"
FT                   /note="KEGG: mex:Mext_2387 undecaprenol kinase; TIGRFAM:
FT                   undecaprenol kinase; PFAM: Bacitracin resistance protein
FT                   BacA"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14788"
FT                   /db_xref="GOA:B0UFD4"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/TrEMBL:B0UFD4"
FT                   /protein_id="ACA14788.1"
FT                   /translation="MDLAGIGKAVILALVEGATEFIPVSSTGHQLLVGHFIGFQSPNNT
FT                   FEVLIQLGAILAIVSVYFRTLLDLALRAPRDPKARRFILAILLAFLPAAIIGGIFSKTI
FT                   KLYLFNPWIVCSTLVAGGLVLLVIDETELDQKYDDVHQFSLGMALKIGLFQCLAMIPGV
FT                   SRSGATIVGAMLMGAGKRAATEFSFYLAMPTMAGAFAKDLLDNYKYLSRDDVGLIAIGF
FT                   VVAFLSALFVVRRLLDYVSRHGFGLFAWWRILVGAAGFAGLIVFG"
FT   gene            complement(263348..263683)
FT                   /locus_tag="M446_0216"
FT   CDS_pept        complement(263348..263683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0216"
FT                   /product="TfoX domain protein"
FT                   /note="PFAM: TfoX domain protein; KEGG: rle:RL2596 putative
FT                   TfoX family protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14789"
FT                   /db_xref="InterPro:IPR007076"
FT                   /db_xref="UniProtKB/TrEMBL:B0UFD5"
FT                   /protein_id="ACA14789.1"
FT                   /translation="MDATAIEEIFSGLGPVTVRRMFGGKGIYHGGRIVAVEVRGDLLLK
FT                   ADAASAPLFAAAGATQWSYAGRKGQAIRMPYWSIPADAYDDPDAMARWVRLAHEAALRA
FT                   DGAADRP"
FT   gene            263941..265776
FT                   /locus_tag="M446_0217"
FT   CDS_pept        263941..265776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0217"
FT                   /product="Methylmalonyl-CoA mutase"
FT                   /EC_number="5.4.99.2"
FT                   /note="PFAM: methylmalonyl-CoA mutase; KEGG: mex:Mext_2388
FT                   methylmalonyl-CoA mutase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14790"
FT                   /db_xref="GOA:B0UFD6"
FT                   /db_xref="InterPro:IPR006099"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="UniProtKB/TrEMBL:B0UFD6"
FT                   /protein_id="ACA14790.1"
FT                   /translation="MDDLTLAAAFPPATGEQWRALVDGVLKGAEYEKRLVHRTRDGIRV
FT                   EPLYGAAAPSPQPLRGAGAPAPWRIAQRVDHPDPAEANALALADLEGGADALTLVLAGA
FT                   RAARGFGLPGPEALERALDGVMLPLIALRLDAGPGAAAAAEALVALAARRGDDLGRLSL
FT                   DLGIDPIGQFATTGALPGPWPEVASGLAATLAGLDRRGFAGRAFLADARPFHEAGATEA
FT                   GELAAVLASAVALLRALEAGGHDLERARDAIAVLLVADADEFLTVAKLRAMRRLWARVE
FT                   ESCGLTPKPLTLHAETAWRTTTRRDPFVNLLRATAAAFSAGLGGADSVTVLPFTAALGL
FT                   PDAFARRCARNTQVVLLEESNLWRVVDPAAGAGGFEALTAELCAQAWAQFQEIEREGGL
FT                   VESLASGRLGGRLAAIREARGRDLATRRQPITGTSEFPHLAEAPVAVLAPAPAAATPAG
FT                   ALPSLRFAEPFERLRDASDAALAATGRRPRVFLANLGPIAAFNTRATFARNAFEAGGVE
FT                   ALTNDGFPDLASLVAAFRAAGTPLACLCSSDEVYAAEAVPAARALAEAGARSLYLAGRP
FT                   GALEAALREAGVTRDLYAGCDLLRLLEEAQDLARA"
FT   gene            265901..266281
FT                   /locus_tag="M446_0218"
FT   CDS_pept        265901..266281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0218"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mex:Mext_2389 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14791"
FT                   /db_xref="UniProtKB/TrEMBL:B0UFD7"
FT                   /protein_id="ACA14791.1"
FT                   /translation="MLRAALAGMIILTAAAGPALAAKRSAPSVKRFDGTWSVEVITETG
FT                   TCDRAYRYGLIIQDGQARYAGGSDFTITGRVQPNGVVRGAISRGDASAQVVGRLANGWG
FT                   NGTWTTSGGTRCGGRWNAERRG"
FT   sig_peptide     265901..265966
FT                   /locus_tag="M446_0218"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 22"
FT   gene            266393..266797
FT                   /locus_tag="M446_0219"
FT   CDS_pept        266393..266797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0219"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mex:Mext_2390 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14792"
FT                   /db_xref="UniProtKB/TrEMBL:B0UFD8"
FT                   /protein_id="ACA14792.1"
FT                   /translation="MMRPLLLGMLCAATATAAAAREPQHSSVPPREAAATDCFAESIGN
FT                   NPAALAHARSGRWYEAAGVIGYLCRPEVDAMMRDHDLRHGPGTGARYFRGAYTRHLAQS
FT                   LEERLKPMLETKAWANAEPRPDAEPASAKP"
FT   sig_peptide     266393..266455
FT                   /locus_tag="M446_0219"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.839 at
FT                   residue 21"
FT   gene            complement(267258..268742)
FT                   /locus_tag="M446_0220"
FT   CDS_pept        complement(267258..268742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0220"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mex:Mext_3511 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14793"
FT                   /db_xref="GOA:B0UFD9"
FT                   /db_xref="InterPro:IPR028087"
FT                   /db_xref="UniProtKB/TrEMBL:B0UFD9"
FT                   /protein_id="ACA14793.1"
FT                   /translation="MRGKLAKLARSFWLAGAANVLVIFGLGAPVLFGVVGITVDYAIWL
FT                   NQKLILQNAADAAALAIVADIQIAAPQLERMQAIAESQVRRFVPLKEGDGPVAVRTAPR
FT                   YRKTSDDPFAPGPVEGDVRTANGWSVTLTQRKRAIMSRLVTPTLTDITVEATAEMAGTI
FT                   KVCVLVLDAAASGALALRDQSRIDAGNCSVYVMSADRRGLQMTDGAALTSLKSCVVGGY
FT                   AGGGYVRPRPISGCPPMRDPLQAREPPPVGGCTYTNLAIADERRTLMPGTYCGGLMINA
FT                   GASVTLAPGTYVIKDGPLVVGSEKQETRSTGWGWWGLRGWRPFVPLLCYWPELVPGSHA
FT                   LWCPRTTTTNSPPGILTGTNVGFYFTGKVPPDQDGAVRPVQFMPRSTVSLTAGKTGSMA
FT                   GLLFFEDRDAPPGRQFAVLSDSARRLVGTIYLPRGTFTVRTNQVVADQSEFTAIVARGI
FT                   DLSSAPRLVINADYGATDVPVPKGIGPTSAMPTLTH"
FT   sig_peptide     complement(268641..268742)
FT                   /locus_tag="M446_0220"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.698) with cleavage site probability 0.639 at
FT                   residue 34"
FT   gene            complement(269146..270951)
FT                   /locus_tag="M446_0221"
FT   CDS_pept        complement(269146..270951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0221"
FT                   /product="GTP-binding protein LepA"
FT                   /note="TIGRFAM: small GTP-binding protein; GTP-binding
FT                   protein LepA; PFAM: elongation factor G domain protein;
FT                   protein synthesis factor GTP-binding; elongation factor Tu
FT                   domain 2 protein; GTP-binding protein LepA domain protein;
FT                   KEGG: mex:Mext_1240 GTP-binding protein LepA"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14794"
FT                   /db_xref="GOA:B0UFE0"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UFE0"
FT                   /protein_id="ACA14794.1"
FT                   /translation="MTAKPIDTIRNFSIVAHIDHGKSTLADRLIQLTGALSAREMTEQV
FT                   LDSMDIERERGITIKAQTVRLDYKAQDGREYVLNLMDTPGHVDFTYEVSRSLAACEGSL
FT                   LVVDASQGVEAQTLANVYQAIDANHEIVPVLNKIDLPAAEPDRVKEQIEEVIGIDASEA
FT                   VPISAKTGLNIEAVLEAIVAKLPPPKGDCEAPLKALLVDSWYDVYLGVVVLVRIVDGVL
FT                   RKGMTIRMMGADAVYGVDRVGVFRPKMQDVAELGPGEVGFLTASIKEVADTRVGDTITE
FT                   DRRPTDQALPGFKPVQPVVFCGLFPVDAAEFENLRAAMGKLRLNDASFSYEMETSAALG
FT                   FGFRCGFLGLLHLEIIQERLEREFNLDLISTAPSVVYRLNMADGTMRELHNPADMPDVM
FT                   KIDTIEEPWIRATILTPDDYLGGVLKLCQDRRGAQIDLNYVGKRAMVVYDLPLNEVVFD
FT                   FYDRLKSISKGYASFDYHISDYREGDLVKMSILVNAEPVDALSMLVHRTRAESRGRAMC
FT                   EKLKDLIPRHLFQIPVQAAIGGKIIARETIRALSKDVTAKCYGGDISRKRKLLDKQKEG
FT                   KKRMRQFGKVEIPQEAFIAALKMDS"
FT   gene            complement(271143..272237)
FT                   /locus_tag="M446_0222"
FT   CDS_pept        complement(271143..272237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0222"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   mex:Mext_2610 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14795"
FT                   /db_xref="GOA:B0UFE1"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B0UFE1"
FT                   /protein_id="ACA14795.1"
FT                   /translation="MLVLVIGAGVVGLACGRALALRGHEVIVAEAEAQIGTGVSSRNSE
FT                   VIHGGMYYPSGSLRARHCVEGRRRLYAFCASHGVPHARTGKLIVAATEPERAKIAAIHA
FT                   QGLANGVEGLALIDGAEARRLEPNLACVAALLSPETGIVDSHALMLALQGDLEAHGGAL
FT                   AFRTPVERLIRDGGGWVALYGGEAPGELRVDAVVSATSFGAQALARATEGYPEARVPRL
FT                   VLAKGNYFGCLGRPAFTRLIYPAPVEGGLGIHLTLDLAGRTRFGPDVEWIDRPDYEVDP
FT                   ARGALFYAAIRRYWPDLPEGALFPDYAGIRPKLSGPGQPAMDFVIDGPAEHGLPGLVQM
FT                   FGIESPGLTSSLSLAEDVADRLGA"
FT   sig_peptide     complement(272175..272237)
FT                   /locus_tag="M446_0222"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.651) with cleavage site probability 0.608 at
FT                   residue 21"
FT   gene            complement(272347..273957)
FT                   /locus_tag="M446_0223"
FT   CDS_pept        complement(272347..273957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0223"
FT                   /product="Phosphoenolpyruvate carboxykinase (ATP)"
FT                   /EC_number="4.1.1.49"
FT                   /note="PFAM: phosphoenolpyruvate carboxykinase (ATP); KEGG:
FT                   mex:Mext_1639 phosphoenolpyruvate carboxykinase (ATP)"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14796"
FT                   /db_xref="GOA:B0UFE2"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UFE2"
FT                   /protein_id="ACA14796.1"
FT                   /translation="MSDIGVYNAAFGPDRAGLRNLKRVFWNLEAPSLYEQALQRGEAQL
FT                   AAGGALVAETGIHTGRSPKDKFVVRDSGTEDQVWWDNNGAITAEQFDRLHADFVAHAEG
FT                   KDLFAQDLYGGAEPAYRVRARVYTEYAWHSLFIRNLLIRPERDALGAYEPDLTIIDLPS
FT                   FKADPARHGVRSETVIACDFTRKIVLIGGSSYAGEMKKSVFTYLNYILPKAGVMPMHCS
FT                   ANVGAQGDSALFFGLSGTGKTTLSNDPARVLLGDDEHGWGPKGIFNFEGGCYAKTIRLS
FT                   REAEPEIYATTERFGTVMENVVIDPVTRLPDFDDASKTENTRCAYPLPFIPNASATGRA
FT                   GHPKNIVMLTCDAFGVLPPIAKLTGAEAMYHFLSGYTAKVAGTEKGLKGPEATFSTCFG
FT                   APFMPRHPSVYGNLLRDLIARHHVDCWLVNTGWTGGGVGTGRRMPIRVTRRLLTAALDG
FT                   SLAKADYRRDPYFGFAVPTSVPGVEPHILYPVKTWADKAAFAETAKRLVEMFQANFKRF
FT                   EAHVDADVRAAEPTMSIAA"
FT   gene            complement(274181..274963)
FT                   /locus_tag="M446_0224"
FT   CDS_pept        complement(274181..274963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0224"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding; KEGG: mex:Mext_1239 pyridoxamine 5'-phosphate
FT                   oxidase-related FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14797"
FT                   /db_xref="GOA:B0UFE3"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019595"
FT                   /db_xref="InterPro:IPR037119"
FT                   /db_xref="UniProtKB/TrEMBL:B0UFE3"
FT                   /protein_id="ACA14797.1"
FT                   /translation="MAESDRQPAAPFAAAQAPFDAVGLAKDLLRSTRSGALATLDRGDG
FT                   SPFASLVTVATDLDGAPLMLLSRLSAHTLNLEAEPRCSLLLSPGGKGDPLAHPRLTVAG
FT                   RAARSDDPRVRARFLARHPKAKLYADFPDFAFFRLEPAAGHLNGGFAKAATLSAAELLT
FT                   DLAGMEGLAASEAGAAAHMNDDHADALALYATHFAGAEPGPWRLTGLDPEGLDLLAADR
FT                   TARVTFPRRLRDPRTLRQVLVEMAAEARRERPAVPGGE"
FT   gene            275262..275978
FT                   /locus_tag="M446_0225"
FT   CDS_pept        275262..275978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0225"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: mex:Mext_1238 response
FT                   regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14798"
FT                   /db_xref="GOA:B0UFE4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B0UFE4"
FT                   /protein_id="ACA14798.1"
FT                   /translation="MPTIALVDDDRNILTSVSIALETEGYRIQTYTDGASALDGLKHSP
FT                   PDLAIFDIKMPRMDGMELLRRLRQKSDLPVIFLTSKDEEIDELFGLKMGADDFIRKPFS
FT                   QRLLVERVKAVLRRFAAKEAGPAAAAREAEAAAARSLERGQLMMDPERHTCTWKGEPVT
FT                   LTVTEFLILQALAQRPGVVKSRNALMDAAYDDQVYVDDRTIDSHIKRLRKKFKVVDTNF
FT                   DMIETLYGVGYRFKEA"
FT   gene            276016..277809
FT                   /locus_tag="M446_0226"
FT   CDS_pept        276016..277809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0226"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: mex:Mext_1237 ATP-binding
FT                   region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14799"
FT                   /db_xref="GOA:B0UFE5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR025908"
FT                   /db_xref="InterPro:IPR025919"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B0UFE5"
FT                   /protein_id="ACA14799.1"
FT                   /translation="MRRLLGAGAPGTGSEADPDAEAPREPLSLRLVGRWIAQRASSSLT
FT                   RRIVVLNLAGLIALLVGFLYLNQFRQGLIEARVKSLLTQGDIIAGAIAASATVDTDAIS
FT                   IDPDRLLQLQAGDPGAGAEEPVSALEFSLNPERVAPLLRRLITPTGTRARVYDRDGSNL
FT                   IDSRALYVRGDLARGEVPVRKERPSLMERAWDGLRQHLPFPHREPGPEDTGPSDGRSLP
FT                   EVQRALAGSRGTLVRRNAHGETIVSVAVPIMRARTVRGALLLSTQEGDIDKIIASERFA
FT                   LLQVFLIAALVMVVLSLLVAGQIVGPVSRLSEAAERVRLGIRSRQEIPDFTTRSDEIGH
FT                   LSRALRDMTQALYRRLDAIENFAADVSHELKNPLTSLRSAVETLPLAKTDESRGRLMQI
FT                   IQHDVKRLDRLISDISDASRLDAELARAEAARVDLKKLLTTVTSVANERRRPRDAAITF
FT                   TVEAPPAGIEDPFAIIGHDSRLGQVVNNLLDNARSFSPKGATVRVNLRRLRNTIELTVE
FT                   DDGPGIPPHALERIFERFYTDRPEQGFGQNSGLGLSISRQIVQAHRGTIRAENRLGPPG
FT                   EDGEPCLLGARFVVRIPGLHR"
FT   gene            277824..278267
FT                   /pseudo
FT                   /locus_tag="M446_0227"
FT   gene            278357..278758
FT                   /locus_tag="M446_0228"
FT   CDS_pept        278357..278758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0228"
FT                   /product="PTS system fructose subfamily IIA component"
FT                   /note="PFAM: PTS system fructose subfamily IIA component;
FT                   KEGG: mex:Mext_1235 PTS system fructose subfamily IIA
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14800"
FT                   /db_xref="GOA:B0UFE6"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:B0UFE6"
FT                   /protein_id="ACA14800.1"
FT                   /translation="MIGMVLVTHGLLATEFKAALEHVVGPQEQLETITIGPEDDMEVRR
FT                   KDIMSAVCRVNTGEGVVVLTDMFGGTPSNLALSCMNGGSVEVVAGINLPMLIKLASVRD
FT                   EESLGEAVLHAQEAGRKYINVASRVLAGK"
FT   gene            278844..279164
FT                   /locus_tag="M446_0229"
FT   CDS_pept        278844..279164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0229"
FT                   /product="Phosphotransferase system, phosphocarrier protein
FT                   HPr"
FT                   /note="TIGRFAM: phosphocarrier, HPr family; PFAM:
FT                   phosphocarrier HPr protein; KEGG: mex:Mext_1234
FT                   phosphocarrier, HPr family"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14801"
FT                   /db_xref="GOA:B0UFE7"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:B0UFE7"
FT                   /protein_id="ACA14801.1"
FT                   /translation="MNDDDAGGWDAPAVPEGATARELPIINRRGLHARASAKFVQAVER
FT                   FESEVTVTRAGETVGGRSIMGLLTLGAAQGTSIFVTALGPDQDACLEAIAALLANRFGE
FT                   DE"
FT   gene            complement(279253..280188)
FT                   /locus_tag="M446_0230"
FT   CDS_pept        complement(279253..280188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14802"
FT                   /db_xref="UniProtKB/TrEMBL:B0UFE8"
FT                   /protein_id="ACA14802.1"
FT                   /translation="MTTTPFSVIQGGIREEGRWSAELRHPASLREAEIAAWRALLPRAL
FT                   SPGFAGDPDFVLTLAQHLAEGRRLALLLVWQHGDGMPVLRGVLPLQLPAGLRPGRTAQL
FT                   WVLPLAEGAAPVVDARETAAILRAALDHLAGAGSRVGTLRLPGLLPAGRLIAALREVAA
FT                   ASGRPLTVASRPAPGPAAEPLPTLPRGRTSLERVRAPRQLRDAVEHFLVLEGARPGPNL
FT                   LHDADAATALRVVTRRFAQRRACGVDLVRRDGAVVAAAIRLGPAGQDRIWREAGCALAP
FT                   ARERPGVMLLDAAVSVAPARRAADGERRSA"
FT   gene            complement(280315..281448)
FT                   /locus_tag="M446_0231"
FT   CDS_pept        complement(280315..281448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0231"
FT                   /product="cobalamin synthesis protein P47K"
FT                   /note="PFAM: cobalamin synthesis protein P47K; cobalamin
FT                   synthesis CobW domain protein; KEGG: mex:Mext_1219
FT                   cobalamin synthesis protein P47K"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14803"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036627"
FT                   /db_xref="UniProtKB/TrEMBL:B0UFE9"
FT                   /protein_id="ACA14803.1"
FT                   /translation="MSPFESLPMPDPSRRPAPIPLTVLTGFLGAGKTTLLNRLLRDPAL
FT                   ADTVVIVNEFGEVGLDHLLIETVDEGMILLGAGCLCCSVRGDLIATLEDLLRKRDNGRI
FT                   QPFRRVIIETTGLADPAPILHGLLYHPYLALRFALQAVVTVVDAVNGAGTLDAHPEALR
FT                   QAAVADRLVLTKTDLPGGEAAALRARLAALNPAAPVLGPDAPAEALLGGLFGTDGKIAD
FT                   VAAWLGAEAVAAAEARHHHAQHHGHHHHDLNRHDAAIRAFSLVSPEPVPRAAFEMFLDL
FT                   LRSGQGAKLLRLKGLVGLAEDPGRPVVVHGVQHVVHAPATLDAWPGPDRTSRLVLILRD
FT                   GDPAFVRRLWDAFLGRPAPDAPDAAALTANPLAIPGG"
FT   gene            complement(281530..282678)
FT                   /locus_tag="M446_0232"
FT   CDS_pept        complement(281530..282678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0232"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: rpb:RPB_1750
FT                   acyl-CoA dehydrogenase-like"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14804"
FT                   /db_xref="GOA:B0UFF0"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B0UFF0"
FT                   /protein_id="ACA14804.1"
FT                   /translation="MDFDLSEEQSLLKDSVERLLADRYDFEARTRHGRHPEGFSPEMWR
FT                   SYAEQGLLAVPFAEEDGGIGGGPVETMIVMEAFGRALVLEPYLATVVLAGGLMRRAASA
FT                   AQRAEWLPGLIGGETRYAFAHHERQARYDLHDVGLSARRDGAGYVLEGDKSLVLHGDSA
FT                   DRLIVSARTAGSRRDRGGIGLFLVDARAEGVSRRGYPTQDGQRAAEISLSSVKVGPEAV
FT                   LGAPEDALPAIERVVEEAIAALCAEAVGAMDRMHALTVEYLKTRKQFGTPIGSFQVLQH
FT                   RAADMFIALEQARSMAFLATMMAGEEDAAERARALSGAKVQIGRSGRIVGQGAVQLHGG
FT                   VGVTMEYSVGHFFKRVTMIDTLFGDADHHLARVAAMGGLIAA"
FT   gene            complement(282819..284021)
FT                   /locus_tag="M446_0233"
FT   CDS_pept        complement(282819..284021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0233"
FT                   /product="pimeloyl-CoA dehydrogenase, large subunit"
FT                   /note="TIGRFAM: pimeloyl-CoA dehydrogenase, large subunit;
FT                   PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   acr:Acry_0253 acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14805"
FT                   /db_xref="GOA:B0UFF1"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR017617"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B0UFF1"
FT                   /protein_id="ACA14805.1"
FT                   /translation="MDLRFTPEERAFRQEVRRFFEENLPAEIRQKLIDGHHPSKQDIVT
FT                   WQRILNAKGWAVPNWPVEWGGTGWDPVRQYIFLDELQSFPAPSPLQFGVYMVGPVIAQF
FT                   GSEAQKRHFLPRIANLDDWWCQGFSEPGAGSDLASLKTRAVRDGDHYVVNGQKTWTTLA
FT                   QHADWIFCLVRTDTAAKKQEGITFLLIDMRTPGITVRPIQTLDGGREVNEVFFDDVRVP
FT                   VENRVGQENRGWDYAKFLLGNERTNIARVGVSKQRIRRLRELAALERVGDAPLIEDPRF
FT                   REKLAALEIELKALEMTQLRVVAAERTREKGKPDPASSILKIKGSEIQQATTELLLDVV
FT                   GPYALPYLPEDEDQGHNEPPIGPDYAGPAAPTYFNWRKISIYGGSNEIQKNIIAKAILG
FT                   L"
FT   gene            complement(284088..286163)
FT                   /locus_tag="M446_0234"
FT   CDS_pept        complement(284088..286163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0234"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase NAD-binding"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase;
FT                   3-hydroxyacyl-CoA dehydrogenase domain protein;
FT                   3-hydroxyacyl-CoA dehydrogenase NAD-binding; KEGG:
FT                   ccr:CC_3189 fatty oxidation complex, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14806"
FT                   /db_xref="GOA:B0UFF2"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0UFF2"
FT                   /protein_id="ACA14806.1"
FT                   /translation="MTEATPVSESREGAVAVLTLQSGPVNALGTALREGIAAALARAEA
FT                   DTAVTAIVLIGGGRMFSAGADITEFGTPPRGISLPDLLDRIEAATKPVVAAIHGNALGG
FT                   GLETALACHYRVAVPSAKVGLPEVKLGILPGAGGTQRLPRIVGPRKALEVIVGGAPLGA
FT                   GQAAAMGLIDELAPEEGLRAHAVAFAQRVVAEGRPLTKIRDRDERLAEGRDAPGLFDAF
FT                   RKENARRMRGFEAPEACIACVEAACRLPFPQGLAFEREQFLKLVSGSQSAAQRYVFFAE
FT                   RQTAKIPDVPEDTPTRPIARVGVIGAGTMGGGIAMNFLNAGIPVTIVEARREALDRGLA
FT                   VIRSNYENTARKGRLRPEDVQTRMGLLADTLAIEDLKDCDLIIEAVFEDMGIKKEIFSK
FT                   LDRVAKPGAILASNTSYLDIDEIASVTGRPADVIGMHFFSPANVMRLLEVVRGARTAKD
FT                   VIATAMQVGRKVGKIAVLVGVCHGFVGNRMLAERQREANRLILEGVTPWDVDRVIYEFG
FT                   LPMGPFAMSDLAGLDIGWSRETNRSESVRDLLCEIDRRGQKTGAGFYDYDAKRKASPSP
FT                   VTEEIIARVAARQGVARKPASDQEILERCLYPMVNEGAKILDEGKAIRASDIDIVWING
FT                   YGWPVYRGGPMFWADGIGLPTVLERLRAYQAEYGDAFAPSPLLERLAAEGKGFRDL"
FT   gene            complement(286262..287464)
FT                   /locus_tag="M446_0235"
FT   CDS_pept        complement(286262..287464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0235"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /note="KEGG: vei:Veis_4960 acetyl-CoA acetyltransferases;
FT                   TIGRFAM: acetyl-CoA acetyltransferase; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14807"
FT                   /db_xref="GOA:B0UFF3"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:B0UFF3"
FT                   /protein_id="ACA14807.1"
FT                   /translation="MREAVIVATARTPIGKAYRGAFNDTQAQALGGHAIAAAVARAGID
FT                   PAEVGDVVMGAALQQGSTGSNIARQAALRAGLPASVAGMSLDRQCASGLMAIATAAKEI
FT                   VADGVDVAVGGGLESISLVQNDRINRFRGTDPWLVERVPALYMTMIETAETVAERYGID
FT                   RAAQDAYALQSQRRTAEAQAAGRFADEIVPLATRMTVTDKATGETASREVTLAQDEGNR
FT                   PQTRPEDLAALKPVFKDGQRVKEGRFVTAGNASQLSDGASASVLMEAREAERRGLQPLG
FT                   AYRGMAVAGCNPDEMGIGPVFAVPKLLRQHGLSVEDIDLWELNEAFACQVLYCRDRLGI
FT                   PDERLNVNGGAISIGHPYGMSGARMTGHILLEGRRRGAKYGVVTMCVGGGMGAAGLFEI
FT                   Y"
FT   gene            287693..288460
FT                   /locus_tag="M446_0236"
FT   CDS_pept        287693..288460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0236"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: rpd:RPD_3206 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14808"
FT                   /db_xref="GOA:B0UFF4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0UFF4"
FT                   /protein_id="ACA14808.1"
FT                   /translation="MPLFDLTGRVAVVTGSSRGIGRAIAERLAEHGARVVVSSRKEEAC
FT                   RAVAEAINARHGEERAVVVPANISSKADLERLARRTEERFGRIDVLVCNAASNPYYGPM
FT                   SGISDEAFRKILDNNVVANHWLIGFCAPGMIARRDGAIIIVSSVGGLKGSGVIGAYNVS
FT                   KAADFQLARNLAVELGPHNVRVNCLAPGLIQTDFARALWEDPASRAAYTARTPLGRIGQ
FT                   PDEIAGAAVFLASPAGAFMTGQSIVIDGGQTIT"
FT   gene            288595..290403
FT                   /locus_tag="M446_0237"
FT   CDS_pept        288595..290403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0237"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   reh:H16_B1239 long-chain-fatty-acid--CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14809"
FT                   /db_xref="GOA:B0UFF5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B0UFF5"
FT                   /protein_id="ACA14809.1"
FT                   /translation="MSYDEPARRLSEADIRIATQSVGCRITDPEMPMTESPAWPALSFA
FT                   EATARLTAPGSPFAVDEAVIRGVPTRIWAAAPPTLRDILLVGRRHGEKTFLVYEDERAS
FT                   FEAFARAVLALSADLIRGGVRPGDRVAIAMRNLPEWPVAFFAALLAGAVAAPLNGWWTG
FT                   PELAYALADCGASVAVVDAERLARLAERRQDCPDLRRVLLARGEAPDAESLREIIGPVA
FT                   AWAALPPGTVPDVPLAPDDLATLFYTSGTTGRPKGAMGTHRNGACAVLAHPYSAARAAL
FT                   RRGEPVPVPDPAAPQKVALVSVPFFHVTGCFATLVTNLHRGGRLVLMRRWDLAQALDLI
FT                   ARERCTSAGGVPTIAWQLLDGWAAGTHDLSSLETITYGGAPAPAELVRRLRAAFPRTTP
FT                   ATGWGMTETSATFTHHMGEDYLHRPDSCGPPLPIGEARIVDPEGRVLPPGEVGELQVKG
FT                   PNVVAGYWNRPDETAASFRDGWLATGDLARMDAEGFLTIVDRARDMLIRGGENIYCCEV
FT                   ENALHEHPAVVDAAVVAVPHPTLGEEPAAVVALARGENASEEELRAFVAARLAAFKVPV
FT                   RILFHEEILPRNPSGKILKSELRKLF"
FT   gene            complement(290489..291031)
FT                   /locus_tag="M446_0238"
FT   CDS_pept        complement(290489..291031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0238"
FT                   /product="acetolactate synthase, small subunit"
FT                   /note="TIGRFAM: acetolactate synthase, small subunit; PFAM:
FT                   amino acid-binding ACT domain protein; KEGG: mex:Mext_4866
FT                   acetolactate synthase, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14810"
FT                   /db_xref="GOA:B0UFF6"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:B0UFF6"
FT                   /protein_id="ACA14810.1"
FT                   /translation="MNAMNTHYPEPVRVEPVARHTLAVIVDNEPGVLSRIAGLFSGRGY
FT                   NIESLTVSETEHTQHLSRITIVTTGTNAVIDQIKAQLDRLVPVHRVVDLTLQGESLERE
FT                   LCLVKVVGKGEHRVEAMRLASSFGARTLDATLNSFVFELTGSTDEIERFIRLMSEIGLV
FT                   EISRTGVAAMSRGAEPM"
FT   gene            complement(291050..292828)
FT                   /locus_tag="M446_0239"
FT   CDS_pept        complement(291050..292828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0239"
FT                   /product="acetolactate synthase, large subunit,
FT                   biosynthetic type"
FT                   /note="TIGRFAM: acetolactate synthase, large subunit,
FT                   biosynthetic type; PFAM: thiamine pyrophosphate protein
FT                   domain protein TPP-binding; thiamine pyrophosphate protein
FT                   central region; thiamine pyrophosphate protein TPP binding
FT                   domain protein; KEGG: mex:Mext_4864 acetolactate synthase,
FT                   large subunit, biosynthetic type"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14811"
FT                   /db_xref="GOA:B0UFF7"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:B0UFF7"
FT                   /protein_id="ACA14811.1"
FT                   /translation="MGAAEVMTGAEMVIRALQDQGVDTLFGYPGGAVLPIYDALFHQDS
FT                   VKHILVRHEQGAVHAAEGYARSSGKVGCVLVTSGPGATNVVTGLTDALLDSIPLVCITG
FT                   QVPTHLIGSDAFQECDTVGITRSCTKHNYLVKSIDDLPRILHEAFYVASHGRPGPVVID
FT                   LPKDVQFASGLYRRPVENGHKTYKPQIQGDRSKIRAAVALMAGARRPVFYTGGGVINSG
FT                   PEASRLLRELVRTTGFPITSTLMGLGAYPGSDPQFLGMLGMHGTYEANLAMHECDVMIC
FT                   IGARFDDRITGRLDAFSPFSKKIHVDIDASSINKNVKADLAILGDCASVLADMLAEWRA
FT                   ITPTPDKGRLTEWLSKINGWKARECLGYWPSATTIKPQHAVQRLYEATKHRETYVTTEV
FT                   GQHQMWAAQYYKFEEPNRWMTSGGLGTMGYGLPAAIGAQLAHPGALVIDIAGEASILMN
FT                   MQEMSTAVQYRLPVKIFILNNEYMGMVRQWQELLHGSRYSESYSSSLPDFVKLAEAYGA
FT                   KGIRCERPGDLDAAIQEMLDYDGPVIFDCIVDKTENCFPMIPSGKAHNEMLLSDYLGET
FT                   GGDLGSVIGEEGKVLV"
FT   gene            293180..293671
FT                   /locus_tag="M446_0240"
FT   CDS_pept        293180..293671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0240"
FT                   /product="CheW protein"
FT                   /note="PFAM: CheW domain protein; KEGG: mex:Mext_2835 CheW
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14812"
FT                   /db_xref="GOA:B0UFF8"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="UniProtKB/TrEMBL:B0UFF8"
FT                   /protein_id="ACA14812.1"
FT                   /translation="MAGAAAFLVVDVAGTGCAVRREAVREVLPLPRLWRPPGVPAALAG
FT                   FFSLGGAAVPVLDLAVLFGLAGASAGRPMLYRHLLLVGEAAPLALLVDRVDDLVSVEPE
FT                   AVTPLPQGTALNGCVAGELRCGGRLLHELAVSRILLAEERARLDAQTRLAQERLAEWAA
FT                   "
FT   gene            293659..295116
FT                   /locus_tag="M446_0241"
FT   CDS_pept        293659..295116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0241"
FT                   /product="MCP methyltransferase, CheR-type"
FT                   /EC_number="2.1.1.80"
FT                   /note="PFAM: MCP methyltransferase CheR-type; KEGG:
FT                   mex:Mext_2836 protein-glutamate O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14813"
FT                   /db_xref="GOA:B0UFF9"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036804"
FT                   /db_xref="UniProtKB/TrEMBL:B0UFF9"
FT                   /protein_id="ACA14813.1"
FT                   /translation="MGRLTPRAPTEDPAFAALKAAIVARTGHHYYADKDDLLWDRLRGR
FT                   LRAAAAPDAGAYLAHLSASEEEWAALEAEITIGETFFFRYAEQFAALRRTILPERIAAR
FT                   AREKRLRIWSAGCSTGPETYSLAILLHEILGEALAEWRIALTGTDINREVLAVARRAEY
FT                   GAWALRSLSAEERARYFRRGARENTFALRPEFRGLARFEPQNLLHLVDGTASLALTDYD
FT                   LILCRNVLIYFHPDTVMAVVRALAERLRPGGWLLLGHAEPNPAFAEILRPVSLPGTAAY
FT                   RRPEEDPAPLPALPPGPAQESFPPRVPPPAPSRPARRAPARPSPPPAPPASPAGESPPG
FT                   ESPPSESPPSESPPGAALAAVRALADAGDLDASWQACRAALQADPTDARLRFYEGLLAR
FT                   ARARPEEAERAFRAAIYLEKGFVMAHYHLGLTLIALGRGAAGRRAVENALRLAAPLPPE
FT                   TELPEGDGLTAARLTDAARPLLDAVAP"
FT   gene            295413..295850
FT                   /pseudo
FT                   /locus_tag="M446_0242"
FT   gene            295874..297559
FT                   /locus_tag="M446_0243"
FT   CDS_pept        295874..297559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0243"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: mex:Mext_2838
FT                   chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14814"
FT                   /db_xref="GOA:B0UFG0"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:B0UFG0"
FT                   /protein_id="ACA14814.1"
FT                   /translation="MTSVSISIGNRILLGFTAVILVIVALGLYALAQIGDVRRATDLIV
FT                   SRDLAVMHQLEGIREAQRRMSDLRDEATTRYFLRALNREVPPKEEPAVGWRRAATAAET
FT                   ALASAITNVNEYRGQSLSADRAAAWQRIGEILTAAGVELRAIRTGTERQFQALDAGDVA
FT                   TVQNAETDLDQAQESFGRTMVSARDALDEAIAAGQRRVGAVYEESRISTIAALATCVVM
FT                   ALVITALIRRSVAHPLETVMAFVGRVGEGDLTGRIADRSRDEFGRLGLVLNQMVDGLRE
FT                   LASQNRGATANLNAAAAEIRASAQEQAASVEEQFAAVQETAATVDEITHAGAQIGKRAQ
FT                   EVIATAQATAQTSQAGLRAVDETARAMDAIREQSEAVATNIVSLSEKTQAIGEIIATVN
FT                   DVSERTHLLALNAAIEAAAAGESGRSFAVVASEMKALADQAKEATGQVRALLGDIQRGI
FT                   NASVMLTEEAVKRVALGKERSDTTHATIEEITARVQESVQTFQQIVASTNQQQLGIEQV
FT                   MGALQNIRQASQQTAAGTRQVESAAANLSELATALTALAQRYRL"
FT   sig_peptide     295874..295972
FT                   /locus_tag="M446_0243"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.977 at
FT                   residue 33"
FT   gene            297667..299910
FT                   /locus_tag="M446_0244"
FT   CDS_pept        297667..299910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0244"
FT                   /product="CheA signal transduction histidine kinase"
FT                   /note="PFAM: response regulator receiver; CheW domain
FT                   protein; ATP-binding region ATPase domain protein; Hpt
FT                   domain protein; KEGG: mex:Mext_2839 response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14815"
FT                   /db_xref="GOA:B0UFG1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B0UFG1"
FT                   /protein_id="ACA14815.1"
FT                   /translation="MDIRAMLLAAFEAEHREHLGAIRAALAAAREGRGPDWNDVFRRAH
FT                   SLKGAARAVDLPAIEEIAHRLETLFDRIVEGAHPLDAAALAAVTLALDRIEGMAAGLAE
FT                   TPDPPLPADAAAALDRALGLQPPAAPPHREAAPATPPAAPAPQAEPAPEPALSVLRIAS
FT                   DDVEGLSRAVHGLSLALQGHDEIGGALAALDGQGRILRRTADAWRERTGEVAALARRLR
FT                   EAGDPGAALLEAALDLGRRLDGEARVMVRGVSGLARDQHRAAGTVEAAARRLRESSDRL
FT                   LLVPAETVFGGYGRMVREIAREAGLPVEVRLQGLDVPIDRSLLQELKDPVLHLMRNAVS
FT                   HGAEPPDERRRKGKPEALTVTLSLAVRGGDLVLAVRDDGRGPDVARIVETARRQGLIAP
FT                   DARPTTREALGLVFAPGFSTTDKIDRLSGRGVGLSVVAEAAARLRGRARLRRAQPHGAE
FT                   VVVVVPLSAARRPLLLVEAGGRVYAIPSGAAARLLRLRAAEIAPVAGVPSARLSLDGRD
FT                   AVVPVVPLAGLLGGDATLPVEDGLLRGVLLRSGSDLCLAAVDRLLDVRASLVGPPPPIG
FT                   GEAGLFSGTILLTDETPALVLDPAGLLARAGETAGRVAPAPARAEAPGRRWTILVVDDS
FT                   ITTRTLEKSILEAQGYRVFVCVDGQDALERLRRDHAEVDLVVADVEMPRLDGFGLLQAI
FT                   KADPALTRLPVILMTSRGDPADIRRGLDLGADAYITKQKFDQRELLDTIGQLL"
FT   gene            300020..301087
FT                   /locus_tag="M446_0245"
FT   CDS_pept        300020..301087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0245"
FT                   /product="response regulator receiver modulated CheB
FT                   methylesterase"
FT                   /EC_number="3.1.1.61"
FT                   /note="PFAM: CheB methylesterase; response regulator
FT                   receiver; KEGG: mex:Mext_2840 protein-glutamate
FT                   methylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14816"
FT                   /db_xref="GOA:B0UFG2"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:B0UFG2"
FT                   /protein_id="ACA14816.1"
FT                   /translation="MTAPVRVMLVEDSLVVRQLLAHIVSRDPRLALVAAVPSGEEALRE
FT                   IHRVQPDVISMDIRLPGIDGLETTRRIMAERPTPIVVIADAVEDSSLKISMNALRAGAL
FT                   SVVEKPVGTGHRAYAAVADEICTQLRIMSEVPVIRRRPIGAERERPPLFDPPARPDAVG
FT                   APPGLVAVAASTGGPPAFARLLGALPAAFPAPILLVQHMGAAFMDGFAAWLNGVVPLAV
FT                   EIAAEGVRPLPGHVYVAPGDRHLEFGPGGLIALSDDPPIGGQRPSATALFRSLARHAGS
FT                   RALGILLTGMGEDGAAGLLDMRRAGALTIAEHETSAVVYGMPAAAVRLRAASAVLPLDM
FT                   IAPRILRAVQPGAAR"
FT   gene            301084..302805
FT                   /locus_tag="M446_0246"
FT   CDS_pept        301084..302805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0246"
FT                   /product="response regulator receiver sensor signal
FT                   transduction histidine kinase"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; KEGG: mex:Mext_2841 ATP-binding region ATPase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14817"
FT                   /db_xref="GOA:B0UFG3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B0UFG3"
FT                   /protein_id="ACA14817.1"
FT                   /translation="MRAAPTGAAPARILLVEDSETQALQLRLFLEGSGFAVTRCATAEA
FT                   ALDALNQGLPDLVVADYHLPGINGDELTRQMRLSLRTRATPVLMLTEAQGRDLERQGLE
FT                   SGADAYVPKSADRDLLVLRIRALLRERGAGTAQEAGHGAFRRARILVVDASATYRAYLA
FT                   GLFGQDGHAVVAAEGPDQALAALAAPDAAFDCVTVDLLSTAYEAVELCRRVASLRESAG
FT                   GPGFYLVGIGSAAAAGKDLLVQAFAAGVDDVVPKGAEGEVLAIRVRTLVRRKLLEEDNR
FT                   RVADELRQHERAVERAQAEAAAAEAKAALAGALERANRDLADANRQLKDAQAKLVQAAK
FT                   MASLGELVAGIAHEINNPLAFILAHQGTVERLVGEVAEQAEGLPEPARRALAKARDRIG
FT                   AMRLGLGRIQDLVVNLRKFSRLDEGEMRSVNVPDAIETVLALLQHKLGTRIAVERLFAG
FT                   EPEIRCTPALLNQVVMNIIGNAADAIPGEGRITVETLSEAENDVIRISDTGPGVPEALR
FT                   ERIFEPFFTTKPVGSGTGLGLAIAYSVVQAHSGTISVETAPGGGACFVISIPRRPA"
FT   gene            302802..304724
FT                   /locus_tag="M446_0247"
FT   CDS_pept        302802..304724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0247"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /note="KEGG: mex:Mext_2842 PAS sensor protein; TIGRFAM: PAS
FT                   sensor protein; PFAM: response regulator receiver;
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; PAS fold-4 domain protein; PAS fold
FT                   domain protein; SMART: PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14818"
FT                   /db_xref="GOA:B0UFG4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B0UFG4"
FT                   /protein_id="ACA14818.1"
FT                   /translation="MITDETNLRRGMDREAARGTILAVDDEPDILVALEDLLEDEFRVL
FT                   TASRPADALALLAAEPDVAVIVSDQRMPGMTGDALLARAREVSDAQAILLTGYADLSAV
FT                   TSALNRGGITGYVTKPWDAALLRGAVRAAYERCRLGRDLATERALLRGLLDHAGDAIAF
FT                   KDPQGRFVRLNAAKAARLGAAVEDCLGEPESRFLDPETAARVEAADREAAAGLHPVEAT
FT                   IAGGPAAAPTWTQVVRVPIRDAHGALAHLATIERDVTEQKQLEARLRQADKMQALGTLA
FT                   GGVAHDFNNLLTAIMGSLELALPKVAGDARLTRLMTNAAQAAQRGAALTKRLLSFSRQR
FT                   DLQARVVDLNGVIRGMDDLLGRSLGGFVQVDHALAPDLWPARVDPEQLELAILNLCING
FT                   RDAMPDGGIVTLSTRNVVVAGSPDPDLPDGDYAVIAIADTGTGIPPEILSRVFEPFFTT
FT                   KAQGQGTGLGLAMVFSLLQQSGGTIRIDTEVGRGTRVDLYLPRAHEPVETDEARAGAAV
FT                   PPRRRARILVVDDDPQVRHVTASFLSGFGHEAVEVPEAEAALARIEAEPFDLVVADLAM
FT                   PGMTGLDLAEAVRGRRPDLPFLIVTGHAEAARIPHAYAVLEKPFPSGELGTRVAALLAD
FT                   APERR"
FT   gene            304958..305548
FT                   /locus_tag="M446_0248"
FT   CDS_pept        304958..305548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0248"
FT                   /product="Adenylyl-sulfate kinase"
FT                   /EC_number="2.7.1.25"
FT                   /note="PFAM: adenylylsulfate kinase; KEGG: rru:Rru_A2290
FT                   sulfate adenylyltransferase, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14819"
FT                   /db_xref="GOA:B0UFG5"
FT                   /db_xref="InterPro:IPR002891"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0UFG5"
FT                   /protein_id="ACA14819.1"
FT                   /translation="MVRVPTPHAAQDSSPVGEALPAGAGSRACIVWLTGLSGAGKSTLA
FT                   GQLRDLLRAEGRPTTILDGDALRRGLNRDLGFSDADRVENIRRTAEVAWLMADAGLTVI
FT                   VALISPFRRERAEARALARGLPFFEVHVDASLPACERRDPKGLYRRARAGEIPRFTGID
FT                   SAYEPPESPDLRVDTERLTPREATAQVLALLRG"
FT   gene            complement(305690..306343)
FT                   /locus_tag="M446_0249"
FT   CDS_pept        complement(305690..306343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0249"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mex:Mext_4632 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14820"
FT                   /db_xref="UniProtKB/TrEMBL:B0UFG6"
FT                   /protein_id="ACA14820.1"
FT                   /translation="MSYLAPGTPENVALAQHVNGRLRAEARVVAARAFLFRALGLGTFS
FT                   AFAGIGIGAGFYGYAAMHEVQGAADKLAAALTTALGDVTLKTKGEVTLTDNTLRLEGGA
FT                   PAKAGRPDVAALTTNQGKSDAPASTAIRTSFTVFKTVPYLDGSIVTGWNFKGDEAKPEK
FT                   QYCYVTRPQSFGDGTTSNQTTVAIDGQVLPQPARSELNFAVVAKNCVWFDPSKI"
FT   gene            complement(306340..307566)
FT                   /locus_tag="M446_0250"
FT   CDS_pept        complement(306340..307566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0250"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mex:Mext_4633 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14821"
FT                   /db_xref="GOA:B0UFG7"
FT                   /db_xref="UniProtKB/TrEMBL:B0UFG7"
FT                   /protein_id="ACA14821.1"
FT                   /translation="MLVRKPPDRIVARERRAWSDETAAWQQRRAVEKGYRIRWGYVAIA
FT                   YVVEALVICTSLAGAWFFAQTYADPHDQSFWFMLLAPVVYAAIELCRVPLGILIRVQRD
FT                   WLIKGLAVIGIVMAAGVTTKSVSQLGEMMFHPRLAEASKALSVLKEAQADRASLDTRIS
FT                   QADARVAQYTAESQALEKRSSEASSQLAGLPGQRCERLQGTNSRGRRYSYMRCVTDPRT
FT                   ATIAGSLKSAGDERAVLARNLAEARAARAALDRGASDRRVTEAEVAYRDAVRRSQLHSF
FT                   TAMVYGVDPIDVTDQQVHAFLRIFVFAPALCAAFASTLLALCAVQVRRTYQDEDDLGVA
FT                   LNQEGVPLLLTQIAESAGQLDDAQRAVREAIAAGVAIPLDQRRPHGTPQGSPPPGPGRD
FT                   DDRIERPRP"
FT   gene            307805..309094
FT                   /locus_tag="M446_0251"
FT   CDS_pept        307805..309094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0251"
FT                   /product="Cystathionine gamma-synthase"
FT                   /EC_number="2.5.1.48"
FT                   /note="PFAM: Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent protein; KEGG: mlo:mll1618
FT                   methionine gamma-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14822"
FT                   /db_xref="GOA:B0UFG8"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B0UFG8"
FT                   /protein_id="ACA14822.1"
FT                   /translation="MSDNRYHKDRLGNRRLHPETLMLGYGYDPALSEGAVKPPIFLTST
FT                   FVFTSAEHGKAFFDYVSGRREPPKGEAAGLVYSRFNHPNSEIVEDRLAVFEEAESALLF
FT                   SSGMSAIATSILAHARPGDAVLHSQPLYGGTETLIAKTLGGLGIAAHGFANGTDPACVR
FT                   EAAAAARAAGRVSVVMVETPSNPLNTLVDLALVRRVADEIGAAQGGEPPVVICDNTLLG
FT                   PLYQQPLRHGADISVYSLTKYVGGHSDLIAGAALGSAARMRPVRLLRSAIGTQLDPHSC
FT                   WMIGRSLETLSLRMSAANRNGEQVAAMLHAHPKVTRLHHLGYLSPGSPEAAVCAAQCGA
FT                   PGSTFSFDVAGGEAEAFRVLNALQLFKLAVSLGGTESLASHPASTTHSGVPKEVRDRLG
FT                   VTDATIRVSIGIEHPDDLIADLEAALATLD"
FT   gene            309335..309700
FT                   /locus_tag="M446_0252"
FT   CDS_pept        309335..309700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0252"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14823"
FT                   /db_xref="UniProtKB/TrEMBL:B0UFG9"
FT                   /protein_id="ACA14823.1"
FT                   /translation="MLHIRLDLAHLHLNNAMDRLIFDIGEVQGCAKQLEDPRSTAEPRA
FT                   EAGKAAGRTRARAAGAAARYGMRPDGLGWTLCEHGSGRTLVMNGVVQAGLDHDVARVIA
FT                   EFLNAHGDQSVVLALTA"
FT   gene            complement(309797..310903)
FT                   /locus_tag="M446_0253"
FT   CDS_pept        complement(309797..310903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0253"
FT                   /product="Capsular polysaccharide biosynthesis protein-like
FT                   protein"
FT                   /note="KEGG: sye:Syncc9902_2182 capsular polysaccharide
FT                   biosynthesis protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14824"
FT                   /db_xref="GOA:B0UFH0"
FT                   /db_xref="InterPro:IPR007657"
FT                   /db_xref="UniProtKB/TrEMBL:B0UFH0"
FT                   /protein_id="ACA14824.1"
FT                   /translation="MTGFTGHRLRRCRDLWGACRLVEAPPAARVLEDVLLVPPGGPVPA
FT                   GLFAAGRRLRGEGGEAAPGALPVGEPAPDGLYLFVPALAPHYGHFVTDTLAHLWPLAAW
FT                   EGPRPRLALLAPPHALDGADYARVILERLGLGPGDLVHFDRPVRLPRLLLPEPAFEERA
FT                   FVHAVYGALCREIGRPFRDGPALDRPVYLTKTRLPAGIARIANEEAIVEELDRRGVEIV
FT                   APETLPFVEQVRLVSTRRVVMGSTGSAFHTTIFAAPGRRVLGLNWTWKLHANFALLDAV
FT                   TGTAGRYYFPLGTRYGAADSFHFGWQVRDPRAVAAELLARAEAFDRLDAIDAADDAADR
FT                   TLLGRVRGLVEDLRWRLSRGGRGVAGGP"
FT   gene            311042..312829
FT                   /locus_tag="M446_0254"
FT   CDS_pept        311042..312829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0254"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: TrkA-N domain protein; sodium/hydrogen
FT                   exchanger; KEGG: mex:Mext_4634 sodium/hydrogen exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14825"
FT                   /db_xref="GOA:B0UFH1"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B0UFH1"
FT                   /protein_id="ACA14825.1"
FT                   /translation="MTDPVVHGASYKEAILFLVTAGIVVPLFHRLRISPVLGFIGAGAL
FT                   LGPSGLGRLTGSAPWLAEVTIGNRSEIAHLADLGVIFLMFMIGVELSWERLRILRRLVF
FT                   GLGSLQVALSSLVLGALLLPLGVNPTAAGLVGLSLALSSTAIVLPVLADQKRLNAPAGR
FT                   ASFAVLLFQDLAVAPVLFAIAVLGRKDGDAIGGLALALGQAAVAIALIVGAGRLGLRPL
FT                   FQLVARTRSPELFMAACLLVIVATALVAAASGLSTTLGAFVAGLLLAETEYRRAIEATI
FT                   DPFKGLLLGVFFVSVGMNLDPAQLLDAPAAILGLSLAMILIKGGVILAVARALRLSRAV
FT                   AVETALLLGAGGEFAFVLIGSALSADLVPEGLGQAALVVTTVTMVMIPLLAALARRLGR
FT                   QIDRRALAQVPAEPPPERQQGRVIEAGYGRVGRLVGEMLARHKVPYLALDMDAARVAEQ
FT                   RRLGNPVYFGDSANPELLRRCGIAGARALVVTLDAPRSVEAVVAAARAERPDLTIVARA
FT                   RDARHATALYELGVDDAVPETIEASLQLSEAVLVDVGVPMGLVIASIHERRDEFRALLR
FT                   RSEAPPPEFQARRTVGKAR"
FT   gene            312836..313939
FT                   /locus_tag="M446_0255"
FT   CDS_pept        312836..313939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0255"
FT                   /product="conserved hypothetical protein; putative
FT                   deoxyribonuclease"
FT                   /note="KEGG: mex:Mext_0674 conserved hypothetical protein;
FT                   putative deoxyribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14826"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="UniProtKB/TrEMBL:B0UFH2"
FT                   /protein_id="ACA14826.1"
FT                   /translation="MTRFSPEQEAALRAVSAWLKAGEPRVFRLFGFAGTGKTTLARRVA
FT                   EDVEGGVLFAAYTGKAASVMRQRGCHDAATIHSLIYRAREGEEGGPAFTLNRTGPVSKA
FT                   ALVVIDECSMVDADLGNDLLSFGKPVLVLGDPAQLPPVKGGGFFTEAEPDVMLTEIHRQ
FT                   AADDPIIRLAMAVREGGQLETGRYGASAVVNRRGITPEAVLAADQVLVGLNRTRRLYNG
FT                   RIRDLMGQTDPMPAVGEKLVCLRNDRTKGLLNGSTWTVQALRAAPRPDLVRLDVVPEDD
FT                   PALRRRPQDIRVLRAVIEGSEEPIPAILKRESDEFTYGYALTVHKAQGSQWDRVVLFDE
FT                   SYAFREHARRWLYTGLTRAAQAITVVV"
FT   gene            314099..314629
FT                   /locus_tag="M446_0256"
FT   CDS_pept        314099..314629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0256"
FT                   /product="20S proteasome A and B subunits"
FT                   /note="PFAM: 20S proteasome A and B subunits; KEGG:
FT                   mex:Mext_0644 20S proteasome A and B subunits"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14827"
FT                   /db_xref="GOA:B0UFH3"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:B0UFH3"
FT                   /protein_id="ACA14827.1"
FT                   /translation="MHATTILMVRKGGRVVIGGDGQVSLGQTIVKGNARKVRRLAKGAV
FT                   IGGFAGATADAFTLFERLEAKLEQYPGQLTRACVELTKDWRTDRYLRRLEAMMLVADRE
FT                   VGLLLSGSGDVLEPEGGVMAIGSGGNYALAAARALEDQDLDAEAIVRRSLAIAAEICVY
FT                   TNGNLVIESLEAA"
FT   gene            314693..316006
FT                   /locus_tag="M446_0257"
FT   CDS_pept        314693..316006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0257"
FT                   /product="heat shock protein HslVU, ATPase subunit HslU"
FT                   /note="KEGG: mex:Mext_0645 heat shock protein HslVU, ATPase
FT                   subunit HslU; TIGRFAM: heat shock protein HslVU, ATPase
FT                   subunit HslU; PFAM: ATPase AAA-2 domain protein; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14828"
FT                   /db_xref="GOA:B0UFH4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UFH4"
FT                   /protein_id="ACA14828.1"
FT                   /translation="MTTFSPREIVSELDRYIVGQADAKRAVAIALRNRWRRQQLHGPLR
FT                   EEVAPKNILMIGPTGCGKTEISRRLARLANAPFLKVEATKFTEVGYVGRDVEQIVRDLV
FT                   EVGIGLKRDEKRRSVQARAEAAAEARILDALVGPTAGQATRDSFRRRLRAGELDDKEVE
FT                   IELASAAPSGLPMFEIPGVPGAAMGAINLGDMLGKALGGQKGKPRRVTVRDAHAPLMAE
FT                   ESDKLLDQDAIVQEAVREVEDNGIVFLDEVDKICAREGRGGADVSREGVQRDLLPLIEG
FT                   TTVATKHGPVKTDHILFIASGAFHVSKPSDLLPELQGRLPIRVELAPLTVDDFRRILTE
FT                   TEASLLKQAVALMATEGVAVTFTEDAVDALARVAVEVNSSVENIGARRLQTVLERVLDE
FT                   ISFTAPDRAGESVTIDAAYVRERVESLAQNADLSRFIL"
FT   gene            complement(316128..317213)
FT                   /locus_tag="M446_0258"
FT   CDS_pept        complement(316128..317213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0258"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /EC_number="2.7.8.13"
FT                   /note="KEGG: mex:Mext_4636
FT                   phospho-N-acetylmuramoyl-pentapeptide-transferase; TIGRFAM:
FT                   phospho-N-acetylmuramoyl-pentapeptide-transferase; PFAM:
FT                   glycosyl transferase family 4"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14829"
FT                   /db_xref="GOA:B0UFH5"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UFH5"
FT                   /protein_id="ACA14829.1"
FT                   /translation="MLYLLSELSGVFSPFNVFRYITFRTGGALFTAGLFVFWFGPWIIS
FT                   LLRLRQGKGQPIREDGPQTHLLTKRGTPTMGGLMILAGLLVAVFLWANPRNSYVWITVV
FT                   VTLGFGAIGFYDDYLKVTKQSHKGFSGKFRLGLEALIAVAACVAVAEYSAPGLAYRLAF
FT                   PVFKDAIVNLGLFWIFFASFVIVGAGNAVNITDGLDGLAIVPVMIAAATFGIIAYLVGN
FT                   VIYASYLQVNYVPGTGELAVVCGALIGAGLGFLWFNAPPAQIFMGDTGSLALGGLLGTV
FT                   AVATKHEIVLAVVGGLFVLEIASVIIQVASFKLTGKRVFRMAPIHHHFEQKGWKEPQVV
FT                   IRFWIIAVVLALLGLATLKLR"
FT   gene            complement(317314..318771)
FT                   /locus_tag="M446_0259"
FT   CDS_pept        complement(317314..318771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0259"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate--D-alanyl-D-alanyl ligase"
FT                   /note="TIGRFAM: UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate--D-alanyl-D-alanyl ligase; PFAM:
FT                   cytoplasmic peptidoglycan synthetase domain protein; Mur
FT                   ligase middle domain protein; KEGG: mex:Mext_4637
FT                   UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate--D-alanyl- D-alanyl ligase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14830"
FT                   /db_xref="GOA:B0UFH6"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B0UFH6"
FT                   /protein_id="ACA14830.1"
FT                   /translation="MTEPLWTLDAVLAATGGRALDGAPDAPLSGLSIDTRTLKVGDLFF
FT                   AIRGEQRDGHDFVRDALARGAGAAVVSQARAADLAGAGPLVAVPEAGEDPVLAAMRKLA
FT                   AAARARSRARIVAVTGSVGKTGTKEALRHVLAAQGATHASVASYNNHWGVPLTLGRMPA
FT                   ASAFGVFEIGMNHAGEIAPLTRLVRPEVAVVTTVEPVHIEHFRALSGIADAKGEIFCGL
FT                   EPGGVAVINRDNPHFERLRDHALASRAGRIVSFGEHPRADVRAERVVMRPDLSIVDARV
FT                   MGIPVTYQLGTPGRHTALNSLAVMAAVHALGADLALAALSLAQLRPPVGRGERTLLRLR
FT                   DGEALLVDESYNANPASVRAALATLAGIEVQGRARRIAVLGDMLELGAEAARLHRDLAA
FT                   AVAEHGIDLVFVAGPLMAELFEALPAGTRGVAAASSADLLDAVVAEIRPGDAVMVKGSN
FT                   STRMGRIVEALKARYGGGADAIAARPT"
FT   gene            complement(318768..320234)
FT                   /locus_tag="M446_0260"
FT   CDS_pept        complement(318768..320234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0260"
FT                   /product="UDP-N-acetylmuramyl-tripeptide synthetase"
FT                   /note="TIGRFAM: UDP-N-acetylmuramyl-tripeptide synthetase;
FT                   PFAM: cytoplasmic peptidoglycan synthetase domain protein;
FT                   Mur ligase middle domain protein; KEGG: mex:Mext_4638
FT                   UDP-N-acetylmuramyl-tripeptide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14831"
FT                   /db_xref="GOA:B0UFH7"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B0UFH7"
FT                   /protein_id="ACA14831.1"
FT                   /translation="MSGTTTLGALFPEAAGAASALPVAALTADSRRVGPGAVFVAVPGT
FT                   RADGRLFAAQAAAAGAVAMVAEGPRPADLPQAVAYLSVPDARRALALAAARLHPGQPAT
FT                   VVAVTGTSGKSSVADFVRQILARLGRRSASLGTLGVVTGEGAAYGALTTPDPVTLHETL
FT                   DRLARDGITDLAMEASSHGIEQRRLDGVRLTAAAFTNLGHDHLDYHRTVEAYLAAKLRL
FT                   FEDLLPEGATAIVNADGPMADRAVAAIRARSLPLVTTGRAGETLRLDAVETRGFAQRLT
FT                   LAAQGRALTVDLPLVGSYQVENALVAAALVLATPAGRGRLEAVIGALGHLAGVPGRLER
FT                   VATHRGALCVVDYAHKPEALAGVLQALRPFATGRLVCVMGCGGDRDRAKRPMMGRIAVA
FT                   GADRVIVTDDNPRSEEPAAIRAEILAAAPGAEEIGDRAEAIRAAVRDLAPGDVLVVAGK
FT                   GHETGQIIGDRTLPFSDRDAVLSAIEETRA"
FT   sig_peptide     complement(320181..320234)
FT                   /locus_tag="M446_0260"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.760) with cleavage site probability 0.388 at
FT                   residue 18"
FT   gene            complement(320231..322033)
FT                   /locus_tag="M446_0261"
FT   CDS_pept        complement(320231..322033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0261"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: penicillin-binding protein transpeptidase;
FT                   Penicillin-binding protein dimerisation domain; KEGG:
FT                   mex:Mext_4639 peptidoglycan glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14832"
FT                   /db_xref="GOA:B0UFH8"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:B0UFH8"
FT                   /protein_id="ACA14832.1"
FT                   /translation="MSDASPDPAPEAAPEAAPPRPSRLLAILRAMFRFAVERSGARVNL
FT                   VGVVFGGVFAVIIGRLVLTAAIPEEPSSQAQRVAAAAATAIRPDIVDRNGEILATDIRT
FT                   VSAFAEPGNIVDKDEAVELLTAVLPDLNAAELRAKLTPKRKGAGFVWIKRELTPKQQAE
FT                   VHRLGIPGIGFLPDHKRVYPNGVAAAHVLGFANLDNVGIAGMEKYIDKTGLKDLNNLGF
FT                   IEKSADLAPVQLSIDLRAQHAVRDELAWGMEHYRAKAAAAMILDVNTGEVLALASLPDF
FT                   DPNEPADALNPDRINRMNVGVYEMGSTFKAMTLAMALESGKFTVNSTFDTRGGVLSWGR
FT                   QKIHEYHGTNRVITMPEVFTHSSNIGSAKMALGVGVPGHKAFLKKMGLLDRMRTELPES
FT                   AEPIVPPRWTEINTITIAFGHGLAVAPLQAAAAVAAITNGGFLITPTFLRRDEAAAREK
FT                   AVQVLTPQTSEAMRFIMRLNATEGSAKKADNPYYFVGGKTGTAEKVIRGHYVKNRLFTT
FT                   FMAAAPMDKPKYLFVTVMDEPQAVAAESGGYATAAWNSGVVTGRILSRVAPILGLPPKF
FT                   EGPTNPFPLMVKLGAYHANQVGAR"
FT   gene            complement(322042..322536)
FT                   /locus_tag="M446_0262"
FT   CDS_pept        complement(322042..322536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0262"
FT                   /product="putative exported protein of unknown function"
FT                   /note="KEGG: mex:Mext_4640 putative exported protein of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14833"
FT                   /db_xref="UniProtKB/TrEMBL:B0UFH9"
FT                   /protein_id="ACA14833.1"
FT                   /translation="MIRLLHLLAIAGLITSAIYAYSIKYETLYQAEQVAKLKSRLRRER
FT                   EATAVLRAEWQLLTRPDRLQAAVDKYLRLEPIGTEHLGRLADLPARADRGDEIARKLES
FT                   LGLLATATPTSRERPGAGRGGDEPRTTGSTAAHSPGTKPPGASPSATPPRTSTRTPTAT
FT                   R"
FT   sig_peptide     complement(322474..322536)
FT                   /locus_tag="M446_0262"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.946) with cleavage site probability 0.757 at
FT                   residue 21"
FT   gene            complement(322533..323546)
FT                   /locus_tag="M446_0263"
FT   CDS_pept        complement(322533..323546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0263"
FT                   /product="S-adenosyl-methyltransferase MraW"
FT                   /note="TIGRFAM: S-adenosyl-methyltransferase MraW; PFAM:
FT                   methyltransferase; KEGG: mex:Mext_4641
FT                   S-adenosyl-methyltransferase MraW"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14834"
FT                   /db_xref="GOA:B0UFI0"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UFI0"
FT                   /protein_id="ACA14834.1"
FT                   /translation="MSGAPHIPVLLAEVRGVLRLGEGPGVVVDGTFGAGGYSRALLAAD
FT                   PDLRVIAIDRDPTAVAAGQELAAAAGGRLRLVQGRFGDLDAIVRREGVEAVDGVVLDIG
FT                   VSSMQLDRAERGFSFRADGPLDMRMEGAGTSAADLVNGAPEAELADIIYHFGEERRSRA
FT                   VARAILEARRRAPIATTGALAEIVAGVVRAEPGSGIHPATRTFQALRIAVNDELGELNR
FT                   ALHAAERILRPGGRLAVVTFHSLEDRIVKQFFSARSGRAVSASRHLPMAERPVPRSFTL
FT                   VTKGPVGPSEAEAAANPRARSAKLRAGERTDAPAPEPLAALAALAALPPRERGGRR"
FT   gene            complement(323942..324299)
FT                   /gene="rnpB"
FT                   /locus_tag="M446_R0085"
FT   ncRNA           complement(323942..324299)
FT                   /gene="rnpB"
FT                   /locus_tag="M446_R0085"
FT                   /product="RNA component of RNaseP"
FT                   /note="RNaseP_RNA; Bacterial RNase P class A as predicted
FT                   by Rfam (RF00010), score 215.14"
FT                   /ncRNA_class="other"
FT   gene            324463..324639
FT                   /locus_tag="M446_0264"
FT   CDS_pept        324463..324639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0264"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mex:Mext_0439 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14835"
FT                   /db_xref="UniProtKB/TrEMBL:B0UFI1"
FT                   /protein_id="ACA14835.1"
FT                   /translation="MSETVEAGWTLETVQQLRAMAREGVAPAVMSLKLKRSVTQIHAKL
FT                   AELGITPSAKSRD"
FT   gene            complement(324690..325769)
FT                   /locus_tag="M446_0265"
FT   CDS_pept        complement(324690..325769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0265"
FT                   /product="sodium/calcium exchanger membrane region"
FT                   /note="PFAM: sodium/calcium exchanger membrane region;
FT                   KEGG: aba:Acid345_4437 sodium/calcium antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14836"
FT                   /db_xref="GOA:B0UFI2"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:B0UFI2"
FT                   /protein_id="ACA14836.1"
FT                   /translation="MQVPAGGMPVWAWASPLVAWLLLAAAILTEPPALLLAAAAAGLVA
FT                   TVFAAVFHAEVVAHRVGEPFGTLVLALSVTVIEVALIVSVMVAGGPEKAALARDTVFSA
FT                   VMIICNGLVGLCLLAGGVRHHEQGFALQGALAALAVLAALVTLTLVLPNFVSTPGPAFT
FT                   VPQLLFAGAASLTLYGAFVFVQTVRHRDYFLPEGGTEEEHAGPPPARVALASFGLLLAC
FT                   LVAVVGLAKALTPTLERAIDVADVPKSVSGIVIAALVLMPEGLAALRAARANRLQTSMN
FT                   LALGSALATIGLTIPAVALVSVLIGRPLVLGLPPKDQVLLALTLLVAVITLGTGRTTVL
FT                   QGIVHLVVFASFLFFALIP"
FT   gene            complement(325799..326239)
FT                   /locus_tag="M446_0266"
FT   CDS_pept        complement(325799..326239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0266"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: mex:Mext_0440
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14837"
FT                   /db_xref="GOA:B0UFI3"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B0UFI3"
FT                   /protein_id="ACA14837.1"
FT                   /translation="MEYLHTMVRVADLDRALDFYCGKFGLEEVRRVENEKGRFTLVFLA
FT                   APGDVARARESRSPLLELTYNWDPEDYTGGRNFGHLAYQVDDIYETCAKLQAAGVTINR
FT                   PPRDGHMAFVRSPDGISIEILQKGGAKPPREPWASMPNTGTW"
FT   gene            326384..329068
FT                   /locus_tag="M446_0267"
FT   CDS_pept        326384..329068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0267"
FT                   /product="aminopeptidase N"
FT                   /note="TIGRFAM: aminopeptidase N; PFAM: Peptidase M1
FT                   membrane alanine aminopeptidase; KEGG: mex:Mext_0542
FT                   aminopeptidase N"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14838"
FT                   /db_xref="GOA:B0UFI4"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR012779"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR024601"
FT                   /db_xref="InterPro:IPR027268"
FT                   /db_xref="InterPro:IPR035414"
FT                   /db_xref="InterPro:IPR037144"
FT                   /db_xref="InterPro:IPR038438"
FT                   /db_xref="InterPro:IPR042097"
FT                   /db_xref="UniProtKB/TrEMBL:B0UFI4"
FT                   /protein_id="ACA14838.1"
FT                   /translation="MRTESPPIVRLADYRPSDYLIDRVDLNVRLHPTETRISATLALRP
FT                   NPRGEAGAPLHLDGDDLALLAVALDGQPTAPGAIELGPLGLTLHRPPQRPFVLSLETQV
FT                   NPSANTKLMGLYRSNGVYCTQCEADGFRRITYFLDRPDVLAVYTTRIEADRDEAPVLLG
FT                   NGNPVEAGEAGPGRHYAVWHDPHPKPAYLFALVGGRLGRIATRFTTMEGRDVAVAVYVE
FT                   PGKEARAPYALDAVTRAMAWDERRFGRAYDLDVFNVVAVSDFNMGAMENKGLNIFNDKY
FT                   VLASPDTATDTDYANIEAIIAHEYFHNWSGNRVTCRDWFQLCLKEGLTVFRDQEFSSDE
FT                   RSRPVHRIAEVRTLRARQFPEDAGPLAHPVRPQAYREINNFYTATVYEKGAEIVRMLGT
FT                   LLGPAAFRAGMDLFFARCDGTAATVEDFLAAFAQVSGRDLAAFSRWYAQAGTPTVSVAG
FT                   RYDPAQRSYTLDFHQSLPAVATEAAGGGPPQPLVIPVALGLVGRGGGALEARSDRVRDG
FT                   VFVLEGESDRLVFTEVAAEPVPSLFRGFSAPVKVAHSLDTAQRLTLLAHDSDPFNRWQA
FT                   AQNLALDLVTARARLGAPIEADAGPEAAALAEALGAFLDGEALRDPAFAALVLAIPGDQ
FT                   EAAQEISTNVDPDAIHRARWTLRAHLGRALLPRLVALRDALAAPPGSPFSPDAASAGRR
FT                   SLRNAALDLIAAADPARGTALAEAQLREADNMTDRLAALAVLTLLPGEARERALAAFGE
FT                   TYRGEPLVLDKWFALQAMIPEAGTVARVRALMRHEGFSASNPNRVRALVGSFSLNNPTQ
FT                   FHRADGAGYELLAETVLDVDSRNPQVAARLLTAFNTWRMMEPTRRARAEAQLRAIAAAP
FT                   GLSPDAGDIASRSLAPARHHINT"
FT   gene            329251..331545
FT                   /locus_tag="M446_0268"
FT   CDS_pept        329251..331545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0268"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: mex:Mext_0543 PAS sensor protein; TIGRFAM: PAS
FT                   sensor protein; PFAM: ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; PAS fold-3
FT                   domain protein; PAS fold-4 domain protein; SMART: PAS
FT                   domain containing protein; PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14839"
FT                   /db_xref="GOA:B0UGL7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B0UGL7"
FT                   /protein_id="ACA14839.1"
FT                   /translation="MLEADPAPLTARAATILGIARALTPAHQRLARAESWLRVAIPAVI
FT                   GLFLVCLFAITATQLMSQRRDAVAEAGREIDLLARLAAATLAQGGGLDGAVPAGALIPG
FT                   REIHLIGPDEVITASLPVPLPPGRSLGEHLGEAQPLLILGERAGLMTVGLRGAPALATL
FT                   RALPGGQQRVAVVQSLDTVTAAWQGRARTEAMVIGTATLVIVCIGLAYTLQADRARAVD
FT                   RVCEQVRQRLDTALCRGRCGLWDWDIARGRIYWSDSMYQLLGYTREHEFLSFGDVNALV
FT                   HPDDTDLYGLASQLAAQDATVDHEFRIRSAAGEWIWLKARAEIVRDQEDGGRHLVGIAI
FT                   DISEQRRLAESTATADMRLRDAVEAVSEAFVLWDAQNRLVLCNSKFRRLHALTPEDAQP
FT                   GRRYDTIMGRAAVPPVRREIQAGEFAETGARTFEAELADGRWLQISERRTKDGGYVSVG
FT                   TDITALKRHQERLVESERQLIATIADLKRSRRTLELQTQQLADLAERYLDQKAQAESAN
FT                   RSKSEFLANMSHELRTPLNAILGFAEVMQDEVFGHLGCEKYREYCRDIRSSGQYLLSVI
FT                   DDILDMSRIEARRVTLAKQPLPVAEVLERVLKVVAEAARAKGLTLSVEMNADAVVLADA
FT                   RALHQILLNLLQNAVKFTPDAGRVAVRTRRALDAVHIYVEDSGIGIPRTVLPKLGAPFE
FT                   QVESNLSRSFKGSGLGLAIARSLTELHGGRLRIRSEVGSGTIVLVRLPQPPGDAPFARE
FT                   GAVAALPAPVA"
FT   gene            complement(331821..334751)
FT                   /locus_tag="M446_0269"
FT   CDS_pept        complement(331821..334751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0269"
FT                   /product="(Glutamate--ammonia-ligase) adenylyltransferase"
FT                   /EC_number="2.7.7.42"
FT                   /note="PFAM: glutamate-ammonia ligase adenylyltransferase;
FT                   KEGG: mex:Mext_0326 (glutamate--ammonia-ligase)
FT                   adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14840"
FT                   /db_xref="GOA:B0UGL8"
FT                   /db_xref="InterPro:IPR005190"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="InterPro:IPR023057"
FT                   /db_xref="UniProtKB/TrEMBL:B0UGL8"
FT                   /protein_id="ACA14840.1"
FT                   /translation="MSAPLVDRIRSAPLLSEPDRARDRLADLLAALDGCPDHAALAAAL
FT                   RLDGPVRALALGLADHSPFLWGLVAREPARFARLLGQGPEAAHADLVAAQWGAGAAGTP
FT                   RAEVARCLRRNRAEHALLVALADIGGVWSLEAVTAALSDFADASVKAALDAALHEAAAG
FT                   GRFRPRDPAAPQEDSGVIVLGMGKLGAGELNYSSDIDLIVFFDPARAPLREGVEATPFF
FT                   SRLAQTLAKLLQERDADGYVHRVDYRLRPDPGATPTALSLDSAFTYYETVGQNWERAAF
FT                   IKARPVAGDLPLAEEFLAELRPFVWRKYFDFAAIADVHAMKRQIHAVRGHGAIAVAGHD
FT                   IKLGRGGIREVEFFVQTQQLVFGGRRPSLRGQRTLDMLPALHAEGWITAEARDELARAY
FT                   RFLRTLEHRLQMVADEQTQRLPEEPGRLARFARFCGYRDAEALGAALVAEATRVQAHYA
FT                   LLFEAGPDLSVDLGDLVFTGAEDDPATLATLRDLGFRHPERAIETVRGWHHGRRPAVTS
FT                   PRAREVVTELVPALLQALAGTADPDGALAALDHAFGRMPAAVELLTILRSHERLRLLFA
FT                   DLLGTAPRLAETVAYSPHVLDAVIDPAFVDPVTDEEAIAQQIRRLIGAPQAFEDFLDRS
FT                   RDAARQMRFVAGARMLSGILPPAGAGRAYAAIARAIVAEALAAVRAVFAAEHGQVPGAR
FT                   VAVLGLGRLGSRQLTADSDLDLVVLYDFDPRHRDSDGRRPLDAAVYHNRLAQRLVAALT
FT                   VPTRRGHLYEVDLRLRPGGSQGPVAGQWPRFVPYQHEEAGLWEQMALTRARVLAGDPDL
FT                   GAEIEAAVAAILESPRDAALVAREVRDMRALIAREKGDGGPHDLKLSPGGLLDLDFLAQ
FT                   ALVLTHAAAHPDLIGRDAPSLFAAARARGLLPDEAADALREAYRLLDDVHHWQRLMVEG
FT                   SFEKGAAPATRARLAAAAGLPDEAALLARLAETRAEVRAWFERLLA"
FT   gene            complement(334881..335342)
FT                   /locus_tag="M446_0270"
FT   CDS_pept        complement(334881..335342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0270"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; KEGG:
FT                   bja:bll0240 transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14841"
FT                   /db_xref="GOA:B0UGL9"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0UGL9"
FT                   /protein_id="ACA14841.1"
FT                   /translation="MRAPDRTDLRMLRLLQEDGRLTNAELAQRVNLSPATCHRRMQRLL
FT                   REGLITGVRALVAPRAVGRGALVLVGVVLDRSTPESFATFERAVVSLGFVLDCHLVAGD
FT                   FDYVLKIRVGDMADFNRLHGEQLIALPGVRQTRTFFVMKEVIDAAPLDF"
FT   gene            335502..336515
FT                   /locus_tag="M446_0271"
FT   CDS_pept        335502..336515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0271"
FT                   /product="1-aminocyclopropane-1-carboxylate deaminase"
FT                   /EC_number="3.5.99.7"
FT                   /note="KEGG: azc:AZC_0267 1-aminocyclopropane-1-carboxylate
FT                   deaminase; TIGRFAM: 1-aminocyclopropane-1-carboxylate
FT                   deaminase; PFAM: Pyridoxal-5'-phosphate-dependent protein
FT                   beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14842"
FT                   /db_xref="GOA:B0UGM0"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005965"
FT                   /db_xref="InterPro:IPR020601"
FT                   /db_xref="InterPro:IPR027278"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UGM0"
FT                   /protein_id="ACA14842.1"
FT                   /translation="MLARFERYPLTFGPTPIERLSRLSAHLGGKVDLYAKREDCNSGLA
FT                   FGGNKLRKLEYIVPDAIASGADTLVSIGGVQSNHTRMVAAVAAKIGMKCRLVQEAWVPH
FT                   EDAVYDRVGNIMLSRIMGADVRLVEDGFDIGIRSSWEQAIAEVKAAGGKPYAIPAGASV
FT                   HKYGGLGYVGFAEEVRAQERELGFAFDYIVVCTVTGSTHAGMLVGFAKDGRERRVIGID
FT                   ASATPAQTRAQVLEIARRTADLVDLGRELSADDVVLNEDYAYPIYGVPSAETKEAIRLC
FT                   GRLEGMITDPVYEGKSMQGMIDLVRKGFFPAGAKVLYAHLGGAPALNGYAYAFRNG"
FT   gene            337015..338829
FT                   /locus_tag="M446_0272"
FT   CDS_pept        337015..338829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0272"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; KEGG:
FT                   mag:amb1217 methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14843"
FT                   /db_xref="GOA:B0UGM1"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:B0UGM1"
FT                   /protein_id="ACA14843.1"
FT                   /translation="MSLISRIATASVVANLIILATAALIGSRMSRGYEAEFFAFHRGQS
FT                   QSILDAQIRSEVWEDYGTKLTDVAREVAQGETVRSVMAEKGSGSERLAAEWSRGAVSSG
FT                   KIALLGITLLDGQGHRIAEHWTAGASLPPALAEAVIRREGRDRFQVLRKVWLDDGLPRL
FT                   TVAVPIGGLRISGYALLHADPMPAFQNLDALVGMALEITSLSGAPLLAGRGGLQAGSGS
FT                   TIHDLVAHGPDGTPIARIRARADTRSLEERLAGIGAHALVVFCTVCGLVALLTGGAILM
FT                   LARVAARQSAAAARQATRLERDREEAARRERERAEEIRRAQREAEMQSLADTIEARVRR
FT                   TAAACVQDAETAAAACRQLTGQSERAGVEVGEAERLCAASLATAHAVAAAGAQFRASIG
FT                   RIAGESAAAADRTGDVVALAEQARDRIGQLVRASEEIGQVVRLIGAISQQTNLLALNAT
FT                   IEAARAGEAGRGFAVVAAEVKELASQTGRATEDIVGRIGAIQAGTGDAVASIGEVAAAI
FT                   GEVDGAFRSIAAAVSEQDAAVAQIARNAEDSVAAGRGLSGNIAGLGRTIEAFDRGSRDS
FT                   AASMQDLASAVAGLDREVGALVLRLKSA"
FT   sig_peptide     337015..337113
FT                   /locus_tag="M446_0272"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.930) with cleavage site probability 0.603 at
FT                   residue 33"
FT   gene            338885..339295
FT                   /locus_tag="M446_0273"
FT   CDS_pept        338885..339295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0273"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: gsu:GSU2516
FT                   rhodanese-like domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14844"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B0UGM2"
FT                   /protein_id="ACA14844.1"
FT                   /translation="MTRLLCLVCLLVCTALPARAQAPMQIQGATTVDAQQILALVEAKP
FT                   DLAIIDNRRPEDFNAGHLDGAVRLLDTDLTAEALAGIVKAKSAPVLFYCNGPKCGRAAK
FT                   AAKAAVDLGYTQVYYYSLGMDEWNKLNLPLSK"
FT   sig_peptide     338885..338947
FT                   /locus_tag="M446_0273"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 21"
FT   gene            complement(339410..340819)
FT                   /locus_tag="M446_0274"
FT   CDS_pept        complement(339410..340819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0274"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: mex:Mext_0328 ATP-binding
FT                   region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14845"
FT                   /db_xref="GOA:B0UGM3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B0UGM3"
FT                   /protein_id="ACA14845.1"
FT                   /translation="MTARLPGSEGLPARLVTLFRTTAFKLSLAYLLVFAAFAFFALGYV
FT                   AWNARQVLDDQIVSTIEAEINGLSEQYAAGGIRRLVGVVERRAREPGASLYLVTTPAGE
FT                   HVVGNVETLPPGLLSEPGQTETAYGRSTDGDRLDHRAIVRIFTLPGGFRLLVGRDVEER
FT                   DRLRAVIARAFAWSLMLVVGLGFVGSLFIAQRVLKRVDAMTEITRGIMAGDLGGRLALA
FT                   GTGDELDRLAQNLNAMLDRIGELMRGLREVSDNIAHDLKTPLTRLRNKADEALRAGSDP
FT                   ATLRAALEANIEESDNLIRVFNALLMIARLEAGGTRENLAAFDAGAVALEVAELYEAVA
FT                   EERGVALTTDVAEGLVVHGSRELIGQALANLIDNALKYGAEAETPEVRVAARREGAEVR
FT                   LTVADRGIGIPAAERGRVLERFVRLETARSNPGFGLGLSLVNAVARLHQGRFVLEDNGP
FT                   GLRASLALPAA"
FT   sig_peptide     complement(340688..340819)
FT                   /locus_tag="M446_0274"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.850) with cleavage site probability 0.743 at
FT                   residue 44"
FT   gene            complement(340816..341502)
FT                   /locus_tag="M446_0275"
FT   CDS_pept        complement(340816..341502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0275"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: mex:Mext_0329 response
FT                   regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14846"
FT                   /db_xref="GOA:B0UGM4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B0UGM4"
FT                   /protein_id="ACA14846.1"
FT                   /translation="MRLLIIEDDREAASYLAKAFREAGHVADLAADGLDGYALAREGSY
FT                   DVLVVDRMLPKLDGLSLIRSLREQGVETPVLILSALGQVDDRVKGLRAGGDDYVPKPYA
FT                   FSELLARVEVLARRRGGGAGEPTAYRVGDLELDRLSHRVTRGGQEIVLQPREFRLLEYL
FT                   MRHAGQVVTRTMLLEHVWDYHFDPQTNVIDVHVSRLRAKVDKGFDRPMIHTVRGAGYMV
FT                   RAGGEA"
FT   gene            complement(342050..342505)
FT                   /locus_tag="M446_0276"
FT   CDS_pept        complement(342050..342505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0276"
FT                   /product="transcriptional regulator, MucR family"
FT                   /note="PFAM: ROSMUCR transcriptional regulator; KEGG:
FT                   mex:Mext_4474 ROSMUCR transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14847"
FT                   /db_xref="GOA:B0UGM5"
FT                   /db_xref="InterPro:IPR008807"
FT                   /db_xref="InterPro:IPR041920"
FT                   /db_xref="UniProtKB/TrEMBL:B0UGM5"
FT                   /protein_id="ACA14847.1"
FT                   /translation="MQPSNTNAAKLAALTADIATAYLSRNHLQTGEVPRLIAEIHGALR
FT                   VASHGTPVQEGPPKPTASEIRRSVTPEALISFEDGKPYKTLRRHLTRLGLTPETYRQKW
FT                   GLPPDYPMTSAEYSKRRSELARALTLGLPIAKPERAGAAKTAEGALP"
FT   gene            342864..343085
FT                   /locus_tag="M446_0277"
FT   CDS_pept        342864..343085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0277"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14848"
FT                   /db_xref="UniProtKB/TrEMBL:B0UGM6"
FT                   /protein_id="ACA14848.1"
FT                   /translation="MTQAKDPGPRGGTRRRARDFGDSAGEGSGGSGLDRHEVGDGVPLT
FT                   EHPHNPLDDVMTPPLGTAPRERRGPRRP"
FT   gene            complement(343130..343303)
FT                   /locus_tag="M446_0278"
FT   CDS_pept        complement(343130..343303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0278"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14849"
FT                   /db_xref="UniProtKB/TrEMBL:B0UGM7"
FT                   /protein_id="ACA14849.1"
FT                   /translation="MTQDDPVRDAIPAELRRRAEAGDLRVSDEGEAAVRVQGRIALDEF
FT                   VMAVIGALAGGP"
FT   gene            complement(343391..343786)
FT                   /locus_tag="M446_0279"
FT   CDS_pept        complement(343391..343786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0279"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   mex:Mext_4845 response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14850"
FT                   /db_xref="GOA:B0UGM8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B0UGM8"
FT                   /protein_id="ACA14850.1"
FT                   /translation="MAATSLRPTSVLVVEDNYLLLELIVALLAQEGLTAHAASSGEAAL
FT                   TLLRRHGPAVDWLFTDIVLPGLIDGWMVAEAYRALHATRPVVFASTTVHLDPRRARGGI
FT                   VLQKPFALDDVVGVARMMRGEVGQRCA"
FT   gene            344176..344682
FT                   /locus_tag="M446_0280"
FT   CDS_pept        344176..344682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0280"
FT                   /product="peptidoglycan-associated lipoprotein"
FT                   /note="TIGRFAM: peptidoglycan-associated lipoprotein; PFAM:
FT                   OmpA/MotB domain protein; KEGG: mex:Mext_4843
FT                   peptidoglycan-associated lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14851"
FT                   /db_xref="GOA:B0UGM9"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR014169"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR039001"
FT                   /db_xref="UniProtKB/TrEMBL:B0UGM9"
FT                   /protein_id="ACA14851.1"
FT                   /translation="MSLPLAPSRVLRAAAALAFALSIAACSSNKDLADASAYAAGGAAT
FT                   PGSAQDFVVNVGDRVFFETDSTDLTATATATLDKQAQWLSRYPRYTFLIEGHADERGTR
FT                   EYNFSLGARRSQAVRDYLTSRGIAASRMRTVSYGKERPVAVCNDISCWSQNRRAVTVLD
FT                   GGAGS"
FT   sig_peptide     344176..344277
FT                   /locus_tag="M446_0280"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.407 at
FT                   residue 34"
FT   gene            344790..345731
FT                   /locus_tag="M446_0281"
FT   CDS_pept        344790..345731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0281"
FT                   /product="tol-pal system protein YbgF"
FT                   /note="TIGRFAM: tol-pal system protein YbgF; KEGG:
FT                   mex:Mext_4842 tol-pal system protein YbgF"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14852"
FT                   /db_xref="GOA:B0UGN0"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR014162"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR032519"
FT                   /db_xref="InterPro:IPR034706"
FT                   /db_xref="UniProtKB/TrEMBL:B0UGN0"
FT                   /protein_id="ACA14852.1"
FT                   /translation="MLRRLILATGLLLAASLPGRAQDAADLVVRLNRLENQSRQMAGQI
FT                   ETLQYENRQLKEQLRKFQEDVEFRFQEGKGGRTAAPAGKPQKRGDAFDPTTSPGAPGAP
FT                   RALGAAPGAAPALATATPSAPRAAAAAPATPNTTATLSPPPAAIEEDQVPSYGEPVDLA
FT                   PSARAPAPPARPRESVAATATGDAKADYEAAYAYVLQRQYEQAEMRLRQFIQSHPRDAL
FT                   VPDATYWLGETYLQRNRTREAAEQFLKVSTDYARSRKAPEAMLKLGASLNALGAREQAC
FT                   ATLAELERKFPQAPASVRQGVDREQKRARCAA"
FT   sig_peptide     344790..344855
FT                   /locus_tag="M446_0281"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.985 at
FT                   residue 22"
FT   gene            345728..346762
FT                   /locus_tag="M446_0282"
FT   CDS_pept        345728..346762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0282"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /note="TIGRFAM: tRNA(Ile)-lysidine synthetase; PFAM:
FT                   PP-loop domain protein; KEGG: mex:Mext_4841
FT                   tRNA(Ile)-lysidine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14853"
FT                   /db_xref="GOA:B0UGN1"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UGN1"
FT                   /protein_id="ACA14853.1"
FT                   /translation="MSDAARPLDPDEAARRLGPWLGAGGQAGGVVLAVSGGPDSTALMG
FT                   CAAALPPRVPVLVATVDHGLRPESGEEAAGVAALAGRLGLPHRILTWRGEKPRTRLQEA
FT                   ARAARYDLLLGLAREAGAGAILTAHTLDDQAETVLMRLCAGSGPAGLAGIAPARRLGGL
FT                   LLGRPFLDLPKARLVATCAAAGWPFAVDPGNAAARFARARLRRVMPLLAAEGLTPARLA
FT                   RLAARLRRNEAALAAAAEAARPSLAAAPAGPGRLALDAAGLAALPEAVALRVLADAIAA
FT                   LRAGERRPERLERLEEALFGRILPAIAAGTPLRLTLGGALLDLAGGRLLLAPEPPRRRT
FT                   KRAG"
FT   gene            346886..348808
FT                   /locus_tag="M446_0283"
FT   CDS_pept        346886..348808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0283"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /EC_number="5.6.1.1"
FT                   /note="KEGG: mex:Mext_4840 ATP-dependent metalloprotease
FT                   FtsH; TIGRFAM: ATP-dependent metalloprotease FtsH; PFAM:
FT                   peptidase M41; AAA ATPase central domain protein; peptidase
FT                   M41 FtsH extracellular; ATPase associated with various
FT                   cellular activities AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14854"
FT                   /db_xref="GOA:B0UGN2"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:B0UGN2"
FT                   /protein_id="ACA14854.1"
FT                   /translation="MNPNFRNFALWVVIFLLVLALVTLFQNPGHRSGGSEIAYSQLLND
FT                   ADAGRIQSVVISGQEVSGSYTGGGTFTTYAPNDPSLVSKLQSKGVTITARPPSDNTPWF
FT                   IALLVNWLPILVFIGAWIFLSRQMQSGAGRAMGFGKSKAKLLTEAHGRVTFEDVAGVDE
FT                   AKEDLQEIVEFLRDPQKFQRLGGRIPRGVLLVGPPGTGKTLIARAVAGEANVPFFTISG
FT                   SDFVEMFVGVGASRVRDMFDQAKKNAPCIIFIDEIDAVGRHRGAGLGGGNDEREQTLNQ
FT                   LLVEMDGFEANEGIIIIAATNRPDVLDPALLRPGRFDRQIIVPNPDVIGRERILRVHVR
FT                   KVPLAPDVDLKVIARGTPGFSGADLMNLVNEAALLAARRGKRIVTMHEFEDSKDKVMMG
FT                   AERRTLVMTDDEKRLTAYHEGGHAIVALNVPATDPVHKATIIPRGRALGMVMQLPERDK
FT                   LSMSFEQMTSRLAIMMGGRVAEEMIFGPEKVTSGAQSDIEQATRLARMMVTRWGFSPEL
FT                   GTVAYGENNDEVFLGMQVNRQQNVSEATAQKIDAEVRRLVESGLQDARRILSDHRNDLE
FT                   ALARGLLEYETLSGEEIRDLLDGKPPVRDTGDYPPAPARGSPVPSAGRGRPRESDGGYE
FT                   PQPQA"
FT   sig_peptide     346886..346966
FT                   /locus_tag="M446_0283"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.754) with cleavage site probability 0.484 at
FT                   residue 27"
FT   gene            complement(348905..349081)
FT                   /locus_tag="M446_0284"
FT   CDS_pept        complement(348905..349081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0284"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14855"
FT                   /db_xref="UniProtKB/TrEMBL:B0UGN3"
FT                   /protein_id="ACA14855.1"
FT                   /translation="MRKILTLSAVLMFVAGPVLAQGRPAGSSAGAAENATQNNKPVSGT
FT                   AGGGGGGAGGGGK"
FT   sig_peptide     complement(349019..349081)
FT                   /locus_tag="M446_0284"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 21"
FT   gene            349566..350261
FT                   /locus_tag="M446_0285"
FT   CDS_pept        349566..350261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0285"
FT                   /product="septum site-determining protein MinC"
FT                   /note="TIGRFAM: septum site-determining protein MinC; PFAM:
FT                   Septum formation inhibitor MinC; KEGG: mex:Mext_1267 septum
FT                   site-determining protein MinC"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14856"
FT                   /db_xref="GOA:B0UGN4"
FT                   /db_xref="InterPro:IPR005526"
FT                   /db_xref="InterPro:IPR013033"
FT                   /db_xref="InterPro:IPR016098"
FT                   /db_xref="InterPro:IPR036145"
FT                   /db_xref="UniProtKB/TrEMBL:B0UGN4"
FT                   /protein_id="ACA14856.1"
FT                   /translation="MTVTSTRHTRPSLPLRGRAFRALVLAPERPLDAWFAQLDALVLRS
FT                   PTLFAERAVILDAAGLAPEAEESAPDLAHLLAELGRRGIRILGIERAEATWTDAAMPPR
FT                   LAGGRPAPITPPIADKPKLNSCVLETSLRSGQSIFHPDGDVTVMGSVSSGAEILAGGSI
FT                   HVYGALRGRAIAGAGGNRRARIYCRKFQPELLGIDGLFRTAETTDPGLHNKAVQVWLER
FT                   DALRMAALD"
FT   gene            350382..351197
FT                   /locus_tag="M446_0286"
FT   CDS_pept        350382..351197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0286"
FT                   /product="septum site-determining protein MinD"
FT                   /note="TIGRFAM: septum site-determining protein MinD; PFAM:
FT                   Cobyrinic acid ac-diamide synthase; KEGG: mex:Mext_1268
FT                   septum site-determining protein MinD"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14857"
FT                   /db_xref="GOA:B0UGN5"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR010223"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0UGN5"
FT                   /protein_id="ACA14857.1"
FT                   /translation="MAKVLVVTSGKGGVGKTTTTAALGAALAQMGENVCVVDFDVGLRN
FT                   LDLVMGAERRVVYDLINVVQGDAKLAQALIRDKRLDTLSLLPASQTRDKDALTEEGVAR
FT                   VVTELRERFDWVICDSPAGIERGATLAMRHADVAVVVTNPEVSSVRDSDRIIGLLDSKT
FT                   VRAEAGESIDKHLILTRYEPARADKGEMLRIEDVLEILSIPLLAVVPESEEVLKASNVG
FT                   SPVTLHNPASAPSRAYVDAVRRLRGETVAMTIPTERRSLLNRLIPRRAA"
FT   gene            351194..351463
FT                   /locus_tag="M446_0287"
FT   CDS_pept        351194..351463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0287"
FT                   /product="cell division topological specificity factor
FT                   MinE"
FT                   /note="TIGRFAM: cell division topological specificity
FT                   factor MinE; PFAM: Septum formation topological specificity
FT                   factor MinE; KEGG: mes:Meso_0321 cell division topological
FT                   specificity factor MinE"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14858"
FT                   /db_xref="GOA:B0UGN6"
FT                   /db_xref="InterPro:IPR005527"
FT                   /db_xref="InterPro:IPR036707"
FT                   /db_xref="UniProtKB/TrEMBL:B0UGN6"
FT                   /protein_id="ACA14858.1"
FT                   /translation="MKPFGFRSRRGSALAARDRLKILLAQDRALFGRRDLITLLREEVI
FT                   LAIAKHVAIDVDKVRVNLDRRGGIATLGIDIDLPAHKGASLAGA"
FT   gene            351523..352113
FT                   /locus_tag="M446_0288"
FT   CDS_pept        351523..352113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0288"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: olu:OSTLU_25682 predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14859"
FT                   /db_xref="UniProtKB/TrEMBL:B0UGN7"
FT                   /protein_id="ACA14859.1"
FT                   /translation="MATDVPTIYANAVLGLSLRRPGILQLTLGAAGFAAEEADAVVRLA
FT                   LPDDTVVELVDALVEGLQAAAESDEEDEEGPEPYEASVGDVATAGLLATTLATAMGDAL
FT                   SLLSERPDFAERLNEIEERALLTTRNSVSEGVSVEDEAKAVRDTVAVLQSLFAHWRSEH
FT                   GPPSDPPPPETPPPDSPPEAPPPGTPPEPGPTG"
FT   gene            complement(352425..353675)
FT                   /locus_tag="M446_0289"
FT   CDS_pept        complement(352425..353675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0289"
FT                   /product="Na+ dependent nucleoside transporter domain
FT                   protein"
FT                   /note="PFAM: Na+ dependent nucleoside transporter;
FT                   nucleoside recognition domain protein; Na+ dependent
FT                   nucleoside transporter domain protein; KEGG: mex:Mext_1971
FT                   Na+ dependent nucleoside transporter domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14860"
FT                   /db_xref="GOA:B0UGN8"
FT                   /db_xref="InterPro:IPR002668"
FT                   /db_xref="InterPro:IPR008276"
FT                   /db_xref="InterPro:IPR011657"
FT                   /db_xref="UniProtKB/TrEMBL:B0UGN8"
FT                   /protein_id="ACA14860.1"
FT                   /translation="MAERILHAALSLAVLLAIAVLASTDRRAIRPRTVLSALAIQVLLG
FT                   AAILLLPTGRRLLGTAAEAVAAVLAYGDRGAAFLFGGLVAPRMFDLFDQGGFVLAFRVL
FT                   PQIVYVSALIGVLYHLGIMQGMARVIGAALQRLLGTSRIETFSAVITIAIGQSEIAVAL
FT                   RPFLPLLTGSELFAVMSSGAASTAGSILAGYAALGVPMEYLLAASVMAIPGGLLYAKIL
FT                   VPSTEPSRVRTMRAEFGERRAVNLIEAAAEGTQKGLAVAVAVGAMLIAFVGLIALANGL
FT                   VGWLGGLLGVAGASIEAILGALFRPLAWILGVPWERAGIVGTAIGQKVAFNEFLAYANL
FT                   SPVLRSGELGRRTTAILCFALCGFANLASIAIQLASFGSLVPERRAEVASYGLRAILAG
FT                   SLSNFTSAAIAGLFVEE"
FT   sig_peptide     complement(353607..353675)
FT                   /locus_tag="M446_0289"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.980 at
FT                   residue 23"
FT   gene            353855..356185
FT                   /locus_tag="M446_0290"
FT   CDS_pept        353855..356185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0290"
FT                   /product="peptidase C14 caspase catalytic subunit p20"
FT                   /note="PFAM: peptidase C14 caspase catalytic subunit p20;
FT                   KEGG: rpc:RPC_3182 peptidase C14, caspase catalytic subunit
FT                   P20"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14861"
FT                   /db_xref="GOA:B0UGN9"
FT                   /db_xref="InterPro:IPR001309"
FT                   /db_xref="InterPro:IPR029030"
FT                   /db_xref="UniProtKB/TrEMBL:B0UGN9"
FT                   /protein_id="ACA14861.1"
FT                   /translation="MPQAARRLIGFVVALAALVLPLAGLRAAPAETRIALVIGNGAYPA
FT                   GALATAANDAGLVAQTLQAAGFDVVGARDLDEDGLRRALRDFTDRAAAAGPEAVAFVYL
FT                   AGYGLQVEGENYFVPVDARIGAASDVPLRALRVSDYAKRLAALPLRARFLVLDAGRRAP
FT                   FRVAGEPLAGGLALVEAEPDSLVAFNAAPGTVAPEEPGPYGAYAQALAEMMREGGLAPA
FT                   ELFARVRLRVSETTRGAAVPWHSARIGAPFVFFERGAEAPPLPALAGTDRRPLGEIGPR
FT                   DAFARCLEQDSLQAYEAFLAAYPQDPLAKRVRAILAARREALTWRRSRVADTPNAYWSY
FT                   LDRYPRGPHAPDARRRLRQLAAAAEPPDHFAALAYDVPPPPPEERIYVERPVVVLDGPA
FT                   DDLPPPPVLLPPRPAALLDLPPPVVEEYVLPAPVFVPVPAAVRLPATVAPPEGNPLAGR
FT                   IHERPGPTGSAIAAGVAGAAIGAAVAARVALPPSLSQKAALRPGLPPGAMPAGGLPGQP
FT                   RGPVPPQAGRPGPPAAIGQPLPGQPLPGQPGRTAPLPAQARPGPPPIPGQALPGPAAPA
FT                   NRPGAGAAPTLRAQPAPGAPPRAAPPAAPVQALRPGWPPPGQPPAGRPASPHGPVAAPA
FT                   PNPDFARQQQVRQEQAAQAQAAQARAAQARAAQAQRAAAAQRQQMMMQQRQQEAARAFQ
FT                   QRQQVMQQQASQAAARQQAAQAAARQQQMMMQQQAAAQRQHQMQMMQMQRPPPAAPRAV
FT                   PQPAPHPGHGGRPCGQPGLPPCR"
FT   sig_peptide     353855..353938
FT                   /locus_tag="M446_0290"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.979 at
FT                   residue 28"
FT   gene            356328..357419
FT                   /locus_tag="M446_0291"
FT   CDS_pept        356328..357419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0291"
FT                   /product="recA protein"
FT                   /EC_number="7.2.2.10"
FT                   /note="KEGG: mex:Mext_2601 RecA protein; TIGRFAM: recA
FT                   protein; PFAM: RecA domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14862"
FT                   /db_xref="GOA:B0UGP0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UGP0"
FT                   /protein_id="ACA14862.1"
FT                   /translation="MAQSSLRLVENPTMDKDKSKAIDAALAQIERAFGKGSIMRLGKGD
FT                   KVQEVETISTGSLGLDVALGVGGLPRGRVIEIYGPESSGKTTLALHTIAEAQKKGGVCA
FT                   FVDAEHALDPVYARKLGVNLDDLLISQPDTGEQALEITDTLVRSGAIDVLVVDSVAALT
FT                   PRAEIEGEMGDQQPGLQARLMSQALRKLTGSISRSNCMVIFINQIRMKIGVMYGSPETT
FT                   TGGNALKFYASVRLDIRRVSTLKDRDEPIGNSVRVKVVKNKVAPPFKQVEFDIMFGEGV
FT                   SKVGELIDLGVKAGIVEKSGAWFSYDSQRLGQGRENAKGFLRDNPDIAGRIEAAIRQNM
FT                   GLVADKILENAVPTAEDFDEGEA"
FT   gene            357817..358410
FT                   /locus_tag="M446_0292"
FT   CDS_pept        357817..358410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0292"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /note="PFAM: ferredoxin; [2Fe-2S]-binding domain protein;
FT                   KEGG: sme:SMa2349 probable oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14863"
FT                   /db_xref="GOA:B0UGP1"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:B0UGP1"
FT                   /protein_id="ACA14863.1"
FT                   /translation="MVGASATTAPAAVPAAAGAQPAGPAAPVTARVAFTVNGARRELDL
FT                   DLRTSLLDALREHLHLTGTKKGCDHGQCGACTIIVDGRRINACLTLAVMHQGSAITTIE
FT                   GLGGPESLHPMQAAFVRHDGYQCGYCTPGQICSAVAVLDEIAAGIPSHATADLTAAPDL
FT                   SEAEIRERMSGNLCRCGAYSNIVEAVTEVAGRRA"
FT   sig_peptide     357817..357876
FT                   /locus_tag="M446_0292"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.979) with cleavage site probability 0.841 at
FT                   residue 20"
FT   gene            358407..359357
FT                   /locus_tag="M446_0293"
FT   CDS_pept        358407..359357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0293"
FT                   /product="molybdopterin dehydrogenase FAD-binding"
FT                   /note="PFAM: molybdopterin dehydrogenase FAD-binding; KEGG:
FT                   aav:Aave_1486 molybdopterin dehydrogenase, FAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14864"
FT                   /db_xref="GOA:B0UGP2"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:B0UGP2"
FT                   /protein_id="ACA14864.1"
FT                   /translation="MKSFTYERPASPAEAASAVARNPGAKFIAGGTNLLDLMKLQIETP
FT                   AHLVDVNGLGLDAIEATPEGGLRIGALVRNTDLAADPRVRRDYPVLSRALLAGATGQLR
FT                   NQATTAGNLLQRTRCPYFYDTAQACNKRRPGSGCAALDGISRQLAVIGGSEACIATHPG
FT                   DMAVAMRVLDAAVETVDATGAARTIPIAEFHRLPGDAPERDTTLRPDELITAVTLPRPL
FT                   GGAQIYRKVRDRASYAFALVSVAAVVQPDGSGRVAFGGLAHKPWRVEAAEAELPRGAAA
FT                   VAAGMLSGARPTRDNAFKLRLAERTLGAALKQARA"
FT   gene            359361..361580
FT                   /locus_tag="M446_0294"
FT   CDS_pept        359361..361580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0294"
FT                   /product="aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding"
FT                   /note="PFAM: aldehyde oxidase and xanthine dehydrogenase
FT                   a/b hammerhead; aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding; KEGG: bra:BRADO2884 putative
FT                   xanthine dehydrogenase, molybdenum binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14865"
FT                   /db_xref="GOA:B0UGP3"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:B0UGP3"
FT                   /protein_id="ACA14865.1"
FT                   /translation="MKFDTPAGQNPIDQLKVVGRPTDRIDGKFKTTGTAPYAYERHDVA
FT                   PNQAYGYVVGAGIAKGRVRAIETEEAARAPGVLAIVTTLDTPRLPRGTMNAAYLFGGDA
FT                   IQHYHQAVALVVAETFEQARAAAFLIRVDCAPEPGRFDLRAEAGAAKPVPGDSGEGSSG
FT                   AGEERVGDFEGAFAQAPVTLDATYTTADESHAMMEPHASVAAWEGDRLTLWTSNQMIGW
FT                   GKGSIAKIFGIPKANVRLDSPYVGGGFGGKLFVRADAVLAALGARAAGRPVKVALTRPM
FT                   IPNNTTHRPATIQRIRLGATRDGILTAIAHESISGNLPDGDPETAVSQTKLLYAGANRL
FT                   TALKLAHLDLPEGNAMRAPGEAPGMLALEVAMDEMAEKLGLDPVEFRLRNDTQVDPNQP
FT                   GRAFSHRDFVGCLRLGAERFGWARRSPTPGQVRDGAWRVGLGMASAFRNNLVLKSGARV
FT                   RLDGRGRVTVETDMTDIGTGSYTIIAQTAAEMMGLPLDRVEVRLGDSDFPTAAGSGGQF
FT                   GANSSTAGVYAACVKLREAVAQRLGINSADAVFADGQVRAGNRAVPLGEAAAQGEIVAE
FT                   DAIEFGGLDKTYQQSTFGAHFVEVGVDADTAEVRVRRMLAVCAAGRILNPKSARSQVIG
FT                   GMTMGVGAALMEKLAVDTRRGFFVNHDLAGYEVPVHADIPHQEVIFLDEVDAMSSPMKA
FT                   KGVGELGLCGVGAAVANAVYNATGVRVRDYPLTVDKLIDRMPEAA"
FT   gene            complement(362109..365852)
FT                   /locus_tag="M446_0295"
FT   CDS_pept        complement(362109..365852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0295"
FT                   /product="ribonucleoside-diphosphate reductase,
FT                   adenosylcobalamin-dependent"
FT                   /EC_number="1.17.4.1"
FT                   /note="KEGG: mex:Mext_1102 ribonucleoside-diphosphate
FT                   reductase, adenosylcobalamin-dependent; TIGRFAM:
FT                   ribonucleoside-diphosphate reductase,
FT                   adenosylcobalamin-dependent; PFAM: ribonucleotide reductase
FT                   large subunit; Ribonucleotide reductase class II vitamin
FT                   B12-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14866"
FT                   /db_xref="GOA:B0UGP4"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR013344"
FT                   /db_xref="InterPro:IPR013678"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/TrEMBL:B0UGP4"
FT                   /protein_id="ACA14866.1"
FT                   /translation="MRIERRITTAGQSPYAGIPFRKAVSEIRNPDGSVVFRLDGIDVPE
FT                   AWSQVACDVLAQKYFRKAGVPAALRRVEENDVPSFLWRSVPDEEALAALPEEARYGSET
FT                   SAVQVFDRLAGCWTYWGWKGGYFSSEEDAAAFLDELRAMLARQMVAPNSPQWFNTGLHW
FT                   AYGIDGPSQGHYYVDYRTGALTKSASAYEHPQPHACFIQSVQDDLVNEGGIMDLWVREA
FT                   RLFKYGSGTGSNFSALRGENEKLAGGGRSSGLMSFLKIGDRAAGAIKSGGTTRRAAKMV
FT                   IVDIDHPDIEAFIDWKVREEQKVAALVTGSKVAAKHLKAVMRACLNCEAEGDACFDPER
FT                   NPALKREVKAARRAMVPDASVKRVIQSARQGATEVDFPIFDTDWDSEAYLTVSGQNSNN
FT                   SVSLTDDFLRAVEADADWPLRTRIGGKVAKTLKARDLWEKIGAAAWASADPGLHFNTTM
FT                   NDWHTCPVGGRIRASNPCSEYMFLDDTACNLASANLLALFDRGTRTFDVEAYEHLCRLW
FT                   TIVLEISVTMAQFPSREIADLSYKYRTLGLGYANVGGLLMTMGLPYDSREGRALAGALT
FT                   AIMTGVAYATSAEMARELGPFPAYEENADAMLRVIRNHRRAAHGEAEGYEFLSTKPVPL
FT                   DHAACPQPDLVAHATRAWDRALVLGEEHGYRNAQATVIAPTGTIGLVMDCDTTGIEPDF
FT                   ALVKFKKLAGGGYFKIINRAVPDALRALGYRESEIAEIEAYAVGHGSLGQAPAVNPAAL
FT                   RAKGFTDDKIAAVEAGLKSAFDIKFVFNRWTLGEDFLTRTLRVPAERLADPSFDLLTHL
FT                   GFTRREIEAANIHVCGAMTLEGAPHLKREHYAVFDCANPCGRTGKRYLSVESHIRMMAA
FT                   AQPFISGAISKTINMPNDATVEDCKEAYRLSWTLGLKANALYRDGSKLSQPLNAALIAD
FT                   DDEDEAEEAVEALIAQPAAARAAAVAEKIVERVIERVERIRSREKMPDRRKGYTQKAVV
FT                   GGHKVYLRTGEYDDGRLGEIFIDMHKEGAAFRSLMNNFAIAISLGLQYGVPLEEYVDAF
FT                   TFTRFEPAGFVQGNDAIKNATSILDYVFRELAISYLGRTDLAHVDPSEIGSTVMGGGVA
FT                   QSKQPAPEPVVAHTIVSRGLLRGSADRLTLIHGGPGGSTAGVAAPATGLSAPAGGSIHA
FT                   VRGAVALRTEPALAGRIDALAEALPFGRPEPKAERSVADRRAEAKMKGYVGEACPECAN
FT                   FTLVRNGTCLKCDTCGSTTGCS"
FT   gene            366469..366885
FT                   /locus_tag="M446_0296"
FT   CDS_pept        366469..366885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0296"
FT                   /product="NADH:ubiquinone oxidoreductase 17.2 kD subunit"
FT                   /note="PFAM: NADH:ubiquinone oxidoreductase 17.2 kD
FT                   subunit; KEGG: mex:Mext_1101 NADH:ubiquinone oxidoreductase
FT                   17.2 kD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14867"
FT                   /db_xref="GOA:B0UGP5"
FT                   /db_xref="InterPro:IPR007763"
FT                   /db_xref="UniProtKB/TrEMBL:B0UGP5"
FT                   /protein_id="ACA14867.1"
FT                   /translation="MALKDTLLRIFTWWSGSTVSLEFYTKRHGELVGTDEFGNRYYRAE
FT                   GPLIDPSVGPERRWVIYNGEADASKVPPGWRGWLSHTVDVAPSEESYTPREWQKPFEPN
FT                   LTGTVAAYRPRGSQLSYGQRPAATGDYVPWTPGE"
FT   gene            366947..367579
FT                   /locus_tag="M446_0297"
FT   CDS_pept        366947..367579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0297"
FT                   /product="conserved hypothetical proteinn"
FT                   /note="KEGG: mex:Mext_1100 conserved hypothetical proteinn"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14868"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019225"
FT                   /db_xref="UniProtKB/TrEMBL:B0UGP6"
FT                   /protein_id="ACA14868.1"
FT                   /translation="MSRTTARSAIRAALVLSLAGVLAPAAQADKIRNPTAVFSGLDKIT
FT                   GRIVTFEVSVDETVQFGALQLTPRVCYTRPPTESARTTAFLEVDEVTLENKYRRIFTGW
FT                   MFAASPGLHAIEHPIYDVWLVDCKGGTDIIAEAKEQDDAPVAAAKPERRRRDPNQQQEA
FT                   RRAQPVNRQGQVDVAPLRGTPVQPRQTPSRRFFPTNDAPSFFNSDPR"
FT   sig_peptide     366947..367033
FT                   /locus_tag="M446_0297"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.965 at
FT                   residue 29"
FT   gene            complement(367640..368689)
FT                   /locus_tag="M446_0298"
FT   CDS_pept        complement(367640..368689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0298"
FT                   /product="signal transduction histidine kinase"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region ATPase domain protein; histidine kinase
FT                   dimerisation/phosphoacceptor; KEGG: mex:Mext_4873 histidine
FT                   kinase dimerisation/phosphoacceptor"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14869"
FT                   /db_xref="GOA:B0UGP7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B0UGP7"
FT                   /protein_id="ACA14869.1"
FT                   /translation="MSDAAAPGQARILYIDDDPGLGRLVQRALRGRGYAVDLAEDGEAG
FT                   LARLRAGGIDVVALDHHMPGRSGLEVLAAIRALPEAPPVVYVTGSEDSRVAVAALKAGA
FT                   VDYVWKDVQGHFRELLGEAIDTALRQEALRRDKERAEAEVRAARDRAEILLREVNHRVA
FT                   NSLALVAALARMQTNAVTDPAAKSALEEMQARISAIAGIHRRLYTSQDVQAVEVDAYLA
FT                   SLVEELEASMKAAGRDHAIRLRAEPIRLATDKAVSLGVVVTELVTNAYKYAYPPEVAGE
FT                   IRVAITRRGEDALCLVVEDDGIGWSGEGTPLGSGLGSRILRAMGTNLRSKVEYDRLPRG
FT                   TRATLAFQG"
FT   gene            complement(368686..369120)
FT                   /locus_tag="M446_0299"
FT   CDS_pept        complement(368686..369120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0299"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   mex:Mext_4874 response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14870"
FT                   /db_xref="GOA:B0UGP8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B0UGP8"
FT                   /protein_id="ACA14870.1"
FT                   /translation="MHPVCIVMIEDDEGHARLIERNIRRAGVNNEILPFRDGTSALAYL
FT                   LGPDGTGEVSAGRHLLILLDLNLPDMTGLDILETVKANPHTRRSPVVVLTTTDDSREIQ
FT                   RCYDFGANVYITKPVNYDGFANAIRQLGLFFSVMQVPENP"
FT   gene            complement(369133..371796)
FT                   /locus_tag="M446_0300"
FT   CDS_pept        complement(369133..371796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0300"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: mex:Mext_4875 PAS sensor protein; TIGRFAM: PAS
FT                   sensor protein; PFAM: GAF domain protein; ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; CHASE domain protein; PAS fold-3 domain protein;
FT                   PAS fold-4 domain protein; PAS fold domain protein; SMART:
FT                   PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14871"
FT                   /db_xref="GOA:B0UGP9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006189"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B0UGP9"
FT                   /protein_id="ACA14871.1"
FT                   /translation="MRDGERFARLVDAQAEDIRERLDTYAALLRGAAGLYAASREVSRA
FT                   EFAAYVARLRLGELYPGIRGLGFAQRFAPGEREALRRRLGAEGAPEPWPETGAPDPTAI
FT                   VALEPADRRNAAAMGFDMSSEPTRREAMARARDGAEVALSGKVELVQEIDRDRQPGFLL
FT                   YLPVYAGEAIPEAVADRRGALRGFVYAPFRAGDFFPQVVTRRTAGGARELAYAVHDGAV
FT                   PDASEPMPERLLYASAPGAGRPEAGLAARRALTLAGRTWTLSAAATPAFAHDPAGALAP
FT                   TIGGLGLVLTLLLAGGALAQVRVSRRSEEARLALQEETARLERLNRAGASLAAEHDLGR
FT                   LVQSIIDNATALTGAAYGAFFERVPAGREGDPEEAWRLFSLTGAPREAFTRFGLPRATA
FT                   LFAPTFRADGVVRSDDVAADARYGSHGGMPEGHLPVRSYLAVPVVSGSGETLGALLFGH
FT                   PEPGRFGTREERLILGFAGQAGIALDNARLLISVRHEQDRFRAAVRAVRGVLWTNDAAG
FT                   RMTGEQPGWAAITGQTRAEYEGYGWARAVHPDDAQPSIDAWNAAVAARRTFVFEHRVRS
FT                   RDGTWRPYAIRAVPILEPDGRIREWVGVHTDITAQREAEAELRESNEEIQRYAYIVSHD
FT                   LRAPLVNVMGFTSELEALQEEIRGALEGHPQAAQIDGDMSEALGFIRAAITKMEGLIAA
FT                   ILKLSREGRRNFRPEPLDMTAVIQGLADAQRHQADAVGARVSVAPGLPPITADRLAIEQ
FT                   IFSNLIDNALKYLSPERPGRIAVAAEAAPGDRVRFAVSDNGRGIAPQDHARVFELFRRA
FT                   GAQDRPGEGIGLAHVKALVRSLGGRIEVASRLGEGTTFTVTLPRRPVASAPGPDRAGFE
FT                   GTPEAAPGGAPGMAAE"
FT   gene            complement(372032..372340)
FT                   /locus_tag="M446_0301"
FT   CDS_pept        complement(372032..372340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0301"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14872"
FT                   /db_xref="UniProtKB/TrEMBL:B0UGQ0"
FT                   /protein_id="ACA14872.1"
FT                   /translation="MLRHLTLPGLVLGLAFLCVGRAAASEDLVARWERADAACGLPSSA
FT                   MSEQACLDRQILAERLRRAGWCEAAPTSPYEHWGWQRCRSRTAVRPAHPRRGSRAKA"
FT   sig_peptide     complement(372266..372340)
FT                   /locus_tag="M446_0301"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.840 at
FT                   residue 25"
FT   gene            complement(372433..372672)
FT                   /locus_tag="M446_0302"
FT   CDS_pept        complement(372433..372672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0302"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14873"
FT                   /db_xref="InterPro:IPR036913"
FT                   /db_xref="UniProtKB/TrEMBL:B0UGQ1"
FT                   /protein_id="ACA14873.1"
FT                   /translation="MEFLIEQDDPGRWRWRLIGRKNETLLRSDETFASRGEAAEAASLW
FT                   SRTIEGASRRMAGAVPPPRRPPRPVPRRPIFAPH"
FT   gene            373092..373352
FT                   /locus_tag="M446_0303"
FT   CDS_pept        373092..373352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0303"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mex:Mext_3988 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14874"
FT                   /db_xref="UniProtKB/TrEMBL:B0UGQ2"
FT                   /protein_id="ACA14874.1"
FT                   /translation="MVGSMWKLGIEMTMLGLEAQTVIGLRLAKIALGGPAAAAEAQLMV
FT                   AEKVAAAGEAAVQAATGGSPRKIVRGYRRKVRANTRRLRRG"
FT   gene            complement(373399..374013)
FT                   /locus_tag="M446_0304"
FT   CDS_pept        complement(373399..374013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0304"
FT                   /product="putative invasion protein B"
FT                   /note="KEGG: azc:AZC_0717 putative invasion protein B"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14875"
FT                   /db_xref="InterPro:IPR010642"
FT                   /db_xref="InterPro:IPR038696"
FT                   /db_xref="UniProtKB/TrEMBL:B0UGQ3"
FT                   /protein_id="ACA14875.1"
FT                   /translation="MRRAIGLRSVPAALAAALGLAGPVLAQPAPKPAVAPPPAASPAAP
FT                   PVPAEPELTTASFGEWTLRCQRLAEGEKVTRFCEVAQAVQVQGQAAPLAQVALGRAPGE
FT                   AGLRLTAVLPVTVSFPSGVRVGLEGKEGREAAALDLAWRRCLPAGCVADGATREDVLKR
FT                   WRAGSEPGRLTFKDAAGRDVTLPLSFRGLDQALEALAKERA"
FT   sig_peptide     complement(373933..374013)
FT                   /locus_tag="M446_0304"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 27"
FT   gene            complement(374013..374780)
FT                   /locus_tag="M446_0305"
FT   CDS_pept        complement(374013..374780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0305"
FT                   /product="SapC family protein"
FT                   /note="PFAM: SapC family protein; KEGG: saz:Sama_0940
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14876"
FT                   /db_xref="InterPro:IPR010836"
FT                   /db_xref="UniProtKB/TrEMBL:B0UGQ4"
FT                   /protein_id="ACA14876.1"
FT                   /translation="MTQLPLFYRAVVPLDREGHRGLRLANPQRFGFARGSHLVPAVVDE
FT                   FAAACRHLPILFLPESLGPTPVFLTGLVPGRSALVSEDGTWTGRYLPAYLRRFPFILGE
FT                   SEGRPALVCLDDTAEGVLREEDAGESLALFGEDGAQTPPLQERVRLVADYAEAAKRTGA
FT                   LGRVLQDLGLLRGVTLHGKDPATGESHALHGALVVDEGALNGLSDEVFLRLRREGWLAA
FT                   ISAHLVSLQAIGDFALTFAPPAPANAESLGEAA"
FT   gene            374990..375397
FT                   /locus_tag="M446_0306"
FT   CDS_pept        374990..375397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0306"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14877"
FT                   /db_xref="UniProtKB/TrEMBL:B0UGQ5"
FT                   /protein_id="ACA14877.1"
FT                   /translation="MSVIAASPASGGPGAAEDGDRAARGAVRPHLPDPAAIPPPRPLSA
FT                   VGSVPSSRFCAIPTAPRSFWRASDAGCPNGRRYNMARARVSRAAHQRNATRIPLRRDAF
FT                   VLAFDEAVRCRRAQPARSRRGTRLHRDRILL"
FT   gene            375610..375900
FT                   /locus_tag="M446_0307"
FT   CDS_pept        375610..375900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0307"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14878"
FT                   /db_xref="UniProtKB/TrEMBL:B0UGQ6"
FT                   /protein_id="ACA14878.1"
FT                   /translation="MTFSHRLARAACRLGLAAAPSLTAGPALAQTASQITPPSFRPPLQ
FT                   RQGGVLVIPDGAGWRRPQARSGSPSLRARPGSRPPSPGPRRPSPPASPAAP"
FT   sig_peptide     375610..375699
FT                   /locus_tag="M446_0307"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 30"
FT   gene            375995..377905
FT                   /locus_tag="M446_0308"
FT   CDS_pept        375995..377905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0308"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_4; Tetratricopeptide TPR_2 repeat
FT                   protein; SMART: Tetratricopeptide domain protein; KEGG:
FT                   bur:Bcep18194_B1065 TPR repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14879"
FT                   /db_xref="GOA:B0UGQ7"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B0UGQ7"
FT                   /protein_id="ACA14879.1"
FT                   /translation="MPAAGRRAPVRSRRGGGRGFALTGAAELREALREQRAGQVEAALA
FT                   RCERLLAREPRNVAAARLAACLCFGLGRFEAALARYDRALALDPDHAETLRDRGVTLQA
FT                   LSRPEDSLASLERALARDPASAATWFDRANALVSLGRPEDALASLDRALALRPADPDAL
FT                   GNRGNVLHELGHLDEALASYAQSLVLRPHAPEVLTNRAITLLTLGRFAEGFQAYEWRRR
FT                   QRGWVEPRPPGPEWQGDLIAGQRLLLYAEQGLGDTIQFVRFARIAAARGMEVVLSVQEP
FT                   LRALLSGLPFLRVLAPDEPLPALHAHAPLMSLPRLLRLDAADLAAGPYLAAQPERVAAW
FT                   RARLPPGFRVGVAWQGQPGRAIDRGRSLPLACLAPLARVPGVRLVSLQKVHGLDQLDRL
FT                   PDGMAVTVLPDLDAGPDAFLDTAAVMMSLDLVVTSDTAVAHVAGALGRPVFVALKPVPD
FT                   WRWGLAGERTAWYPTMRLFRQERRGDWEAMAAAMAREVAGLAGGAGAPDGAPGTVRVPV
FT                   SLGELVDKITILELKAERIADPAKRANVVRELALLDAALAASGLLSEEVAALQTTLRGI
FT                   NAELWDAEGRIRACAQDAAARDELVALALRISTTNERRSAVKREINLRGGSVLIEEKQY
FT                   R"
FT   gene            377975..378316
FT                   /locus_tag="M446_0309"
FT   CDS_pept        377975..378316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0309"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14880"
FT                   /db_xref="UniProtKB/TrEMBL:B0UGQ8"
FT                   /protein_id="ACA14880.1"
FT                   /translation="MAAVRVVIHELRDDLRHGHPRRWPGLAIKVTHREGLRAYLGGCTW
FT                   PDGDDAETFLDWCASQLPDAWIQIRTPDLSSPGGAISITMAVGMRGAKPDPHGQMRTRQ
FT                   RWPFPLADW"
FT   gene            378738..379592
FT                   /locus_tag="M446_0310"
FT   CDS_pept        378738..379592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0310"
FT                   /product="metal-dependent phosphohydrolase HD region"
FT                   /note="SMART: metal-dependent phosphohydrolase HD region;
FT                   KEGG: rpb:RPB_1323 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14881"
FT                   /db_xref="GOA:B0UGQ9"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="UniProtKB/TrEMBL:B0UGQ9"
FT                   /protein_id="ACA14881.1"
FT                   /translation="MITTAHLAAEALGDHLAAALRGTFGATQAPLAEMVGSVARLALEC
FT                   LANSDALYHDLEHTLLVTQVGLDILRGRTLLEPVTAGDWAHLLVACLMHDIGYVRGILP
FT                   GDSAREGYVVDAAGGRVVLPRGASDAALTAHHVERSKLFVSARLGQSDLLDAARIARSI
FT                   EHTRFPAEETCPGRDPADEACLVRAADLIGQMGDPLYLRKANALFHEFEEAGTNAALGY
FT                   TSPADLVERYPDFFWRSVSSHLDGALKYLDVTVSGRQWIAGLQANVFRAERPGGFGPPR
FT                   AAP"
FT   gene            379721..381151
FT                   /locus_tag="M446_0311"
FT   CDS_pept        379721..381151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0311"
FT                   /product="cytochrome c oxidase accessory protein CcoG"
FT                   /note="TIGRFAM: cytochrome c oxidase accessory protein
FT                   CcoG; KEGG: xau:Xaut_0463 cytochrome c oxidase cbb3 type
FT                   accessory protein FixG"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14882"
FT                   /db_xref="GOA:B0UGR0"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014116"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR032879"
FT                   /db_xref="UniProtKB/TrEMBL:B0UGR0"
FT                   /protein_id="ACA14882.1"
FT                   /translation="MTGTSLPAPLYAPRKKIYPAAVHGRFRRIKWGLLVVTLGIYYLLP
FT                   FLRWDRGPNAPDQAVLLDLPARRFYFFFIEIWPQEFYYVTGLLVLAAMVLFLMNAVAGR
FT                   IWCGYLCPQTVWTDLFLAVERRIEGDRRAQMRAAGGGWSAERLARAILKHGAWLAIAWW
FT                   TGGAWVLYFADAPTLVHQLATFQAPFAAWLWIGILTFTTYLLAGHAREQVCTYMCPWPR
FT                   IQASLIDKEALNITYRYDRGEPRLSLKKAEQARAAGAPAGDCVDCGQCVAVCPTGVDIR
FT                   NGLQLSCIQCGLCIDACDAVMTRIGRPPGLIAYDSDLAVRRRQQGLPTRIRPVRPRTIL
FT                   YAAMIAVVGSAMLARLLTRPDLGLHVAHERNPLSVTLSDGAVRNAYAVRFINKQHRSRR
FT                   LDLSLEGIPGARLALAGDPVGEALAREIGPDRTEEVRVLVTVPPPGTAAASTPLTFVLR
FT                   DPASGAEARLADQFSTRR"
FT   gene            complement(381135..381587)
FT                   /locus_tag="M446_0312"
FT   CDS_pept        complement(381135..381587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0312"
FT                   /product="protein of unknown function DUF395 YeeE/YedE"
FT                   /note="PFAM: protein of unknown function DUF395 YeeE/YedE;
FT                   KEGG: rxy:Rxyl_1617 protein of unknown function DUF395,
FT                   YeeE/YedE"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14883"
FT                   /db_xref="GOA:B0UGR1"
FT                   /db_xref="UniProtKB/TrEMBL:B0UGR1"
FT                   /protein_id="ACA14883.1"
FT                   /translation="MRAAPRLLAALASGLLFGVGLALSGMMNPRKVLGFLDLAGAWDPS
FT                   LAFVLAGAVGVSALGYALKARMAAPLLAPRFEVPANRRVDARLLGGAVLFGVGWGLAGF
FT                   CPGPALAGLALGLPSVAVFVAAMLAGMLLHRLTAERPRRPALSAGC"
FT   sig_peptide     complement(381513..381587)
FT                   /locus_tag="M446_0312"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.718 at
FT                   residue 25"
FT   gene            complement(381584..382009)
FT                   /locus_tag="M446_0313"
FT   CDS_pept        complement(381584..382009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0313"
FT                   /product="protein of unknown function DUF395 YeeE/YedE"
FT                   /note="PFAM: protein of unknown function DUF395 YeeE/YedE;
FT                   KEGG: mex:Mext_1143 protein of unknown function DUF395
FT                   YeeE/YedE"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14884"
FT                   /db_xref="GOA:B0UGR2"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:B0UGR2"
FT                   /protein_id="ACA14884.1"
FT                   /translation="MALTPFLAPLAGGALIGASAALLLLANGRIAGISGIAGGLLGPPG
FT                   RETAWRAVFLAGLLLGPVLFRLAAGHWPPVEVEVSWPVLIAAGLLVGFGTRLGSGCTSG
FT                   HGVCGLARLSPRSLAAVAAFMAAAIVTVFLVRHGVAR"
FT   sig_peptide     complement(381929..382009)
FT                   /locus_tag="M446_0313"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.462 at
FT                   residue 27"
FT   gene            complement(382273..382488)
FT                   /locus_tag="M446_0314"
FT   CDS_pept        complement(382273..382488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0314"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14885"
FT                   /db_xref="UniProtKB/TrEMBL:B0UGR3"
FT                   /protein_id="ACA14885.1"
FT                   /translation="MAYTIRVRELRTRGPANEFVLAHSIMDRAQAEHLVARLATSYPRH
FT                   GFDPDRGIYWFQGFSGLHEIWAAADA"
FT   gene            complement(382739..382813)
FT                   /locus_tag="M446_R0002"
FT                   /note="tRNA-Val3"
FT   tRNA            complement(382739..382813)
FT                   /locus_tag="M446_R0002"
FT                   /product="tRNA-Val"
FT   gene            382991..385318
FT                   /locus_tag="M446_0315"
FT   CDS_pept        382991..385318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0315"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   mex:Mext_1949 glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14886"
FT                   /db_xref="GOA:B0UHT1"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B0UHT1"
FT                   /protein_id="ACA14886.1"
FT                   /translation="MSERAGQVRGGHVRAGQDRGGQDRGGQDRGGQDRGGQDHADPIRA
FT                   GAARGAVEAAILPLRGERTTRAFAPDPHEAASLVLDLRGSGLGGRWVEISFRDEGRGSF
FT                   SRVELAAVAERLSQHETTSLAERAYGNGRFTWTGRLPAGLVALKVTPMLGETEVTLGDM
FT                   TLRERSRLALLGRGLLRRPDLAGQAVFWRLLGKRVRARNRLLRAITPPGLTGYDTWVRC
FT                   FDTLSEADRARIRAEAGAMTDPPLISVVMPVYNPAPKVLEDALRSVRAQLYPHWELCIA
FT                   DDASTDPAVPRLLDRAAAADARVRVVRRPENGHIARATNTALALAAGPYVAFMDHDDVL
FT                   PEHALFEVARAIAKDPSLDLIYTDEDKVDAKGRRFEPHFKSDWNPELLYAQNYINHLTV
FT                   VRTSLVREVGGLRPGFEGSQDHDLLLRLADRLSPDRIRHLPHVLYHWRAAIGSGTFSDT
FT                   ALARAEAARLQALRDLIARRGWPHRAERGPLGFNRLVRAVPDPAPRVSVVIPTRDRAEL
FT                   LAVALRGLLKGTAYPDIEVIILDNDSREPATRALFAEVAADPRVRVLPSPGAFNFSALS
FT                   NEGAAAATGPLLLFLNNDIEVREPGWLAEMVSIAVEPGIGAVGAKLSYPDGTLQHGGVV
FT                   LGAGGVAGHSHLGIGPEDPGYFGRMAMAQEVSAVTGACLMMRASVFREVGGFDAERLAV
FT                   AFNDVDLCLRIRQAGYAIIWTPHAGLIHHESKSRGLEDTPQKRARFEAEVATMLERWGA
FT                   QLRNDPYYNPNFARAKAQFRLW"
FT   gene            385428..385664
FT                   /locus_tag="M446_0316"
FT   CDS_pept        385428..385664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0316"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; KEGG:
FT                   xau:Xaut_4452 putative transcriptional regulator, AsnC
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14887"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="UniProtKB/TrEMBL:B0UHT2"
FT                   /protein_id="ACA14887.1"
FT                   /translation="MQTFFVEIKCQLGRTYTVASALADREIASEIYSTAGHYDVLAKFH
FT                   VEDGVDIGHFVAENVQTIPNIQDTRTIITFKAF"
FT   gene            386148..393578
FT                   /locus_tag="M446_0317"
FT   CDS_pept        386148..393578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0317"
FT                   /product="Beta-ketoacyl synthase"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR;
FT                   phosphopantetheine-binding; Alcohol dehydrogenase
FT                   zinc-binding domain protein; Alcohol dehydrogenase GroES
FT                   domain protein; KR domain protein; Beta-ketoacyl synthase;
FT                   Acyl transferase; KEGG: mex:Mext_1947 beta-ketoacyl
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14888"
FT                   /db_xref="GOA:B0UHT3"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042104"
FT                   /db_xref="UniProtKB/TrEMBL:B0UHT3"
FT                   /protein_id="ACA14888.1"
FT                   /translation="MRHRPDIAIIGRACRLPGATGIDGLWQLLAEGRCAVSRIPEDRWS
FT                   LERLGHPRVQERGKSYTWAAGVLDDIWSFDPTVFGISPREAEQMDPQQRMLLELTWEAL
FT                   EDAGLRPSAVAGTGIGVFVGASSLDYGNLRVLDCASGDAYAATGNTLSILSNRISYIFD
FT                   LKGPSFTLDTACSSSLVALDAAVAAIASGRIDTAVVAGVNVLASPFNFISFSNASMLSR
FT                   TGLCQAFSARADGYVRAEGGVVLVLQSAAAAARTGATVRAVIAASKVNSDGRTTGISLP
FT                   SGYAQGVLLEEIYREAGIDLDAVAFVEAHGTGTPVGDPIEAGAIGSKIGRGRTAPLPIG
FT                   SIKTNIGHTEPVSGLAGLLKASLALEHDLLPPSLHCEELNPAIRFDDLNLAVNTAPRPL
FT                   ARGRGERFAGVNSFGFGGTNAHVILTDAKGAAPAGAGEAAPAPEVLLLSAQSRAALNEL
FT                   AEAYAERLDGAAPAEIGRIAAAAAHRRERLPTRLAVPLADASAVAESLRAVAASEEPPA
FT                   GALGTASERSGPVAFVYSGNGSQWAGMGRDAYAANASFRSRFEAVDALFRPLAGWSLTE
FT                   ALFADDLEARLVLTSVSQPLIFAIQSAATAALRAVGLTPGVIIGHSVGEIGAAEAAGIL
FT                   SLPQAVRVIFNRSKHQETTRGLGTMAVLLAPVEEVETFLADFPDLDIAALNSPKAVTVA
FT                   GPVESIDAAMKAMARKRRRGRKLDLDYAFHGRLMDPIEGPLLRDLKGLAPSSGTVPMAS
FT                   TVTGDLLAGERFDAGYWWRNIREPVRFSEAVQAAARAGARVFVEVGPRPTLLPHIGDCL
FT                   EPLGIDGATVGVLHKKPSDRDPFLQALASAVVQGAAVDEAVAFGRNPEGPVALPSYPWQ
FT                   RRPFRLAETTEVLSPASPRPYHPLIGSRLFAGGLEWQAHLDLATNPDLDDHRIDGQAIL
FT                   PGAAFVEMALAVAREHLGSEAVTLADVEIQQPMIFAEEALREVQARFAPGVNQVQILSR
FT                   PRLAQAAWQLHAVAKIVEGERPVPARVEVALPEDQVVSGEELYERARRSGLGFGPSFRQ
FT                   VARSARLDEATIVSELVPAEANPRFGLVPARLDSCFHGLILLFADLLGENAGKAYVPVR
FT                   FGEVRLLRPGGVIARAMIRTLRCNERSILADFTLVDAEGAVIATLREGRFQALRAKGGG
FT                   DLDAYAIRQATELATEPTAIALEPQPSVAATARRQAPGVLAQDEAALSPGHMLLEGWAT
FT                   ALAYRLARGLSRGSIVDLASLGRLPEALRPWFVNQLIALDGSGLAEGLGDHRWKLRTDV
FT                   TLPDPDEIMRWIAADHPDLSAELLLCADLGAVVARILDGSLSQAPVLPQAALDGFSLRG
FT                   ATVRASAETLMRLLERSQSALPRDRALRLLQIGYGPLSAQVAAFAAACEAKLTVFEADR
FT                   RLAERARLALPAGITVIEDPAELPQAAIDAVLASDVLHRSDRELLGRLAASLATGGLFA
FT                   AVEPAASLFRDLVFGLAPTWFEGEPDLPVGRLDDVAGWQRALSAAGLVKVSADRAATEA
FT                   GNDLLLLAEAPPRPKPAPGQTFAFIIGSEDDFAAETASSLATLLVASGVHVSIILDSEV
FT                   SLQELARETPDTVMYLAKAFGRGGEPAARLRERVLGLKRCVEHLGTRPTRLWVVCPGAT
FT                   RDRGGPACSVEAGVWAFTRTLANEVASLDIRRVDLAATLTSKRTAERLRDLILSGTAET
FT                   EIVLDEDRTRVVRFAAGGTGRRSVREAGAAPAARLERSAHGGLNEMRWGPAERVAPGPG
FT                   QVEIAVEATGLNFRDVLWALSMLPEEILEDGFAGPRLGLECSGRVTAVGPGVTAVAPGD
FT                   AVVAFAQSGFATHVVVPEMVVAPAPKGIGLQAAATTPVAFLTAYYGLVTLARIKAGEWV
FT                   LVHGGAGGVGLAALQIAASRGARVIATAGSTEKRALVKALGAEHVLDSRSLAFVDEIRR
FT                   ITSDGVDVVLNSLSGEAMERSLNVLKPFGRFVELGKRDYVANTHIGLRPFRRNLSYFGV
FT                   DLDQLLQFQPEEGQRLFREVMALFADGVLKPLPFQPFAAEEVSDAFRLMQQSGHVGKIV
FT                   IAPPRAGTVAAETRRPFVVAPDRSHLVTGGLGGFGIEAARWLADHGARHIVLVGRRAPS
FT                   SEEALATIAELTGRGVSVRTLACDIADRAAVATLLDAVEAEGPPLAGIIHGAMVLQDGL
FT                   VANLDPAALDAVLAPKVTGASHLDALTRTRSLDYFVLFSSATTFIGNPGQGAYVAANGF
FT                   MEGLARQRRRLGLPALAVAWGAIGDVGVLARNRAVMETLSERVGVTPVAARKSLDLMAE
FT                   ALSLQGPAPDDAVLAIAAMHWGKARERLATLKSPSYAALGSEQQTEAGGVTAISIPGLL
FT                   RSLDLDEVRKVVADAIVEDVARILRLPKDDLSRVRQLSEIGLDSLMGVELGASLQERFG
FT                   LEAPPAGVSSSQTVLELADTLIQSVAAPVDEGAAAVLSLAQRHAGESLDASQLDPLQAL
FT                   VEEKSREIKVIL"
FT   gene            393686..395053
FT                   /locus_tag="M446_0318"
FT   CDS_pept        393686..395053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0318"
FT                   /product="8-amino-7-oxononanoate synthase"
FT                   /EC_number="2.3.1.47"
FT                   /note="PFAM: Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent protein; aminotransferase
FT                   class I and II; aminotransferase class-III; KEGG:
FT                   mex:Mext_1946 8-amino-7-oxononanoate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14889"
FT                   /db_xref="GOA:B0UHT4"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B0UHT4"
FT                   /protein_id="ACA14889.1"
FT                   /translation="MSSSTKPTGGREALAGFVAARLGKAPTRPGPTRPAPKPALVPAQD
FT                   FESLPGYKELKLQRSAAELIGLGNPFFRVHDAKAGATTRIDGETLINFSSYDYLGLNGH
FT                   AEVNAAAQAALSTYGTSASASRVVAGERPGHLALERALAAHYGTESCVVMVSGHATNVA
FT                   TIAALMEAGDVIYHDALIHNSVVTGAQLSGAQRRSFPHNDLAALEGLLHATRHEHRRAL
FT                   IIIEGLYSMDGDAPDLAGFVALKERYGAWLMVDEAHGLGVLGRHGHGLHEHCDVDPRSV
FT                   DIWMGTLSKTLSSCGGYVAGCAALVEFLKCTAGGFVYSVGMSPPLAAAAAASLDLMHRE
FT                   PERVERLRRNGQLFLSEARQRGLDTGTSLGLAVVPVIIGDSLKAVTLSDRLFKRGVNVQ
FT                   PIIHPAVPERSSRLRFFLTSEHTVEQIRLTVAALAEETAELNRGGSLVERLIARRS"
FT   gene            complement(395123..395968)
FT                   /locus_tag="M446_0319"
FT   CDS_pept        complement(395123..395968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0319"
FT                   /product="formyl transferase domain protein"
FT                   /note="PFAM: formyl transferase domain protein; KEGG:
FT                   mex:Mext_2540 formyl transferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14890"
FT                   /db_xref="GOA:B0UHT5"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:B0UHT5"
FT                   /protein_id="ACA14890.1"
FT                   /translation="MRIALFTLEALPNARAVRRFVADHAAEIAFVGLSNPERPSAGGLL
FT                   GQVRRHLVRSGPGFLPYLGVNFGLPDLVRGLAPVTQRLGGSLDQPETTPLAALCRRLGL
FT                   AHARIDAVNAPETTALIAEHRADLIVSYHFDQIFDAATLAAAPLGGINLHPSLLPRHRG
FT                   PVPTLHALLDETPDFGVTVHRLSPQIDAGTILAQERADLPADVTATRAAMRLHEAGRPL
FT                   LAGILDAVRRDGRVPPGRAVPVLPYCGFPSPAQLRDLKRRGRRLVDARDLAEAFSLSLR
FT                   "
FT   gene            complement(396001..396774)
FT                   /locus_tag="M446_0320"
FT   CDS_pept        complement(396001..396774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0320"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   mex:Mext_2539 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14891"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0UHT6"
FT                   /protein_id="ACA14891.1"
FT                   /translation="MPVILISGASSGIGAALARHYAAPGTTLALNARGAERLEAVAESC
FT                   RRAGAEVETRALDVRDRAATRAWIEDLAARRGLDLAIANAGVNGGHPEGGIETEETAFL
FT                   VIDVNLLGALNVALPCVARMAARGRGQVALISSLAAIAPLPDAPAYSGTKAALLAHGLA
FT                   LREKLAPRGVRMNVVCPGYVRTAMGADYQGWRPLEMSAEAAARRIARGLARDEAVIAFP
FT                   AALAAAARGAALLPESLRRLGMRGFRFRTGERQQR"
FT   gene            396961..398946
FT                   /locus_tag="M446_0321"
FT   CDS_pept        396961..398946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0321"
FT                   /product="Capsule polysaccharide biosynthesis protein"
FT                   /note="PFAM: Capsule polysaccharide biosynthesis protein;
FT                   KEGG: dvl:Dvul_2595 capsule polysaccharide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14892"
FT                   /db_xref="GOA:B0UHT7"
FT                   /db_xref="InterPro:IPR007833"
FT                   /db_xref="UniProtKB/TrEMBL:B0UHT7"
FT                   /protein_id="ACA14892.1"
FT                   /translation="MDHSKLKRFWPRTASDSEPETPRRSRRLGSDPTSRRVRLTDRWDD
FT                   GFLRLPAAGRGARGLSYIVDGLGIYYDATAPSELEIMLEEGGWETPETLARAEAGSARL
FT                   REERLSLDNDPRRRLLGEVLGEAPGPRAAPRVAIVDQGRRDATIGFGLAGATCFTAMLA
FT                   AAAAEHPQAERVVVMDPAAPPGTVGHIDAATAARFGARLVTEPVAAWSVVEECARLFVV
FT                   TSHIGLEAALAGRRVTCFGLPFYAGWGFTDDRLHLPRRSRRRSPQEVFAAAYIVCSRYF
FT                   DPYLGEACRLEDALDYLALIVGRARENTARTLCLGFSAWKRRSVSETFSSPGQRPVIPQ
FT                   KVARVTASDLRGFARVVAWASRMPEGTEEACRAAGIPLLRMEDGFLRSVGLGVALRPGA
FT                   SHVLDRAGVYYDATRPSDLERLLETAEFDEAMLERAADLRETIVAARVSKYNVGGAPMP
FT                   PRPRPGPLVLVAGQVENDASIRLGCLEVRTNADLLRRARERHPEAVIAFKPHPDVEAGL
FT                   RPGWVPAQDLAAHADMVLRDVSAADAIDAADHVETLTSLIGFEALLRGKPVTTHGLPFY
FT                   AGWGLTESPPCPRRTRRLSLDELVAGALIAYPRYVDPRTGLPCPPEVLVRRLAEGDPSL
FT                   SRRELTAEAVMKQVWSLIWRHVLRRG"
FT   gene            complement(399061..400128)
FT                   /locus_tag="M446_0322"
FT   CDS_pept        complement(399061..400128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0322"
FT                   /product="Phytanoyl-CoA dioxygenase"
FT                   /note="PFAM: Phytanoyl-CoA dioxygenase; KEGG: swi:Swit_3963
FT                   phytanoyl-CoA dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14893"
FT                   /db_xref="GOA:B0UHT8"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:B0UHT8"
FT                   /protein_id="ACA14893.1"
FT                   /translation="MAALTRTAARAAGTLASAARVPVWLAGIAGADKSFAKNPILGSPT
FT                   LNRLGLHAARVQLAARIAEQRRARLAPLVDPADRAAFDRDGIVIKRDFLDPETFRALKD
FT                   EIFGRRFAARELRQGQAVQRMVPLGRDTLPGLPQLSALVSHPALRGLTYYAASRAGEPV
FT                   YYLQTVVAEPDGPNDPQTALHADTFHATTKGWFFLHDVAEEEGPFVYVPGSHRLTPERL
FT                   AWERAQSVAARGHANSHHAAGSFRIREEDLPGLGYGAPVRVAVPANTLVIADTFGFHAR
FT                   APSLRASTRVTVHTYIRRNPFLPWTGLDPKALPGLRGRELALYLGFQDLKRRLTGRGAP
FT                   WRPVGPVTVDAPAQV"
FT   sig_peptide     complement(400051..400128)
FT                   /locus_tag="M446_0322"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.613) with cleavage site probability 0.419 at
FT                   residue 26"
FT   gene            complement(400700..402058)
FT                   /locus_tag="M446_0323"
FT   CDS_pept        complement(400700..402058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0323"
FT                   /product="Capsule polysaccharide biosynthesis protein"
FT                   /note="PFAM: Capsule polysaccharide biosynthesis protein;
FT                   KEGG: sme:SMc02269 capsular polysaccharide
FT                   biosynthesis/export protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14894"
FT                   /db_xref="GOA:B0UHT9"
FT                   /db_xref="InterPro:IPR007833"
FT                   /db_xref="UniProtKB/TrEMBL:B0UHT9"
FT                   /protein_id="ACA14894.1"
FT                   /translation="MRADAARHGGTGVGDGAKRQVFLFLQGPISPFFAETADALEARGH
FT                   RCLRVNLCFGDWLFWRRPGGIDFRGSREKWPAFVADLIDREGVTDLVLLGEQRFYHKVA
FT                   IAAAKARDLKVTVTDFGYLRPDWITFERDGMSGDSCFPRDPEAVMDLARDVPDPDLVPR
FT                   YRDSFVTQVIWDMAYHLMSNWLWWLYPGYRSHQVHHPALVYIATALHILRAKRTGPRGD
FT                   RHVEALREAGTPYYVMPLQMENDFQLRAYSPFFDLKTPIHMVIRSFAAHAPAGSRLLIK
FT                   IHPLDPNIRNWKRIVRRSAVKWNVPDRVDYIDGGNLGTMLEGCQGVVTVNSTVGMWSMR
FT                   AGKPTMTLGAAVYDIDGLTYQGSLDRFWTEARPPRRDLWDAFVKAIVANIQIRGVYYRR
FT                   EGLAAAVEAAASRLDLAQGTWLEVRSRAARRQREAPALAAEMEIGGIEAMQNA"
FT   gene            402691..403923
FT                   /locus_tag="M446_0324"
FT   CDS_pept        402691..403923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0324"
FT                   /product="polysaccharide export protein"
FT                   /note="PFAM: polysaccharide export protein; KEGG:
FT                   mex:Mext_2535 polysaccharide export protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14895"
FT                   /db_xref="GOA:B0UHU0"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="UniProtKB/TrEMBL:B0UHU0"
FT                   /protein_id="ACA14895.1"
FT                   /translation="MVRVGPLAVAGAVLLSGCSNFLPAAGPTASAVTEGADIATDQGLL
FT                   ARYEIIDVDAAVVEALRGRPLDSLLASFGDRRAAVAPVIGIGDAVTVTIWEAGTGGLFS
FT                   GPVLADRFSAGSKASTIPEQIVGRDGSISVPYAGRIQVAGKRVQEVQGQIEQELAGKAI
FT                   QPQVLVTVTSPLSSSVTVIGEAASAGGGARLSAAALRGPVSSIGGGRVPLSERGDRLLD
FT                   VIAAAGGVSAPVNETFVRLSRGPTTATVPLLSVVSNPRENIFLRPGDTVTLVRDPQTFL
FT                   AIGALGTQSEIPFSADGITLAQALTKARGLSDFQADPAGVFVFRFEPASVVRRLRPGSP
FT                   LLGSPQVPVVYRINMRDPNSLFVSQAFRMRNRDLVYVSNAPFTEVQKVLGAFSTVTAPV
FT                   AAGASIYTVTR"
FT   sig_peptide     402691..402786
FT                   /locus_tag="M446_0324"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.976) with cleavage site probability 0.549 at
FT                   residue 32"
FT   gene            complement(403966..404943)
FT                   /locus_tag="M446_0325"
FT   CDS_pept        complement(403966..404943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0325"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; D-isomer specific 2-hydroxyacid
FT                   dehydrogenase NAD-binding; KEGG: sen:SACE_1944 D-isomer
FT                   specific 2-hydroxyacid dehydrogenase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14896"
FT                   /db_xref="GOA:B0UHU1"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0UHU1"
FT                   /protein_id="ACA14896.1"
FT                   /translation="MAGQDPIRVAVLDDYQRAAAGLADWAGLGPGIAVDFLHEPVPRAE
FT                   AAARLAPYAVLCLMRERMPLDAALIEALPNLRLVVFTGGRTHALDFPALARAGVTVCHT
FT                   RNGEGGVATAELAFALILACLRHLPGEFARMRAGLWQDSIGSVLDGRRLGLVGLGRIGG
FT                   RMARIGAAFGMEPVAWSPHLTPERAAAGGAALVSREDLFRTADVVSLHLVLAPATRGIV
FT                   GAAEIGLMRPGAVLINTARGPLVDEAALIAALREGRLRAAGLDVFDREPLPADHPLRAL
FT                   PNAVLTPHLGYVTDATYRMFYEDTVEAIAAWRRGAPVRVVEPAA"
FT   gene            405289..406377
FT                   /locus_tag="M446_0326"
FT   CDS_pept        405289..406377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0326"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   mex:Mext_2534 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14897"
FT                   /db_xref="GOA:B0UHU2"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B0UHU2"
FT                   /protein_id="ACA14897.1"
FT                   /translation="MTPWLVVACLLGAARPAAAEVVVGVAVPRTGPVAGIGEQVLQGVQ
FT                   AAVKEANARGGLAGEPIILDVQDDACEPGQAVEVAERFAKAGVGLVVGHVCSSASLAAS
FT                   DVYAAKGVVMISPASNAARLTDRGLPTIFRVSGREDDQGRLSATILAERFRDKKIAILY
FT                   DDTPLSRSLADSTKANLNKIGQNETLFAAIVPGQTDDAALIKRLQGAGIEVVYYGGHYQ
FT                   EMGKLVRSAAEQGYRPQWFGTSGIATKEFGTLAGPASNGVLMTFNPDLRRKPEAAAAVK
FT                   ALQADGIDPGGFVLYGYAAMQALVEAGNFARSSNPKTIAETLHSERFNLVLGNVGFDQK
FT                   GDVTAPGYVLYVWRDGAFTYAN"
FT   sig_peptide     405289..405348
FT                   /locus_tag="M446_0326"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 20"
FT   gene            complement(406421..407704)
FT                   /locus_tag="M446_0327"
FT   CDS_pept        complement(406421..407704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0327"
FT                   /product="putative transcriptional regulator, GntR family"
FT                   /note="KEGG: mex:Mext_0675 aspartate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14898"
FT                   /db_xref="GOA:B0UHU3"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024551"
FT                   /db_xref="UniProtKB/TrEMBL:B0UHU3"
FT                   /protein_id="ACA14898.1"
FT                   /translation="MVPLAELPPEALRTSLAALQERYAALTRRGLKLDMTRGKPAPEQL
FT                   DLSEGLLALPGNRDHLTETGEDARNYGGLQGLAEVRRLFAPILGAPPEQVAVGNNSSLA
FT                   LMHDCLVYALLKGVPGGAGPWSREGEIRFLCPVPGYDRHFALCETYGIVMEPVPMNPDG
FT                   PDLGSVEERLRDPRVKGMWCVPQYANPGGETYAESTVERLAAMPAAAPDFRLFWDNAYA
FT                   LHHLTERRPALRNVLEAAAAAGQPDRPIVFASTSKVTLAGAGLAFLAASPANLRWYLAH
FT                   AGKRSIGPDKLNQLRHARFLSREGALEALMDGHRRLLAPKFRAVTTILERELGGSGAAR
FT                   WTNPEGGYFILLEVPEGCATRVVELAAGSGLALTPAGATHPYGRDPQDRMLRLAPSYPS
FT                   LAEVEAAAEVVALCTLLAATEARLRAVA"
FT   gene            complement(407892..408308)
FT                   /locus_tag="M446_0328"
FT   CDS_pept        complement(407892..408308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0328"
FT                   /product="ribosomal protein L17"
FT                   /note="PFAM: ribosomal protein L17; KEGG: mex:Mext_2175
FT                   ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14899"
FT                   /db_xref="GOA:B0UHU4"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UHU4"
FT                   /protein_id="ACA14899.1"
FT                   /translation="MRHGYRGRRFNRTTEHRKAMFANMSAALIKHEQIVTTLPKAKDLR
FT                   PVVEKLITLGKRGDLHARRQAIAQIRDEAMVKKLFEVLGPRYQARPGGYCRIMKAGFRY
FT                   GDNAPLAVIEFVDRDVDARGRDSGPTQAAAEAAE"
FT   gene            complement(408496..409515)
FT                   /locus_tag="M446_0329"
FT   CDS_pept        complement(408496..409515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0329"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /note="KEGG: mex:Mext_2176 DNA-directed RNA polymerase,
FT                   alpha subunit; TIGRFAM: DNA-directed RNA polymerase, alpha
FT                   subunit; PFAM: RNA polymerase alpha subunit domain protein;
FT                   RNA polymerase dimerisation; RNA polymerase insert; SMART:
FT                   RNA polymerase RpoA/D/Rpb3-type"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14900"
FT                   /db_xref="GOA:B0UHU5"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UHU5"
FT                   /protein_id="ACA14900.1"
FT                   /translation="MVIQKNWQELIKPNKLEVVPGHDPKRVATVVAEPLERGFGTTLGN
FT                   ALRRVLLSSLQGAAVTSVHIDGVLHEFSSIPGVREDVTDIVLNIKTIAIRSNSDAPKRM
FT                   TLRKTGPGLVTAGDISTIGDIQILNPDLVLCTLDEGAEIRMEFTVATGKGYVPADRNRP
FT                   EDAPIGLIPVDALFSPVTKVSYRIENTREGQDLDKDKLTMTVETNGAVSPEDALAYAAR
FT                   IIQDQLQIFVNFEEPRKEEAAPLAPQLPFNPALLKKVDELELSVRSANCLKNDNIVYIG
FT                   DLIQKTEAEMLRTPNFGRKSLNEIKEVLAAMGLHLGMDVPGWPPENIEDLAKRFEEHY"
FT   gene            complement(409735..410124)
FT                   /locus_tag="M446_0330"
FT   CDS_pept        complement(409735..410124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0330"
FT                   /product="ribosomal protein S11"
FT                   /note="PFAM: ribosomal protein S11; KEGG: xau:Xaut_4775
FT                   ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14901"
FT                   /db_xref="GOA:B0UHU6"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UHU6"
FT                   /protein_id="ACA14901.1"
FT                   /translation="MAKEATRIRRRERKNIVSGVAHVNASFNNTMITITDAQGNTISWS
FT                   SAGAMGFKGSRKSTPYAAQVAAEDAGRKAAEHGMRTLEVEVSGPGSGRESALRALQAAG
FT                   FTVTSIRDVTPIPHNGCRPRKRRRV"
FT   gene            complement(410317..410685)
FT                   /locus_tag="M446_0331"
FT   CDS_pept        complement(410317..410685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0331"
FT                   /product="ribosomal protein S13"
FT                   /note="PFAM: ribosomal protein S13; KEGG: mex:Mext_2179
FT                   ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14902"
FT                   /db_xref="GOA:B0UHU7"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UHU7"
FT                   /protein_id="ACA14902.1"
FT                   /translation="MARIAGVNIPTNKRVVIALQYIHGIGPKKAEEITEKVGIPAERRV
FT                   NQLTDAEVLQIREAIDRDYVVEGDLRREVAMNIKRLMDLGCYRGLRHRRNLPVRGQRTH
FT                   TNARTRKGKAKPIAGKKK"
FT   gene            complement(410902..411501)
FT                   /locus_tag="M446_0332"
FT   CDS_pept        complement(410902..411501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0332"
FT                   /product="adenylate kinase"
FT                   /note="PFAM: adenylate kinase; KEGG: mex:Mext_2180
FT                   adenylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14903"
FT                   /db_xref="GOA:B0UHU8"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/TrEMBL:B0UHU8"
FT                   /protein_id="ACA14903.1"
FT                   /translation="MRIILLGPPGAGKGTQSARIVERFGIPQLSTGDMLRAAVAAGTPV
FT                   GLQAKSIMESGGLVPDEVVIGIVGDRIEEPDARKGFILDGFPRTVAQAKALDALLAGKG
FT                   LRLDAVIEFKVDEAALVGRIANRAAETLARGEVVRKDDTPEVFKTRLDAYRSLTAPLSE
FT                   YYAGTGLLRPIDGMAPIDQVSREIEALLGGLQPVSA"
FT   gene            complement(411687..413024)
FT                   /locus_tag="M446_0333"
FT   CDS_pept        complement(411687..413024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0333"
FT                   /product="preprotein translocase, SecY subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecY subunit; PFAM:
FT                   SecY protein; KEGG: mex:Mext_2181 preprotein translocase,
FT                   SecY subunit"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14904"
FT                   /db_xref="GOA:B0UHU9"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:B0UHU9"
FT                   /protein_id="ACA14904.1"
FT                   /translation="MASAAEQLAANLNFGAIAKADELKKRIWFTLGALIVYRLGTYIPL
FT                   PGIDPDALRQSFANAQGGVLGLFNMFSGGAVERMAIFALNIMPYISASIIVQLLTSVLP
FT                   SLEALKKEGESGRKVLNQYTRYLTVVLAIFQAWGIAVGLQSSGGIVQEPGLFFAISTVI
FT                   TLTGGTLFLMWIGEQITSRGIGNGSSLIIFAGIVAHLPSAIAGTLELGRQGALSTAVIL
FT                   GVAVMATAVVYFIVFMERAQRRLLINYPKRQVGNRMYEGQTSFMPLKLNTPGVIPPIFA
FT                   SSLLLLPATAASFQSDPSGTGIVATLATYLGHGRPLYMVLYAALIIFFAFFYTAVVFNP
FT                   QETADNLKKHGGFIPGIRPGERTAEYIDKVLSRVTVIGAAYLTLICLIPEILVSYASLP
FT                   FYFGGTSLLIVVSVTMDTVAQVHGHLLAHQYEGLVKKAKLRGARRR"
FT   gene            complement(413135..413623)
FT                   /locus_tag="M446_0334"
FT   CDS_pept        complement(413135..413623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0334"
FT                   /product="ribosomal protein L15"
FT                   /note="PFAM: ribosomal protein L15; KEGG: mex:Mext_2182
FT                   ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14905"
FT                   /db_xref="GOA:B0UHV0"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UHV0"
FT                   /protein_id="ACA14905.1"
FT                   /translation="MKLNEIRDNEGATKDRMRVGRGIGSGKGKTAGRGVKGQKARTGVA
FT                   IKGFEGGQMPLHRRLPKRGFNNPGATDLNEVNVGRIQQAVDSGKLDPSAPVTVEALVAA
FT                   GVVSRVRDGVKILGVGELTASLTFQVARASKSAVAAIEKAGGSVTQSLAATDGAVASA"
FT   gene            complement(413634..413825)
FT                   /locus_tag="M446_0335"
FT   CDS_pept        complement(413634..413825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0335"
FT                   /product="ribosomal protein L30"
FT                   /note="TIGRFAM: ribosomal protein L30; KEGG: mex:Mext_2183
FT                   ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14906"
FT                   /db_xref="GOA:B0UHV1"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UHV1"
FT                   /protein_id="ACA14906.1"
FT                   /translation="MAEKTVRVQQIGSPIRREASQRETLIGLKLNKLHRIAELPDTPSV
FT                   RGMIAKVHHLVRVLDGAA"
FT   gene            complement(413836..414414)
FT                   /locus_tag="M446_0336"
FT   CDS_pept        complement(413836..414414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0336"
FT                   /product="ribosomal protein S5"
FT                   /note="TIGRFAM: ribosomal protein S5; PFAM: ribosomal
FT                   protein S5 domain protein; Ribosomal protein S5; KEGG:
FT                   mex:Mext_2184 ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14907"
FT                   /db_xref="GOA:B0UHV2"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UHV2"
FT                   /protein_id="ACA14907.1"
FT                   /translation="MAREREGRRRDEREERDTEFVDRLVHINRVAKVVKGGRRFGFAAL
FT                   VVVGDQKGRVGFGHGKAREVPEAIRKATEAAKRGLIRVALREGRTLHHDVAGRHGSGKV
FT                   ILRAAPQGTGIIAGGPMRAVFESVGMQDVVAKSLGSSNPYNLIRATFDALKREDSPRAV
FT                   AARRGLKVSALQARRRDAEPGSADSADAA"
FT   gene            complement(414515..414877)
FT                   /locus_tag="M446_0337"
FT   CDS_pept        complement(414515..414877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0337"
FT                   /product="ribosomal protein L18"
FT                   /note="TIGRFAM: ribosomal protein L18; PFAM: ribosomal
FT                   protein L18P/L5E; KEGG: mex:Mext_2185 ribosomal protein
FT                   L18"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14908"
FT                   /db_xref="GOA:B0UHV3"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UHV3"
FT                   /protein_id="ACA14908.1"
FT                   /translation="MSRKIDLLDRRRARVRRALRAAANGRPRLSVFRSSKQIYVQVIDD
FT                   ASGRTLAAASSLDKDLRARLKTGADKAAALEVGKLVAERAKAAGVTKVIFDRSGYLYHG
FT                   RVKALADAAREGGLEF"
FT   gene            complement(414890..415423)
FT                   /locus_tag="M446_0338"
FT   CDS_pept        complement(414890..415423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0338"
FT                   /product="ribosomal protein L6"
FT                   /note="PFAM: ribosomal protein L6; KEGG: mex:Mext_2186
FT                   ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14909"
FT                   /db_xref="GOA:B0UHV4"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UHV4"
FT                   /protein_id="ACA14909.1"
FT                   /translation="MSRVGKKPVTVPAGVTATVDGQNVKIKGAKGELSFRVPDLVEVSH
FT                   ADGAISVQPRSQTKEARAMWGLSRAQVANLIEGVTKGFEKKLEINGVGYRAAVAGKVLK
FT                   LSLGYSHDVEYEIPAGITITTPRPVEIIVAGIDKQRVGQIAAEIREYRGPEPYKGKGVK
FT                   YSDEFIFRKEGKKK"
FT   gene            complement(415457..415852)
FT                   /locus_tag="M446_0339"
FT   CDS_pept        complement(415457..415852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0339"
FT                   /product="ribosomal protein S8"
FT                   /note="PFAM: ribosomal protein S8; KEGG: mex:Mext_2187
FT                   ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14910"
FT                   /db_xref="GOA:B0UHV5"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/TrEMBL:B0UHV5"
FT                   /protein_id="ACA14910.1"
FT                   /translation="MITDPVGDMLTRIRNGQQRRRNVVQTPGSKLRARILDVLKSEGYI
FT                   RDYATTDYGNGRTEFAIELKYHDGQPVIRSIERVSKPGRRVYSSVDTLPRVADGLGVTI
FT                   VSTPLGVMADHEARERNVGGEVLCKVF"
FT   gene            complement(415869..416174)
FT                   /locus_tag="M446_0340"
FT   CDS_pept        complement(415869..416174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0340"
FT                   /product="ribosomal protein S14"
FT                   /note="PFAM: ribosomal protein S14; KEGG: mex:Mext_2188
FT                   ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14911"
FT                   /db_xref="GOA:B0UHV6"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UHV6"
FT                   /protein_id="ACA14911.1"
FT                   /translation="MAKKSKIERNKQRVALVKRYAAKREALLSTANDESLPMEDRFEAR
FT                   LKLAELPRNANPTRIRNRCAMTGRPRAYYRKLGISRVALRDLGSRGMIPGLVKSSW"
FT   gene            complement(416219..416785)
FT                   /locus_tag="M446_0341"
FT   CDS_pept        complement(416219..416785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0341"
FT                   /product="ribosomal protein L5"
FT                   /note="PFAM: ribosomal protein L5; KEGG: mex:Mext_2189
FT                   ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14912"
FT                   /db_xref="GOA:B0UHV7"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/TrEMBL:B0UHV7"
FT                   /protein_id="ACA14912.1"
FT                   /translation="MAEARKDGYTPRLRKHYDEVVRAKMIQEFGYTNPMQVPTIEKITI
FT                   NMGVGESTQDSKKATVAAEDLGLIAGQKPVITRARKAIATFKVRENMPIGCKVTLRRQR
FT                   MYEFMDRLITIALPRVRDFRGLNPKSFDGRGNYALGLREHLVFPEINYDKAQNAWGMDI
FT                   VVTTTAKTDAEARALLKHFNFPFRQ"
FT   gene            complement(416778..417095)
FT                   /locus_tag="M446_0342"
FT   CDS_pept        complement(416778..417095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0342"
FT                   /product="ribosomal protein L24"
FT                   /note="TIGRFAM: ribosomal protein L24; PFAM: KOW domain
FT                   protein; KEGG: xau:Xaut_4787 ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14913"
FT                   /db_xref="GOA:B0UHV8"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UHV8"
FT                   /protein_id="ACA14913.1"
FT                   /translation="MAAKVKKGDKVVVLTGRDKGRTGEVIQVMPKENRALVRGVNLVKR
FT                   HQRQTQTQEGGIISKEAAIDLSNLAVADPKDGKPTRVGFRILEDGRKVRFAKRSGDLID
FT                   G"
FT   gene            complement(417095..417463)
FT                   /locus_tag="M446_0343"
FT   CDS_pept        complement(417095..417463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0343"
FT                   /product="ribosomal protein L14"
FT                   /note="TIGRFAM: ribosomal protein L14; PFAM: ribosomal
FT                   protein L14b/L23e; KEGG: mex:Mext_2191 ribosomal protein
FT                   L14"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14914"
FT                   /db_xref="GOA:B0UHV9"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UHV9"
FT                   /protein_id="ACA14914.1"
FT                   /translation="MIQMQTNLDVADNSGARRVMCIKVLGGSKRKYAGVGDIIVVSVKE
FT                   AIPRGRVKKGDVMKAVVVRTAKDVRRPDGSVIRFDRNAAVLINNQKEPIGTRIFGPVPR
FT                   ELRARNHMKIISLAPEVL"
FT   gene            complement(417735..417995)
FT                   /locus_tag="M446_0344"
FT   CDS_pept        complement(417735..417995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0344"
FT                   /product="ribosomal protein S17"
FT                   /note="PFAM: ribosomal protein S17; KEGG: mex:Mext_2171
FT                   ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14915"
FT                   /db_xref="GOA:B0UHW0"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UHW0"
FT                   /protein_id="ACA14915.1"
FT                   /translation="MPKRVLQGVVVSDKQDKTIVVKVERRFTHPVMKKTVRRSKNYHAH
FT                   DENNAAKVGQTVFIEESRPFSKLKTWRLVEGEARDVAATEA"
FT   gene            complement(418008..418223)
FT                   /locus_tag="M446_0345"
FT   CDS_pept        complement(418008..418223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0345"
FT                   /product="ribosomal protein L29"
FT                   /note="PFAM: ribosomal protein L29; KEGG: mex:Mext_2170
FT                   ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14916"
FT                   /db_xref="GOA:B0UHW1"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:B0UHW1"
FT                   /protein_id="ACA14916.1"
FT                   /translation="MKSSQRLSDLSAMSPDQLGEELVNLKKEQFNLRFQRATGQLENVA
FT                   RIREVRRDIARVRTLQRRKTLQAAQG"
FT   gene            complement(418237..418650)
FT                   /locus_tag="M446_0346"
FT   CDS_pept        complement(418237..418650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0346"
FT                   /product="ribosomal protein L16"
FT                   /note="PFAM: ribosomal protein L16; KEGG: mex:Mext_2169
FT                   ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14917"
FT                   /db_xref="GOA:B0UHW2"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UHW2"
FT                   /protein_id="ACA14917.1"
FT                   /translation="MLQPKKTKFRKQFKGRIHGTAKGGTDLNFGSYGLKALEPERVTAR
FT                   QIEAARRAITREMKRQGRVWIRIFPDVPVTQKPTEVRMGSGKGSPEYWAARVHPGRVMF
FT                   EIDGVAEDIAREALRLGAAKLPVRTRFIQRIAD"
FT   gene            complement(418685..419443)
FT                   /locus_tag="M446_0347"
FT   CDS_pept        complement(418685..419443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0347"
FT                   /product="ribosomal protein S3"
FT                   /note="KEGG: mex:Mext_2168 ribosomal protein S3; TIGRFAM:
FT                   ribosomal protein S3; PFAM: ribosomal protein S3- domain
FT                   protein; KH type 2 domain protein; Ribosomal protein S3
FT                   domain; SMART: KH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14918"
FT                   /db_xref="GOA:B0UHW3"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/TrEMBL:B0UHW3"
FT                   /protein_id="ACA14918.1"
FT                   /translation="MGQKVNPIGLRLGINRTWDSRWYANKGEYARLMHEDVAIRQALMK
FT                   QLKQAAVSKIVIERPHRKCRVTIHSGRPGVVIGKKGADIEKLRKLVGTMTKADVTINII
FT                   EVRKPEIDATLVADSIAQQLERRVAFRRAMKRAVQSAMRLGAEGIRINCSGRLGGAEIA
FT                   RLEWYREGRVPLHTLRADVDYGTATAFTTYGTCGIKVWVFKGEILEHDPMAQDKRAQEE
FT                   GGRSGGRRDRDRERGDRDRDRGDRGGRDAA"
FT   gene            complement(419454..419837)
FT                   /locus_tag="M446_0348"
FT   CDS_pept        complement(419454..419837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0348"
FT                   /product="ribosomal protein L22"
FT                   /note="TIGRFAM: ribosomal protein L22; PFAM: ribosomal
FT                   protein L22/L17; KEGG: mex:Mext_2167 ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14919"
FT                   /db_xref="GOA:B0UHW4"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UHW4"
FT                   /protein_id="ACA14919.1"
FT                   /translation="MGKAAAPRALPENEAKAVARMLRVSPQKLNLVAQLIRGKKVANAL
FT                   ADLQFSRKRIAVEVRKCLESAIANAENNHDLDVDDLVVKEAYVGKALVLKRFHARARGR
FT                   GARILKPFANLTIVVREVRAEAA"
FT   gene            complement(419839..420117)
FT                   /locus_tag="M446_0349"
FT   CDS_pept        complement(419839..420117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0349"
FT                   /product="ribosomal protein S19"
FT                   /note="TIGRFAM: ribosomal protein S19; PFAM: ribosomal
FT                   protein S19/S15; KEGG: mex:Mext_2166 ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14920"
FT                   /db_xref="GOA:B0UHW5"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UHW5"
FT                   /protein_id="ACA14920.1"
FT                   /translation="MARSVWKGPFVDGYLLKKAETARGSTRAEVIKIWSRRSTILPQFV
FT                   GLTFGVYNGQKHIPVYVTEEMVGHKFGEFSPTRTFHGHAADKKAKRR"
FT   gene            complement(420130..420966)
FT                   /locus_tag="M446_0350"
FT   CDS_pept        complement(420130..420966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0350"
FT                   /product="ribosomal protein L2"
FT                   /note="PFAM: ribosomal protein L2; KEGG: mex:Mext_2165
FT                   ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14921"
FT                   /db_xref="GOA:B0UHW6"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UHW6"
FT                   /protein_id="ACA14921.1"
FT                   /translation="MALKTFKPVTPSLRQLVIVDRSELYKGKPVKALTEGKISSGGRNN
FT                   LGRVTVRFRGGGHKRTLRNVDFKRREFAGKVGTVERIEYDPNRTAFIALVSYEGGGQSY
FT                   ILAPQRVKAGDRVVSGEQVDIKPGNAMPIGNMPVGTIVHNVELKIGKGGALARSAGNYA
FT                   QIVGRDQGYVTLRLNSGEQRLVHGQCYATVGAVSNPDHMNISLGKAGRKRWLGRRPHNR
FT                   GVAMNPIDHPHGGGEGRTSGGRHPVTPWGFPTKGKKTRSNKRTDTFIVSSRHNRKK"
FT   gene            complement(420993..421289)
FT                   /locus_tag="M446_0351"
FT   CDS_pept        complement(420993..421289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0351"
FT                   /product="Ribosomal protein L25/L23"
FT                   /note="PFAM: Ribosomal protein L25/L23; KEGG: mex:Mext_2164
FT                   ribosomal protein L25/L23"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14922"
FT                   /db_xref="GOA:B0UHW7"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UHW7"
FT                   /protein_id="ACA14922.1"
FT                   /translation="MSADPRHYDVIVAPVITEKATNLSELNKVVFRVAPKATKPQIKEA
FT                   VERLFEVKVKSVNTLITKGKTKMFRGQRGQRSDVKKAIVTLEEGQTIDVTTGL"
FT   gene            complement(421286..421906)
FT                   /locus_tag="M446_0352"
FT   CDS_pept        complement(421286..421906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0352"
FT                   /product="ribosomal protein L4/L1e"
FT                   /note="PFAM: ribosomal protein L4/L1e; KEGG: mex:Mext_2163
FT                   ribosomal protein L4/L1e"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14923"
FT                   /db_xref="GOA:B0UHW8"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UHW8"
FT                   /protein_id="ACA14923.1"
FT                   /translation="MKFEITTLDGGEAGSVEVNEAIFGLEPRADLLQRCVRWQLAKRQA
FT                   GTHKVKTRSEISRTTKKMYKQKGTGNARHGAASAPQFRGGARAFGPVVRSHAHDLPKKV
FT                   RALALRHALSAKARAASLVVVDDVRLEDGKTKALKDRFGALGWSNALIIGGAEVDENFG
FT                   RAARNLPSIDVLPVQGINVYDILRRDKLVLTRAAVDALEARFK"
FT   gene            complement(421906..422646)
FT                   /locus_tag="M446_0353"
FT   CDS_pept        complement(421906..422646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0353"
FT                   /product="ribosomal protein L3"
FT                   /note="PFAM: ribosomal protein L3; KEGG: mex:Mext_2162
FT                   ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14924"
FT                   /db_xref="GOA:B0UHW9"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UHW9"
FT                   /protein_id="ACA14924.1"
FT                   /translation="MRSGVIAQKVGMTRVFTDAGEHVPVTVLKVDQCQVVAHRTVEKNG
FT                   YVALQVGVGKAKVKNVSKAERGRFAIAKVEPKRKLAEFRVTEDALIPVGAEITADHFIP
FT                   GQFVDVTGTTTGKGFAGGMKRWNFGGLRATHGVSISHRSIGSTGGRQDPGKTFKNKKMP
FT                   GHLGVERVTTQNLRVVRTDPERGLILVEGAVPGVAGGWIQIRDAVKRKLPAEAPMPGKF
FT                   RELADGAAPAVDAAPEAPAVEENA"
FT   gene            complement(422697..423005)
FT                   /locus_tag="M446_0354"
FT   CDS_pept        complement(422697..423005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0354"
FT                   /product="ribosomal protein S10"
FT                   /note="PFAM: ribosomal protein S10; KEGG: rpc:RPC_3449
FT                   ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14925"
FT                   /db_xref="GOA:B0UHX0"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UHX0"
FT                   /protein_id="ACA14925.1"
FT                   /translation="MNGQNIRIRLKAFDHRILDSSTREIVSTAKRTGAQVRGPIPLPTR
FT                   IERFTVNRSPHIDKKSREQFEMRTHKRVLDIVDPTPQTVDALMKLDLAAGVDVEIKL"
FT   gene            complement(423091..424281)
FT                   /locus_tag="M446_0355"
FT   CDS_pept        complement(423091..424281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0355"
FT                   /product="translation elongation factor Tu"
FT                   /note="TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain protein;
FT                   elongation factor Tu domain 2 protein; KEGG: mex:Mext_4392
FT                   translation elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14926"
FT                   /db_xref="GOA:B0UHX1"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:B0UHX1"
FT                   /protein_id="ACA14926.1"
FT                   /translation="MAKEKFSRTKPHCNIGTIGHVDHGKTSLTAAITKVLAEAGGATFT
FT                   AYDQIDKAPEEKARGITISTAHVEYETPNRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVSAADGPMPQTREHILLARQVGVPALVVFMNKVDMVDDPELLDLVELEVRELLSKYDF
FT                   PGDDIPITKGSALCALENREPKIGHDAILELMKTVDEYIPQPERPIDLPFLMPIEDVFS
FT                   ISGRGTVVTGRVERGIIKVGEEVEIVGIRPTTKTTVTGVEMFRKLLDQGQAGDNVGVLL
FT                   RGTKREDVERGQVVCKPGSVKPHTKFKAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDV
FT                   TGVVQLPEGTEMVMPGDNVTMDVTLIVPVAMEEKLRFAIREGGRTVGAGVVASISE"
FT   gene            complement(424391..426466)
FT                   /locus_tag="M446_0356"
FT   CDS_pept        complement(424391..426466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0356"
FT                   /product="translation elongation factor G"
FT                   /note="TIGRFAM: translation elongation factor G; small
FT                   GTP-binding protein; PFAM: elongation factor G domain
FT                   protein; protein synthesis factor GTP-binding; elongation
FT                   factor Tu domain 2 protein; elongation factor G domain IV;
FT                   KEGG: mex:Mext_2159 translation elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14927"
FT                   /db_xref="GOA:B0UHX2"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UHX2"
FT                   /protein_id="ACA14927.1"
FT                   /translation="MPRTHAIEDYRNFGIMAHIDAGKTTTTERILYYTGKSHKIGEVHE
FT                   GAATMDWMEQEQERGITITSAATTCFWRDKRLNIIDTPGHVDFTIEVERSLRVLDGAVC
FT                   VLDGNQGVEPQTETVWRQADKYDVPRVVFVNKMDKIGADFFKCVADIIDRVAGKPVCLQ
FT                   LPIGSENNFRGVIDLIKMKAIVWSGEALGANFSEEAIPADLAEQAAEYRTKLIEACVEM
FT                   DDDAMTAYLDGVEPDEDTMRRLVRTAVQRRAFHPVLCGSAFKNKGVQPLLDAVVDYLPS
FT                   PADRGEIKGIDYKTEEEVVRRPSDAEPFSMLAFKIMDDPHVGTITFCRIYSGKVESGAN
FT                   LLNSTRDKRERVGRMLLMHANNREDIKEAYAGDIVALAGLKDTRTGDTLCDPTKAVILE
FT                   KMEFPEPVIEIAVEPKSKADQEKLGIALSKLAAEDPSFRVSTDPESGQTILKGMGELHL
FT                   DIKVDILKRTYKVEANIGQPQVAYREKLTRRTEIDYTHKKQTGGTGQFARVKLVVEPNE
FT                   PGAGYAFESKIVGGAVPKEYVPGVEKGLNSVLTAGILAGFPVVDIKVELIDGAYHEVDS
FT                   SALAFEIASRAALREALQKGGSVLLEPVMKVEVVTPEDYTGSVIGDLNSRRGQIQGQDM
FT                   RGNANVINAMVPLANMFGYVNQLRSFTQGRANFTMQFDHYEEVPRGEAEKVVAKYA"
FT   gene            complement(426502..426972)
FT                   /locus_tag="M446_0357"
FT   CDS_pept        complement(426502..426972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0357"
FT                   /product="ribosomal protein S7"
FT                   /note="PFAM: ribosomal protein S7; KEGG: mex:Mext_2158
FT                   ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14928"
FT                   /db_xref="GOA:B0UHX3"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UHX3"
FT                   /protein_id="ACA14928.1"
FT                   /translation="MSRRHSAEKREIIPDPKYGDVVLTKFMNSVMYEGKKSVAESIVYG
FT                   AFDIIESRARANPIEVFRAALDNVAPAIEVRSRRVGGATYQVPVEVRHERRQALAIRWL
FT                   IQAARSRNDRTMVERLSAELLDAANNRGAAVKKREDTHRMAEANRAFSHYRW"
FT   gene            complement(427090..427461)
FT                   /locus_tag="M446_0358"
FT   CDS_pept        complement(427090..427461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0358"
FT                   /product="ribosomal protein S12"
FT                   /note="TIGRFAM: ribosomal protein S12; PFAM: ribosomal
FT                   protein S12/S23; KEGG: mex:Mext_2157 ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14929"
FT                   /db_xref="GOA:B0UHX4"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UHX4"
FT                   /protein_id="ACA14929.1"
FT                   /translation="MPTINQLIANPRKIQKSRNKVPALDACPQKRGVCTRVYTTTPKKP
FT                   NSALRKVAKVRLTNGFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHILRGVLDT
FT                   QGVKNRKQRRSKYGAKRPK"
FT   gene            complement(428001..432203)
FT                   /locus_tag="M446_0359"
FT   CDS_pept        complement(428001..432203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0359"
FT                   /product="DNA-directed RNA polymerase, beta' subunit"
FT                   /note="KEGG: mex:Mext_4018 DNA-directed RNA polymerase,
FT                   beta' subunit; TIGRFAM: DNA-directed RNA polymerase, beta'
FT                   subunit; PFAM: RNA polymerase alpha subunit; RNA polymerase
FT                   Rpb1 domain 3; RNA polymerase Rpb1 domain 1; RNA polymerase
FT                   Rpb1 domain 5; RNA polymerase Rpb1 domain 4; SMART: RNA
FT                   polymerase I subunit A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14930"
FT                   /db_xref="GOA:B0UHX5"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UHX5"
FT                   /protein_id="ACA14930.1"
FT                   /translation="MNQEVMNLFNQQAQPQSFDQIKISISSPEKILSWSYGEIKKPETI
FT                   NYRTFKPERDGLFCARIFGPIKDYECLCGKYKRMKYKGVICEKCGVEVTLARVRRDRMG
FT                   HIELAAPVAHIWFLKSLPSRIGLLLDMALKDLERILYFESYVVIEPGLTPLKERQLLSE
FT                   EEYLRAQEEYGEDSFTAMIGAEAIRRILQDLNLEKIAADLRQEIATTTSDLKPKKLLKR
FT                   LKIIEAFQLSGNKPEWMILTVVPVIPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRL
FT                   KRLIELRAPDIIIRNEKRMLQEAVDALFDNGRRGRVITGANKRPLKSLADMLKGKQGRF
FT                   RQNLLGKRVDYSGRSVIVVGPELKLHQCGLPKKMALELFKPFIYARLDAKGFSATVKQA
FT                   KKLVEKEKPEVWDILDEVIREHPVMLNRAPTLHRLGIQAFEPKLIEGKAIQLHPLVCAA
FT                   FNADFDGDQMAVHVPLSLEAQLEARVLMMSTNNILHPANGAPIIVPSQDIVLGLYYLSI
FT                   VADGAPGEYKSNNPLNPMQGVYGDFGELEHALASRAVTLHSKVKWRWKGLGPDGEEVTR
FT                   TYDTTPGRVILSSVLPRHPKVPFDVVNKLMTKKEISAMIDTVYRHCGQKESVIFCDRIM
FT                   GLGFSHAFKAGISFGKDDMVVPENKWTIVDETRALVKDYEQQYQDGLITQGEKYNKVVD
FT                   AWAKCSDRLASEMMNRISSVQKDEKGADKQVNSIYMMSHSGARGSPAQMKQLAAMRGLM
FT                   AKPSGEIIESPIISNFKEGLDVLEYFNSTHGARKGLADTALKTANSGYLTRRLVDVAQD
FT                   AVIREVDCGTDAGIRMRAIIDAGQVVATLATRILGRATAEDLVAQDGSIIVPKGQMIEE
FT                   RHLDAINKAGIQEVKIRSVLVCATKNGVCATCYGRDLARGTPVNQGEAVGVIAAQSIGE
FT                   PGTQLTMRTFHIGGAAQIADSSFIESSFEGTVRIRNRGLARNSDGDLIAIGRNVAVVIV
FT                   GPDGTERAVHRLQYGARVRVDEGDSIKRGQRIAEWDPYTRPILTEVDGIVAYEDLIDGQ
FT                   SITETTDESTGIAKRVVIDWRGSARTADLRPALAIHDQNGKVLKLPRGSDARALLPVEA
FT                   IIGVDPGARVKAGDILARVSTESAKTRDITGGLPRVAELFEARRPKDAAIIAEKSGTIS
FT                   FGRDYKNKRRLSLTPHDGSEPVEYLIPKGKHIHLQDGDVVEVGDFIVDGNPAPHDILAI
FT                   KGVEELAAYLVNEIQEVYRLQGVSINDKHIEVIVRQMLQKVEITDSGDSEILTGDQIDR
FT                   TELQEINEQLVSEGKKPVQGVPVLLGITKASLQTRSFISAASFQETTRVLTEAAVNGKV
FT                   DTLEGLKENVIVGSLIPAGTGAMIADIKSIARRRDELIMAQKTAESGAALQELPAAE"
FT   gene            complement(432387..436511)
FT                   /locus_tag="M446_0360"
FT   CDS_pept        complement(432387..436511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0360"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, beta subunit;
FT                   PFAM: RNA polymerase Rpb2 domain 6; RNA polymerase Rpb2
FT                   domain 7; RNA polymerase Rpb2 domain 2; RNA polymerase beta
FT                   subunit; RNA polymerase Rpb2 domain 3; KEGG: mex:Mext_4017
FT                   DNA-directed RNA polymerase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14931"
FT                   /db_xref="GOA:B0UHX6"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UHX6"
FT                   /protein_id="ACA14931.1"
FT                   /translation="MANTLVGRKRIRKFFGKIREVAEMPNLIEVQKASYDQFLMVDEPE
FT                   GGRPDEGLQSVFKSVFPISDFSSTALLEFVKYTFEAPKYDVDECRQRGITFAAPLKVTL
FT                   RLIVFDVDPDTGAKSVKDIKEQDVYMGDMPLMTENGTFIVNGTERVIVSQMHRSPGVFF
FT                   DHDKGKTHSSGKLLFAARIIPYRGSWLDVEFDAKDIVYARIDRKRKIPVTSLLFALGLD
FT                   GEEILSTFYNRITYARDGRDWRVPYDAERLKGFKATTDLIDADSGEVVLEAGKKLTARA
FT                   ARQIAEKGTKALRATDEDLVGQYIAEDMVNYKTGEIYAEAGDEISEKLLKGLSDVGIEE
FT                   IPVLDIDHVNVGPYIRNTLAVDKNSAREGALFDIYRVMRPGEPPTLDTAEAMFHSLFFD
FT                   AERYDLSAVGRVKMNMRLDLDAPDTMRTLRREDMLAVVKALVDLRDGKGEIDDIDHLGN
FT                   RRVRSVGELMENQYRLGLLRMERAIKERMSSVDIDTVMPQDLINAKPAAAAVREFFGSS
FT                   QLSQFMDQTNPLSEVTHKRRLSALGPGGLTRERAGFEVRDVHPTHYGRICPIETPEGPN
FT                   IGLINSLATFARVNKYGFIETPFRRVRGGVVTDEVVYLSAMEEAKYYVAQASAAMDAER
FT                   RLTEDLVVCRRAGEVIVVAPDRVDLMDVSPKQLVSVAAALIPFLENDDANRALMGSNMQ
FT                   RQAVPLVRADAPFVGTGMEAVVARDSGAAIAARRAGVIDQVDATRIVIRATEETDPTKP
FT                   GVDIYRLQKFQRSNQSTCITQKPLVRVGEVVKKGDIIADGPSTEFGELALGRNVLVAFM
FT                   PWNGYNFEDSILLSERIVKDDVFTSIHIEEFEVMARDTKLGPEEITRDIPNVSEEALKN
FT                   LDEAGIVYIGAEVHAGDILVGKITPKGESPMTPEEKLLRAIFGEKASDVRDTSLRVPPG
FT                   VTGTIVEVRVFNRHGVDKDERAQAIEREEIERLAKDRDDEQAILDRNTYARLADVLVGQ
FT                   SPVAGPKGFKKDTLLTREVLADYPRSQWWQFAVVDDRMMTEIEAMQKQYDESKKRLEQR
FT                   FLDKVEKLQRGDELPPGVMKMVKVFVAVKRKIQPGDKMAGRHGNKGVVSRIVPIEDMPF
FT                   LEDGTHADIVLNPLGVPSRMNVGQILETHLGWAAAGLGRQVAQAVDAYLRNQDAQPLRE
FT                   QMSRIYSPSELEGLSDRELAEVGNNLRRGVPMATPVFNGAKEADIEAMLEMAGLDRSGQ
FT                   STLYDGRTGEPFDRKVTVGYIYMLKLHHLVDDKIHARSIGPYSLVTQQPLGGKAQFGGQ
FT                   RFGEMEVWALEAYGAAYTLQEMLTVKSDDVAGRTKVYEAIVRGDDTFEAGIPESFNVLV
FT                   KEMRSLGLNVELISSKRAANDQLEAPPEAAE"
FT   gene            complement(436811..437191)
FT                   /locus_tag="M446_0361"
FT   CDS_pept        complement(436811..437191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0361"
FT                   /product="ribosomal protein L7/L12"
FT                   /note="TIGRFAM: ribosomal protein L7/L12; PFAM: Ribosomal
FT                   protein L7/L12; KEGG: azc:AZC_0886 ribosomal protein
FT                   L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14932"
FT                   /db_xref="GOA:B0UHX7"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UHX7"
FT                   /protein_id="ACA14932.1"
FT                   /translation="MADLAKLVDDLSSLTVLEAAELAKMLEEKWGVSAAAAVAVAAGPA
FT                   AGGAAAPAAEEQTEFTVVLAAAGDKKIEVIKEVRAITGLGLKEAKDLVEGAPKPVKEGV
FT                   SKDDAAKLKAQLEKAGAKVELK"
FT   gene            complement(437246..437773)
FT                   /locus_tag="M446_0362"
FT   CDS_pept        complement(437246..437773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0362"
FT                   /product="ribosomal protein L10"
FT                   /note="PFAM: ribosomal protein L10; KEGG: mex:Mext_4015
FT                   ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14933"
FT                   /db_xref="GOA:B0UHX8"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UHX8"
FT                   /protein_id="ACA14933.1"
FT                   /translation="MDRAAKADLVASLNEVFSTTSLVVVAHYKGLTVADMQKLRRQMKQ
FT                   AGATVKVAKNRLANIALDGTNVASIKPLLKGPTLLAYSSDPVAAAKVAVDFAKGNDKLV
FT                   ILGGAMGATALNPDGVKALATLPSLDELRAKIVGLVQAPATKIAQVVNAPAAKLARVFG
FT                   AYADTANKDEAA"
FT   gene            complement(438317..440404)
FT                   /locus_tag="M446_0363"
FT   CDS_pept        complement(438317..440404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0363"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: azc:AZC_0726 histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14934"
FT                   /db_xref="GOA:B0UHX9"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:B0UHX9"
FT                   /protein_id="ACA14934.1"
FT                   /translation="MQIKHRLNAILALFVIIVIALCGRSLHESWRRWSLAEEVSRLASV
FT                   DRALLDTLSAMRFEGGALSAALRIEVDQAASLRSEAAERRAALEAALPPALARLEEVEH
FT                   PAIRAAAEAVRAVMAEWRRLRQESDAALARPLAERDREVIGRVMAGRDRFVAAGEALLV
FT                   AVEAEIRAEDPTLSDLILGRTMSWAARSLSGSANVQINELLTQKRPMTPTEQQSINALF
FT                   RVSDFAFAAAREIGTRTGMAPALRAAIADADAGYYKGAYQDTLRRIQEVLASPDLPRPS
FT                   VAEWRKGSTPALNTIGAVPTAFVVELDEAAARAARSATQNLAVFAGLLVLSVLLAVCGI
FT                   AFIARGIIRPLSAMTVAAERLAQGDTAVAVPGGGRRDEIGALAAAVQVFKDNLLRSRVL
FT                   EEEAALARAGAEAQRRAATHEMAEGFERAVSGIVRAVSRSASELQATARTMTATASQTA
FT                   VQSASVAAAAEQAASNVGTVAAAAEELGASVQEIGRQVAGSTQLARTAVAEAGTTAGVV
FT                   EDLAGAAAKIGEAVSLITTIAGQTNLLALNATIEAARAGEAGRGFAVVAAEVKELANQT
FT                   AKATEEISAQVGRIQASTRQAVGAIGGIGSRIREISDVATSIAAAVEEQGAATQEIVRN
FT                   ITQAATGTGEVTGNIASVAGAAEETGAAANHVLAAASALSEESDHLAAEVRRFLETVRA
FT                   A"
FT   gene            complement(440727..442358)
FT                   /locus_tag="M446_0364"
FT   CDS_pept        complement(440727..442358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0364"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: cobalamin B12-binding domain protein; Radical
FT                   SAM domain protein; SMART: Elongator protein 3/MiaB/NifB;
FT                   KEGG: mex:Mext_4012 radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14935"
FT                   /db_xref="GOA:B0UHY0"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR025274"
FT                   /db_xref="InterPro:IPR034530"
FT                   /db_xref="UniProtKB/TrEMBL:B0UHY0"
FT                   /protein_id="ACA14935.1"
FT                   /translation="MRSTVPVSSTRRILCVFPAYTPSFGTFQHAYPLMGGVKAFMPPQG
FT                   LLLIAAYLPEAWQVRFVDENIAPAAPEDFAWADAVFVSGMHVQAPQIRDIGERAHAAGR
FT                   VAVLGGPSVSGAPEQYPDFDYLHIGEIGDATDELIRRLDADVARPPAQLRLETGERLGL
FT                   SDFPAPAYAQVPLRRYLIGSLQFSSGCPYRCEFCDIPALYGRQPRLKTPEQLLAELDAI
FT                   VAQPGHPAVVYFVDDNFIGNRKATREMLPHLVAWQKRKGYPLQFACEATLNMAKQPEIL
FT                   ALMREANFVTVFVGIETPELDALKVIDKTHNAAVPMLEGIATLNSYGLEVTSGIILGLD
FT                   TETAESEEKLVAFIDRSGVPVLTMNLLQALPRTPLWDRLAKEGRLVDDPRLESNVRFLR
FT                   PHDEVVASWRRAIAHAYAPERLFDRFRHQIDVTYVNRVPIPARNRLTRDNLRRALVMGF
FT                   NIAVRVGLLSDYRRAFWRAAGYALRRGQVEAVFNMGFVAHHLIRFTREALEGKQNASFY
FT                   ATRPVERSKEGAVGWWRRTRSERKPA"
FT   gene            complement(442582..443289)
FT                   /locus_tag="M446_0365"
FT   CDS_pept        complement(442582..443289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0365"
FT                   /product="ribosomal protein L1"
FT                   /note="PFAM: ribosomal protein L1; KEGG: mex:Mext_3999
FT                   ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14936"
FT                   /db_xref="GOA:B0UHY1"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UHY1"
FT                   /protein_id="ACA14936.1"
FT                   /translation="MAREGKRIRAAREGIDPTKVYSLTDAVKMIKDRSKAKFDETFEIS
FT                   MNLGVDPRHADQMVRGVCNLPNGSGRTVRVAVFARGAKADEARAAGADIVGAEDLLETI
FT                   QGGTIDFDRCIATPDMMPLVGRLGKVLGPRGLMPNPKVGTVTMDVKGAVGAAKGGAVEF
FT                   RVEKAGIVHAGIGKVSFDDQKIVENARAFADAVARAKPTGAKGTYIQRIAVSSTMGPGI
FT                   KVDPASVLAAQSA"
FT   gene            complement(443302..443751)
FT                   /locus_tag="M446_0366"
FT   CDS_pept        complement(443302..443751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0366"
FT                   /product="ribosomal protein L11"
FT                   /note="PFAM: ribosomal protein L11; KEGG: mex:Mext_3998
FT                   ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14937"
FT                   /db_xref="GOA:B0UHY2"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UHY2"
FT                   /protein_id="ACA14937.1"
FT                   /translation="MAKKITGYVKLQVPAGAANPSPPIGPALGQRGLNIMEFCKAFNAK
FT                   TAQIEKGTPIPVIITAYQDRSFTFEMKQPPVSFFLKKAAGMKIGKKPASGSKTPGKGAP
FT                   AGRISEAQIREIAEKKMPDLNCDSVDSAVAMIRGSARAMGLEITG"
FT   gene            complement(443968..444501)
FT                   /locus_tag="M446_0367"
FT   CDS_pept        complement(443968..444501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0367"
FT                   /product="NusG antitermination factor"
FT                   /note="TIGRFAM: transcription termination/antitermination
FT                   factor NusG; PFAM: KOW domain protein; NGN domain protein;
FT                   KEGG: mex:Mext_3997 transcription
FT                   termination/antitermination factor NusG"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14938"
FT                   /db_xref="GOA:B0UHY3"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:B0UHY3"
FT                   /protein_id="ACA14938.1"
FT                   /translation="MSKRWYIVHAYSNFENKVAQSIKDQAAQRGLLDKFDEVMVPTEKV
FT                   VEVRRGRKVDAERKFFPGYVLVKCDLTDEVYHLIKNTPKVTGFLGADKSKPVPIPDAEA
FT                   ERIKGQVQEGTERPKASISFEVGESVRVADGPFASFNGVVEEVDESRSRLKVAVSIFGR
FT                   ATPVELEYGQVEKV"
FT   gene            complement(444535..444840)
FT                   /locus_tag="M446_0368"
FT   CDS_pept        complement(444535..444840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0368"
FT                   /product="preprotein translocase, SecE subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecE subunit; PFAM:
FT                   protein secE/sec61-gamma protein; KEGG: mex:Mext_3996
FT                   preprotein translocase, SecE subunit"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14939"
FT                   /db_xref="GOA:B0UHY4"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:B0UHY4"
FT                   /protein_id="ACA14939.1"
FT                   /translation="MASNEATKKVDLGRNATRGTPVPRGAGPTPPPVRPAPKRVGPFEF
FT                   LQQVRDEGRKVTWPTRKETLITTLMVFVMVVLASLFFVVVDQVLRYLVTLVLGIGA"
FT   gene            complement(445054..445130)
FT                   /locus_tag="M446_R0003"
FT                   /note="tRNA-Trp1"
FT   tRNA            complement(445054..445130)
FT                   /locus_tag="M446_R0003"
FT                   /product="tRNA-Trp"
FT   gene            complement(445276..446694)
FT                   /pseudo
FT                   /locus_tag="M446_0369"
FT   gene            447114..448796
FT                   /locus_tag="M446_0370"
FT   CDS_pept        447114..448796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0370"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: mex:Mext_2555
FT                   chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14940"
FT                   /db_xref="GOA:B0UJ90"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:B0UJ90"
FT                   /protein_id="ACA14940.1"
FT                   /translation="MLNQISIRIKMIFCASTMLLLTIATAWLANHQMSVLNEAASDLRL
FT                   NVLQATQALGQVQAQALRVRINGSRLLSARTPEQQRDAATSMQQRYRELAAAEENFRRL
FT                   ALAEAASLFDTYTRQWKAYLDLQAEAVATLERGDAAAAMELYNGRMSDAIRAVIATLVK
FT                   LVELNTASAAASGDAMTSTFDNAQIQLMGFIMVAALMAAGAAAMMILAVSRPLGRMTAT
FT                   MHRLAAGDTATEIAGLDRRDEIGEMSRAVQVFRDGMIRAAELEAQTARARAEAEDQRRA
FT                   GMREMAAGFEAMVGGIVASVTTAAAELQATARTMSVTAGETASQSTSAAAAAEEASSNV
FT                   RTVAAAAEELGSSVQEIGRQVDGAAELAQAAAAEADQTATMVQDLSRAASQIGDVVSLI
FT                   STIAGQTNLLALNATIEAARAGEAGRGFAVVAAEVKELANQTARATEGISGQIGAIQTS
FT                   TNQAVGAIGGIVRRIQEIRTVAMGIAASVEEQGATTQEIARNVAEAASGTGEVTSHVGS
FT                   VAQAAERTGAAAGQVLDAASSLSRQSQQLDAEVARFLASVRAA"
FT   sig_peptide     447114..447194
FT                   /locus_tag="M446_0370"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.529 at
FT                   residue 27"
FT   gene            complement(448916..450106)
FT                   /locus_tag="M446_0371"
FT   CDS_pept        complement(448916..450106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0371"
FT                   /product="translation elongation factor Tu"
FT                   /note="TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain protein;
FT                   elongation factor Tu domain 2 protein; KEGG: mex:Mext_4392
FT                   translation elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14941"
FT                   /db_xref="GOA:B0UHX1"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:B0UHX1"
FT                   /protein_id="ACA14941.1"
FT                   /translation="MAKEKFSRTKPHCNIGTIGHVDHGKTSLTAAITKVLAEAGGATFT
FT                   AYDQIDKAPEEKARGITISTAHVEYETPNRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVSAADGPMPQTREHILLARQVGVPALVVFMNKVDMVDDPELLDLVELEVRELLSKYDF
FT                   PGDDIPITKGSALCALENREPKIGHDAILELMKTVDEYIPQPERPIDLPFLMPIEDVFS
FT                   ISGRGTVVTGRVERGIIKVGEEVEIVGIRPTTKTTVTGVEMFRKLLDQGQAGDNVGVLL
FT                   RGTKREDVERGQVVCKPGSVKPHTKFKAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDV
FT                   TGVVQLPEGTEMVMPGDNVTMDVTLIVPVAMEEKLRFAIREGGRTVGAGVVASISE"
FT   gene            450314..450598
FT                   /locus_tag="M446_0372"
FT   CDS_pept        450314..450598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0372"
FT                   /product="acylphosphatase"
FT                   /note="PFAM: acylphosphatase; KEGG: mex:Mext_2998
FT                   acylphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14942"
FT                   /db_xref="GOA:B0UJ92"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="InterPro:IPR020456"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="UniProtKB/TrEMBL:B0UJ92"
FT                   /protein_id="ACA14942.1"
FT                   /translation="MMGGDRTVRAAIRGRVQGVGFRAWTRDEATRLGLSGHVRNCPDGS
FT                   VEALLSGPAEAVGQMLAALRRGPAGARVSEVAVEASPETAPSGFAIRRG"
FT   gene            450611..451306
FT                   /locus_tag="M446_0373"
FT   CDS_pept        450611..451306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0373"
FT                   /product="protein of unknown function DUF599"
FT                   /note="PFAM: protein of unknown function DUF599; KEGG:
FT                   mex:Mext_2999 protein of unknown function DUF599"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14943"
FT                   /db_xref="GOA:B0UJ93"
FT                   /db_xref="InterPro:IPR006747"
FT                   /db_xref="UniProtKB/TrEMBL:B0UJ93"
FT                   /protein_id="ACA14943.1"
FT                   /translation="MGDFSLLDLAAVVSFAVAWIGYGVAVERLSRGRNSLNRMMNLYRH
FT                   TWTEQLELRENRVVDTTINASLQNGTAFFASTSLIALGSVLTLTRSADDVLTLFSTLPF
FT                   GMQTTRTTWEIKVAGLAVIFVYAFFKFAWAYRLFNYGAILIGAVPPRGGDPDAIRHAAK
FT                   RAATMNVVAGAHFNRGQRAWFFALAYLGWFVSPYILFATTAAVVYVMWKRQFASEACRA
FT                   LQEPDDTAP"
FT   gene            451290..451559
FT                   /locus_tag="M446_0374"
FT   CDS_pept        451290..451559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0374"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mex:Mext_3000 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14944"
FT                   /db_xref="InterPro:IPR021660"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0UJ94"
FT                   /protein_id="ACA14944.1"
FT                   /translation="MTPHPDEAAIAETLLRLVAERGPDKTICPSEVARALGGPHPDGWS
FT                   PLMQPVRRQAVRLMKEGRIAILRKGRVVPDPDAFRGVYRLSLPR"
FT   gene            complement(451619..452323)
FT                   /locus_tag="M446_0375"
FT   CDS_pept        complement(451619..452323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0375"
FT                   /product="Dimethylmenaquinone methyltransferase"
FT                   /note="PFAM: Dimethylmenaquinone methyltransferase; KEGG:
FT                   mes:Meso_3140 dimethylmenaquinone methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14945"
FT                   /db_xref="GOA:B0UJ95"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:B0UJ95"
FT                   /protein_id="ACA14945.1"
FT                   /translation="MPLDKTLIDALQAVTTATLTTVMLKKGLRRCWMKGPQPRFAANAR
FT                   IVGPAFTLRFVPAREDLATPESWSSPTSTRGAIEAMPEGCIAVVDAMGVTEAGIFGDIL
FT                   AARMHKRGVAALVTDGVMRDGEGVAGTGLPVWCAGVAAPASVAGLTFVGWNQPIGCGGV
FT                   AVFPDDVIVADGDGAVVIPAAIAQEVALAAVEQERLELWIMREVEKGLPLPGLYPPNAE
FT                   TRARYEAETAAK"
FT   gene            complement(452419..453060)
FT                   /locus_tag="M446_0376"
FT   CDS_pept        complement(452419..453060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0376"
FT                   /product="Glutathione S-transferase domain"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   mex:Mext_3002 glutathione S-transferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14946"
FT                   /db_xref="GOA:B0UJ96"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:B0UJ96"
FT                   /protein_id="ACA14946.1"
FT                   /translation="MRRLWGRLSSVNVQKAVWALEELGLACERVEAGGAFGRVRDPDYL
FT                   ALNPNGLVPVLEEDGYVLWESNAILRYLAEAHGPAAAARGGVALMPEEERARGHVHQWL
FT                   DWQATTFTPAMRDAFWQTVRLPAEGRDPDLIARSVAAGEAAAAILDAHLAGRPFAVGDA
FT                   FTAADIALGCAAHRWLHLAVPREPRPNLQAWYARVAARPAAAKVLTVPIT"
FT   gene            complement(453036..454106)
FT                   /locus_tag="M446_0377"
FT   CDS_pept        complement(453036..454106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0377"
FT                   /product="lysine 2,3-aminomutase YodO family protein"
FT                   /EC_number="5.4.3.2"
FT                   /note="KEGG: mex:Mext_3003 lysine 2,3-aminomutase YodO
FT                   family protein; TIGRFAM: lysine 2,3-aminomutase YodO family
FT                   protein; PFAM: Radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14947"
FT                   /db_xref="GOA:B0UJ97"
FT                   /db_xref="InterPro:IPR003739"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022447"
FT                   /db_xref="InterPro:IPR025895"
FT                   /db_xref="UniProtKB/TrEMBL:B0UJ97"
FT                   /protein_id="ACA14947.1"
FT                   /translation="MSRRTLRDPASLVEAGLVPRAALPALERVASRYAVAVTPAMADLI
FT                   ETPEDGIGRQFLPRAEELDAAPGERADPIGDAAHAPLPGIVHRYPDRVLLKPLHVCPVY
FT                   CRFCFRREVVGPDGMGALSEAQLDAALAYVAARPEIWEVVVTGGDPFLLSPRRLERIGA
FT                   ALAATDHVRVLRLHTRVPAVEPERVDAALVAALKRFGRAVFVALHANHPGEFTPAARAA
FT                   IARLVDAGIPLVSQSVLLRGVNDDPETLAALMRAFVENRVKPYYLHHGDLAPGTGHFRT
FT                   SLPVGQALMRGLRGRVSGLCQPTYVLDIPGGHGKVPVGPAYLEPRPGGFTVTDPEGRAH
FT                   AYPPEGDERCADSGDG"
FT   gene            complement(454103..455155)
FT                   /locus_tag="M446_0378"
FT   CDS_pept        complement(454103..455155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0378"
FT                   /product="Lysine--tRNA ligase"
FT                   /EC_number="6.1.1.6"
FT                   /note="PFAM: tRNA synthetase class II (D K and N); KEGG:
FT                   mlo:mlr8260 lysyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14948"
FT                   /db_xref="GOA:B0UJ98"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004525"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/TrEMBL:B0UJ98"
FT                   /protein_id="ACA14948.1"
FT                   /translation="MTSASPWWAPHVHADRRPRLLARNRIKAALRAWFAERGFVEVETA
FT                   ALQVSPGNETHLSAFATRAIGPDGRGQPLYLHTSPEFACKKLLAAGERRLVVFAPVYRN
FT                   RERGPLHHPEFTLVEWYRAGDGCEALMRDCAALLARAAEAAGAERLRYRDREADPFAQP
FT                   ERLTVAEAFARHAGIDLLATVAPDGATDREGLRAAVTASGIRTAPDDTWADLFSRVLVE
FT                   RIEPHLGLGRATILCDYPIPEAALARPSPADPRVAERFELYACGVELANGFGELTDADE
FT                   QRRRFAAEMDEKERIYGERYPVDEDFLAALARMPEASGIALGFDRLVMLATGARRIEEV
FT                   IWTPVAEPGR"
FT   gene            455287..455853
FT                   /locus_tag="M446_0379"
FT   CDS_pept        455287..455853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0379"
FT                   /product="translation elongation factor P"
FT                   /note="TIGRFAM: translation elongation factor P; PFAM:
FT                   Elongation factor P/YeiP protein; Elongation factor KOW
FT                   domain protein; Elongation factor P; KEGG: mex:Mext_3005
FT                   translation elongation factor P"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14949"
FT                   /db_xref="GOA:B0UJ99"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UJ99"
FT                   /protein_id="ACA14949.1"
FT                   /translation="MKVIASSLRKGNVVEKDGRLYVILSAENIHPGKGTPVTQLDMRRI
FT                   TDGVKVSERYRTTEQVERAFVEDREHTFLYKDGEGSHFMNPESYEQVAVPDDVIGDQAA
FT                   YLQEGMAVMLSLHNGVPLAIELPQRVTLEIVETEPVTKGQTASSSYKPAVLSNGVRTLV
FT                   PPHITTGTRVVIMTADGSYVERAKD"
FT   gene            complement(455864..456874)
FT                   /locus_tag="M446_0380"
FT   CDS_pept        complement(455864..456874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0380"
FT                   /product="protein of unknown function DUF1624"
FT                   /note="PFAM: protein of unknown function DUF1624; KEGG:
FT                   mex:Mext_3006 protein of unknown function DUF1624"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14950"
FT                   /db_xref="GOA:B0UJA0"
FT                   /db_xref="InterPro:IPR012429"
FT                   /db_xref="UniProtKB/TrEMBL:B0UJA0"
FT                   /protein_id="ACA14950.1"
FT                   /translation="MPRFPVAALRRLLAAPAAGRLAVIDAARGAALAAMALYHATWDLG
FT                   FLRLTPENLALTPPGRAAAHAIAGSFLVLAGVSLVLAQGKVFRPGPFLGRLARIGAAAA
FT                   GISLATRILFPESWIFFGVLHCIALSSLLALPALRLPPWLVAAASAAILAAPALLDAPA
FT                   LAAPWVLPAPLLLVLGLAPEVPATNDYVPMIPWFGCVLAGVALGRIARPRLAASRLGAW
FT                   RPASRGARLLAGAGRRSLGIYLLHQPLLLALLSGVAALTGPHPRAGEAGFRRDYAQTCA
FT                   VAGGSPARCRAAARCLLGRLREDGLWQAAGQGALSPAQQARAVALSQSCYDGAAE"
FT   gene            457190..457804
FT                   /locus_tag="M446_0381"
FT   CDS_pept        457190..457804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0381"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="PFAM: Cold-shock protein DNA-binding; SMART: Cold
FT                   shock protein; KEGG: mex:Mext_3007 cold-shock protein
FT                   DNA-binding"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14951"
FT                   /db_xref="GOA:B0UJA1"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:B0UJA1"
FT                   /protein_id="ACA14951.1"
FT                   /translation="MSDEVGSGPLGPRPGSTFEASAKRAADGEADAPLDLVEISGRIKW
FT                   FDVAKGFGFIVPDSGAPDVLLHVTCLRRDGHQSASEGARIVVEAVQRARGWQAFRVVSL
FT                   DQSTATHPAELPMPRTHVTVVPTSGLETAVVKWFNRLRGFGFLSRGEGTPDIFVHMETL
FT                   RRYGIAELKPGERVMVRYGDGSKGLMAAEVRLADGSLPASH"
FT   gene            457815..458291
FT                   /locus_tag="M446_0382"
FT   CDS_pept        457815..458291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0382"
FT                   /product="protein of unknown function DUF192"
FT                   /note="PFAM: protein of unknown function DUF192; KEGG:
FT                   mex:Mext_3008 protein of unknown function DUF192"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14952"
FT                   /db_xref="InterPro:IPR003795"
FT                   /db_xref="InterPro:IPR038695"
FT                   /db_xref="UniProtKB/TrEMBL:B0UJA2"
FT                   /protein_id="ACA14952.1"
FT                   /translation="MSLRFTRPHTAAALAALAFVLTLLAAPVRAEGPTEPLSIVSRSGR
FT                   HAFQVEVMRDDAGRAQGLMFRRSMAPDHGMLFDFAQVAPVTMWMKNTYLPLDMLFIRAD
FT                   GTVSRIAADTEPLSTRVIPSGGPILAVLELNAGTAAKLGIRAGDKVEHPLFRGR"
FT   sig_peptide     457815..457907
FT                   /locus_tag="M446_0382"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.924 at
FT                   residue 31"
FT   gene            458838..460517
FT                   /locus_tag="M446_0383"
FT   CDS_pept        458838..460517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0383"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: mex:Mext_3147
FT                   chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14953"
FT                   /db_xref="GOA:B0UJA3"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:B0UJA3"
FT                   /protein_id="ACA14953.1"
FT                   /translation="MQLSIGKKLSLAAALGITLVSGLVANQWASAQRIAAANAAAGREQ
FT                   VILDGIQQARLSHAQIRSAAQDILAAETAGQLAQATDQIRASRNAGVAALDEPIRIALL
FT                   PDVLRELQTSLASFADLATAGAAAIRFEDGSRRLDANRLAQLAAERQRVGLKLEQAGNA
FT                   SVTNAQRFATEARLNTAATVESANLIGLAVGGTVILVLIGSAVFSARFVARPVRDLSAC
FT                   LGTLAAGDLQVAVPFTGRGDELGAMAAAVQVFKETMQRARALEEETALARAGAEEQRRA
FT                   TMRTMAERFESAMSGIIGAVTAAAADLRGTAEAMAGTASETAAQSATVASAAQQAASNV
FT                   GTVAAASEELGSSIAEIGRQVQSSATLSRSAVEESRQSAALVQELSAAARIGDVVAMIT
FT                   TIAGQTNLLALNATIEAARAGEAGRGFAVVAAEVKELANQTAKATDEIGSQIGRIQTST
FT                   GEAVAAIDAISSRIREISGVASGIAAAVEQQGAATQEIVRNVTQAAAGTGEVTANITGV
FT                   AHAAEATGEAANRVLASASTLSQQSAQLSHEVGRFLETLRAA"
FT   sig_peptide     458838..458918
FT                   /locus_tag="M446_0383"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.339 at
FT                   residue 27"
FT   gene            complement(460532..460948)
FT                   /locus_tag="M446_0384"
FT   CDS_pept        complement(460532..460948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0384"
FT                   /product="AIG2 family protein"
FT                   /note="PFAM: AIG2 family protein; KEGG: mex:Mext_2997 AIG2
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14954"
FT                   /db_xref="GOA:B0UJA4"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR017939"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="UniProtKB/TrEMBL:B0UJA4"
FT                   /protein_id="ACA14954.1"
FT                   /translation="MPLYFAYGSNMDRAAMARRCPASTPRGIGRLHRHRLVIMREGYAS
FT                   VTRDPGATVWGLVWDLALSDVPALDRYEGVASGLYVKAQQPVVTGEGVRRALIYLGRGQ
FT                   GGVPRPGYLEGVIAAARQAGLPESYCRGLAALGR"
FT   gene            complement(460962..462977)
FT                   /locus_tag="M446_0385"
FT   CDS_pept        complement(460962..462977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0385"
FT                   /product="Carbamoyl-phosphate synthase L chain ATP-binding"
FT                   /note="PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; ATP-dependent carboxylate-amine ligase domain
FT                   protein ATP-grasp; Carbamoyl-phosphate synthase L chain
FT                   ATP-binding; Carbamoyl-phosphate synthetase large chain
FT                   domain protein; biotin carboxylase domain protein; RimK
FT                   domain protein ATP-grasp; KEGG: mex:Mext_2996
FT                   carbamoyl-phosphate synthase L chain ATP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14955"
FT                   /db_xref="GOA:B0UJA5"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR041265"
FT                   /db_xref="UniProtKB/TrEMBL:B0UJA5"
FT                   /protein_id="ACA14955.1"
FT                   /translation="MFDKILIANRGEIACRIIKTARRMGIKTVAVYSDADRDAVHVAMA
FT                   DEAVAIGPAPAAQSYLVIEKIIAACRQTGAQAVHPGYGFLSEREAFPKALAEAGIVFIG
FT                   PNPGAIAAMGDKIESKKAASAAEVSTVPGFLGVIEDPAHAVRIADEIGYPVMIKASAGG
FT                   GGKGMRIAHSAEEVAEGFARARSEAASSFGDDRVFVEKFITDPRHIEIQVIGDKHGNVI
FT                   YLGERECSIQRRNQKVIEEAPSPLLDEATRRKMGEQAVALAKAVNYDSAGTVEFVAGQD
FT                   KSFYFLEMNTRLQVEHPVTEMITGLDLVELMIRVAAGERLPLSQADVKLNGWAVESRVY
FT                   AEDPTRNFLPSIGRLTTYRPPAEGALGAATIRNDTGVEEGSEIAIHYDPMIAKLVSWAP
FT                   TRAEAIGAQAQALDAFAIDGIRHNIPFLSALMQHPRWQEGRLSTGFIAEEFPGGFEAPR
FT                   PAGKVALRMAAVAAAIDHMLNERKRGISGQMRDPGHLRFERDRVVWLGDQRFEATVETS
FT                   AAAPVGATAVAFADGTTWPLESDWRPGDPVWTGTIGGARAAVQVRPLLNGVFLQHAGAA
FT                   AEARVYTRREAELAALMPVKEVGGSGKQLLCPMPGLVKSIMVAPGQEVKAGEPLAIVEA
FT                   MKMENVLRAERDATVQTIQAKEGDSLAVDAVILEFA"
FT   gene            complement(463131..463571)
FT                   /locus_tag="M446_0386"
FT   CDS_pept        complement(463131..463571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0386"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mex:Mext_2995 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14956"
FT                   /db_xref="UniProtKB/TrEMBL:B0UJA6"
FT                   /protein_id="ACA14956.1"
FT                   /translation="MIKFSLQDFCNRMVAKGEIGPGDVRELARTILPEGLGSREEADML
FT                   IALDRAVPGADADFADFLVSAVVDLAVWGERPTGYVDAETARWLCASLCCGTGPTATGA
FT                   RIAVEVVREAHSADPALVAFALSANRLRALAEEPAPRPALAA"
FT   gene            complement(463733..464317)
FT                   /locus_tag="M446_0387"
FT   CDS_pept        complement(463733..464317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0387"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   bja:blr4219 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14957"
FT                   /db_xref="GOA:B0UJA7"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:B0UJA7"
FT                   /protein_id="ACA14957.1"
FT                   /translation="MRRPVPALVLTAALLSGCSYKSIPDPTLSAQDAAWMAMVPDGETD
FT                   PRFARYLIDDPTGEPPGTIVVETRERQLYFVLPERKAIRYGVTVGDEAYGWTGTARVFR
FT                   KAAWPDWNPPAEMVRRWPHVHPMKGGPANPLGARALYLADGARDTLYRIHGTNEPERIG
FT                   QAASSGCIRMRNIDVVDLSNRVASDAKVIVR"
FT   sig_peptide     complement(464252..464317)
FT                   /locus_tag="M446_0387"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.931) with cleavage site probability 0.789 at
FT                   residue 22"
FT   gene            464510..465439
FT                   /locus_tag="M446_0388"
FT   CDS_pept        464510..465439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0388"
FT                   /product="histone deacetylase superfamily"
FT                   /note="PFAM: histone deacetylase superfamily; KEGG:
FT                   mex:Mext_2993 histone deacetylase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14958"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:B0UJA8"
FT                   /protein_id="ACA14958.1"
FT                   /translation="MTTLYLCHPASLDHATPHGHPERAERIRAIERALEDERFSALVRE
FT                   QAPRAELSVATLAHPEEYVAAIAEASPREGLVAIDSDTVMSPGTLEAVLRSLGAAVQAV
FT                   DEVMSGKVANAFAAMRPPGHHAERRRAMGFCFFNQAAVAARHARKAYGAERVALVDWDV
FT                   HHGNGSQDIFWRDKSVLYCSTHQMPLYPGTGATSERGDHDTIVNAPLRPGDDGERFREA
FT                   FETAILPRIDAFHPDLIVISAGFDAHWRDPLANLQLTEADFAWTTRRLMDLADRHAGGR
FT                   VVSVLEGGYDLDGLSRSVAAHVEALMGR"
FT   gene            complement(465523..466455)
FT                   /locus_tag="M446_0389"
FT   CDS_pept        complement(465523..466455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0389"
FT                   /product="Auxin Efflux Carrier"
FT                   /note="PFAM: Auxin Efflux Carrier; KEGG: rso:RSc1095
FT                   probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14959"
FT                   /db_xref="GOA:B0UJA9"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B0UJA9"
FT                   /protein_id="ACA14959.1"
FT                   /translation="MIGTVLLALLPIALLIGLGAGLRRTGFLAESFWPQAERLGYYLLL
FT                   PALFVHGLATARLDGVPVAGLAAVLVASTLAVAALLVALRPLLGGSGAAFTSVFQGGVR
FT                   FNNYVGVSAAAGLFGAQGVALAAVANAAIVPTVNVLCVLVFARFGAGGRPRPLALARQL
FT                   ALNPLLAACLIGIALQATGLGLPPGLDALLRSLGQASLPLGLLCVGAALDLSAARAWLR
FT                   PVLVASAAKFVLMPAATLMACRITGLQGSAAATALLFQALPTASSSYILARQLGGDAPL
FT                   MAGITAAQTVLAGAAIPLVLLGLLGLVGF"
FT   gene            complement(466524..466733)
FT                   /pseudo
FT                   /locus_tag="M446_0390"
FT   gene            complement(466916..468220)
FT                   /locus_tag="M446_0391"
FT   CDS_pept        complement(466916..468220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0391"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /note="TIGRFAM: 3,4-dihydroxy-2-butanone 4-phosphate
FT                   synthase; PFAM: 34-dihydroxy-2-butanone 4-phosphate
FT                   synthase; GTP cyclohydrolase II; KEGG: mex:Mext_2991
FT                   3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14960"
FT                   /db_xref="GOA:B0UJB0"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:B0UJB0"
FT                   /protein_id="ACA14960.1"
FT                   /translation="MVRPVKLGDWLRQQGVSRTTFARRCGLSPAAVTGLCNNPGAWLSR
FT                   ETAALVARETGGAVTPNDFLGLSPPRQEMPMPHASVVETIEAFARGEIVVVTDDDDREN
FT                   EGDLVVAASLCTPEKMAFIIRNTCGIVCAPITGPEAKRLRLEPMVASNDAPLGTAFTVT
FT                   VDVKHGLTTGISAEQRCNTVRALANGNMGAADFVRPGHVFPLIARDGGVLMRSGHTEAA
FT                   VDLCRLAKLPPVGVICELANDDGTVMKGPQIEAFAEAHGLRRISVADLIAYRQAREKLV
FT                   ERVGTFPVKTEWGTLTGYAYTTPFDPMQQFAFVHGRIGDGRDTLVRLHRSNVVADVIEG
FT                   GRAIACVMRRFAQEGRGVLVYLRDGTAGVPPTTFREEQTEAEAARVRQWREIGLGAQIL
FT                   RDLGVVSIRNLATASRSYVGLSGFGIELLGDEPLE"
FT   gene            complement(468264..469436)
FT                   /locus_tag="M446_0392"
FT   CDS_pept        complement(468264..469436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0392"
FT                   /product="Chorismate synthase"
FT                   /EC_number="4.2.3.5"
FT                   /note="PFAM: chorismate synthase; KEGG: mex:Mext_2990
FT                   chorismate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14961"
FT                   /db_xref="GOA:B0UJB1"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UJB1"
FT                   /protein_id="ACA14961.1"
FT                   /translation="MSHNSFGHLFRVTTFGESHGPALGCVVDGCPPLIPLDAAEIQAEL
FT                   DRRRPGQSRFTTQRREPDAVRILSGVFADDRTGGRQLTTGTPIALMIENVDQRSKDYSD
FT                   IRDTYRPGHADYTYEAKYGIRDYRGGGRSSARETAARVAAGAIARKVLPGVTIRGALVQ
FT                   MGPHAIDRARFDWAEVGNNPFFCPDAEAAARWAEVLDGVRKDGSSLGAVIEVVAEGVPP
FT                   GLGAPVYGKLDADLAAAMMSINAVKGVEIGDGFAAAALRGEENADEMRPGHGGAPSFLA
FT                   NHAGGILGGISTGQAVVCRFAVKPTSSILTPRASVTRDNRPTDVLTRGRHDPCVGIRAV
FT                   PVGEAMMACVLADHVLRHRGQVGAHPAGAHPAGADPAGTHPGGPGGFQPG"
FT   gene            470202..473480
FT                   /locus_tag="M446_0393"
FT   CDS_pept        470202..473480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0393"
FT                   /product="ribonuclease, Rne/Rng family"
FT                   /note="TIGRFAM: ribonuclease, Rne/Rng family; KEGG:
FT                   mex:Mext_3659 ribonuclease, Rne/Rng family"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14962"
FT                   /db_xref="GOA:B0UJB2"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR028878"
FT                   /db_xref="UniProtKB/TrEMBL:B0UJB2"
FT                   /protein_id="ACA14962.1"
FT                   /translation="MANKMLIDASHPEETRVVTVKGSKVEEFDFEAANRRQLRGNIYLA
FT                   KVTRVEPSLQAAFVEYGGNRHGFLAFSEIHPDYYQIPVADRLALLEEDARAEREQEERP
FT                   ERNERASDDRRRRRRRGRRAEAASAKADPVVSAPAEGLEVEGLEVEGGEDPAAETASAP
FT                   AGEARGEPVAEAAPGDAAPGSEGAAAAPEAPEPAPAEPAAVTADAPAAADQAAAPTATS
FT                   AADQAAAPTATSAADQAAAPTATSAADQAAAPTATSAADQAAAPAAEVAPEPDAAPAAE
FT                   AAPPAETLAAIDTAPTDQAAEAAPETAAETAPGSDDATDADEDEDEDDADEHDEEADEA
FT                   HAEAAHADEHDSEDEDEDEDEEGDDEDGEDEGEGDEEEPVVEQVGGRGDALAEIPDRPR
FT                   APRRHYKIQEVIKRRQVILVQVVKEERGNKGAALTTYLSLAGRYSVLMPNTGRGGGISR
FT                   KITSAADRKRLKEIAADLEVPDGMGVILRTAGASRTKPEIKRDFEYLMRLWESVRELTL
FT                   SSSAPALVYEEGSLIKRAIRDLYNKDIDEVLVAGDDAYREAKDFMRMLMPSQSKVVKPY
FT                   RDPTPLFARYGVEQQLDAMFSNHVALRSGGYLVINPTEALVSIDVNSGRATREHDIEDT
FT                   ALKTNLEAAEEVARQLRLRDLAGLIVIDFIDMEEKRNNRAVERKLNECLKDDRARIQVG
FT                   RISPFGLLEMSRQRIRTGVLESSSVPCPHCGGSGFVRATSSVALQILRAIEEALIKSSS
FT                   HNLILRTRTDVALYILNQKRGHLRELETRFGVSITVSADERLPPTSAFHLDRGEPAQPP
FT                   EPRLPVTSIRAEAVQPPPLEEEDEEEDETLEQAEGAAEEAGEAGGAGTEDEGGGRRRRR
FT                   RRRRRGRGEGRPGEIEGETETAGQEAVGDEAAGDEAAGEEAAGEETGLPAAGPEGDEEP
FT                   GEGPVTIPITEGGEAVIAREGDEGGGRRRRRGRRGGRSRDRHEEAEVGHIGDEVVVGAS
FT                   ETAEADPAGTLAQDALAEEIVAVGEISGPSPEAVAPASPAEMPDLTATEREAVRADAIQ
FT                   APEPEQAPAAPEPEPVAVVLTPPDPDRPKRAGWWSRTKAAIGGE"
FT   gene            473861..475219
FT                   /locus_tag="M446_0394"
FT   CDS_pept        473861..475219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0394"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; KEGG:
FT                   mex:Mext_2643 chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14963"
FT                   /db_xref="GOA:B0UJB3"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:B0UJB3"
FT                   /protein_id="ACA14963.1"
FT                   /translation="MMFRSLRSSRTAPVATIETAAAAEDRIADLLDQAIASGQMTGLGG
FT                   RIGAALAQLVARSRRSAGTDLGLSARVSAEASEAGTILVWMTHDASEMAAQTRSMASAV
FT                   EEVAASTRELWSRSQGSAQLAEQARAGIVGCASDMQEATRTMEVIEAGAVQMEQRLRGF
FT                   ESAAQQIQEIAGAIEAISSQTNLLALNATIEAARAGEAGKGFAVVAAEVKQLSGQTARA
FT                   TDQIRTRLAALLQELAAMQGAVSESRQAVATGTAAVGRVGARIVEEGQTVAHSAEGIRA
FT                   LADVLGQQQAATQEISAGVQQVAAKTEKTRQEIDGLMSQLARAETLAIETLDGSAGRDI
FT                   AGFGFVRLPADLAAWKRRLALVLIGARPARPEEAVLGAVDVPAQCGLLKADPAYAGLPF
FT                   EAILACSNEARRHAAEVVEGVSAQNWDKATPAFQAFERTVRALADHCRAVLQR"
FT   sig_peptide     473861..473929
FT                   /locus_tag="M446_0394"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.626) with cleavage site probability 0.574 at
FT                   residue 23"
FT   gene            complement(475255..476202)
FT                   /locus_tag="M446_0395"
FT   CDS_pept        complement(475255..476202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0395"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: gbe:GbCGDNIH1_1637 transcriptional
FT                   regulators, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14964"
FT                   /db_xref="GOA:B0UJB4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0UJB4"
FT                   /protein_id="ACA14964.1"
FT                   /translation="MKHLRSLSYVAEIARSGSIRRAAEVLHIAPSALTRQVQELEYELG
FT                   TPIFERLAQGMRLNAAGELLVRHIRDQLADLERVRSQIADLSGVRRGHVALACSQAFVN
FT                   QVVPEEVELYRGHFPQVTFTVQVRDHVQAVAALAAFEADLALVLQPPPSSDLQVLFACR
FT                   QPVCAMMRAGHALAREAGPVRLRDCLAHPLALPDRSLALRHHLDRALARTGAPPPAMES
FT                   GSLEFLRELVLREEVVSFQVPSGIPRDPRLCARPIDARDLDTMAMILGQFRGRMLPVAA
FT                   AKFADQLASSLNRRYGAAEAGDPAGPAAPRPAPA"
FT   gene            476329..477276
FT                   /locus_tag="M446_0396"
FT   CDS_pept        476329..477276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0396"
FT                   /product="NMT1/THI5 like domain protein"
FT                   /note="PFAM: NMT1/THI5 like domain protein; KEGG:
FT                   rpb:RPB_2838 twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14965"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:B0UJB5"
FT                   /protein_id="ACA14965.1"
FT                   /translation="MIRRRDLLTGLAAGLVLSPLPLRAQAPTVIRMGSLKLIHSIAPHF
FT                   YDQFTPAGVRVEVVPFESPTECKNAVVTKSVDFGMFGIAAATLGAAAGEPLVVIASACN
FT                   RGMAIIARKESGIAGLKDLRGKRVAIWPGSTQEVFVLERLRMEGMSVKDITPVRVSFSE
FT                   MHIALARGDVDAYVGAEPGPGVSLSTGIGSLVEYPYGTEMGALNMVFGAHRDTLAEKPD
FT                   LVRTMLDIHRKGTEYAAKNRDAMVAMAVAKLGQKREAIEISAPNVELTWQLGETEVKQA
FT                   RAYAEHMLVLKQIKRLPDFASFIDTRFVSAMRAA"
FT   sig_peptide     476329..476403
FT                   /locus_tag="M446_0396"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            477273..478130
FT                   /locus_tag="M446_0397"
FT   CDS_pept        477273..478130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0397"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rpa:RPA2678 putative
FT                   permease protein, subunit of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14966"
FT                   /db_xref="GOA:B0UJB6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B0UJB6"
FT                   /protein_id="ACA14966.1"
FT                   /translation="MSAADLTQAPPAAAGEAPVVPRRAPGLARLREPLLALAFPLALGA
FT                   VWHLATVGRPYSLIPPPGEVWTELRDLAVGGVNDDAFSGTLLTHLAASVSRVLGGFGLA
FT                   VLAALPLGLLIGRVPLVRQLLDPTFQILRPVPVTAWLPLAMILFGLGPRSACFLVFLGA
FT                   FYPILVNTVFGVRSVEPRLFEAAAMLGCRGSAQFTQVVLPAALPSIFTGLRLGLGFAWV
FT                   VIVVGEMTGVPTGLGAMIMEARQLSRTEIVICGMVVIGVAGFVSDRIVTLIGRRLLAWS
FT                   PTHG"
FT   gene            478155..478934
FT                   /locus_tag="M446_0398"
FT   CDS_pept        478155..478934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0398"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mms:mma_3084 sulfonate/nitrate transport system
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14967"
FT                   /db_xref="GOA:B0UJB7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0UJB7"
FT                   /protein_id="ACA14967.1"
FT                   /translation="MADPTLPILDIRGVSKSFTTQGRRVDALRGANLTVRRGEFICLLG
FT                   ASGCGKSTLLRIVAGFEAASEGEALMWGKPIAGPDPSRGMVFQDYGLFPWLTVRENIGF
FT                   GPKSRGRPAAEVRETAARYIEVVGLQRFADAYPHQLSGGMKQRVAIARVLANDAEIVLM
FT                   DEPFGALDAMTRERLQDELLDLWSRTGLTVLFVTHAIEEAVFLADRVVMMSPGPGRIET
FT                   VHEIALPRRRDVSSPAFNDVRRMLAGQLHSHHARRAA"
FT   gene            478931..479836
FT                   /locus_tag="M446_0399"
FT   CDS_pept        478931..479836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0399"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG:
FT                   jan:Jann_2944 polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14968"
FT                   /db_xref="GOA:B0UJB8"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:B0UJB8"
FT                   /protein_id="ACA14968.1"
FT                   /translation="MSADPRRPERRLAYRAAVDRPRLVLPGEKRVVVWPVVNVEHWLID
FT                   NPMPRQVLVAPTAAALLPDLPNWAWHEYGMRVGFWRFLDAFARRGIRPTLSINGSVCEA
FT                   YPRVAAASRDAGWEFMGHGFHQVPTQRVEDEPAMIARTVEAIARFAGGPPLGWLGPGLT
FT                   ETLDTPDHLAAAGIRYVGDWPMDDRPCRLRTRHGPLVTLPYSVELNDIPVLAIQHHGAE
FT                   EFLARALAQVERLAAEAASAGPLGGAKVMGFAIHPYITGVPHRIAVVERLLDALAARSD
FT                   VLFWQGRDILDWYLGTGDDA"
FT   gene            479853..480677
FT                   /locus_tag="M446_0400"
FT   CDS_pept        479853..480677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0400"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rpb:RPB_2835 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14969"
FT                   /db_xref="GOA:B0UJB9"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B0UJB9"
FT                   /protein_id="ACA14969.1"
FT                   /translation="MPDAMPDAWRAMDRAALSAAYDNSGAVAGSAAIVAGWRERSAALR
FT                   QAHPAELDLGYGAEARQRLDLFRCGAAGAPLLAFLHGGYWQRNAKEGFACMAEGPLARG
FT                   LDVALIGYTLAPEASLTRIAEEVGAALAVLRRREAGRLVVSGWSAGGHLAALALTRGQA
FT                   DAALAVSGIFDLAPIRGTALNDALNLSPEEVEALSPIRHLPAASGPLTVAYGAEELPEL
FT                   RRQSETYGAAWRAAGLPGALRPLPGHDHFSVLSELIRPDGALTEAAVALARG"
FT   gene            complement(480796..482259)
FT                   /locus_tag="M446_0401"
FT   CDS_pept        complement(480796..482259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0401"
FT                   /product="Peptidoglycan-binding domain 1 protein"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein; KEGG:
FT                   mex:Mext_1393 peptidoglycan-binding domain 1 protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14970"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:B0UJC0"
FT                   /protein_id="ACA14970.1"
FT                   /translation="MPRRLALLLAVLLSLPAAAQQPAPRPGPAPAPKPAPAPKPAPAPK
FT                   PAPAPKPAPESKPAPAAPPADAAFEAARAAFEARPEAERRAVQEALVWASDYTSVTTGT
FT                   FGRRTYEALVAWQGQNGLEPSGLLDERARARLLAAGQAAKQAAQFTLQADAATGITLGV
FT                   PERLLSRRGRIPNGSRWQSPDGRVTLDTKAFAPGETDLDALFEKAASVSPERKVTYKLK
FT                   RPDFVVVTGETPQGKFYIRYAAGPAGLRGFSLAYDKALAREVDRLVIAVANSFAPFPSE
FT                   APAAPPAAATAAAPIAPAPAGSSATGLAVGPRRLVTAAAAMAACPAPLVAGAPARVVRQ
FT                   EAGLALLETERPLSPGTLPPAAPAAPAPGEDLVVLGMGRDGAPTVAPGVAGAAGGVVAP
FT                   LQPGAAGAPVLDRAGRLVGFVAQMPAQPRLIAGVMPPLTHPVVGVAALRGLGAAEGAAL
FT                   PPSGPAAPKSAGAIAAPLAGALVAVQCRG"
FT   sig_peptide     complement(482200..482259)
FT                   /locus_tag="M446_0401"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 20"
FT   gene            482431..487728
FT                   /locus_tag="M446_0402"
FT   CDS_pept        482431..487728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0402"
FT                   /product="alpha-2-macroglobulin domain protein"
FT                   /note="PFAM: alpha-2-macroglobulin domain protein;
FT                   alpha-2-macroglobulin domain protein 2; SMART:
FT                   Tetratricopeptide domain protein; KEGG: mex:Mext_1395
FT                   alpha-2-macroglobulin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14971"
FT                   /db_xref="GOA:B0UJC1"
FT                   /db_xref="InterPro:IPR001599"
FT                   /db_xref="InterPro:IPR002890"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR011625"
FT                   /db_xref="InterPro:IPR011626"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR021868"
FT                   /db_xref="InterPro:IPR026284"
FT                   /db_xref="InterPro:IPR041203"
FT                   /db_xref="InterPro:IPR041246"
FT                   /db_xref="InterPro:IPR041462"
FT                   /db_xref="UniProtKB/TrEMBL:B0UJC1"
FT                   /protein_id="ACA14971.1"
FT                   /translation="MLRATRTGRLAGALAVALTLIVPAAAQAPQPPRPAPSALVPPPKD
FT                   PAPKGFVRQDLASEAVRLEAEIRSDAAGKPQKPAAQWRREAEKLFKDDDHDGALAAYAG
FT                   AIAAEPGDWKTWYALAETANGVENDDYDENQKLRRRARAGAYLAYQRAASRADEAKALA
FT                   LLGRVLADQESWRPALDAYKASLALADASDIRAAYEELREKHGFRITDYKVDSEAAAPR
FT                   ACFTFSEDLSAKTDMAPFVAVSGAANAAVTAEGQQVCVDGLKHGERYAVVLRQGLPSAI
FT                   AGETLRKSADYEIYVRDRSPQVRFTGRNYVLPRTGQAGVPLVSVNAPKLDVEVLRIGDR
FT                   GLLPTLRSEEFLSQLTGATARTLAREKGVRVWKGTLDTAGAEPNQEVVTAFPVLQAVGK
FT                   IEPGLYVMLAQPSGTAALGDEETGGYDQQATQWFVVSDLGLTALKGADGVHVFVRSLAS
FT                   AATVQGAEIRLVARNNEVLGVRTTDAQGHAAFDPGLSRGEGGIAPSLVVARLGDDYGFL
FT                   DLALSAFDLADRGVKGRPAPAAAEAFVFPERGVYRSGETVQITALLRDAKGAAIPGLPL
FT                   TLVVKRPDGIEYRRAAVPDAGLGGRAFPLPLLPGAAPGTWRVLAYTDPKAAPVGEASFL
FT                   VEDYLPERLEVTLTPKAPALAPNQPAVIDVAARFLYGAPGANLQVGGSVAVQAAASSGI
FT                   RGLDGFAIGLDDESVVPTTAEIDERVTTDAQGRATVRAPVPALSAPRPLEAKVSLQVGE
FT                   PGGRAVQRSVTLPILPAGPVVALRKTFGDLREGGTATFEVVAAQPDGTRLPARGAAWTL
FT                   KKVERNYQWYRADGRWSYEAVRTSRKVANGALDLAPDAPARIAAPVEFGTYRLEVSAPN
FT                   LQAASLSFTVGTGGSESADAPDLLDLTLDKAAYASGETLKARFAPRFAGTATVAVVSDR
FT                   VHEIRTLSVPAGGGAVEIPVKAEWGAGAYLVATAYRPLDQAAKRLPGRALGLAWFSVDR
FT                   AARSLDVAVEAPAKVRPRGDLRLPIRLSGLKPGEEARVTVAAVDVGILNLTRYAAPDPF
FT                   AFFFGQKALSTEIRDLYGYLIDGMQGTLGAIRSGGDAGGAELADAPPTQEPLVRYSGVV
FT                   TVGPDGRAEVTFPLPAFNGTARVMVTAWTAGRVGSAAADVIVRDAVVLTGTLPRFLNVG
FT                   DRSRLHVALDNVEGAAGDYAVDLDLSGPVVVPAEALTRKIRLEAGQRGAIEIPVTAAGP
FT                   GVARLDLRLTGPGLDGAAGQSFALAVQPGTGALLRRSVRSLDPGASVTLSNDLLADLLP
FT                   GTGTLTVSASPLAGLDVPALLQALDRYPYGCTEQTVSRAMPLLYVNRLASLDRLALDDK
FT                   VDERIRGAIDRVLSRQDASGSFGLWSAANSEDLWLNAYVADFLTRARERGFPVPQTAFS
FT                   LALDRLRNAVANTSEVSGGGMDLAYAAYVLARNGRPVMGDLRYLADTKLSDFSTPLARG
FT                   QIAAALALLGDRGRAQKAFEAAVSALRGEKDKAEYRPDYGSRLRDGAGLIALAAETGLV
FT                   RDSIAPLGAVIGEERASGRVTSTQENAWMVLAAEGLSKEAESMAFAVDGEAQGGPLYRS
FT                   FKAAQLDAKPVTVTNRGTTSAQLVLGVAGSPIVPEPPEARGYTVERRYHRLDGSLVDVT
FT                   QLRQNDRVVVVLKVTEDKARAARLLLVDRLPAGLEIDNPKLLDADAVPALSFVKSDVQP
FT                   THKEFRDDRFVAAYDRDPSQPAFLTVAYTVRAVTPGRYVHPAATIEDMYRPERYGRTAF
FT                   GAMEVGAPR"
FT   sig_peptide     482431..482511
FT                   /locus_tag="M446_0402"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.889 at
FT                   residue 27"
FT   gene            complement(487750..488646)
FT                   /locus_tag="M446_0403"
FT   CDS_pept        complement(487750..488646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0403"
FT                   /product="transcriptional regulator, LysR family"
FT                   /EC_number="4.2.1.1"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: rpb:RPB_0527 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14972"
FT                   /db_xref="GOA:B0UJC2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0UJC2"
FT                   /protein_id="ACA14972.1"
FT                   /translation="MPRSDLSDLVAFARVARHRSFRRAAAELGLSPSALSHALRDLEAR
FT                   LGARLLNRTTRSVAPTEAGAALLARLGPALDEIDRALGEVAASGGRLTGTLRLNAPRSA
FT                   CRLVLAPLAARFLSRHPGLRLEIACDDALADIVREGFDAGVRFGERVPRDMIAVPLGGR
FT                   QRFAVVGSPAYLAARGLPATPEDLAGHACLRQRFAGGAVMRWEFERDGRALALDLDGPL
FT                   ILNEQELLLQAAVEGSGLAQVFEGYAAPFLAEGRLVRLLEPWCPSFPGFLLYHPSRRQP
FT                   PPPLRAFLDFVRESAAA"
FT   gene            488742..489728
FT                   /locus_tag="M446_0404"
FT   CDS_pept        488742..489728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0404"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: bpt:Bpet4198
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14973"
FT                   /db_xref="GOA:B0UJC3"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B0UJC3"
FT                   /protein_id="ACA14973.1"
FT                   /translation="MRQRPLGRSGLTVSLPGLGCMGMSEFYGPADDAQSRAALEAALAL
FT                   GYDFLDTADTYGHGHNEALIGAVLAGRRDRAVVATKFGIVRAPGRYERRIDNSPAYVAA
FT                   ACEASLRRLGVETIDLYYCHRRDPAVPIEEVVGAMARLVEAGKVRALGLSEVSPATLRA
FT                   AQAVHPIAAVQSEYSLWTREPEQGLLAACRDLGVALVAYSPLGRGFLTGAVDVAGLAQD
FT                   DVRRANPRFRDEALARNARLAAALGTFAAERGASAAQVALAWLVTREPHVIPIPGTRKE
FT                   ARLAENAAAMEIRLTPEDLRALDALFAPGAVAGSRYDEAGMVGIETD"
FT   gene            489836..491935
FT                   /locus_tag="M446_0405"
FT   CDS_pept        489836..491935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0405"
FT                   /product="penicillin-binding protein 1C"
FT                   /note="TIGRFAM: penicillin-binding protein 1C; PFAM:
FT                   glycosyl transferase family 51; penicillin-binding protein
FT                   transpeptidase; Penicillin-binding domain protein; KEGG:
FT                   mex:Mext_1396 penicillin-binding protein 1C"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14974"
FT                   /db_xref="GOA:B0UJC4"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR009647"
FT                   /db_xref="InterPro:IPR011815"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:B0UJC4"
FT                   /protein_id="ACA14974.1"
FT                   /translation="MAGGAAGRNGAWRRVVPALLLAAALAAGAAGLWREIGRDPGLDLA
FT                   AAERRSPVVLDRAGVLLRPFATADGRWRLPLAPEAVDPRFLTLLMAYEDRRFARHPGVD
FT                   PLAVLRAAGQWLRAGRIVSGGSTLSMQVARLVEPRAERSLAAKLRQVRGAVALERRLGK
FT                   AGVLRLYLALAPYGGPLEGVRAASLAYFGHEPGRLSLAEAALLVALPQAPEARRPDRFP
FT                   EAARRARDRVLDLAAARGAVRRDEAEAAKAEPVPQRRRPFPMLAAHAAEAALAEAPDRA
FT                   VHRLTIDARLQASLEALAAERVAALGPGLSTAILVVDNATGAVRAHVGSAGYLDAGRAG
FT                   AIDMAAALRSPGSALKPFVYALAFELGLAHPETLIEDRPSRFGAAYAPENFDLTFQGTV
FT                   TARRALQMSLNVPAVELMELVGPARFIARLRAGGAGIALPRDAAPGLPVALGGLGITLT
FT                   DLARLYAGLARGGLVPDLVRRPEAGPPAREPPRIAEGVAAWYVTDILRGTPPPENALPN
FT                   RIAYKTGTSYGYRDAWAVGFDRRITVAVWVGRPDGASVPGLVGRVAAAPILFDAFARCG
FT                   GEPEPVPPVRDALVTSTAGLPPPLRHLRRDAAKVAGEAPGAPLRIAYPPDGARVDLGFA
FT                   EGAPAGLALKALGGTLPLTWMVNSLPLPEAARRQAEWQPDGAGFARISVMDATGASDSV
FT                   VVRLE"
FT   sig_peptide     489836..489925
FT                   /locus_tag="M446_0405"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.909) with cleavage site probability 0.890 at
FT                   residue 30"
FT   gene            complement(492072..493007)
FT                   /locus_tag="M446_0406"
FT   CDS_pept        complement(492072..493007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0406"
FT                   /product="porphobilinogen deaminase"
FT                   /EC_number="2.5.1.61"
FT                   /note="KEGG: mex:Mext_4848 porphobilinogen deaminase;
FT                   TIGRFAM: porphobilinogen deaminase; PFAM: Porphobilinogen
FT                   deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14975"
FT                   /db_xref="GOA:B0UJC5"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/TrEMBL:B0UJC5"
FT                   /protein_id="ACA14975.1"
FT                   /translation="MAHRPLRIGTRGSPMALAQTGMVRDRIAAAHPHLAEPGAMELVVV
FT                   NTVADRILDRPLSAIGGKGLFTKELEQALFAGEIDVAVHSMKDVETWLPDGLVIACILE
FT                   RDDPRDAFLSLASGSLAELPAGARVGTSSLRRGAQVLMRRPDLRIVPLRGNANTRIRKL
FT                   EEGVCDATLLAIAGLERLGLAHLARTVIPVEEMLPAVAQGALGIECRAADEDVIALLQA
FT                   VACPRTTTALAAERGLLAELDGSCRTPIAALAQIDGDRLTLDGLLFLPDGSAHWATTRS
FT                   GPAAEAASIGREAGADLKAQAGETYRRHLQ"
FT   gene            complement(493091..493315)
FT                   /locus_tag="M446_0407"
FT   CDS_pept        complement(493091..493315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0407"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14976"
FT                   /db_xref="UniProtKB/TrEMBL:B0UJC6"
FT                   /protein_id="ACA14976.1"
FT                   /translation="MTADRTQPDRDQPRRAGDQPRRGGDQPRREGLAESSLATSRRPAG
FT                   HAPGQPAEPPHPAGTPQGEPVADEQIPRD"
FT   gene            complement(493359..493658)
FT                   /locus_tag="M446_0408"
FT   CDS_pept        complement(493359..493658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0408"
FT                   /product="Antibiotic biosynthesis monooxygenase"
FT                   /note="PFAM: Antibiotic biosynthesis monooxygenase; KEGG:
FT                   rpd:RPD_2710 antibiotic biosynthesis monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14977"
FT                   /db_xref="GOA:B0UJC7"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B0UJC7"
FT                   /protein_id="ACA14977.1"
FT                   /translation="MVLEIAQIEVKPGHEAAFEDGVAEAAALFRRAKGCKGMELHRSIE
FT                   HPTRYRLMVKWETLENHTVDFRSSPDFQAWRDLVSDHFAAPPAVEHTTTTAAGF"
FT   gene            493965..494390
FT                   /locus_tag="M446_0409"
FT   CDS_pept        493965..494390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0409"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mex:Mext_4553 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14978"
FT                   /db_xref="UniProtKB/TrEMBL:B0UJC8"
FT                   /protein_id="ACA14978.1"
FT                   /translation="MTTLKEFEEALREHGMLMALALLERLRERDRANRTVKPGRRIVGK
FT                   KMTPELARAILDLHGSTEMTQQEIAFKLGVNQGRVNEVIKRGKWLSGDQAAPEAVARDK
FT                   GKARIRGTDVKRPRKGKEKAPTPRKPKAQTELLFGDP"
FT   gene            complement(494605..495072)
FT                   /locus_tag="M446_0410"
FT   CDS_pept        complement(494605..495072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0410"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG: mex:Mext_4556
FT                   heat shock protein HSP20"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14979"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/TrEMBL:B0UJC9"
FT                   /protein_id="ACA14979.1"
FT                   /translation="MRQFDLAPLYRSTVGFDRLFSALDQFVSAEAAPTYPPYNIERTGE
FT                   TAYRITVAVAGFTDQDLSIEVRENALTIKGERKAAEARKGEFLHQGIAARSFERRFQLA
FT                   DYVQVTGATLENGLLHVDLVREIPEAKKPRQIQIATGSAPRSIEGTVQQAA"
FT   gene            495304..496305
FT                   /locus_tag="M446_0411"
FT   CDS_pept        495304..496305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0411"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: mex:Mext_4557
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14980"
FT                   /db_xref="GOA:B0UJD0"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B0UJD0"
FT                   /protein_id="ACA14980.1"
FT                   /translation="MTVPLIATPDNPIPPGARTLAVPTRDGLTLRAATWTAATRTTKGT
FT                   VCLVQGRAEFIEKYYETVQDLRARGFAVAAFDWRGQGGSDRTVADARKGHVGDFEEYRL
FT                   DLEAVATQVLEPLMPRPYFGLAHSMGGAVCLAAAREGWLPFSRLVTLAPMLGIVMVRHP
FT                   RAAMRAAALLNGLGLGPRFVPGGSPVSIATKPFPGNRLTTDPARYARNAAAALAVGAGA
FT                   VGDPTVAWLAAAFRTMRRLGDPRYPLAIRLPVLVVAAGDDPVCSTPAIERFAARLKAGH
FT                   SITLRGARHEILMEQDAIRAQFWAAFEAFVPGTPLPEPREEDLIALERLPPG"
FT   gene            complement(496466..497254)
FT                   /locus_tag="M446_0412"
FT   CDS_pept        complement(496466..497254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0412"
FT                   /product="histidinol-phosphate phosphatase"
FT                   /note="TIGRFAM: histidinol-phosphate phosphatase; PFAM:
FT                   inositol monophosphatase; KEGG: mex:Mext_4559
FT                   histidinol-phosphate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14981"
FT                   /db_xref="GOA:B0UJD1"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR011809"
FT                   /db_xref="UniProtKB/TrEMBL:B0UJD1"
FT                   /protein_id="ACA14981.1"
FT                   /translation="MSVVDFARFVDELATQSGQAILPFFRAAFVTEDKAIGPKPFDPVT
FT                   EADRAGEAVMRQIIRRTFPDHGILGEEFGTEGEEAEYVWVLDPIDGTRGFIAGLPLWGT
FT                   LIGLTRAGTPCYGLMHQPFLGERFSGDGRSAQYRGPNGTRKLLTRRRAALSEAIAATTD
FT                   PRLFGEGRDREAYGRVEAATRLMRFGTDCYSYCMLAAGQIDLVIEAGLKPYDIVALIPI
FT                   VEGAGGIVTSWDGGPAAGGGNVVAAGDKRLHEAALEMLNR"
FT   gene            complement(497352..499391)
FT                   /locus_tag="M446_0413"
FT   CDS_pept        complement(497352..499391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0413"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   mex:Mext_4560 protein of unknown function UPF0118"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14982"
FT                   /db_xref="GOA:B0UJD2"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:B0UJD2"
FT                   /protein_id="ACA14982.1"
FT                   /translation="MARDDGGQASLIPAVPKRIAAAETPGRGFALPLLIAALIVAALYF
FT                   GREILIPIAIAVLLSFVLWPLVSLLRRLRLGRTASIGLSVLTCLGVVGLLTLVIGLQVA
FT                   DLGSNLPQYQRTIERKLENLREGPVGSIAGYMRSIGKHLQQAGSIPEDKAKPQDPTAPR
FT                   PAPSVQNPDKPVLVEVRERELTPLELAERLLSPALAPLATTGIVFVVLMFILGQREDLR
FT                   DRLIRLAGSSDLHRTTVAMNDAARRLSRFFLVQLALNAGFGVAIGIGLWIIGVPSPILW
FT                   GIFTALMRFVPYVGAFLSALLPLLLAAAVDPGWHMVLATAALFLILEPIVGQVVEPLLY
FT                   GHSTGLSPFAVLVSALFWTWLWGPVGLLLSTPLTVCLVVLGRHVDQLEFLDVLFGDRPA
FT                   LTPVENFYQRLLADDPDEAQELAESILSECSLSSYYDDVVLKGLQLAASDARRGVLTEE
FT                   QLERIRTAIDELVTDLADREDVAPAAQTSLAGRLLGRDADAAAPCDGEPAVPGAPAPET
FT                   LPAPWRQKGAVLCVAGRGPLDEAASTMLSQLLEKNGLGTRVVPFAAVSRARIADLDAGE
FT                   ARMVCISYLEISGTPAHLRYLVQRVRRRLPQARILVGLWPTDDLALADPEARAALGADD
FT                   HVTSLREAVEACLAAATGEAASAGRPAPVAPAPRSASLPAGAPA"
FT   gene            complement(499560..500852)
FT                   /locus_tag="M446_0414"
FT   CDS_pept        complement(499560..500852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0414"
FT                   /product="Nicotinate phosphoribosyltransferase"
FT                   /EC_number="6.3.4.21"
FT                   /note="PFAM: Nicotinate phosphoribosyltransferase-like;
FT                   KEGG: azc:AZC_3377 nicotinate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14983"
FT                   /db_xref="GOA:B0UJD3"
FT                   /db_xref="InterPro:IPR006406"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="UniProtKB/TrEMBL:B0UJD3"
FT                   /protein_id="ACA14983.1"
FT                   /translation="MLDLATRVYNHTWKIDPIIRSVLDTDFYKLLMAQTIFRRHRDVEV
FT                   TFGIHNRTTRVRLGEIIDEGELREQLDHCRSLRLTRGESTWLRGNTFYGKRQMFSPDFM
FT                   DWLENFRFPDYLLEKQDGQYVLTFHGPWIETTMWEVPALSILNELRSRGVLKGMGKFDL
FT                   QILYARAMTRIWEKIERLKLLPGLSIADFGTRRRHGFLWQDWCVEAMIEGLGPAFLGTS
FT                   NCLIALRHDIEAVGTNAHELPMVYAALAEDDAALARAPYAVLADWQQDYAGNLLVILPD
FT                   TYGTTGFLANGPAWMADWTGIRIDSKDPIIGGEEVIAWWRENGRNPREKLAIFSDGLDV
FT                   DTIETIHHRFHGRLRIGYGWGTLLTNDFRGLAPDGRLDPISIVCKVISANGRPTVKLSD
FT                   NPTKALGPEEEVERYKRVFSVGAQVAQPLLV"
FT   gene            complement(501005..501514)
FT                   /locus_tag="M446_0415"
FT   CDS_pept        complement(501005..501514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0415"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding; KEGG: mex:Mext_4563 pyridoxamine 5'-phosphate
FT                   oxidase-related FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14984"
FT                   /db_xref="GOA:B0UJD4"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR038725"
FT                   /db_xref="UniProtKB/TrEMBL:B0UJD4"
FT                   /protein_id="ACA14984.1"
FT                   /translation="MHQGSHRDHEGAQKLFSLIKDVKVAMMTTVDSDGQLRSRPMWSQE
FT                   ADPQGDLWFFVRLDAPVTGEISRDSQVNLAYADPSNQNYVSVSGKAEIVRDKATIDSKW
FT                   NESLKTWFPKGKDDPSVTLIRVHPEKGEYWDSPNATMLHLYGYVKAAVTGESPKTEKKA
FT                   VDLSAR"
FT   gene            501688..501897
FT                   /locus_tag="M446_0416"
FT   CDS_pept        501688..501897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0416"
FT                   /product="TOBE domain protein"
FT                   /note="PFAM: TOBE domain protein; KEGG: rpb:RPB_0855
FT                   molybdenum-pterin binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14985"
FT                   /db_xref="GOA:B0UJD5"
FT                   /db_xref="InterPro:IPR004606"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="UniProtKB/TrEMBL:B0UJD5"
FT                   /protein_id="ACA14985.1"
FT                   /translation="MRISARNQLSGTITSVTKGTTTAHVTLELPGGQVVTAALTNDSVD
FT                   GLHLAVGKPAVAVIKSGDVTIAVD"
FT   gene            501903..502943
FT                   /locus_tag="M446_0417"
FT   CDS_pept        501903..502943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0417"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   mex:Mext_3842 periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14986"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:B0UJD6"
FT                   /protein_id="ACA14986.1"
FT                   /translation="MALDRRALLLGLAGLCAAGRARAAGRTRAAGLDEAGRPLPAPSGP
FT                   VTRVFPAGPPAAILLYTLAPDLLAGWPRAIRPAERPYLLPEAAALPEVGRLTGRGNTAN
FT                   LETVLALKPDLVVDTGDTGETYRSLADRLQQQTGIPALLFDGRLPAVPATYRRLGAVIG
FT                   RAERAERLAARCEAILNTVQGRLAAVPPEARPRVYFARGPRGLETARAGAINVEVLDLL
FT                   GAVNVAGAGGSLARVSPEDVLAWAPEVIVALDPGFAAAARTDPLWQGVPAVAAGRLHLS
FT                   PALPFGWVDSPPSVNRFLGLWWLGKALYPSLFPEDLRALARDFHRDFYHVVPDEAALDR
FT                   LLAGAS"
FT   sig_peptide     501903..501974
FT                   /locus_tag="M446_0417"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 24"
FT   gene            502940..503992
FT                   /locus_tag="M446_0418"
FT   CDS_pept        502940..503992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0418"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   mex:Mext_3843 transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14987"
FT                   /db_xref="GOA:B0UJD7"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B0UJD7"
FT                   /protein_id="ACA14987.1"
FT                   /translation="MSGPPARAEGRIGARRAPGLGPALALGALILAVALAFGVGRYPVG
FT                   LGDVARVLAAKLTGAPSGAPAAVEAVVLQIRGPRILAAILIGAALSLAGAAFQGLFRNP
FT                   LVSPDILGASSGAAFGAVLGIWLSLGVLAIEVLAFAGGLLAVGAVYAVGAVLARRDPVL
FT                   VLVLAGVVIGSLLGAGVGLVKFLADPYNQLPAMTFWLLGSLSATHATDLAALAVPVAAG
FT                   TALLLLLRWRLDALSLPDEEARALGLATGPLRLAVVAAATLVTAASVAAAGIVGWVGLV
FT                   VPHLARFLVGPGFARLLPTAALLGAGTLLVIDTLARTVAPVEVPLGILTAVVGTPVFLW
FT                   LLAGAERDWS"
FT   gene            503989..504456
FT                   /pseudo
FT                   /locus_tag="M446_0419"
FT   gene            504469..504759
FT                   /pseudo
FT                   /locus_tag="M446_0420"
FT   gene            complement(504816..505502)
FT                   /locus_tag="M446_0421"
FT   CDS_pept        complement(504816..505502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0421"
FT                   /product="phosphoribosylformylglycinamidine synthase I"
FT                   /EC_number="6.3.5.3"
FT                   /note="KEGG: mex:Mext_0599
FT                   phosphoribosylformylglycinamidine synthase I; TIGRFAM:
FT                   phosphoribosylformylglycinamidine synthase I; PFAM:
FT                   CobB/CobQ domain protein glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14988"
FT                   /db_xref="GOA:B0UJD8"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B0UJD8"
FT                   /protein_id="ACA14988.1"
FT                   /translation="MKAAVIVFPGSNRDADVTRALRLAGAEVAKVWHADTALPSGTDLA
FT                   VLPGGFSYGDYLRCGAIAGRANAMDAVRAHAARGGLVLGICNGFQILCESGLLPGVLMR
FT                   NVNRRFICHRQTLRVERADTAFTRAYRQGQVIDVCVAHGEGNYYADPETVARLEGEGRV
FT                   AFRYSDAAGDLTETANRNGSLNSIAGIYSDELNVLGLMPHPENFVEDLVGGTDGRGLFE
FT                   SLARAA"
FT   gene            complement(505499..505741)
FT                   /locus_tag="M446_0422"
FT   CDS_pept        complement(505499..505741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0422"
FT                   /product="phosphoribosylformylglycinamidine synthase, purS"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine synthase,
FT                   purS; PFAM: phosphoribosylformylglycinamidine synthetase
FT                   PurS; KEGG: bja:bsl5728 phosphoribosylformylglycinamidine
FT                   synthase subunit PurS"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14989"
FT                   /db_xref="GOA:B0UJD9"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="UniProtKB/TrEMBL:B0UJD9"
FT                   /protein_id="ACA14989.1"
FT                   /translation="MKARVTVTLKTGVLDPQGKAIEGALRSLGIAGIASVRQGKFFEVE
FT                   VDGSDPAAAEATVKAACDKLLANTVVENYRVEIAR"
FT   gene            505870..506442
FT                   /locus_tag="M446_0423"
FT   CDS_pept        505870..506442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0423"
FT                   /product="acetyltransferase, CysE/LacA/LpxA/NodL family"
FT                   /note="KEGG: psa:PST_3480 acetyltransferase,
FT                   CysE/LacA/LpxA/NodL family"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14990"
FT                   /db_xref="GOA:B0UJE0"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR024688"
FT                   /db_xref="UniProtKB/TrEMBL:B0UJE0"
FT                   /protein_id="ACA14990.1"
FT                   /translation="MRSEKEKMLAGDLYRADDPELVADAARNAEWLARYNAPAALSPEA
FT                   RRALLRAHLGAVGDGVVIRPPFSCDYGLHIRLGRGVFLNFNCVILDVCPVEIGEATQIG
FT                   PGVQILAADHPRDPALRRAGLETGRPVRIGANCWIGGGALILPGVTIGDDAIVGAGSVV
FT                   TRDVPAGATVVGNPARPAAPGGRRPAG"
FT   gene            complement(506507..507346)
FT                   /locus_tag="M446_0424"
FT   CDS_pept        complement(506507..507346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0424"
FT                   /product="protein of unknown function DUF1206"
FT                   /note="PFAM: protein of unknown function DUF1206; KEGG:
FT                   mex:Mext_2038 protein of unknown function DUF1206"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14991"
FT                   /db_xref="GOA:B0UJE1"
FT                   /db_xref="InterPro:IPR009597"
FT                   /db_xref="UniProtKB/TrEMBL:B0UJE1"
FT                   /protein_id="ACA14991.1"
FT                   /translation="MHEPRPPLLEILARAGYGARGLTYCLVGGLALLAALGEGGRTGGS
FT                   RSALMVLLDKPFGRLMLGAVAFGLMGFALWRWIEAATDADRRGRSARGLAVRAGHGVSG
FT                   VIYAGLAVSVARAALGWGGSGPQDQAARDWTAWLLGEPFGAVAVAAAGAVVIGAGAGFL
FT                   LKAWRGDVTRQLALPVDARSWARAAGRLGYAARAVVFWLIGGFLILAAVESRSSEVRGL
FT                   GGALAALRDQPYGPVLLGLTAAGLAAFGAFGLVQARYRRIDPPHLDDLAAGRSRAGS"
FT   gene            complement(507358..507954)
FT                   /locus_tag="M446_0425"
FT   CDS_pept        complement(507358..507954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0425"
FT                   /product="protein of unknown function DUF533"
FT                   /note="PFAM: protein of unknown function DUF533; KEGG:
FT                   smd:Smed_2778 protein of unknown function DUF533"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14992"
FT                   /db_xref="GOA:B0UJE2"
FT                   /db_xref="InterPro:IPR007486"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:B0UJE2"
FT                   /protein_id="ACA14992.1"
FT                   /translation="MVDTRGLVDALVRSRRGGLGGAAAGAALGGLALIAGLGYRAFSRQ
FT                   AGPQQAGPQDSAPGPGAAPAPGGAAGGAARQPFRAEEVSDDDANLFLRAMVAATVADGM
FT                   IDAQERARLDAALDEAGLDAPARSAFEGLLREPPDVDEIADRVSDPETAARVYAAARLA
FT                   IDPDTVQERSFLNRLAEALDVDPDAVARIEREVGA"
FT   gene            508073..508867
FT                   /locus_tag="M446_0426"
FT   CDS_pept        508073..508867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0426"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mex:Mext_3952 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14993"
FT                   /db_xref="InterPro:IPR022224"
FT                   /db_xref="UniProtKB/TrEMBL:B0UJE3"
FT                   /protein_id="ACA14993.1"
FT                   /translation="MLLALAALRLVTLAFLLLFLAPLAAHALWWWSRDDLAPDWATADW
FT                   SSARLLPPAAAMPGAVVRVYAARVGRWRGIFAHHSWLVVKEAGAARYTRYDVVGWGRPV
FT                   RTDAYPADGRWFGNPPQVVLALDGEAAARAVPKLREAVAAYPYQDFGSYRAWPGPNSNT
FT                   FVAHLLRAVPEVQAALPPTALGKDFSEALVALTPSRTGLQLSWRGYAGLTLGWVEGVEV
FT                   NLLGAVAGLDLRRPALKLPGWGRIGMEPAGATGTLIAPTARP"
FT   sig_peptide     508073..508156
FT                   /locus_tag="M446_0426"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.970 at
FT                   residue 28"
FT   gene            complement(508914..512033)
FT                   /locus_tag="M446_0427"
FT   CDS_pept        complement(508914..512033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0427"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   mex:Mext_3922 acriflavin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14994"
FT                   /db_xref="GOA:B0UJE4"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B0UJE4"
FT                   /protein_id="ACA14994.1"
FT                   /translation="MRLNVSAWAIRKPIPSIVLFLVLGLLGLVSFRTLPITRFPNIDVP
FT                   LVSVSINQPGAAPSELQTQVTKWVEDAVAGVKGVKHITSAITEGNSATTVEFRLEVNTD
FT                   RAVNDVKDAIAKIRMNLPRTIEEPIINRVEIAGLPIMIYGASAPAMTPEDLSWFVDDVV
FT                   ARQIQGLRGVGGVERLGGVNREVRVTLKPDRLLSLGITAADVNRQLRLTSADMAGGRAE
FT                   LGGQEQSIRTLAASASLDTLAATSIVLPGGRKVRLDDLATLTDGAEEPRVFARLNGEPV
FT                   VAFAISRASGASDASVAQLVARKIDELRAAHPNVRFDLIDTSVTNTIGNYESAMHGLME
FT                   GAALAVLVVFLFLRDWRATLIAAVALPLSVFPTFWAMSAMGFSLNAVSLLAITLVTGIL
FT                   VDDAIVEIENIVRHVRLGKSPYRAAIEGADEIGLAVIAITATLVAIFAPVSFMGGIAGQ
FT                   YFKQFGLTIAAAVFMSLLVARLITPMMAAYFMRDHGHEEETPGPVMRTYTRVVAWSVRH
FT                   KFVTLVVGLALFAGSLMSTKLLPAGFLPKEDAARTLMVLELPPGAKLDDTIAVSDRVVQ
FT                   KIRALPEVRSVFVDGGRQLPGKKEIRLATLTINLTPKNTRTRTQGDLEAAIMAALRDEP
FT                   DIRYWSLREGGQRDFTLIVAGPDTEVVRDVAERMQREVAQVPNLVNVMSTAPLDRTELR
FT                   IRPKPAVAADLGVSTDTIAETVRVGTIGDIGANLAKFNAVDRQIPIRVQLPAEARGDLQ
FT                   ALEALKVPTKTGAAVPLTAVADISLGRGPTAIDRYDRAVRVALEANLQGSDALAEAIAK
FT                   ALATPAAKTLPPGVALRQTGDAEVMGEVFEGFALAMGAGLMMVLGVLILLFGSFLQPLT
FT                   ILFSLPLSIGGAILGLLIFNRPISMPVVIGILMLMGVVTKNAIMLVDFAVEEMARGVDR
FT                   ITAITDAGRKRARPIVMTTIAMAAGMVPSAMALGIGGEFRSPMAIAVISGLIVSTLLSL
FT                   LFVPAIFVLMDDLARLFVRLFGRFVGAVDEAPAHPHAAAPYAPPPRIAAE"
FT   gene            complement(512081..513307)
FT                   /locus_tag="M446_0428"
FT   CDS_pept        complement(512081..513307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0428"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   mex:Mext_3921 efflux transporter, RND family, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14995"
FT                   /db_xref="GOA:B0UJE5"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B0UJE5"
FT                   /protein_id="ACA14995.1"
FT                   /translation="MPRLRLLAGTLAALALAPLVSWTQESRAAEAAAPAARAEVPVPAV
FT                   TVVVAAEREIVERTVVTGTLVPRDEIMVSPEIEGCRITELLVEEGDRVARGAVLARLSR
FT                   EMIDTQLAQNAAAIARAEAAVEQARSTIVQAEAAQVEAALALERTRTLIRTGNATEVQM
FT                   EQRTSAARSAEGRLAAARNGLSIAEAELLQARAQRRELDLKLARTEIRAPEGGIVSRRT
FT                   ARVGATASATAEPLFRLIARGEIELEGEVTETGMPRLKPGAPAQLDLDTPDGSVGVPGR
FT                   VRAVYPEIDRATRLGKVRIRLEPDPRLRIGAFARGSVEVARRTGVAVPVASVVYGNGGA
FT                   TVLVVAGDRVEARQVRTGLSAAGFIEIRDGVRAGDAVVARAGSFLRDGDRVRPVFPAQQ
FT                   VSADALPRP"
FT   sig_peptide     complement(513236..513307)
FT                   /locus_tag="M446_0428"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.819 at
FT                   residue 24"
FT   gene            complement(513307..513948)
FT                   /locus_tag="M446_0429"
FT   CDS_pept        complement(513307..513948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0429"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: mex:Mext_0395
FT                   regulatory protein TetR"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14996"
FT                   /db_xref="GOA:B0UKQ7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/TrEMBL:B0UKQ7"
FT                   /protein_id="ACA14996.1"
FT                   /translation="MLADTLSDRIDPAEERRGRILDAAERCFVRGGFHRTTMQDVAAEV
FT                   GMSPGNLYRYFPSKDAIVAGLAERDRGAVAVDFAGLPLGADLVGAFVGLARRHLADEPA
FT                   EKAILCVEMWAEATRNPAMAAICRDFEREMRGMIAGILREAGGPAVDAEALTQIVMVMA
FT                   DGVIARRALIPDFDPGPVLDAMARLIEAALSGQFDPTGGPGPASARQDRP"
FT   gene            514082..514261
FT                   /locus_tag="M446_0430"
FT   CDS_pept        514082..514261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0430"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mex:Mext_3920 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14997"
FT                   /db_xref="UniProtKB/TrEMBL:B0UKQ8"
FT                   /protein_id="ACA14997.1"
FT                   /translation="MTIFQIRQAATGAVLWTGCAQDEQHALDAMAREAGYRDYASLPET
FT                   LRGSGARVDRLNLG"
FT   gene            complement(514406..515644)
FT                   /locus_tag="M446_0431"
FT   CDS_pept        complement(514406..515644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0431"
FT                   /product="Dyp-type peroxidase family"
FT                   /note="TIGRFAM: Dyp-type peroxidase family; PFAM: Dyp-type
FT                   peroxidase; KEGG: esa:ESA_02350 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14998"
FT                   /db_xref="GOA:B0UKQ9"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006313"
FT                   /db_xref="InterPro:IPR006314"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B0UKQ9"
FT                   /protein_id="ACA14998.1"
FT                   /translation="MTDAPSRRSLLRALAAGTGAAALAPVPGRAASLEEADGTADRQPF
FT                   RGLHQAGILTPQPASALFVAFDVLAQDRGELARLLRILTERFAYLTEGGPVPGLDPRLP
FT                   PADSGILGPVVRPDNLTATLAVGASLFDERYGLAAARPRRLRPMDRFPNDSLDAKLCHG
FT                   DLLLQLCANTADTAIHALRDVIRTTPGLLSLRWKREGFLPPQVVKRAGQDTVRNMLGFK
FT                   DGTANLDTRDAELMRRQVWVGPEDGEPAWARNGSYQVIRLVRNLVERWDRTPLGEQERI
FT                   MGRHKDTGAPLGETREHALPDYASDPKGERTPLDAHIRLANPRKAETARNLILRRGYNY
FT                   SAGITASGQLDMGLIFVSFQRDLDAGFVAVQNRLNGEPLEEYIRPVGGGYFFALPGVTA
FT                   PDGYLGEELLVGA"
FT   sig_peptide     complement(515552..515644)
FT                   /locus_tag="M446_0431"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.970 at
FT                   residue 31"
FT   gene            complement(515655..516770)
FT                   /locus_tag="M446_0432"
FT   CDS_pept        complement(515655..516770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0432"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: spe:Spro_2928 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACA14999"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR018976"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="InterPro:IPR034981"
FT                   /db_xref="InterPro:IPR038352"
FT                   /db_xref="UniProtKB/TrEMBL:B0UKR0"
FT                   /protein_id="ACA14999.1"
FT                   /translation="MPPRRLPALAALLALPGGALAEAPPPVAVTVTDKGCEPASLTVPA
FT                   GKSVFRIRNQSRRVLEWEILQGTMIVEERENIVPGFVQTLSATLQPGSYQMTCGLLSNP
FT                   KGTLTVLAAAETAPGGPPDPLALVGPLAAYKHYVSTQVDTFVARTRAFAEAVKAGRLAE
FT                   AKALYAAARQPYERIEPVASLFNDLDKSMDVRADDFEHKEADPGFIGFHRIEKGLWADN
FT                   STEELGPHADKLLADAEELQRRVRDLTIPPAKMVGGAAGLIEEVAATKISGEEDRYSRT
FT                   DLSDFHANVEGSRKIYDLLRPLVDKRDPDLVARTDKNFARVDALLLKYRSEDGSFAPYD
FT                   KLSERDRQALKAPITVLAEDLSTLRGKLGLD"
FT   sig_peptide     complement(516705..516770)
FT                   /locus_tag="M446_0432"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            complement(516792..517628)
FT                   /locus_tag="M446_0433"
FT   CDS_pept        complement(516792..517628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0433"
FT                   /product="iron permease FTR1"
FT                   /note="PFAM: iron permease FTR1; KEGG: oan:Oant_3859 iron
FT                   permease FTR1"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15000"
FT                   /db_xref="GOA:B0UKR1"
FT                   /db_xref="InterPro:IPR004923"
FT                   /db_xref="UniProtKB/TrEMBL:B0UKR1"
FT                   /protein_id="ACA15000.1"
FT                   /translation="MLIAFLIMLREGIEAALIVGIIAGYLAQTGRRAWMPAVWTGVVLA
FT                   ALLCLALGLVLDRVGAEFPQKQQEMVEGAIALLAAGMLSGMVFWMRKAARSVRADLHGA
FT                   VDAALHRGAFGLVLMAFLAVGREGLESVFFLLATVQQDVGWGVPAGAALGIAASVLVGW
FT                   GIARGGVRLDLRRFFRWTGIFILFVAAGLIASALRAFHEAGLWNHLQATAFDLSGVLPA
FT                   DTVLGTLLTGIFGYQEAPAWGEVLAYLAFLVPSLWLFLAASPAAVAAPPRPETLHA"
FT   gene            517852..518505
FT                   /locus_tag="M446_0434"
FT   CDS_pept        517852..518505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0434"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; KEGG: mex:Mext_0815
FT                   ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15001"
FT                   /db_xref="GOA:B0UKR2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0UKR2"
FT                   /protein_id="ACA15001.1"
FT                   /translation="MIRFENVTKIYRTSGHRRTVLDRASFTMRSGVSYGILGINGAGKS
FT                   TMIRMMAGSEGLTKGRIIRTSRVSWPLGFSGGFHPNMTGKENAIFVARVYGEDPYKVLD
FT                   FVSDFAEIGDYMNVPIRTYSSGMGSRFNFGMSMAIPFDTYLIDEITSVGDARFQQRCEE
FT                   VWSKRRANADIIMCSHNMDVIRQFSSEGIVLANGRAVIYSDVNDAIEVYQRLNQ"
FT   gene            518745..519986
FT                   /locus_tag="M446_0435"
FT   CDS_pept        518745..519986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0435"
FT                   /product="capsule polysaccharide export protein-like
FT                   protein"
FT                   /note="KEGG: mex:Mext_0816 capsule polysaccharide export
FT                   protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15002"
FT                   /db_xref="GOA:B0UKR3"
FT                   /db_xref="UniProtKB/TrEMBL:B0UKR3"
FT                   /protein_id="ACA15002.1"
FT                   /translation="MTVDARNPTGQPLDSAERSRLIAESLRQMARVSRHNDPRAVVRGG
FT                   GLLRGRDLVTPLLFLALCVLPSLLATAFFGFYLSDRYVTEVHFAIRPALGAAENAARDG
FT                   MGMTAAIPREMIAQDTLLLADYIASRPMVEAIERQLPLREMFSRPSIDALSRFDPKRPV
FT                   EKLVRYWRNRVAAKIEGTSGIISVTVNAFEAGEAVAISRAVLAESERMVNDLNARARQD
FT                   ALAASESALARIKERLDAAEEAVRDLRNRDRVLDALKTNEATIKTIGQLREQRIALSVK
FT                   QSLLLRDLREDARSVQDLKAQIAQLDGSIQRLEREATTPDPTRRQALADALTRFEEADT
FT                   ERKNAQALYNAVLAARDRARMILDRQFEFFSVVVAPVEAQSPQQPRRGLWIGSIVAASA
FT                   LAFAAVVMTRKILA"
FT   gene            519999..520772
FT                   /locus_tag="M446_0436"
FT   CDS_pept        519999..520772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0436"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mex:Mext_3137 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15003"
FT                   /db_xref="InterPro:IPR018649"
FT                   /db_xref="UniProtKB/TrEMBL:B0UKR4"
FT                   /protein_id="ACA15003.1"
FT                   /translation="MLDLSAIAARHGVSVDAARHLAEALAQGGGTAAQFNHPDLGGMGQ
FT                   WSSGGMIMIGDMFNAGLKARVAALCADLAPIAGRLAAPAGWWPAELGHPASAGSQNGLR
FT                   YAYFPDTRRLAVEAGGQLAVYDTGEHRIGGVSQQQGGASSLLFTSQFGPVRPEDLPLVS
FT                   GGAAQAPAPPVPAPPQLQVQGWAQPAPPPAAPQAPPAAPQAEPPIPAPAPAAAAVPAAA
FT                   GDPLALIERLAELHRKGVLTEAEFTTKKSELLGRL"
FT   gene            520912..521952
FT                   /pseudo
FT                   /locus_tag="M446_0437"
FT   gene            complement(521969..522277)
FT                   /locus_tag="M446_0438"
FT   CDS_pept        complement(521969..522277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0438"
FT                   /product="ETC complex I subunit conserved region"
FT                   /note="PFAM: ETC complex I subunit conserved region; KEGG:
FT                   mex:Mext_3134 ETC complex I subunit conserved region"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15004"
FT                   /db_xref="GOA:B0UKR5"
FT                   /db_xref="InterPro:IPR006885"
FT                   /db_xref="InterPro:IPR038532"
FT                   /db_xref="UniProtKB/TrEMBL:B0UKR5"
FT                   /protein_id="ACA15004.1"
FT                   /translation="MPSARIYKPAKDPSQSGMARTKQWVLEFDQTAPRETDPLMGWTSS
FT                   SDMLQQVRLEFDTREEAVAYATREGIAYRLEEPKPLLRKGLSYADNFKYNRTAPWTH"
FT   gene            complement(522320..522396)
FT                   /locus_tag="M446_R0004"
FT                   /note="tRNA-Pro3"
FT   tRNA            complement(522320..522396)
FT                   /locus_tag="M446_R0004"
FT                   /product="tRNA-Pro"
FT   gene            522702..523157
FT                   /locus_tag="M446_0439"
FT   CDS_pept        522702..523157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0439"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mex:Mext_3811 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15005"
FT                   /db_xref="UniProtKB/TrEMBL:B0UKR6"
FT                   /protein_id="ACA15005.1"
FT                   /translation="MLGDVTKLSMGAGAVLVASAHPAPAEPIANWAEMRAALAACWTIP
FT                   SGTEGSLIAFRFGLDKTGAMRGQPLVTARRFKGDRGAAEHFEDAARAALARCFPMRVTP
FT                   SFGAILGESPIRLRFVNTRPSNAYQINSNITIFAPQNDASPATPSRP"
FT   sig_peptide     522702..522764
FT                   /locus_tag="M446_0439"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.728) with cleavage site probability 0.726 at
FT                   residue 21"
FT   gene            523684..524475
FT                   /pseudo
FT                   /locus_tag="M446_0440"
FT   gene            complement(524482..525348)
FT                   /locus_tag="M446_0441"
FT   CDS_pept        complement(524482..525348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0441"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: nha:Nham_2368 methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15006"
FT                   /db_xref="GOA:B0UKR7"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B0UKR7"
FT                   /protein_id="ACA15006.1"
FT                   /translation="MRRSDIQKGSEILSQVMFVPPDEMRRELSQYAIGTQSYYEAQLRL
FT                   IYEPIAGRRHELNFEGHDTVNFDAMTAFPFGGGPSDAAYWEICYAHLIQMASLSRGSRV
FT                   LEIGFGAGGLAELMVRCGLDVTAVEVRQSNCDYLEQRVKSFGGTVDARAGEVEHMTFDK
FT                   EFDAIVFYESFHHMPSPWGIVRQLRNHLSAEGVFIFGAEPICDDDDPVVPFPWGFRMDG
FT                   GALSAIRDVGWVEFGFQRSYFLDNLTRLGFDTVHRALPGYHHASVWIAKQNVVNLLKSM
FT                   KAERRYR"
FT   gene            525866..526567
FT                   /locus_tag="M446_0442"
FT   CDS_pept        525866..526567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0442"
FT                   /product="Glutathione S-transferase domain"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   mex:Mext_3132 glutathione S-transferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15007"
FT                   /db_xref="GOA:B0UKR8"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:B0UKR8"
FT                   /protein_id="ACA15007.1"
FT                   /translation="MIDLYYWTTPNGHKVTLFLEETGLPYTIKPVNIGKGEQFQADFLK
FT                   IAPNNRIPAIVDHAPADGGAPVSLFESGAILLYLAEKTGRFIPGELRGRAEVLQWLFWQ
FT                   MGGLGPMAGQNHHFVQYAPEPIPYAIDRYVNETNRLYGVLDRRLADRTFVAGEEYSIAD
FT                   MAIYPWIVPHERQRQNLDAHPHLKRWFSAIAERPATKAAYARAAEINQQPTMSEEAKTI
FT                   MFGQTAANTKR"
FT   gene            complement(526777..527085)
FT                   /pseudo
FT                   /locus_tag="M446_0443"
FT   gene            complement(527151..527645)
FT                   /locus_tag="M446_0444"
FT   CDS_pept        complement(527151..527645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0444"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   mex:Mext_2047 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15008"
FT                   /db_xref="GOA:B0UKR9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B0UKR9"
FT                   /protein_id="ACA15008.1"
FT                   /translation="MEGRVSRGVTVRPATPADLDALVALEAATFATDRAERRAIRHAIG
FT                   SPTISLLVALDGPVLVGAATLERRRTSRRARLSSIAVAPARAGTGLGRLLLDAAEAEAR
FT                   RHGCTRLRLEVREDNGPGIRLYERAGYVRFETVPDYYEDGTTAWRYEKVLAPREEAADP
FT                   A"
FT   gene            complement(527630..529258)
FT                   /locus_tag="M446_0445"
FT   CDS_pept        complement(527630..529258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0445"
FT                   /product="periplasmic glucan biosynthesis protein MdoG"
FT                   /note="PFAM: periplasmic glucan biosynthesis protein MdoG;
FT                   KEGG: mex:Mext_2046 periplasmic glucan biosynthesis protein
FT                   MdoG"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15009"
FT                   /db_xref="GOA:B0UKS0"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR007444"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014438"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:B0UKS0"
FT                   /protein_id="ACA15009.1"
FT                   /translation="MTIEPSREPSRRTLLAGLLAGAALPARAQVGRAQVGPTQPGPSAL
FT                   PSPPPAGPTPFRFDDVVRRARDLANAPFDGGVPALPGPLAGLDYDAWRDIRFRPDKALL
FT                   GDRDGPFRLQLFHLGFLFKRPVTVNVVREGVPTPIPYQAALFDLGRTKLDGPLPLNLGF
FT                   AGFRLHYPLNRPGILDELIAFLGASYFRFLGRDQLYGLSARGLAVNVEAQGGPEEFPFF
FT                   REFWIEVPPKNADRAVIYGLLDGAACTGAYQFLVYPGDETVVDVRVSLHPRREVAGIGL
FT                   APLTSMFFIGENDRHRSDDYRPELHDSDGLLMQSGSGEWIWRPLRNPQERWISAFQDRD
FT                   PKGFGLMQRDRVFENYQDLEAFYHRRPSYWVEPQGAWGEGAVHLVELPTGNETHDNVVA
FT                   YWQPRQPLAAGQAVELSYLLRAIGESESLHPGARVVNTYVARPAASGGPAEAPDPLSRR
FT                   FLIDFSGGDLAYWLGDPKAVEIVPSTTRGRIVATSLVPNLHVKGFRAALDVRLDDPGQA
FT                   TDLRAFLRAGGRTLSETWTFPWKAA"
FT   sig_peptide     complement(529172..529258)
FT                   /locus_tag="M446_0445"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 29"
FT   misc_feature    529451..529823
FT                   /note="speF leader as predicted by Rfam (RF00518), score
FT                   106.03"
FT   gene            529927..531099
FT                   /locus_tag="M446_0446"
FT   CDS_pept        529927..531099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0446"
FT                   /product="Ornithine decarboxylase"
FT                   /EC_number="4.1.1.17"
FT                   /note="PFAM: Orn/DAP/Arg decarboxylase 2; KEGG:
FT                   mex:Mext_2045 Orn/DAP/Arg decarboxylase 2"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15010"
FT                   /db_xref="GOA:B0UKS1"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002433"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:B0UKS1"
FT                   /protein_id="ACA15010.1"
FT                   /translation="MIMTDRIRDFLRARRDLGRDEGPVMVLDLDVVRDNYHAFARALPD
FT                   TRVFYAVKANPAPEVLGLLASLGSCFDTASVAEIQMALAAGATADRISFGNTIKKERCI
FT                   ARALALGVRLFAVDCEAEVEKIARAAACADVAPEEVQVFCRILCDGAGAEWPLSRKFGC
FT                   VPDMAVDVLEHAHRQGLRAYGVSFHVGSQQGNTEAWDGALASAAMIFRECAERGIALAM
FT                   VNLGGGFPTKYLKEVPGVESYGGAIFRALTKHFGNRMPETIIEPGRGMVGNAGIIEAEV
FT                   ILVSKKSEAADEVRWVYLDIGKFGGLAETMDESIRYRIRTDHDEDRMVPCVLAGPTCDS
FT                   ADVLYEKIPYPLPVSLSIGDKVLIEGAGAYTTTYAAVAFNGFPPLQSYVI"
FT   gene            531297..531860
FT                   /locus_tag="M446_0447"
FT   CDS_pept        531297..531860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0447"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   mex:Mext_2044 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15011"
FT                   /db_xref="GOA:B0UKS2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B0UKS2"
FT                   /protein_id="ACA15011.1"
FT                   /translation="MIQIRDERATDIAAREQLLDTCFGEARFTKTCERLREGRLPAEGL
FT                   ALVAEQDGRLVGTVCLWDVAAGPRRPALMLGPLAVEPGLQGLGVGGTLMRAALARAAAL
FT                   GHRAVILVGDAPYYARFGFAAGAVGALWLPGPYARERFLGLDLAPGALAGAAGLVQATG
FT                   RPAPAPDLAALVAAEAARPLALAA"
FT   gene            531981..532511
FT                   /locus_tag="M446_0448"
FT   CDS_pept        531981..532511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0448"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15012"
FT                   /db_xref="UniProtKB/TrEMBL:B0UKS3"
FT                   /protein_id="ACA15012.1"
FT                   /translation="MTRFSIPSQRVGDDSRTEPAVTGRDCGHRTNVGGRDRARAPHDPE
FT                   PLGRKSHDGCGSGCCTEPGSERSPMADAVMSLGALSEKRFGPDQRREMGGSPRCGLAHD
FT                   SKLTARHTMSSWPAPKENGRPMPALDRDMAMSIVPAGQVRAQHDRGLAERFHRDRSHSR
FT                   HSARRVRSEGHPQ"
FT   gene            complement(532657..532878)
FT                   /locus_tag="M446_0449"
FT   CDS_pept        complement(532657..532878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0449"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15013"
FT                   /db_xref="GOA:B0UKS4"
FT                   /db_xref="UniProtKB/TrEMBL:B0UKS4"
FT                   /protein_id="ACA15013.1"
FT                   /translation="MSAVTDRIADGVFVVFASGLGVLVAANIALLVARLTHRDRLARRI
FT                   TSLASRVTWLFKVGRHSEDDCRNDRLRA"
FT   gene            533048..533737
FT                   /locus_tag="M446_0450"
FT   CDS_pept        533048..533737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15014"
FT                   /db_xref="UniProtKB/TrEMBL:B0UKS5"
FT                   /protein_id="ACA15014.1"
FT                   /translation="MTLRTGPIPDGRAKSPAAPSVGASRAGLPHRQPDRAGPAGHWGGS
FT                   AISHAAARGAILRVVAAQCRRGMTPPRLGAGGGSRRPARARSAEILPDLPLDVVGDAPA
FT                   MGLDEAADLRVAPTQALGMDGLHDAADQGEETGLGLGGGGGAVGKSVAENREHGTLLKV
FT                   MCARAFPSVCCNAIWDMTRRTRRPAAAAEPCGCLMAAATLRSPGRPVDPAGRSRQSPRR
FT                   RPVTDLG"
FT   gene            533773..535203
FT                   /locus_tag="M446_0451"
FT   CDS_pept        533773..535203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0451"
FT                   /product="Homospermidine synthase"
FT                   /EC_number="2.5.1.44"
FT                   /note="PFAM: homospermidine synthase; KEGG: mex:Mext_2042
FT                   homospermidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15015"
FT                   /db_xref="GOA:B0UKS6"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR023181"
FT                   /db_xref="InterPro:IPR032095"
FT                   /db_xref="UniProtKB/TrEMBL:B0UKS6"
FT                   /protein_id="ACA15015.1"
FT                   /translation="MTDWPVHGHISGPIVMIGFGSIGRGTLPLIERHFTYDKARFTVVE
FT                   PSDAHKALAERHGLRFAQVALTRDNYREVLTPLLTEGGGQGFCVNLSVDTSSRDIMELC
FT                   REIGALYIDTVAEPWPGFYFDKNAGPGDRTNYALREQILDARRRRPGGTTAVSCCGANP
FT                   GMVSWFVKQALLNVAADLGLSVEEPRTREGWAALMREVGVRGIHIAERDTQRAKSEKPM
FT                   GVFVNTWSVEGFVSEGNQPAELGWGTHETWMPENARTHAGDAPAIYLLQPGADTRVRSW
FT                   TPTAQAQFGFLVTHNEAISIADYYSVREGGKVVYRPTCHYAYHPCNEAVLSLHEMFGQA
FT                   GRVQEKHHILDENEIVDGIDELGVLLYGHGRNAYWYGSQLSIEETRAIAPYQNATGLQV
FT                   TSAVLAGMVWALENPEAGIVEADEVDFRRCLEVQLPYLGPVVGVYTDWTPLADRPGLFP
FT                   ENIDASDPWQFRNVLVQR"
FT   gene            535339..535905
FT                   /locus_tag="M446_0452"
FT   CDS_pept        535339..535905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0452"
FT                   /product="protein of unknown function DUF820"
FT                   /note="PFAM: protein of unknown function DUF820; KEGG:
FT                   mex:Mext_2040 protein of unknown function DUF820"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15016"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:B0UKS7"
FT                   /protein_id="ACA15016.1"
FT                   /translation="MSLALRREPRMRFAEFLNLIRARPDEERWELLDGEPVLMAPPTGR
FT                   HQQIVMNLGRHLAELAERRGCRALPGLGLHNDAVDDFAPVPDLVVRCGPLLQDGYARDP
FT                   ILVAEVLSPSTMHEDRGRKAAFYQSLQTLRAFLIVYQDETRVEVWSRGNGPDWTKRALG
FT                   GGDAIDLPDLGGSLPVASLYAGLHT"
FT   gene            535920..536261
FT                   /locus_tag="M446_0453"
FT   CDS_pept        535920..536261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0453"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mex:Mext_2039 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15017"
FT                   /db_xref="UniProtKB/TrEMBL:B0UKS8"
FT                   /protein_id="ACA15017.1"
FT                   /translation="MPHFDEFYANKLRGTLGVTDAESVLDLRGTPRAKAEASLTDMLER
FT                   SRFAKGKTVAVRLDAPVPGGGETLFQPVGRLLLEAKRRGWVDRLQTLPAQDGLGFYIAL
FT                   AGKPAREGA"
FT   gene            536293..537708
FT                   /locus_tag="M446_0454"
FT   CDS_pept        536293..537708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0454"
FT                   /product="Amidase"
FT                   /note="PFAM: Amidase; KEGG: sen:SACE_3403 glutamyl-tRNA
FT                   amidotransferase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15018"
FT                   /db_xref="GOA:B0UKS9"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:B0UKS9"
FT                   /protein_id="ACA15018.1"
FT                   /translation="MTESLADLCATDLLARYAARDLSPVEVTEAVLARVEAMEPTLQAL
FT                   CLLLPEEAREAARASEARWRRGEALALDGVPATVKENIATRGVAMPLGTAARRDAPPSP
FT                   EDAPAAARLREAGAILFARTTMPDYGMLSSGLSSIHPLTRNPWDPTRTPGGSSAGAGAA
FT                   AAAGYGPLHLGTDIGGSIRLPAGWCGIVGLKPSNGRVPVDPPYYGRCAGPMTRSVADAA
FT                   LAMRELSRPDHRDGTALPPAGLDWLALDGLDPKGLRLGLLREAGVGLPVDPAVAAVIED
FT                   AAARLAAAGARVEPVAPFLTRAMLDGLDTFWRERAWSDIGALAPERRAAVLPFIRDWAQ
FT                   AARGSSGAAVFAGMSQMGAMRDAALRAIRPFDFLISPVAPIPAFPAELASPTDDPMRPF
FT                   EHIGFTVAFNMSEQPAVAVPVGLTPEGLPVGLQIVGHRFDDLGVLRLARVFEDLRAPLP
FT                   RRAPAAPPRAPAR"
FT   gene            537749..539710
FT                   /locus_tag="M446_0455"
FT   CDS_pept        537749..539710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0455"
FT                   /product="polysaccharide biosynthesis protein CapD"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; dTDP-4-dehydrorhamnose
FT                   reductase; KEGG: mex:Mext_2037 polysaccharide biosynthesis
FT                   protein CapD"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15019"
FT                   /db_xref="GOA:B0UKT0"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0UKT0"
FT                   /protein_id="ACA15019.1"
FT                   /translation="MRRPTLKSAAIVAHDLVATALAVTLTFLIRFDDARLAERLAHLPV
FT                   LLGPFVLYAGLVYRWFGLYRTKWRFASLPDLAAIVRAVAVLALSLLLLDYALVSPALFG
FT                   IYFFGKIAIGLYFVLQLFLLGGPRVAFRYLKYSRSRQSHARAATTPALLLGRGAEIEVV
FT                   LRAIEAGTVRKLAAQGILSPRAEDRGQSLRGVPVLGAFADLEQVVADLAARGVAVRRLV
FT                   ATPNALTPEADPDGLLARARRLGLPLARVTTLGEGLRDAELAPLEIEDLLLRPTVPIDR
FT                   PRLERFLAGQRVVVTGGGGSIGSEICARAVAFGASALLVVENSEPALHGVLTRPALAES
FT                   EAEVSGVIADIRDRERLFHVLRAFRPDAVFHAAALKQVPYLERDWTEGIKTNVFGSVNV
FT                   ADAALAAGARALVMISTDKAIEPVSQLGVTKRFAEMYAQALDAAGGPARLVAVRFGNVL
FT                   GSVGSVVPVFKAQIARGGPVTVTHPEMVRYFMTVREACDLVLTAASHADREGRDPRAGD
FT                   QRAAVYVLKMGQPVRIRDLAERMIRLAGFEPGLDIEIAVTGARPGERLNEILFARDEPM
FT                   VTLDGIEGVMAAKPVFADRAQLARWLERLRAAVAQADRAAAEAVFAEAVPDFARRPGAA
FT                   REAPAAELAPRDVGAGGA"
FT   gene            complement(540012..541118)
FT                   /locus_tag="M446_0456"
FT   CDS_pept        complement(540012..541118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0456"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mex:Mext_4748 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15020"
FT                   /db_xref="GOA:B0UKT1"
FT                   /db_xref="InterPro:IPR021293"
FT                   /db_xref="UniProtKB/TrEMBL:B0UKT1"
FT                   /protein_id="ACA15020.1"
FT                   /translation="MRDAAGSASAAEPAPCQIHRRNAMTLSRLLARLLAGIVAVAALVQ
FT                   GAWAEPNAAACQRFRAELANLQRESNRGQVEEIQRLVAYRSSIGCEGGRFLFFDMRPPQ
FT                   CAQVEQRIRALNAGYGAGNTQVADARREQLVAAVKDSCTGLPAAAKLADGFARGGGHVI
FT                   CVRLCDGAYFPMPNLPDGREGADEMCKALCPGTEAAAYSMPASDNGLKDAAAIQTRRAY
FT                   AALPNAFKFQKTFVPNCSCRGQGQTWAQALVKAESMLVQHKGDIFVTPAQAEALSRPKV
FT                   RLTLVGRADRSAAVVAASAAARNGLEEPPGAEAPATPAAKPAGPDERPAVRVIAPTIIP
FT                   VPIQARIDGPQAAAPASPAPGTEPVATP"
FT   gene            541232..541732
FT                   /locus_tag="M446_0457"
FT   CDS_pept        541232..541732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0457"
FT                   /product="CreA family protein"
FT                   /note="PFAM: CreA family protein; KEGG: mex:Mext_4747 CreA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15021"
FT                   /db_xref="InterPro:IPR010292"
FT                   /db_xref="UniProtKB/TrEMBL:B0UKT2"
FT                   /protein_id="ACA15021.1"
FT                   /translation="MRVALAAGMLAGLGGAARAEEPDRIFDKSTVWRPLTPNDKLVVYG
FT                   IDDPDVGGVACHYTLPERGGIKGTLGLAEQVSDISLSCRQIGPVQFKRKLTQGEVVFSE
FT                   RRSLIFKSMQIVRGCDAKRNTLVYMVYSDKLIEGSPKNSTSTVPLMPWGTEPPPKCGDF
FT                   LKG"
FT   sig_peptide     541232..541291
FT                   /locus_tag="M446_0457"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT   gene            complement(541863..542198)
FT                   /locus_tag="M446_0458"
FT   CDS_pept        complement(541863..542198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0458"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mex:Mext_4746 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15022"
FT                   /db_xref="UniProtKB/TrEMBL:B0UKT3"
FT                   /protein_id="ACA15022.1"
FT                   /translation="MRRSLAALGLVGLLALAGPALAAGSEAAAAPGAEKTFLIPSSDGY
FT                   GVAECLSTGGGECGQVVADAWCESQGFAKAASFGAAAQDEYTGAIDTPSAPVSRPADRP
FT                   IRITCRD"
FT   sig_peptide     complement(542130..542198)
FT                   /locus_tag="M446_0458"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 23"
FT   gene            542544..543926
FT                   /locus_tag="M446_0459"
FT   CDS_pept        542544..543926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0459"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="KEGG: mex:Mext_4745 cysteinyl-tRNA synthetase;
FT                   TIGRFAM: cysteinyl-tRNA synthetase; PFAM: tRNA synthetase
FT                   class I (M); Cysteinyl-tRNA synthetase class Ia"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15023"
FT                   /db_xref="GOA:B0UKT4"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:B0UKT4"
FT                   /protein_id="ACA15023.1"
FT                   /translation="MAPLLRLYNTLTRAKEPFAPIDPSRVRMYACGPTVYDAAHIGNGR
FT                   PIIVFDLLFRLLRHLYGADAVTYVRNVTDVDDKINARAAERGVSIRTLTDETLAGFHAD
FT                   LRRLGVLMPEDVNRPGARPAFIEPRATDHIAEMAQMIERLVAAGHAYLAEDHVLFDVPS
FT                   MPDYGALSRRPLDEMEAGARVDVAPYKRSPLDFVLWKPSKPGEPAWPSPCGIAAPGRPG
FT                   WHIECSAMSWRHLGETFDIHAGGIDLVFPHHENEVAQSRCCFGTPVMANVWLHNGFLQV
FT                   EGDKMSKSLGNFVTLREVLADWPGEAVRLAMLRTHYRQPIDWTLRALEEASRTLERWYE
FT                   SVGDLGPAPAVPEGVRDALLDDLNTPAALGELHRLEDPAALKAGAGLMGLLGATRSARA
FT                   EAAVAASGIDVAAVEGLIAARKAARAAKNWAESDRLRGALAGMGVTVKDNKDGTTTWTV
FT                   EG"
FT   gene            complement(544136..544729)
FT                   /locus_tag="M446_0460"
FT   CDS_pept        complement(544136..544729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0460"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   mex:Mext_4743 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15024"
FT                   /db_xref="GOA:B0UKT5"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:B0UKT5"
FT                   /protein_id="ACA15024.1"
FT                   /translation="MRTVCVYCGSGFGTDPVFREAARALGHSLAEAGIGLVYGGGNVGL
FT                   MGTVARAVLDAGGHVTGIIPDFLKSRERMLDDVQETIVVPDMHTRKRLMFDRSDAFVAL
FT                   PGGIGTLEELVEQMTWAQLGQHAKPILLLSVAGFWAPLLALLDHMRAKGFIREGLDLNY
FT                   LVAERPEAVVGMLESALRAHPPRPEADALIEERF"
FT   gene            544943..546262
FT                   /locus_tag="M446_0461"
FT   CDS_pept        544943..546262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0461"
FT                   /product="Peptidoglycan-binding LysM"
FT                   /note="PFAM: Peptidoglycan-binding LysM; KEGG:
FT                   mex:Mext_4742 peptidoglycan-binding LysM"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15025"
FT                   /db_xref="GOA:B0UKT6"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:B0UKT6"
FT                   /protein_id="ACA15025.1"
FT                   /translation="MTAELRRGVALAGIGLVSGIVLIGIVSSGNRMLSTRDAPEPAAPG
FT                   AAAEQQAALAPPPAPPSAPPSALPSTWPPSAAPRAPSFDVIRVEPTGESVVAGRAAPEA
FT                   QVELLRDGEVFARTQADASGQFVLVPPALPPGSHAIGLRSVAPDGTRTTGPESAVVAVA
FT                   ANAASKPLVAVSAPGQPTTVLSQPEEAPKPAPSVVAAAREAPAAPPPGTTPIRIASVDA
FT                   ETGGKLFVSAQGAPQTNVRLYLNETLIAPGRTGSDGRVAFSIGRGVRPGDYRVRIDQVD
FT                   PATGSVRTRSEVKFAVPPSVEAAPVVAAARPAPAGPPKPAGHPAPSPAAAPAPPGPATP
FT                   AVDAAIAPAGPAALAAAGPASGRIPDPSTVFVSAVSTATVTRGDNLWSISRKAYGKGVR
FT                   YTVIFGANQAQIRNPNRIYPGQVFVLPGEAPPAAVGAKRG"
FT   gene            complement(546556..547287)
FT                   /locus_tag="M446_0462"
FT   CDS_pept        complement(546556..547287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0462"
FT                   /product="Asp/Glu/hydantoin racemase"
FT                   /note="PFAM: Asp/Glu/hydantoin racemase; KEGG:
FT                   rme:Rmet_3887 Asp/Glu racemase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15026"
FT                   /db_xref="InterPro:IPR026286"
FT                   /db_xref="UniProtKB/TrEMBL:B0UKT7"
FT                   /protein_id="ACA15026.1"
FT                   /translation="MRLGMLTPSSNTRLEPATAAMLRDLPGVTAHFSRFRVTAISLAPE
FT                   DLGQFDAEPVLAAADLLADAKVDVVAWNGTSAAWLGFDRDEALCAGIEARTGIAACTAV
FT                   LGFRDVFRRAGHRRIGLVTPYRGDVQARIRANWEAAGFACAAERHAGLSDNFSFAALPE
FT                   GDLAGMVRAVAAEGVEAVAIVCTNLDGTALAPALEAELGLPVYDSIAVTLWAALRRAGA
FT                   DPAPLARWGRLFAPCTNGSGC"
FT   gene            complement(547287..548060)
FT                   /locus_tag="M446_0463"
FT   CDS_pept        complement(547287..548060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0463"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bja:blr3293 ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15027"
FT                   /db_xref="GOA:B0UKT8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0UKT8"
FT                   /protein_id="ACA15027.1"
FT                   /translation="MSAIDLLDVRKVYRDRDGQDLVALERTRLSLAAGEFLCLLGPSGC
FT                   GKSTLLNLVAGFEAPSSGEIRVAGRCVERPGADRGVVFQQPTLMPWLTVIDNVAFHLTL
FT                   KGVGRAERRERAQAYLDLVGLRGFERHYPAELSGGMSQRVGIARALLMNPAVILMDEPF
FT                   AALDAQTKSEMQEELVAIWERVGATVIFVTHSVDEALVLGTRVAVMSRRPGRIREVLPF
FT                   DAPRPRDVTSPAFNDVKRHVLGLIRAESARPPRAA"
FT   gene            complement(548063..548929)
FT                   /locus_tag="M446_0464"
FT   CDS_pept        complement(548063..548929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0464"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bja:blr3292 ABC transporter
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15028"
FT                   /db_xref="GOA:B0UKT9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B0UKT9"
FT                   /protein_id="ACA15028.1"
FT                   /translation="MASATDLPRPASALRLPPGAVLRRRLAGWAERAALPLVLVAGWEA
FT                   FARSGALPPALLPAPSAVLHALADWMLGLDESTQSSSGHWPSDALASLSRVLAGYAIAA
FT                   LCGVGLGVAIGWWRLVERTVEPTLQMLRPIPPVSWIPLAIIWFGIADRPAIFLVFLGAF
FT                   FPILMNTIHGVRSVDRNLIRAGAMMGASERQLLARIVLPAALPAIVSGLRIAIGSAWML
FT                   TVTAEMVAVKSGLGYVLWDSYYFLRYDIVLAAMISIGLLGYLSDLCLKAVAATVLHWQR
FT                   GTTVQGR"
FT   gene            complement(548913..549941)
FT                   /locus_tag="M446_0465"
FT   CDS_pept        complement(548913..549941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0465"
FT                   /product="ABC transporter substrate-binding protein"
FT                   /note="KEGG: bja:blr3291 ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15029"
FT                   /db_xref="UniProtKB/TrEMBL:B0UKU0"
FT                   /protein_id="ACA15029.1"
FT                   /translation="MLRHRFGLVMVAALWAWSGAATAQDGAPVRLGYAKCAHCLPMALI
FT                   PDLAKELGKELGKGVTVEATGFNSGNDVLTALVAKSLDVAQVTYLHYVTALDKGFDLVA
FT                   VAGEVNGGSECLSTKGLNLAAEDWAGLKALVEARKAAGTPLKVAASRGNAQDIHMRGAL
FT                   LKQGINPNRDIQFVNIPNPSDHLAAMQRGEVDLVCSVEPFASQIRMAGAANHFVLPYDQ
FT                   AAGKLTNLIVTRSDVIKARRAAVQAVVDADVALVAKLQADRGVWVDVINQKTGLSKDVA
FT                   AEALKNAEPDYRMYRARTLAIAEMMRDLKYISRDVSKEVEANMDYSFLEAATKQSRDGL
FT                   GH"
FT   sig_peptide     complement(549870..549941)
FT                   /locus_tag="M446_0465"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 24"
FT   gene            550148..550867
FT                   /locus_tag="M446_0466"
FT   CDS_pept        550148..550867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0466"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: bja:bll3290 transcriptional regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15030"
FT                   /db_xref="GOA:B0UKU1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0UKU1"
FT                   /protein_id="ACA15030.1"
FT                   /translation="MDQVRRPRGRPRKPALLGPVAGSGRLSLHEQAVRRLRAMIVEGAL
FT                   PAGAPLVETELSEALGVSRTPLREAVKLLAMEGLVELRPNRSPRIAALDPEAVRALFEA
FT                   LAWIERAGAELAAQRMGRDDLDRLQALQAAIEAHHRNGEIAPYFAANHATHALIVACAG
FT                   NPPLREAHEALHARAEIARRRALDSHGRWSESVAEHRAILAALVARDGPRAGLLLAEHV
FT                   SHTGAALLAALSRSDAA"
FT   gene            550871..551623
FT                   /locus_tag="M446_0467"
FT   CDS_pept        550871..551623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0467"
FT                   /product="Asp/Glu/hydantoin racemase"
FT                   /note="PFAM: Asp/Glu/hydantoin racemase; KEGG:
FT                   reh:H16_A3073 hydantoin racemase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15031"
FT                   /db_xref="UniProtKB/TrEMBL:B0UKU2"
FT                   /protein_id="ACA15031.1"
FT                   /translation="MRLLLLNPNTSRDVTALMRDTAAAAAAPGTEIVAATAPRGVPYIA
FT                   NRAEAQIGGAIALEMLAEAGPGIDAAILAAFGDPGLVGARELFDIPVIGLAEAAMLSAC
FT                   LLGGRFGIVTFAQGLLPWYRDCVAMHGLSARCAAIRAIEGRFASLAGVQAEKEDQLVAL
FT                   AEAAVREDGADVLIFAGAPLSGLGPRVRERVPVPVVDQVVAAVKLAEAAVALRPRKAAS
FT                   GALSRPPAKESRGLPEALAARLAHTDRG"
FT   gene            complement(551647..552180)
FT                   /locus_tag="M446_0468"
FT   CDS_pept        complement(551647..552180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0468"
FT                   /product="transferase hexapeptide repeat containing
FT                   protein"
FT                   /note="PFAM: transferase hexapeptide repeat containing
FT                   protein; KEGG: smd:Smed_1693 transferase hexapeptide repeat
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15032"
FT                   /db_xref="GOA:B0UKU3"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:B0UKU3"
FT                   /protein_id="ACA15032.1"
FT                   /translation="MPLYALDAHHPRLADPARVWIAPDAQVIGQVEIDLDVSIWFSAVL
FT                   RGDNEPIRLGARCNIQDGVVLHTDPGFPLEIGEDVTIGHRAIVHGCTVGANSLVGMGAT
FT                   LLNGARIGRNCLVGANALVTEGKEFPDNSLIVGAPAKAVRSLDEQAVEGLRLAAARYVA
FT                   NGRRYEAGLRRLDP"
FT   gene            complement(552245..552961)
FT                   /locus_tag="M446_0469"
FT   CDS_pept        complement(552245..552961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0469"
FT                   /product="undecaprenyl diphosphate synthase"
FT                   /EC_number="2.5.1.31"
FT                   /note="KEGG: mex:Mext_4063 undecaprenyl diphosphate
FT                   synthase; TIGRFAM: undecaprenyl diphosphate synthase; PFAM:
FT                   Di-trans-poly-cis-decaprenylcistransferase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15033"
FT                   /db_xref="GOA:B0UKU4"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:B0UKU4"
FT                   /protein_id="ACA15033.1"
FT                   /translation="MQSSCSQGGGLHVAMIMDGNGRWATARGLPRSAGHRAGVEAIRRV
FT                   AEAAPDLGVGTLTLFAFSSDNWRRPPAEVAALMGLLRRYLRRETERLARTGTRLTVIGR
FT                   RDRLPAGLPGALARAEAETAGGARLHLRIAVDYSARDAILAAAAGAPGADVGAESREAF
FT                   GRRLSGGVPDVDLMIRSGGEKRLSDFLLWECAYAELHFTDRMWPDFGGDDLAAALRDFT
FT                   RRERRFGGLGTVPAAA"
FT   gene            complement(553018..553380)
FT                   /locus_tag="M446_0470"
FT   CDS_pept        complement(553018..553380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0470"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mex:Mext_4062 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15034"
FT                   /db_xref="GOA:B0UKU5"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR027395"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0UKU5"
FT                   /protein_id="ACA15034.1"
FT                   /translation="MSEPSGRFSYEGLDRVIHERARLSVLTSLVTHPDGLLFADLKQLC
FT                   GLTDGNLSRHLQVLQEAGLVELRKGYAQNRPQTVCRLTPGGRRRFLDYLAVLEQVVRDA
FT                   AEALDEAPAAFGSLRP"
FT   gene            complement(553373..553993)
FT                   /locus_tag="M446_0471"
FT   CDS_pept        complement(553373..553993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0471"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mex:Mext_4061 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15035"
FT                   /db_xref="GOA:B0UKU6"
FT                   /db_xref="UniProtKB/TrEMBL:B0UKU6"
FT                   /protein_id="ACA15035.1"
FT                   /translation="MPYQTDRDLDRALADIVAIRSQIARDTHFRGLGPATIAATGGIAL
FT                   LAAGLQALWLMPVGALAYLLYWIAVAALAVALIGAEAVTRSRRLHSGLADAMIGSAVEQ
FT                   FLPALAAGALVALVLVRVAPDSLWLLPGLWQVFVSLGLFAATRTLPRAVSLAGAWYLLA
FT                   GLAGLVVAAGTRDLSPWAMGLPFGIGQVLLALILHLTCRDADV"
FT   gene            complement(554309..555862)
FT                   /locus_tag="M446_0472"
FT   CDS_pept        complement(554309..555862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0472"
FT                   /product="integral membrane sensor hybrid histidine kinase"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; KEGG: mex:Mext_1782 PAS sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15036"
FT                   /db_xref="GOA:B0UKU7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B0UKU7"
FT                   /protein_id="ACA15036.1"
FT                   /translation="MRTELIWTHTAAAAILGLSFLSLAVGLMLVLTRRPDLRVRVLSWS
FT                   IGAFLLACAAAQLAEAWTAWSPGTPLVPDGGIEAPAKVLAALAALPLLACLRRFLAAAA
FT                   ALPSPEDLRRLDRDLAARTRERDAAEAASAAKSAFLARVSHEIRTPLSSILGFTDLLLA
FT                   DPDRSPEDRRRLDIIQVSGFALLSLVNDVVDVSNIEAGKVALRSEPFDLHALVETSLAM
FT                   VRPAAEAKALSLSVEIAPNVPARVRGDADRVRQILLNLLGNAVAFTAAGAVGVSLRCEE
FT                   AVSRRGRVTLAVKDTGPGIPPERQATLLSQDGPDPPRVGSKGLGLAVCRRLVALMGGEI
FT                   GFESHEGYGSTFWVRLDLEPVAPAPAAAPPEPEPFLAAPRILLVEDIPANQKLVRLILE
FT                   EEGYAVDTASNGVEAVAMIRSAPYRLVLMDVQMPAMDGLTATRRIRQMGGPSGRIPIVA
FT                   MTGHILPRHLEACREAGMDDVIAKPFKRAELTAVIAHWTLLEGERARPPGGAALASSAG
FT                   "
FT   sig_peptide     complement(555788..555862)
FT                   /locus_tag="M446_0472"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.981 at
FT                   residue 25"
FT   gene            556243..556566
FT                   /locus_tag="M446_0473"
FT   CDS_pept        556243..556566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0473"
FT                   /product="thioredoxin"
FT                   /note="TIGRFAM: thioredoxin; PFAM: Thioredoxin domain;
FT                   KEGG: mex:Mext_4442 thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15037"
FT                   /db_xref="GOA:B0UKU8"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B0UKU8"
FT                   /protein_id="ACA15037.1"
FT                   /translation="MATVKVTDASFRQDVLEASEPVVVDFWAEWCGPCRAIGPALEEIS
FT                   SEMQGRVKIAKVNVDENPGIASEYGIRSIPTLMIFKDGKLASQKVGAAPKGDLSRWIQS
FT                   ASA"
FT   gene            complement(556690..557598)
FT                   /locus_tag="M446_0474"
FT   CDS_pept        complement(556690..557598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0474"
FT                   /product="porin"
FT                   /note="KEGG: mex:Mext_4443 porin"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15038"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:B0UKU9"
FT                   /protein_id="ACA15038.1"
FT                   /translation="MKRLLSAFAAFTALTAAASAADLPRRVAPPVIAPVPVFTWTGFYA
FT                   GFNAGYGFDASSTNPDVIVLTRDPRVVAGPAGSALAIGWTGDRNTEGFSGGGQIGYNYQ
FT                   FTPGAGVVVGIEADAQYVDFGRNRNAFSFAIPNQPGAQFNGANGLRLFDPRGLSGLDYF
FT                   GTVRGRLGYAFDRVLFYGTGGFAYGGGGGTNFGLPNTDDFQTGWTAGGGIEYALPTDSF
FT                   LNFFRSSAVTLKVEGLYVNLDRNRRNGAYAFDNAGVIVAGLPNSIILSNTAGFPAVGNL
FT                   ARRNTEFAVVRAGLNYKFGTW"
FT   sig_peptide     complement(557536..557598)
FT                   /locus_tag="M446_0474"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.986 at
FT                   residue 21"
FT   gene            complement(557930..559255)
FT                   /locus_tag="M446_0475"
FT   CDS_pept        complement(557930..559255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0475"
FT                   /product="FolC bifunctional protein"
FT                   /note="TIGRFAM: FolC bifunctional protein; PFAM: Mur ligase
FT                   middle domain protein; KEGG: mex:Mext_4444 FolC
FT                   bifunctional protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15039"
FT                   /db_xref="GOA:B0UKV0"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B0UKV0"
FT                   /protein_id="ACA15039.1"
FT                   /translation="MESSDALMARFLALHPRTIDLSLGRIERLLAALGHPERRLPPVIH
FT                   VAGTNGKGSTIATMRAILEAGGLSVHVYTSPHLVRFHERIRLGQVGGGRFVAEDRLADA
FT                   FARCEAANAGEPITVFEITTAAALLLFAECPADVLLLEVGLGGRVDATNVIDRPAAAVV
FT                   TPIGRDHAEYLGDTVEAVAGEKAGIFKRGCPAVIAPQDYAEADRVLCARAEALRAAPVL
FT                   VGNQDFSVHEERGRLVYQDEEGLLDLPRPRLAGRHQIVNAGTAIAALRAAGFGDLGTAA
FT                   FEAGLSQVDWPGRLQRLGRGRLPGLMPAGSELWLDGGHNVDGGRILAAAMADLQERGDA
FT                   PLVLVTGLLGTKDAEGFLKNFVGLARAVVAVPISGQLAARPAEEVAAIAASVGLPATTA
FT                   PSIEAALVALQDRAWEAPPRVLICGSLYLAGAVLTANGTPPV"
FT   gene            complement(559592..560503)
FT                   /locus_tag="M446_0476"
FT   CDS_pept        complement(559592..560503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0476"
FT                   /product="acetyl-CoA carboxylase, carboxyl transferase,
FT                   beta subunit"
FT                   /note="TIGRFAM: acetyl-CoA carboxylase, carboxyl
FT                   transferase, beta subunit; KEGG: mex:Mext_4445 acetyl-CoA
FT                   carboxylase, carboxyl transferase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15040"
FT                   /db_xref="GOA:B0UKV1"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UKV1"
FT                   /protein_id="ACA15040.1"
FT                   /translation="MKVETMNWITEVVRPRIKTLFKRETPENLWVKCPETGQMVFHKEV
FT                   EAHDFVIPGSEHHLRMSAQQRLKMMFDQGTWLDVPLPEAPVDPLKFRDEKRYVDRLKDA
FT                   RAKTGMADAFKVGFGRVGGLPMTLAVQDFGFMGGSLGMAAGEAFVRGAETALDKRTPYV
FT                   LFAASGGARMQEGILSLMQMPRTTVAVRRLNRARLPYIVVLTNPTTGGVTASYAMLGDV
FT                   HLAEPGALIGFAGPRVIEQTIREKLPDGFQRAEYLREHGMIDQVVHRRDLKATVARLCG
FT                   LLMQAPAATPAPASAAAQPVPA"
FT   gene            complement(560614..561441)
FT                   /locus_tag="M446_0477"
FT   CDS_pept        complement(560614..561441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0477"
FT                   /product="tryptophan synthase, alpha subunit"
FT                   /EC_number="4.2.1.20"
FT                   /note="KEGG: mex:Mext_4446 tryptophan synthase, alpha
FT                   subunit; TIGRFAM: tryptophan synthase, alpha subunit; PFAM:
FT                   tryptophan synthase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15041"
FT                   /db_xref="GOA:B0UKV2"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UKV2"
FT                   /protein_id="ACA15041.1"
FT                   /translation="MTTRLDDTFARCRAEGRAALVTYVMAGDPDPETSLQVLRALPEAG
FT                   ADIVEFGLPFTDPMADGPAIQAAGLRALKAGQTVSGTLALVRRFRAENRTTPVILMGYY
FT                   NPLYIYGVARFLADAVAAGVDGLIVVDLPPEEDDELCLPTQEAGLAFIRLATPTTDERR
FT                   LPAVLANTSGFVYYVSITGITGSATPDFGQVEAAVARIRARTALPVVVGFGVKTGAHAA
FT                   AIARGADGVVVGSALVDALARSLDLDGRATSGSVAAVSALVRDLAAGVRAAAR"
FT   gene            complement(561514..562515)
FT                   /locus_tag="M446_0478"
FT   CDS_pept        complement(561514..562515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0478"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: cko:CKO_02929 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15042"
FT                   /db_xref="GOA:B0UKV3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0UKV3"
FT                   /protein_id="ACA15042.1"
FT                   /translation="MIRFEGAGKAYPGHARPVVDRLDLAVEEGTTCVLIGPSGCGKSTT
FT                   LRMVNRLVTPSTGRVRVGGRDVAELDPIGLRRRTGYVLQGVGLFPHRSVAQNVATVPGL
FT                   LGWPRRRIAERVDAMLDLVGLDPATFRDRRPDSLSGGQRQRVGVARALAADPPVLLMDE
FT                   PFGAVDPLVRGRLQAEIGAILRRLGKTVLFVTHDIDEALRMGDRVALMREGRLVQVDPP
FT                   ERLLARPADPFAEEFVGADRWLRRLALIPAAAARTAGPPPRASLPPLASLPPLASLPPL
FT                   ASLPPQASLRDALSALVAGTDEAVGLAEGGVVTLSSLRAAAADSAGGFTSPP"
FT   gene            complement(562522..562803)
FT                   /locus_tag="M446_0479"
FT   CDS_pept        complement(562522..562803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0479"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15043"
FT                   /db_xref="UniProtKB/TrEMBL:B0UKV4"
FT                   /protein_id="ACA15043.1"
FT                   /translation="MRMLLAPAILGLAILPDLAAAQQPDPTSPPGLAQPAPGVRGHRQP
FT                   RPDTVGGKPEAGSAALPSPEDSARKAAARDKAWDAKMKRTLGSICSGC"
FT   sig_peptide     complement(562744..562803)
FT                   /locus_tag="M446_0479"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.673 at
FT                   residue 20"
FT   gene            complement(562953..563807)
FT                   /locus_tag="M446_0480"
FT   CDS_pept        complement(562953..563807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0480"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: sil:SPO1092 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15044"
FT                   /db_xref="GOA:B0UKV5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0UKV5"
FT                   /protein_id="ACA15044.1"
FT                   /translation="MESWDAWQTLLAVARTGRLSAAAGRLGIDATTAGRRVRRLEAALG
FT                   RPLLAREGGLLVPTRTCLALMPRLEAAERALREVAGEAASDEAPGPGWRPVRVTAVAVL
FT                   CDHLLAPAVPRLLAARPALGLDLIAEDRNLSLTRREADLALRLGPPARGAAAARPVGRL
FT                   DYAVFAAAGEGAPERLPWAALDGALAHLPEVRFAERAAGRAGPRHRVSRLETLLRLTRA
FT                   GGVRAVLPEIMAGRDPALRRLAPAVSRPIFLIGHPEDEGQPLVRAVASWIEGLLPPPAD
FT                   GPP"
FT   gene            563924..564556
FT                   /locus_tag="M446_0481"
FT   CDS_pept        563924..564556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0481"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG: bbt:BBta_5288
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15045"
FT                   /db_xref="GOA:B0UKV6"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:B0UKV6"
FT                   /protein_id="ACA15045.1"
FT                   /translation="MHEPRTLLQLAGATPTPARIARAVLVVIDAQGEYADGALPLDGFG
FT                   PALAAVRALLAAAREAGAPVVHVAHRGRDGGLFDRGGPGGAIVPEALPRPGEPVIEKTL
FT                   PNAFAGTDLAARLRDLGRTDLVLAGFMTHNCVSATARAALDLGYRVTVAGDATATRALP
FT                   DPLGGPPLPAEAVQRAALAALADRTAVVAPAREIVAPAPGILGADAR"
FT   gene            564778..565449
FT                   /locus_tag="M446_0482"
FT   CDS_pept        564778..565449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0482"
FT                   /product="Uncharacterized protein SCO1/SenC/PrrC involved
FT                   in biogenesis of respiratory and photosynthetic
FT                   systems-like protein"
FT                   /note="KEGG: ppu:PP_3487 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15046"
FT                   /db_xref="GOA:B0UKV7"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B0UKV7"
FT                   /protein_id="ACA15046.1"
FT                   /translation="MATPRAVRIGALLLGLVALAGSVPAAPGGALGPEGGRPSAIEDLV
FT                   WPDAPGTRIRRDQSGRPLTPETLRDKVAVVGFVSTQCPITCVVLARELDALAGALPPSL
FT                   RDRVVIVAVTVDPARDDVAALRRFGEGMGIDPGRVRLVTSDPAATAHQAALLRYPADRL
FT                   PLPPPRLLVFDRRGDLAMIYGTEPVDRPRLLTDLALLERFEAGIHAPPRPDGAPLPASN
FT                   P"
FT   sig_peptide     564778..564840
FT                   /locus_tag="M446_0482"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.670 at
FT                   residue 21"
FT   gene            565467..567962
FT                   /locus_tag="M446_0483"
FT   CDS_pept        565467..567962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0483"
FT                   /product="Domain of unknown function DUF1929"
FT                   /note="PFAM: Domain of unknown function DUF1929; KEGG:
FT                   mex:Mext_1210 galactose oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15047"
FT                   /db_xref="InterPro:IPR011043"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR015202"
FT                   /db_xref="InterPro:IPR037293"
FT                   /db_xref="UniProtKB/TrEMBL:B0UKV8"
FT                   /protein_id="ACA15047.1"
FT                   /translation="MTRRLPLAAQRARRLLLATTILGALPAFPALAAQFGVVVNPVQDP
FT                   LFANLAIPDSAPATGMWSAVQAWPLNAISTALLPNGKLVSWGTPVNAPGTQDGHSFAIW
FT                   DPYQGFAPGSHTILPGVLNVNSFCGTQALQADGSLLVSGGIFDNGNDKGSAVVNTGATG
FT                   VSALGARLAADRYYATMITLADGQKLIMGGAYPYASGWGDPNGSIAKGLMSGMTPEIYN
FT                   PATGWRSLFGANSRDAFGPDFNRWWYPRAWVAPNGKVFGITSDRMWFLDPTGNGSVWAM
FT                   PFRAPQRSVTVATDAPNVGPNSTAVMYDAGKILQVGGNSYDNGTGFLASSRATMIDING
FT                   NAPIANDIAPMNIGRSWANATVLPTGTVAVTGGSKSVDAAGGDTVLEAELWDPRTGQWT
FT                   LGPRAAIYRGYHSSAVLLQSGAVLTSGGGAPGPVSNQNSEVYYPPYLFTTVNGKAALAP
FT                   RPQIVSLNTVSLAHGQSLQFEFTSANGLAQVALLGLSQGTHSFNTGQRRSLLTFTQAGQ
FT                   VATVQAPATPALAPPGYYQIVAIDQKGVPSPGVIIALGSGVAPPPQVAAPVGNVAQGGV
FT                   TPPPPPPPAPPLPPPAPPPAPPPAPPPPPPAPTDLWLPIGNTAKRIAVGRDGTLVMLNA
FT                   VDGSLSKYAPDKTWVKLAGNFKDVAVVDANSIYGIQMDGVIVRFNGQTWRRVGYGGKTI
FT                   SASADGTIVIVNILNEIWKKYGDNDQEAWGQIPGKAQRVAAMNANSFWSVGLDGDVYRA
FT                   DQTGKWVLVGSNAVDIAASPDGSVAVINSDVGVLWRKFGDDTVEAWGWVKTPGPAQAVA
FT                   VPNGQHAFVIGRDGVIYRQ"
FT   sig_peptide     565467..565565
FT                   /locus_tag="M446_0483"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 33"
FT   gene            568316..568660
FT                   /locus_tag="M446_0484"
FT   CDS_pept        568316..568660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0484"
FT                   /product="conserved hypothetical proteinn"
FT                   /note="KEGG: mex:Mext_2621 conserved hypothetical proteinn"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15048"
FT                   /db_xref="InterPro:IPR018744"
FT                   /db_xref="UniProtKB/TrEMBL:B0UKV9"
FT                   /protein_id="ACA15048.1"
FT                   /translation="MPGRRPDPAPRQVPTRRERIAQAVARLAPRLPAFEAEAILDRALA
FT                   SPGLRGAAPENAAWLGMVAYARHVFTEYDALLAEGYDQDSARHFVLDDLNAVLAGWGVR
FT                   RRIGEEAEEA"
FT   gene            568740..570932
FT                   /locus_tag="M446_0485"
FT   CDS_pept        568740..570932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0485"
FT                   /product="primosomal protein N'"
FT                   /note="KEGG: mex:Mext_1010 primosomal protein N'; TIGRFAM:
FT                   primosomal protein N'; PFAM: helicase domain protein; type
FT                   III restriction protein res subunit; DEAD/DEAH box helicase
FT                   domain protein; SMART: DEAD-like helicases"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15049"
FT                   /db_xref="GOA:B0UM24"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM24"
FT                   /protein_id="ACA15049.1"
FT                   /translation="MSAAIADVLIPLALDTAYSYAVPDGLTLAEGDVVQIPLGPRETVG
FT                   VVWSLRESASGGNLRRVTGKIADDGMRTPLRRLVDWIARYTLAPKGSALAMALRLPEEG
FT                   PRGETARIGVRATGMPPSRVTPARTKVLAVAADGAVRGKRALSLEAGVSASVVDGLIDD
FT                   GVLETVALAPERVAEPPDPDHPHAALSEAQAEAARALIASLTAPPRTGGPAGDGGVTLL
FT                   EGVTGSGKTEVYFEAVAEAVRRGVQSLVLMPEIALTAQFLDRFAARFGARPAAWHSGVG
FT                   GRRRERIRAGVAAGEIPVVVGARSALFLPFRSLGLIVVDEEHEAAYKQEDGVCYHARDM
FT                   AVVRAKLENAALVLASATPSIETRVNAQRGRYRRVVLPERFGGRRLPEIRAIDMRREQI
FT                   PRGRYLSPTLTAAIAETNGRGEQALLFLNRRGYAPLTLCRACGHRYQCPNCSTWLVEHR
FT                   FRRALVCHHCGHAERRPEACVACGTFDTLAACGPGVERIAEEVAATFPERRVIVLSSDF
FT                   PGGAERLRAELQTVAEGGCDIVVGTQLVAKGHNFPHLTLVGVLDADIGLASGDPRAAER
FT                   TFQLLQQVTGRAGRGEKPGRALVQTYQAEHPVIAALISGDAERFYEEETAARSMAGLPP
FT                   FGRLAALIVSAAEREAAEAHGRALAQVAEPPPGVMVLGPAEAPLALVRGRHRFRLLVKA
FT                   EREVDIQSYLRDWLARGPKPRGSVRVGIDVDPQSFL"
FT   gene            571265..571996
FT                   /pseudo
FT                   /locus_tag="M446_0486"
FT   gene            complement(571933..572133)
FT                   /locus_tag="M446_0487"
FT   CDS_pept        complement(571933..572133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0487"
FT                   /product="protein of unknown function DUF343"
FT                   /note="PFAM: protein of unknown function DUF343; KEGG:
FT                   mex:Mext_2253 protein of unknown function DUF343"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15050"
FT                   /db_xref="InterPro:IPR005651"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UM25"
FT                   /protein_id="ACA15050.1"
FT                   /translation="MADTPSVEPTRIDPKLLELLVCPLTKGRLEYDSARQELISRSAKL
FT                   AYPIRDGIPIMLPEEARPLAE"
FT   gene            572502..572849
FT                   /locus_tag="M446_0488"
FT   CDS_pept        572502..572849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0488"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15051"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM26"
FT                   /protein_id="ACA15051.1"
FT                   /translation="MGLQTIRPFSVIRDIAATDAPARRGHAADSPVEIRGPASSEYWTI
FT                   PSGLDVAEAREADPPRLTEATTSPLGTVAAAGLDAREAALTAARVRDALSSERLPIGNT
FT                   APQNLRTLFRV"
FT   gene            complement(573040..576513)
FT                   /locus_tag="M446_0489"
FT   CDS_pept        complement(573040..576513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0489"
FT                   /product="double-strand break repair helicase AddA"
FT                   /note="TIGRFAM: double-strand break repair helicase AddA;
FT                   PFAM: UvrD/REP helicase; KEGG: mex:Mext_4440 double-strand
FT                   break repair helicase AddA"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15052"
FT                   /db_xref="GOA:B0UM27"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR014151"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM27"
FT                   /protein_id="ACA15052.1"
FT                   /translation="MGIEGFVVDAVTQTAQRRAADPRASAWVSANAGAGKTKVLTDRVV
FT                   RLLLHGAPPAKILCLTFTKAAAANMAIRVFERLGRWVTLPEEALRAELTALEGERPDPA
FT                   TLRRARRLFARAVETPGGLKIETLHALCERLLHLVPFEANVPARFVVLDEAQTREAVDR
FT                   TIDNVLADAVDGTRPDLAQALARVAPEAAGEALRRAIGEAVRARAVLLHPQGLPARLER
FT                   LREALGLAPDEAVGTIEARMREGAPADWAGLAAQLRTGKATDEKRADALARAAAAEEPQ
FT                   DLPLYLAAFFKDEGEGDPYAPASLGTKAVPEAVRRLLLDEQARLGRLRERLKAARAQER
FT                   TAALFTLAAEIHRRVEAQKARLGALDFDDLIHKTLDLLTRVDSAWVLYKLDRGVDHVLI
FT                   DEAQDTNPEQWEILRRITEDFCAGEGARRGPLPRTRFAVGDPKQSIYSFQGAAPEEFET
FT                   TRQAWRRAARGAGLAFEDVGLTLSFRSAKGVLRGVDATFALAEHYRGLSFGDGAIGTVH
FT                   ETVRVGAPGQVELWPTEEPCEEPEPDAWVQPVDAVEAGAPALVVARRVARAVRHWTREG
FT                   DEHGRIWRPGEILILVRKRSAAFEGVIRALKAEDVPVAGQDRLDIAAHIAVMDLVAAGR
FT                   AALLPDDDLTLACALKTPLVGLTDDDLVRLAARRAPEESLAAALARHAGAGDPAALRGA
FT                   AALATWRRLAQESGPFGFYADLLGPLGGRARLVARLGGEAGDAIDVFLTAAAQAEQGAD
FT                   APSLTGFLSRYAPSGGRDAGGHTVKRDLESARDEVRVMTVHGAKGLEAGLLVLIDGCEP
FT                   LGRNDPPLLPVPVRGAGGVADGTVPVWSPSKGHDCPAGAAAREALHERARQEHNRLLYV
FT                   AMTRAKDRLVIAPYRGRDRETPESWCEMVRRGLVAAFGGVERAEMPYGPAETWRHGAAL
FT                   PAAPATAVPPAPPGERPDWLFRPVAPEAEPLPPLRPSGLGAADEPRRSQPRSGDPAARR
FT                   RGVLIHALLEHLPALAPERRAAAARAFVAARAPGLPAAEREALATSVLRLLADPDLSVL
FT                   FGPLARAEVALAGTVSLGGVEWPVHGRIDRLAVTEEAVWLCDFKTGRPPAEGAPVPGGM
FT                   AAQVALYAALLARIHPDRAVIPLLVWTAGPVIRRLSGAECAAALAALRPA"
FT   gene            576734..577294
FT                   /locus_tag="M446_0490"
FT   CDS_pept        576734..577294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0490"
FT                   /product="cytochrome B561"
FT                   /note="PFAM: cytochrome B561; KEGG: nha:Nham_3894
FT                   cytochrome b561"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15053"
FT                   /db_xref="GOA:B0UM28"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM28"
FT                   /protein_id="ACA15053.1"
FT                   /translation="MEVAMARSATAAPEEALVRYDTTTIVLHWLTALLVGLLWILGQTN
FT                   DWWPRGPLRGGLWSLHVLLGFALMATLATRVVWRIGPGRALPSAEDGPLRLLARATHSG
FT                   LYLLLIAVVGLGLADALVRGFVLFGAIPLPQVGDQALRRPINALHEWAANAVMAVAGLH
FT                   AAAGLFHHYVRQDGVLGRMWRAS"
FT   gene            complement(577359..580481)
FT                   /locus_tag="M446_0491"
FT   CDS_pept        complement(577359..580481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0491"
FT                   /product="double-strand break repair protein AddB"
FT                   /note="TIGRFAM: double-strand break repair protein AddB;
FT                   KEGG: mex:Mext_4439 double-strand break repair protein
FT                   AddB"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15054"
FT                   /db_xref="GOA:B0UM29"
FT                   /db_xref="InterPro:IPR014153"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM29"
FT                   /protein_id="ACA15054.1"
FT                   /translation="MSAARIFTIPPGAPFLATLADALLDGTLVGPVAQGPLGLAAVTLF
FT                   LPTRRATRALAAELAARCGPAVLLPRMTPLGEADEAELDLAALAPGECPEAVAHPPIPA
FT                   LERRLILARLVQAWAAGIDRRLLPMGEEVPFRVPSSPADAVGLAADLEGLMDALTVEGL
FT                   PWDEIGRAVEAEYSQYFSLTLDFVRIAAEHWPAILAERGVSDPVARGRALVLAEAARLR
FT                   RERPADPIVVAGSTGSIPATAALIGAIAAMPRGAVVLPGLDLALDEEGWAAIETGEAVA
FT                   HGHPQAILHRLLRGLDCPRAAVRPLGAPGPAARARAELLSQALRPAETTDAWADLDPGA
FT                   REALARAGGAGLALVEAADEREEALAIAVALREALERPDCRAALITPDRGLARRVAAEL
FT                   GRWEIVAEDTAGQPLALSLAGRLARLATDVAALDAKPERVLALLAHPMVRLGLARPALE
FT                   RAAAALEIGVLRGPAPAKGFAGLAEALRVARGGERPHAPRPVRRLTQADWEAAADLVAR
FT                   LDRAFRDFAPRDFAPDQEEGVRDLVALAQAHRETCDLLLDGPDAPQDEPSVAVLDGLFD
FT                   DLALAQAGMLEGRFSDYPAFFTALARERVVSARAERPHPRLRILGLLEARLLRVDRVVL
FT                   GGLDEGVWPPKAETDAFLNRPMRAAVGLSSPERRLGQTAHDLVQALGCPDAVITRAHKR
FT                   EGSPTVPSRFLQRLRAFMGEAAWSGCLAAGGRLRALAASLDRGTEPLPPRPARPAPRPD
FT                   PALFPRALSVTEVETLVRDPYGIFARHVLGLDPLEPVAVQPSASDRGTIVHDVLGGFAQ
FT                   RFPEALPADPRLPLYDLAVNAFAPIADAYPELYAEWWPRFERMAASFLAWEVERRPGLR
FT                   RVHAEISGRWRIPIGPAEDFTLRARADRIEARRDGGHVIVDFKTGQPPSAREVFAGFAP
FT                   QLTLEAAMLQAGGFRDLGPGTGAPELLYVRASGGKVPLDPVPLKPPRGEARSVEELIDE
FT                   HARRFQGLVARFLRGEAAYLSRPYPKYARAFSPYDHLARVKEWSLVEGEGA"
FT   gene            complement(580478..581215)
FT                   /locus_tag="M446_0492"
FT   CDS_pept        complement(580478..581215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0492"
FT                   /product="Nucleotidyl transferase"
FT                   /note="PFAM: Nucleotidyl transferase; KEGG: mex:Mext_4430
FT                   nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15055"
FT                   /db_xref="GOA:B0UM30"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM30"
FT                   /protein_id="ACA15055.1"
FT                   /translation="MPHTSAITRAFVLAAGLGKRMRPITATMPKPLVEVAGRALVDHAL
FT                   DRLAEAGIAEVVVNVHYLADLMEAHLRRRNGPPRIVLSDERDRLLETGGGVRKALPLLG
FT                   EAPFLILNSDSFWLEGPRPNLARMVAAFDPEAMDMLLLVASAATSLGYDGLGDFQMDKA
FT                   GRLARRAEREVAPFVYAGVAVVGPSFFADTPEGPFSLNLLFDRAVARERLHGLRLDGQW
FT                   LHVGTPEALQAAEERVRASAVQP"
FT   gene            complement(581252..582796)
FT                   /locus_tag="M446_0493"
FT   CDS_pept        complement(581252..582796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0493"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; protein of
FT                   unknown function UPF0079; KEGG: mex:Mext_4431 protein of
FT                   unknown function UPF0079"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15056"
FT                   /db_xref="GOA:B0UM31"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR012180"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM31"
FT                   /protein_id="ACA15056.1"
FT                   /translation="MDREAMDARTPWEIVLPDESATEDLGRFLAELLQPGDLVALSGGL
FT                   GGGKTTLARALIRELTGEPDLDVPSPTFTLIQPYEGRGGVAVVHADLYRLRGPDELVEL
FT                   GFDELTERAITLVEWPDRLPPRSGPTLALDLALKPEFGDTARLARLIGGGGMAERLQRA
FT                   RALRALLDRSGWGEATRTPMQGDASSRAYERLTQPDGTTAILMISPPRADGPPVRDGKP
FT                   YSAIVHLAESVHAFVAVDRGLRALGLSAPKILGQDLEAGLLILEDLGTEPVADASGPRP
FT                   ERYAEAVKVLARLHGTALPAVLPVAEGSDHTLPPYDLDALLFETELLIDWYAPHHARTP
FT                   LSGAQRAAFTAAWTEALTGLPPERPTWVLRDYHSPNLIWLPGRDGLERIGLIDFQDAVL
FT                   GHPAYDVASLLQDARVDASAEFELRLLGLYARERKLREPDFDVQGFAHAYAVLGAQRAT
FT                   KILGIFTRLDRRDGKPGYLAHVPRIEGYLNRNLAHPALAGVRAWYEACLPGLVPAA"
FT   gene            complement(583263..584426)
FT                   /locus_tag="M446_0494"
FT   CDS_pept        complement(583263..584426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0494"
FT                   /product="N-acetylglucosamine-6-phosphate deacetylase"
FT                   /EC_number="3.5.1.25"
FT                   /note="KEGG: mex:Mext_4325 N-acetylglucosamine-6-phosphate
FT                   deacetylase; TIGRFAM: N-acetylglucosamine-6-phosphate
FT                   deacetylase; PFAM: amidohydrolase; Amidohydrolase 3"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15057"
FT                   /db_xref="GOA:B0UM32"
FT                   /db_xref="InterPro:IPR003764"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM32"
FT                   /protein_id="ACA15057.1"
FT                   /translation="MSSPGLALAAPRVFDGEAELGPRTLVIRDGRIEDLAAEPPPGLPC
FT                   TILPPGTILAPGFVDLQVNGGGGALLNDAPTPGTLARIAAAHRRGGTTSLLPTLISDHR
FT                   PVIRAAVAAVAEAIAAGMPGILGIHLEGPFLSPRRPGIHDPARLAAFAPGDVDLLTGLG
FT                   ARGVTLVTLAPEVAPPGTVAALVARGARVSAGHTADDGTAFRRALAEGLTGATHLFNAM
FT                   SQLTAREEGAVGVALVDDRVFAGIIADGHHVGDTALVLALRLKGPGRLMLVTDAMPPVG
FT                   DPRPEAGFTLFGRAIACRGDRLTGPDGTLAGSALTMAGAVRHMVRRGGASLAEALTMAS
FT                   LTPARWIGRDDRIGRIAPGLAADLVVLDRDLVVWGTCVRGEFARAAA"
FT   gene            complement(584423..585442)
FT                   /locus_tag="M446_0495"
FT   CDS_pept        complement(584423..585442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0495"
FT                   /product="Glutamine--fructose-6-phosphate transaminase
FT                   (isomerizing)"
FT                   /EC_number="2.6.1.16"
FT                   /note="PFAM: sugar isomerase (SIS); KEGG: mex:Mext_4326
FT                   glutamine--fructose-6-phosphate transaminase (isomerizing)"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15058"
FT                   /db_xref="GOA:B0UM33"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM33"
FT                   /protein_id="ACA15058.1"
FT                   /translation="MSPPATLMAREIAEIPAVAAPLCAGDSEAARIGRGLARRRFPFAV
FT                   ICGRGSSSHAGIHLRYLIETRLGLAVSAAAPSVVTGYGRPPQVEGALFVVISQSGRSPD
FT                   LVAATRAAREGGALTLAIVNDPGSPAAEAADLVLPIGAGPERAVAATKTVVTSLVAGAA
FT                   LVASWAEDGALAAGLAALPARLDRALGLDWSAWSTDLAAATAAFVTGRGHGLGPVREIA
FT                   LKLAETLRLPALGYSAAELRHGPRAALSPRTPVLALRQADRLSAGIDGLVRDLRGAGVP
FT                   VQACGGPLGSLPWPGDGHPACDPILMLVPAYRAIEAEARRRGFDPDSPPGLAKVTETL"
FT   gene            complement(585439..586338)
FT                   /locus_tag="M446_0496"
FT   CDS_pept        complement(585439..586338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0496"
FT                   /product="sugar isomerase (SIS)"
FT                   /note="PFAM: sugar isomerase (SIS); KEGG: mex:Mext_4327
FT                   sugar isomerase (SIS)"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15059"
FT                   /db_xref="GOA:B0UM34"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005488"
FT                   /db_xref="InterPro:IPR040190"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM34"
FT                   /protein_id="ACA15059.1"
FT                   /translation="MSTERGSPRYVDLDAWDGLDVLGALWEGQLAAVAAVGPALPAIAA
FT                   AAEAAAPALREDGRLIYVGAGTSGRIGVQDGAELPPTFDWPEARLGFAIAGGHGALTQA
FT                   VEDAEDSSAEAAAWIAGAGVGPRDVVVGLSASGTTPFTVSALRGARGRGAVTIGIANNP
FT                   GTPVLESCDHPVLVATGEEALAGSTRLKAGTAQKVVLNLLSTLIMIRLGRVYRGRMVAM
FT                   RATNRKLRARGVAMVAELAGCGAEAAARALAEAEGDIKRAVLIGCGADPEGAARLLARH
FT                   GGSLRHALAAAGGREPRP"
FT   gene            complement(586456..588075)
FT                   /locus_tag="M446_0497"
FT   CDS_pept        complement(586456..588075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0497"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: azc:AZC_0023 putative oligopeptide ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15060"
FT                   /db_xref="GOA:B0UM35"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM35"
FT                   /protein_id="ACA15060.1"
FT                   /translation="MSELSLSRRRFVAGAAALAALGPTGSALAQGAASGSLTYGISMFD
FT                   LPLTTGQPDRGAGGYQFTGLTLYDPLVAWELDVADRPGKLIPGLATAWESDPADRRNWI
FT                   FRLREGVTFHDGSAFDADAVIWNFEKVLNDKAAHYDQRQASQVRPRLPSVASYRKLDAM
FT                   TVQVTTKAVDALFPYQMLWFLISSPAQYEAVGRDWTKFAFQPSGTGPYRMGQLVPRVRL
FT                   DLVPNETYWNRKRMPKLARLTLTCIPDALARANALLSGTVDLIETPAPDAVPRLKAAGM
FT                   RVVGNDTPHVWNYHLSILEGSPWRDLRLRRAANLAIDREGVVALMGGLATPAVGQVQPS
FT                   SPWFGKPSFAIRTDVEAARKLVEEAGYSVRNPLRTKFIIPTGGSGQMLSLPINEFVQQS
FT                   WAEIGIAVEFQPVELEVAYTAWRQGAADPSLKGVTGGNIAYVTSDPLYAILRFYSSRQI
FT                   APTGVNWSHYRNPEVDALCDKVQASFDPAEQDRLLARIHEIVVDDAVQVWVVHDTNPHA
FT                   LSAKVKGYTQAQHWFQDLTTLA"
FT   sig_peptide     complement(587986..588075)
FT                   /locus_tag="M446_0497"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.980 at
FT                   residue 30"
FT   gene            complement(588447..588854)
FT                   /locus_tag="M446_0498"
FT   CDS_pept        complement(588447..588854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0498"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bbt:BBta_0349 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15061"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM36"
FT                   /protein_id="ACA15061.1"
FT                   /translation="MSAHATRDLAGPCDWMLAPLSAWAGLFTAAQEIRAVDDECLRVML
FT                   EERLAPPAAADGTGPALGLVPLMHALGLDPEAVGRTAPATMATLERACAGCGQGSRCER
FT                   DLAAGLAAVAHPDYCPNAARLAALVEAARAA"
FT   gene            589050..590456
FT                   /locus_tag="M446_0499"
FT   CDS_pept        589050..590456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0499"
FT                   /product="adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /note="KEGG: mex:Mext_4433 adenosylhomocysteinase; TIGRFAM:
FT                   adenosylhomocysteinase; PFAM: S-adenosyl-L-homocysteine
FT                   hydrolase; S-adenosyl-L-homocysteine hydrolase, NAD
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15062"
FT                   /db_xref="GOA:B0UM37"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UM37"
FT                   /protein_id="ACA15062.1"
FT                   /translation="MPSNQDYIVRDIGLADFGRKEIAIAETEMPGLMAVRAEYAASQPL
FT                   KGAKIAGSLHMTIQTAVLIETLKALGADIRWVSCNIYSTQDHAAAAIAAAGIPVFAVKG
FT                   ETLTEYWDYTARLFDWHDGGMPNMILDDGGDATMFVHAGLRAERGDTAFLDAPGSEEEE
FT                   IFFALIKRMLKEKPKGWFAGLAESIKGVSEETTTGVHRLYILAKEGKLLFPAINVNDSV
FT                   TKSKFDNLYGCRESLVDGIRRGTDVMMAGKVAMVAGFGDVGKGSAASLRNAGCRVMVSE
FT                   VDPICALQAAMEGYEVTTMEDAAPRADIFVTATGNKDVITIDHMRSMKDRAIVCNIGHF
FT                   DNEIQVAGLKNLKWSNIKPQVDEIEFPDGHRIILLSEGRLVNLGNAMGHPSFVMSASFT
FT                   NQTLAQIELWTNQGKYENQVYTLPKTLDEKVAALHLEKIGVKLTTLRPDQAAYIGVQAS
FT                   GPFKPDHYRY"
FT   gene            590821..593313
FT                   /locus_tag="M446_0500"
FT   CDS_pept        590821..593313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0500"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; SMART: PAS domain
FT                   containing protein; KEGG: mex:Mext_4432 ATP-binding region
FT                   ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15063"
FT                   /db_xref="GOA:B0UM38"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM38"
FT                   /protein_id="ACA15063.1"
FT                   /translation="MGVGRTLRRRPSAGAIAGAWAVSAVLTGLPEAAMGAPALVPVPSS
FT                   LAHSAMALALLVGLIVFSTILSLLHIRERARWARRERDLSAEVADLRGAHDRAALLLGS
FT                   ERQIVVVWSGRDEPLIEGDASLAMDGTRTASPRRVLAFGTWLTAADAAALDAAVDTLRS
FT                   RGERFRLTARTLGGRTVEAQGQAVGGRALLRLREITGERQELVELRATLQEARGSLSVL
FT                   AALLDAIPQPVWRRGRDGRLLWANAAYVAAVEATDRERVVAEGVELLDRAARDEAERRR
FT                   TSREAGALRVSAVVAGARRTLDVTEVALETGSVGIAVDVSELESVRADLQRQMEANVRT
FT                   LDQLPTAVAIFDARQRLIFHNAAYRQLWDLGPAFLDGSPLDGEILDALRNARKLPEQAD
FT                   FRSWKTGVLSAYRAAEAQENWWHLPDGRTLRVVADPNPQGGLTYLFDDVSERVHLESRY
FT                   NALMRVQSETLDTLKEPVAVFGSDGRLKLANRAFMAIWRIGPETLAAQPHVDEIIGLCR
FT                   SLSAAEEPWTEIRGAVTGLMDARHAVASRLELKDGTVLDCAAQPLPDGATLLTHIDVTA
FT                   SVNVERALTEKNEALERTARLRDEFVHHVSYELRSPLTNIIGFTELLGDETVGALNTRQ
FT                   REYADHIMRSSAALLVIINDILDLASIDAGSMELTREVVDVQATIAAAVRGIEDRLAEA
FT                   AITLDLDVPADIGGFVADGKRIRQILFNLLSNAIGFSAPGQTVVVQARKTGAEIAFSVI
FT                   DQGRGMPPEVVARVFDRFESHTLGTRHRGVGLGLSIVRSFVELHGGRIDIASAPGQGTR
FT                   VTCTFPIGNGKANLAAAE"
FT   sig_peptide     590821..590928
FT                   /locus_tag="M446_0500"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.962) with cleavage site probability 0.754 at
FT                   residue 36"
FT   gene            complement(593518..596814)
FT                   /locus_tag="M446_0501"
FT   CDS_pept        complement(593518..596814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0501"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; transcription factor
FT                   CarD; TRCF domain protein; DEAD/DEAH box helicase domain
FT                   protein; SMART: DEAD-like helicases; KEGG: mex:Mext_1298
FT                   DEAD/DEAH box helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15064"
FT                   /db_xref="GOA:B0UM39"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM39"
FT                   /protein_id="ACA15064.1"
FT                   /translation="MVKRQPRAARRAEIVAPALPDGALAEALLSLSAAASPLVLVARDA
FT                   RRLDGIAAILRALAPGLGVAVYPAWDCLPGDRTSPSRGAMGARAGVLRWLSEPAPPAIV
FT                   LTTAPALIQRVPPPETWAQARVLLRVGEQVEAEALEAALTRLGYIPDERVDEPGEIALR
FT                   GRTFEVFPAAAPVPCRVEHEDGHITAIRSYDPVTQRSLGEAAELLIDPATELILGPDSP
FT                   EPLRPFTGQEHRLPAFYPRLATLLDPVPGARLVVEAGAEARAEAFFEQLAEAGGARAGA
FT                   GLYLAPEEWRALLGRRRIATALPSEDRAVPAFARERRPAAAFGRFLAARCEAGDRVILA
FT                   GPGRALGRLAREAVDQLGHKLLRARDWAAALRAEPGRVAVLEAPIAEGFRVPDHALTVI
FT                   AAADLLGKRAAPAWAAPARAAPGREGAPAALPFADPDLHRGDVVIHEDHGLCVFEGLEL
FT                   LRGPEGGGGEAARLRFADDAVRLAPLSEAGRIWRYGAAAEAVTLDRLDGGNLPGGTWAT
FT                   RRAGVEAAVAESARRMLALAEARRRATAPALVPPERQMERFGAGFGFPPTPDQAAAIDA
FT                   VMADLAAGRPMDRLVCGDVGFGKTEVALRAAAAALFAGKQVAVAAPTTVLVRQHVETFR
FT                   RRFARFGIVPAQLSRLVPPAEAKRVRAGLADGSVRLVIGTHALAGRGLVYADLGLVVID
FT                   EEQRFGAAQKARLRRAASGAHVLTLTATPIPRTLQSALVGLQDLSVIATPPVVRRPIRT
FT                   VVAPFDPETVRAALTREHRRGGQSFVVCPRIADLAPMEARLRAIVPDLSLAVAHGEMPP
FT                   AAMDEAMVRFAEGEGDVLLATNIIESGLDVPRANTMLVWHPERFGLAQLHQLRGRVGRG
FT                   QRRAAAYLLTDPEAPPPPASEARLRALTALDRLGAGFALSARDLDLRGAGDLFGEEQAG
FT                   HVKLIGLGLYRDLLERAIRAARGEPPEAAPAEIRLGLAGAIPAAYLPEPELRFGLAARI
FT                   ARLRSPEEAEALRDEIEDRFGPLPPETETLLTLAGLRMACRDLGIAQLGAGPQGLAADF
FT                   HPGRAAAVARAIAEVERRGDRLILHRPCADPVACGRLARRFVRALEAAQG"
FT   gene            597061..598842
FT                   /locus_tag="M446_0502"
FT   CDS_pept        597061..598842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0502"
FT                   /product="TrkA-C domain protein"
FT                   /note="PFAM: Citrate transporter; TrkA-C domain protein;
FT                   KEGG: sme:SMa1916 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15065"
FT                   /db_xref="GOA:B0UM40"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM40"
FT                   /protein_id="ACA15065.1"
FT                   /translation="MTHQQIIACALIAGTMLLFVWGRLRYDIVAGLALLGGIASGLVPA
FT                   REAFGGFSDDIVIIVASALVVSAAVARSGAVEAALRPIAPRLRSAQAQVALLVATVAVL
FT                   SAFIKNIGALAIMLPIAFQLAQKGDRSPSLFLMPMSFAALLGGLVTQIGTSPNIIVARL
FT                   RGELTGTPFRMFDFAPVGIGLMVAGVAFLCVGYRLLPRDRRGTPGLDAAVAISDYATEA
FT                   RLPQDSPFAGRTLSDLTANADGEVSVTGLVRDKTRRTVPLPDAVLRAEDRVILRGDPTA
FT                   LDRFIGEAGLLLDGQDRPTREEDGAEDEVGTVEAVIGPTSVLIGQSAGRIALHERFDVN
FT                   LLAVSRAGKRFTERLRDIRLRTGDVIVLQGREAGLPARLRDLGLWPLAARNLPLGSARR
FT                   GWITLSILAATVIAVAFSLVPVMVAFFAAALGVVLFRTLPAREAYEAIEWPILVMLGAL
FT                   IPVSDTLRTTGTTDLFAGWLSQLGILLPGWGAVGLIMLAAMAVTPFLNNAATVLVMAPL
FT                   AASFATTLGYRPDAFLMAVAIGAGCDFLTPIGHQCNTLVMGPGGYRFGDYARLGAPLSL
FT                   LVLVAGVPLILLVWPLA"
FT   gene            complement(598876..599805)
FT                   /locus_tag="M446_0503"
FT   CDS_pept        complement(598876..599805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0503"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: mex:Mext_4518 LysR
FT                   substrate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15066"
FT                   /db_xref="GOA:B0UM41"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM41"
FT                   /protein_id="ACA15066.1"
FT                   /translation="MTIDHIDLSRIDLNLLVALDALLAERSVTRAAARVGVGQSAMSSS
FT                   LGRLRALFGDDLLTRAPEGMRPTPRALSLAEPVRTLLRQVQVLVRRDEAFDPRTVARTF
FT                   TISLPDSTEVLLGPTLLAYLRAEAPGISLLLRSVDRAHILQEIDADRVDLAIDLSFRGQ
FT                   QHHKQRLLYRDSYVCLFNAALVGLAPPISLDDYLRFPHVLTSLRETAHGVVDDALAKLG
FT                   RSRTLAVTSPRFLAVPFLVRSAPVLTTMQARLAHLFAEALGLTVSPAPVPLDEVAMSML
FT                   WHASYDDDPAHRWLRNLLRRLATAPAEA"
FT   gene            599904..600284
FT                   /locus_tag="M446_0504"
FT   CDS_pept        599904..600284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0504"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: smd:Smed_5694 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15067"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM42"
FT                   /protein_id="ACA15067.1"
FT                   /translation="MNARTLVVAAAAALSLLGPARAEPLAPARAGSLGPAQARSIDLGP
FT                   LAGVAYYTPEPRGYHVVVTLAPRAAAPAVRLEGVLAEGQSLTVSTPRQSGAAARVIEIR
FT                   REGDAVSVSAGPVEVQETAALR"
FT   sig_peptide     599904..599972
FT                   /locus_tag="M446_0504"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            600549..601184
FT                   /locus_tag="M446_0505"
FT   CDS_pept        600549..601184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0505"
FT                   /product="MotA/TolQ/ExbB proton channel"
FT                   /note="PFAM: MotA/TolQ/ExbB proton channel; KEGG:
FT                   rpa:RPA0154 possible MotA/TolQ/ExbB proton channel family"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15068"
FT                   /db_xref="GOA:B0UM43"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM43"
FT                   /protein_id="ACA15068.1"
FT                   /translation="MDAATFSPSAMFFQAGLAGRAVILTLVASSAWCWVLILESLYTTA
FT                   KLRRSLRGLERGEVPDLLRPVVEAGRQAAALVLPEESPGEVQRRTAAAMERAAARAMTA
FT                   TEGGYSHLAVIASVAPFVGLLGTVWGIMNSFISIADAKDTSLAVVAPGIAEALATTAIG
FT                   LIAAIPAAVAHGRLGAVLGRLSQHMGHLIEALAVDLVVKARAVDRGAR"
FT   gene            601184..601648
FT                   /locus_tag="M446_0506"
FT   CDS_pept        601184..601648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0506"
FT                   /product="Biopolymer transport protein ExbD/TolR"
FT                   /note="PFAM: Biopolymer transport protein ExbD/TolR; KEGG:
FT                   gbe:GbCGDNIH1_1104 TolR protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15069"
FT                   /db_xref="GOA:B0UM44"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM44"
FT                   /protein_id="ACA15069.1"
FT                   /translation="MAFSSRGSGPYGSSADINVTPLIDVMLVLLIVFMVTAPLLTTGMK
FT                   VNLPQSRAAKPIDPKEPAVVAVAKDGRVFIGTDEIALDRLVPAVTAAIENDLSRVVHLR
FT                   GDKDASYGDVVKVMDLLASSGITHLAVVANRRSAGEAGHPAPRRATGSEP"
FT   gene            601645..602463
FT                   /locus_tag="M446_0507"
FT   CDS_pept        601645..602463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0507"
FT                   /product="TonB family protein"
FT                   /note="TIGRFAM: TonB family protein; PFAM: Gram-negative
FT                   tonB protein; KEGG: rpa:RPA0156 TonB like protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15070"
FT                   /db_xref="GOA:B0UM45"
FT                   /db_xref="InterPro:IPR003538"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM45"
FT                   /protein_id="ACA15070.1"
FT                   /translation="MTAAGLAEARDLAPPRSKGDHPRALARAAAFAVALAAHGLLLWVP
FT                   RPSPAPPSAVETLEISVVAQGDATTDEAEETRSAAEMPPEPEPAPPEPPLPPPPAEAEP
FT                   PPVRESPAAPAIPVRPPEPPAPPRPAPPKPPKPRPPERPRAETRPPRKPDSKPSQASMA
FT                   QHRAHAGADQGANIRSGQAVAAYGAILKAEINRHKSYPAAARDRQASGVVMVSFAIGPS
FT                   GRIASAAIGRSSGDPALDAAALQAVRAASPPPPPGGHFSGRIAIEYALRR"
FT   gene            complement(602482..603537)
FT                   /locus_tag="M446_0508"
FT   CDS_pept        complement(602482..603537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0508"
FT                   /product="transcriptional regulator, LacI family"
FT                   /EC_number="5.1.1.1"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: cau:Caur_1157
FT                   periplasmic binding protein/LacI transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15071"
FT                   /db_xref="GOA:B0UM46"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM46"
FT                   /protein_id="ACA15071.1"
FT                   /translation="MTIKDVARRAGVSFQTVSLVLNHPEKVARSTREMVGATMRELDFV
FT                   PSLAARSLRKKPSRSIACVFSVGAQPYDDVTGMMQETYQGIVLQTFAHVTDRHGYMLVH
FT                   RRWNAGEPDGLSRITSLVSEARVDGMVVLADRRDDPLIASLRAKSVPFFVFGLDVPEAS
FT                   FAMRAERDAVRQIVGYLVRTGCKAICFYKGERDGRHLPAVADRLSGYREALAAAGLRPR
FT                   DDLVVPCDWSSESGYRTTLRLLRRAPRPDAIVAANDRVAFGVLKALHEQGVRVPDEISV
FT                   VGFDNLVQCAYTVPRLTSIEVPTLEMVEFAVTTLIEMIEGVRAPHDPAQKLYPGRLVVR
FT                   DSTRPFAEARR"
FT   gene            complement(604472..605314)
FT                   /locus_tag="M446_0509"
FT   CDS_pept        complement(604472..605314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0509"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ccr:CC_1790 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15072"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="InterPro:IPR015069"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM47"
FT                   /protein_id="ACA15072.1"
FT                   /translation="MTRRERRCDGGSRIISRRRILQLSGAAAWGSGPGRPVSAALASSD
FT                   PAAASRPFPWIGVKFTSRGKLLPCPGNTIVCPIDIDGPAAALMAYRATIAAEPYADKFV
FT                   FTPPSSYHMTVFEGVVDLVRKPGFWPADLPLDAPLGQCDRVFLEKLETFDLGCAPRFRM
FT                   KVAEGASNRDVRPGEAIRLIPVDAAEEAKLRGLRDRLSDLLKLRQPGHDTYRFHTTQTY
FT                   AIAPLTEAEAARYRVVRREAIAALAAALPVLELGPPAFCFFDDMFQFRPRLRLARRRP"
FT   sig_peptide     complement(605195..605314)
FT                   /locus_tag="M446_0509"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.695) with cleavage site probability 0.576 at
FT                   residue 40"
FT   gene            complement(605318..607714)
FT                   /locus_tag="M446_0510"
FT   CDS_pept        complement(605318..607714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0510"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: cvi:CV_3188 probable TonB-dependent
FT                   receptor"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15073"
FT                   /db_xref="GOA:B0UM48"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM48"
FT                   /protein_id="ACA15073.1"
FT                   /translation="MSVKIRTFYKGLIACLAAAALPHAALAQGATDLGTVSVEAAAARG
FT                   EGAGDRGAPLLAEQNGTAAATTLRREDIARQPGTANLAQRIGGIAGVNSYSRDPSGLFG
FT                   GGYSIRGFDSTQIGLSLNGVPLNDPGTFSVLPQIYTDSENLCAVDVTQGTSAGTVAQHG
FT                   AIGGQVSMEQCRPADAPAVTFSQSFGSYFLNKTFLRANTGPLFDEVLKGYVSYSHARSD
FT                   YFAGPGEAERHHVDSRFDVKLDNGGSISFTSFYNEFANTFVRTVTKDQYQAFGYRNGWL
FT                   RTPPTILTGPGAVFSAIGLAVTPTPANTGYSGYSWEPGRHAYASIDGRFPLSDGVELRL
FT                   TPYFLHQESGSTSEIVLKEAGYAGKLLSSPIGAFSAYGTRGTNALLGQMSQSDFDRVGN
FT                   VVSLTGRLDNHTVTGSLWTEYTYQHQMNPFQQIDQTNNTLPDIWFKSNLLRGFDGNIVT
FT                   NRNWKTDYYNTTVAISDSISLLDDAMHVDLSLRQKFYSRSFHNLPSGTSTRTDSYLDYT
FT                   VNRSYAFLLPAVGMRYDLDAANQVFANASMNARVPPNFADGRLVNGATNLIQVPTIKAE
FT                   RALSFDLGYRLKGDFLDVNATGFLIKYSDRIAQTANGDGSLSSKYTNIGSTTAVGAEVE
FT                   VATKPYEGWSVLLSQAINHDTIDGNIVPDPKSPALRTKGKFYFNSPLSLTASTVMYENG
FT                   PFFAFARAKYTSEVYATLTNDISLPGYATVDLGLGYKLKGTSLVEAIPGAQDGLFKLNV
FT                   TNLFNKKYIYINPGNTTGFALSAANAPSFYLGSPFAVTASLTLDF"
FT   sig_peptide     complement(607631..607714)
FT                   /locus_tag="M446_0510"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.976 at
FT                   residue 28"
FT   gene            608051..609964
FT                   /locus_tag="M446_0511"
FT   CDS_pept        608051..609964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0511"
FT                   /product="K potassium transporter"
FT                   /note="PFAM: K potassium transporter; KEGG: mex:Mext_2282 K
FT                   potassium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15074"
FT                   /db_xref="GOA:B0UM49"
FT                   /db_xref="InterPro:IPR003855"
FT                   /db_xref="InterPro:IPR023051"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM49"
FT                   /protein_id="ACA15074.1"
FT                   /translation="MEATAEADQVHAPIPRVPAALALGALGIVYGDIGTSPLYALKETI
FT                   RAASSGGPPRAEAVVGSVSLILWALVLIVSIKYAILIMRASNKGEGGIVAMLALLGARH
FT                   APPRSWRAMLLVLGLVGAALLYGDGAITPAISVLSAIEGLKVDAPGVKPFVVPVTLVIL
FT                   IGLFAVQRRGTGFIGRIFGPVMLLWFCAIALAGAAGIVGDPRILAALNPAHAVETLLTA
FT                   GLPVSFAMLGAAFLAVTGGEAMYADMGHFGCGPIRLAWFSIVLPALVLNYLGQGALLLQ
FT                   DPSALENPFFQLVPSFAHYPMVAFATLATVIASQAIISGAFSLTQQAIQLGFFPRMRIV
FT                   HTSSREAGQIYIPLVNWLLAAATLGAVLAFGSSDALAGAYGIAVSLLMVITTVLATLIA
FT                   LHWGFNPLLVLAANGTFLLVDLTFFGANSLKFLEGGWFPLLLAAGVAFLMLTWRRGMLL
FT                   MEEARVQVRLPEKEFLARVEAKHLPRIPGTAAFLTSGDEGMPLPLMNFVHHLRVLHERV
FT                   LLVTVKGLDVPRVPMAERFTVVPITPDVTRLVLRFGFMDGTNVPAVLRAAVEAGHLPGI
FT                   DPDRLTYLISHETVVPSPQHPGLSGWREEIFALMQRNAEETASYFCVPTKQVMEVGAEV
FT                   PV"
FT   gene            610156..611187
FT                   /locus_tag="M446_0512"
FT   CDS_pept        610156..611187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0512"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: rpc:RPC_2016 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15075"
FT                   /db_xref="GOA:B0UM50"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM50"
FT                   /protein_id="ACA15075.1"
FT                   /translation="MADRTIQSGGSDGARVLSHKFEPPADPRDLARAWCEHIAPAFEVG
FT                   LRPEADLSAPIAMQTYHLGDLIVGDVIAPAHVLERGSRMIERQGIDHILIQFYRRGQST
FT                   VERRDGSERVTEGQCVVFDLAQPVRIVAEPVDATNLVVPRARLEDQGCQVGGLHGRAFD
FT                   YDGDPFGRLFHEFLANLVACGDLLHPREAAAGARALVQLCDTFLRGRAGNGPPQNLDAR
FT                   IRVRRFIERQLHDFDLGPAMIAAQLGLSRSTLYRLFGETGGVLAYIRDRRLMRAMRLLV
FT                   RSDAAQPMRISQLAYAVGFADEKTFRRAFRRRFGFLPSEAMAYQLGPDDAGMPVLRRWF
FT                   DNL"
FT   gene            complement(611550..612389)
FT                   /locus_tag="M446_0513"
FT   CDS_pept        complement(611550..612389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0513"
FT                   /product="porin"
FT                   /note="KEGG: mex:Mext_2882 porin"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15076"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM51"
FT                   /protein_id="ACA15076.1"
FT                   /translation="MNKKRLSSALLAIAVAGPACAADLPRRVQPPSFTPVPVFTWTGFS
FT                   VGGNVGYAFTTRESRNRNAAFLIDDRAIGTVGGTFGFSNRGQNGFTGGLQVGANYQMTP
FT                   GSGVVVGVEADAQYLDAGRRRSGVLAGPNTVLNPNAIFFDPRATAGLEYFGTARGRLGY
FT                   AFDRTLVYATGGFAYGGGSARRFFGATDNAQMRTGWTVGGVEYALGRDSFLNVFGASAV
FT                   TLKLEGLYVNLARNGGASLLAVNTGTGDVFLRTPGRRALGDDFMVLRSGLNYTFSTN"
FT   sig_peptide     complement(612324..612389)
FT                   /locus_tag="M446_0513"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            complement(612619..613188)
FT                   /locus_tag="M446_0514"
FT   CDS_pept        complement(612619..613188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0514"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: mex:Mext_0904 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15077"
FT                   /db_xref="GOA:B0UM52"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR004385"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM52"
FT                   /protein_id="ACA15077.1"
FT                   /translation="MEAKILDLRVLHEGWSRFGIAKVRLADGSQAVREIEDHGDSVGVL
FT                   PYDPERRVAVLVRELRVPALYAEGAQTLLEAPAGLIEDGTPADNARREALEEVGLRLRD
FT                   LEPVGTTYSCAGISTERIHLFLAPYRQADRVGAGGGAPGEHESIRVVEMPLDALAALAD
FT                   RAELTDLKTLALTLALRARHPGLFGR"
FT   gene            complement(613309..614469)
FT                   /locus_tag="M446_0515"
FT   CDS_pept        complement(613309..614469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0515"
FT                   /product="phosphohydrolase (DHH superfamily)-like protein"
FT                   /note="KEGG: mex:Mext_3673 phosphohydrolase (DHH
FT                   superfamily)-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15078"
FT                   /db_xref="GOA:B0UM53"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM53"
FT                   /protein_id="ACA15078.1"
FT                   /translation="MTLTQITHHDLDGYGASTVVACLCDPERVVHVPRYGDVGPVVEAE
FT                   LKRLGRARARETLLLTDLGLEEPTIAFLRRFAAMNRRREPGDGHGLVVLDHHASSVEQL
FT                   GRQGFAPQPDPDRPGLLRFGVEDPAVTVLIDEGSSATRMALTHRALFATRPEPDRAEDL
FT                   AVLVEAVDAVDLWRKHDPRFPSGQALDEAFWDNVATLVPAGHPAHDGVVSRLLLDAAAA
FT                   LRAGATPADLERRVPEIRGAIVDDLMRQAPGDDPALTTRLRVARLLARSDALFHPLPDG
FT                   TLLSFGLDPGTFQRVSDLIMAEGRAARVVNVQRTGTLSFRSNDGTALAGARLFRGGGHQ
FT                   DAAGGKLPSGTAFSLADAVAQVEPVLAPPRPAAEDSPFAALRNWKG"
FT   gene            complement(614582..615040)
FT                   /locus_tag="M446_0516"
FT   CDS_pept        complement(614582..615040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0516"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: osa:4332624 Os03g0309300"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15079"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM54"
FT                   /protein_id="ACA15079.1"
FT                   /translation="MSVGETERGLGGGPAGGEGADERRQPVDRGTGQLGGGAPGGLGAN
FT                   APGSGGGGLGGLAGAPGAGTDGLPGGGSVGTAGEGLARRRTLAGGGTGDLGSDLGANQG
FT                   GVAGGSTGDIGGGVGSTGDLGGDMGDDPLAGGGDVGRGAGTSGGRSGT"
FT   gene            complement(615084..616298)
FT                   /locus_tag="M446_0517"
FT   CDS_pept        complement(615084..616298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0517"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   mex:Mext_1916 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15080"
FT                   /db_xref="GOA:B0UM55"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM55"
FT                   /protein_id="ACA15080.1"
FT                   /translation="MSARPRLAVVSALGVVQILTWGTSYYLLTVLAPPIAAETGWPLPW
FT                   IVGSLSAGLLVSGLVSPRVGRAIGRSGGRPVLALAILVLALGLTVIGLAPSLPVFFAGW
FT                   LILGAGMGGGLYDAAFATLGRLYGAGARPAISALTLWGGFASTVCWPLSAVLVAQLGWR
FT                   GTCLAYAGLLLALALPLVLLVIPAPPPLPETAAAPAGSAALAPGERRAFLCLAGILTLG
FT                   GATTAIVSVHLLTLLQARGASLAAAVALGAVVGPAQVGARVIEMANRGRHHPIWTLTAA
FT                   MGLIAAGLVLLAFGVAWPALALVLYGAGNGVYSIARGTLPLALFGPLRYAPLVGRLARP
FT                   NLVAQALAPSAGAFVLAAAGAQAALALLTGLALANLVLVAALWRERRAAGEGAPAGEPG
FT                   SRPDR"
FT   gene            complement(616295..617632)
FT                   /locus_tag="M446_0518"
FT   CDS_pept        complement(616295..617632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0518"
FT                   /product="putative secreted protein"
FT                   /note="KEGG: mex:Mext_1915 putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15081"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM56"
FT                   /protein_id="ACA15081.1"
FT                   /translation="MSETPTFLPVAVIGAGPVGLAAAAHLVARGLPVKVYEAGTEVAAH
FT                   VRDWGHVRLFSPWAFNVDPAARALLARRGWEMPPESAHPTGAELVGRYLAPLAATPDLA
FT                   PAIETGARVTALSRKGLDKAAGRDRAARPFVLAVRERGGRLRRDLARAVIDASGTWATP
FT                   NPLGADGLPAAGEAALADRIATGIPDVLGRDRAAYAGRTTLVVGAGHSAANVLLDLGRL
FT                   AEEEEGTRLLWATRGTDLSRVYGGGAQDRLAARGDLGLRLRALVEAGRARLVRGFALTA
FT                   LRPAGAGLLVEGETGSGPCTLGPVDRIVTATGQRPDLALTRELRLDLDPGLESARALGP
FT                   LIDPNLHSCGSVPPHGHRELAHPEPGFYTAGIKSYGRAPTFLMMTGYEQVRSIAAALAG
FT                   DRAAADEVALVLPETGICTTARGADPGGDSGGAVSSGAGSCCGRAA"
FT   sig_peptide     complement(617561..617632)
FT                   /locus_tag="M446_0518"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.860) with cleavage site probability 0.349 at
FT                   residue 24"
FT   gene            complement(617680..617997)
FT                   /locus_tag="M446_0519"
FT   CDS_pept        complement(617680..617997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0519"
FT                   /product="putative transcriptional regulator, ArsR family"
FT                   /note="KEGG: mex:Mext_1914 transcriptional regulator, ArsR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15082"
FT                   /db_xref="GOA:B0UM57"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM57"
FT                   /protein_id="ACA15082.1"
FT                   /translation="MNVEQAAKQLEALGNPTRLRVYRALVRAGPAGLPVRQLQERVGLA
FT                   AASTLSHHLHRLILTGLVSQERQATTLICRAVYPSMDALLDFLTAECCADAGCARGDAA
FT                   A"
FT   gene            complement(618052..619107)
FT                   /locus_tag="M446_0520"
FT   CDS_pept        complement(618052..619107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0520"
FT                   /product="arsenical-resistance protein"
FT                   /note="TIGRFAM: arsenical-resistance protein; PFAM: Bile
FT                   acid:sodium symporter; KEGG: mex:Mext_3866
FT                   arsenical-resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15083"
FT                   /db_xref="GOA:B0UM58"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM58"
FT                   /protein_id="ACA15083.1"
FT                   /translation="MGTFERYLTLWVALCIVVGVALGHAVPGVFRAVGAAEIAKVNLPV
FT                   AGLIWLMVVPMLLKIDFAALRHVGRHWRGIGVTLLVNWAVKPFSMAALGWLFIGHLFRP
FT                   LLPADQIDGYVAGLIILAAAPCTAMVFVWSNLTRGEPHFTLSQVALNDGIMVVAFAPIV
FT                   GLLLGLSAITVPWGTLVLSVVLYIVIPVVVAQAARRSLLAAGGQPALDRLLARLGPASL
FT                   AALLATLVLLFGFQGEQILAQPAVIALLAVPILIQVYLNSGLAYLLNRLAGEQHCVAGP
FT                   SALIGASNFFELAVAAAISLFGFESGAALATVVGVLIEVPVMLSVVRIVNRSKDWYERG
FT                   AARARLAPQEG"
FT   sig_peptide     complement(619036..619107)
FT                   /locus_tag="M446_0520"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.876) with cleavage site probability 0.588 at
FT                   residue 24"
FT   gene            complement(619115..619540)
FT                   /locus_tag="M446_0521"
FT   CDS_pept        complement(619115..619540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0521"
FT                   /product="arsenate reductase"
FT                   /note="TIGRFAM: arsenate reductase; PFAM: arsenate
FT                   reductase and related; KEGG: mex:Mext_1910 arsenate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15084"
FT                   /db_xref="GOA:B0UM59"
FT                   /db_xref="InterPro:IPR006659"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM59"
FT                   /protein_id="ACA15084.1"
FT                   /translation="MDVVIYHNPACGTSRNALAMIRNAGIEPHVVESLKTPPSRAMVRA
FT                   LARRAGVTVRDLLREKGTPYAELGLGDPSLSEDQLLDAIAAHPILLNRPIVVSPLGVRL
FT                   CRPSEAVLDLLPAQQGEFVKEDGERVVDESGRRVATA"
FT   gene            complement(619656..620015)
FT                   /locus_tag="M446_0522"
FT   CDS_pept        complement(619656..620015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0522"
FT                   /product="putative transcriptional regulator, ArsR family"
FT                   /note="SMART: regulatory protein ArsR; KEGG: mex:Mext_3864
FT                   regulatory protein ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15085"
FT                   /db_xref="GOA:B0UM60"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM60"
FT                   /protein_id="ACA15085.1"
FT                   /translation="MDERQALAAFAALAQAHRLRSVRRLVAAGPDGMAAGSLAAEVGVA
FT                   VSNLSFHLKELAHAGLVQSRREGRSIIYSADYGALSGLIEFLMRDCCGGRPEVCAPAVT
FT                   ALAACCGPQETVSRA"
FT   gene            620066..620809
FT                   /locus_tag="M446_0523"
FT   CDS_pept        620066..620809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0523"
FT                   /product="arsenical resistance protein ArsH"
FT                   /note="TIGRFAM: arsenical resistance protein ArsH; PFAM:
FT                   NADPH-dependent FMN reductase; KEGG: mex:Mext_3863
FT                   arsenical resistance protein ArsH"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15086"
FT                   /db_xref="GOA:B0UM61"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR014063"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM61"
FT                   /protein_id="ACA15086.1"
FT                   /translation="MDKPLQPFADGLPNLAEAHFAVPSPAALEPGRHLTHAPRFLILYG
FT                   SLRERSFSRLLAYEAARLLERMGGEVRIYHAHGLPLPDDAPADHPKVQELRALSLWSEG
FT                   QVWVSPERHGALTGVMKSQIDWLPLAEGALRPTQGRTLAVMQVSGGSQSFNAVNALRVL
FT                   GRWMRMITIPNQSSVPMAYREFDEAGRMRPGPLYDRVVDVCEELVKFTLLTRDRAEYLV
FT                   DRYSERKERAPERLRAVEAEIGTGR"
FT   gene            621214..622185
FT                   /locus_tag="M446_0524"
FT   CDS_pept        621214..622185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0524"
FT                   /product="TRAP dicarboxylate transporter, DctP subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctP
FT                   subunit; PFAM: TRAP dicarboxylate transporter- DctP
FT                   subunit; KEGG: pol:Bpro_1871 TRAP dicarboxylate
FT                   transporter, DctP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15087"
FT                   /db_xref="GOA:B0UM62"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM62"
FT                   /protein_id="ACA15087.1"
FT                   /translation="MRAALAVLGLCSAVVGGRAEAQERVLRLGYLFSQASQLGAGAQRF
FT                   AEEVAKRTGNGTRVELYPNGSVGGEVEMVEELRLGHLDMAFLTSAPFASLIPEFGVFDI
FT                   PFLFRDARHAQAVLDGPIGQGYLRKFQQKGILALAWGENGMRHITNGKRPVTGPEDLQG
FT                   LSMRVPQSDVMLAGFRALGVKAEPLAFPALYGALQSGRFDGQENPIAVITASHFERVQT
FT                   HLTLSGHIYSWAAILIAKPAWEGLSPSEQRAFAEAARAGGEVSREVAGRAEKEGVEALR
FT                   RAGMAVVASVDRAAFARRLEATNAEFGRRFGADLIQQIKSVP"
FT   sig_peptide     621214..621279
FT                   /locus_tag="M446_0524"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.972 at
FT                   residue 22"
FT   gene            622199..624190
FT                   /locus_tag="M446_0525"
FT   CDS_pept        622199..624190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0525"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: rpb:RPB_3545
FT                   methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15088"
FT                   /db_xref="GOA:B0UM63"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM63"
FT                   /protein_id="ACA15088.1"
FT                   /translation="MPTLGLDRLSVAQRILAGFGVVLLLLGASALLTFRNASVLTAEVA
FT                   RAGERVEAAESASEFERFLNGVRRLVLNYMRTEQGEMLVELKAGLAKLAAESERMARSG
FT                   GAEAGPLAAHAKDYAAQAETLVAAMQARKAALGEVVKLGAALSNAGYAIAARAAREPDL
FT                   AAASFRADRALQSAIAAAILFRSSGNPADADTAGVELARYGREIDALARGDEGGTLQAS
FT                   LKVVAAKLPPFKAALGSSLDGAGSVEQAYQVLKRTGDALIGLGSATRAQAVREQQHLMG
FT                   QVAADAAELRLMVLAIGAAAVILGGVLAWRVGRGVARPLAAMTGAMQRLASGDYAVVVP
FT                   ALARRDEIGAMARAVQVFREALVAKQEADARAAREADATMRRADLLDRVTRHFEQNVSL
FT                   LTQGLAGAATEMEATARAMSATADQTAQQSAAAMGAAARTAGNVQTVAAASEEMSASIR
FT                   EIGQQVGQSARIAHRAAEEANRTDVLVGQLAAAAERIDAIVGMIGQIAGQTNLLALNAT
FT                   IEAARAGEAGRGFAVVASEVKALASQTTRATEEIAGQIRAIQDATHESVDAIRSIGRTI
FT                   TEMAGVAGAIAAAMEEQGAVTQDIARTVQEAARGTGQVTDGIAGVRDAAGSTGAAATQV
FT                   LGAAQELAQHSERLTQEVGAFLSAVKAA"
FT   sig_peptide     622199..622324
FT                   /locus_tag="M446_0525"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.603) with cleavage site probability 0.234 at
FT                   residue 42"
FT   gene            complement(624308..624766)
FT                   /pseudo
FT                   /locus_tag="M446_0526"
FT   gene            complement(624813..626756)
FT                   /locus_tag="M446_0527"
FT   CDS_pept        complement(624813..626756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0527"
FT                   /product="adenylate/guanylate cyclase with TPR repeats"
FT                   /note="PFAM: adenylyl cyclase class-3/4/guanylyl cyclase;
FT                   TPR repeat-containing protein; Tetratricopeptide TPR_2
FT                   repeat protein; SMART: Tetratricopeptide domain protein;
FT                   KEGG: bja:blr6986 putative adenylate cyclase 3"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15089"
FT                   /db_xref="GOA:B0UM64"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM64"
FT                   /protein_id="ACA15089.1"
FT                   /translation="MDKLVERRLAAILVVDVVGYSRLIGLDEAGTLRRLKALRRELVDP
FT                   AILSARGRIVKSTGDGLIAEFPSPVRAVACAVAIQKAMALRGAGEAQERALRLRVGINL
FT                   GDVVAEPDGDLYGDGVNVAARLEPLAEPGGICISRSVHDQVRDKLRYPFEDRGEQELRN
FT                   IARPVGVYALPAAAIPGLAEGEERPDEADPAPRRRPLRAVLLAGGVLSLLAAGALGWSY
FT                   RTGPARAPAPGPPATATRESEPAPRPRLSIVVLPFANLSNDPEQDFFADGITEDLTTDL
FT                   SHLAGSFVIARNTAFTYKGKPTDVKQVGRDLGVRYALEGSVRRTGERVVVNAQLISAET
FT                   GAHLWADRFEGERARLGELQAEFVGRLARSLDIQLIQAESQRSLRERPDNPDAADLAMR
FT                   GWAAVNKPRSRESLGEAVAFFEQALRRDPTNGFAKLGLARAMSSRVISRWSPDPAAEIA
FT                   EADRIVTAYLAEHANDPMAFYVKAEIYKYRKNFDAALPLYLKSVELDKNFAQGYATIGN
FT                   VKILSGKSAESFAYTEKALRLSPRDPAAKIWKYFICHANAHLARWDEAITTCNQAIADG
FT                   PFWQTYIDLAAAYAWKGRASEAGHAVAELLKLMPGYTVEKWAKADWSDDPTFLDEYRRI
FT                   TEGLRKAGLPDA"
FT   gene            complement(627012..628415)
FT                   /locus_tag="M446_0528"
FT   CDS_pept        complement(627012..628415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0528"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: bja:bll3875
FT                   hypothetical metabolite transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15090"
FT                   /db_xref="GOA:B0UM65"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM65"
FT                   /protein_id="ACA15090.1"
FT                   /translation="MRPDATTAPVNAGGRLDRLPIGPFHYRIMWLIGIGMFFDGFDIYI
FT                   AGTVLGATLKSGFSTLPENALFVSSTFVGMMAGSFLTGFLGDRYGRRFTYQANLLIFGL
FT                   AAIAAAFAPSMTVLIVLRFIMGVGLGAENVVGYSTMTEFVPARSRGRWLGLMAVFVVTG
FT                   LPVASLAGYVVIPLLGWRAMFVLGGLGALGVWYLRKRLPESPRWLEAVGRTEEADALLR
FT                   EIEREAARGGALPPPAPLGPPAPKAAFATLFRPPLLGRVIVGCLCLIVINTLLYGFVTW
FT                   LPTFFIKQGLSVATSFGYSLLMGLGAPIGSAIGALTADRWGRKPTIAGASAAAILFGLL
FT                   YPLTTDPVLLPLVGFGLTVPIYVLVALLFGIYIPELFPTEVRLRASGLCNTFGRGATIV
FT                   TPFIVVSLFQTYGIGGVMALMIGLLAVQIVTVLALGVEPRQQSLEEMKPRDLGGVQEEP
FT                   VRTVQRGLA"
FT   gene            complement(628495..630015)
FT                   /locus_tag="M446_0529"
FT   CDS_pept        complement(628495..630015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0529"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: bja:bll3876
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15091"
FT                   /db_xref="GOA:B0UM66"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM66"
FT                   /protein_id="ACA15091.1"
FT                   /translation="MVSRPDLAVETRGNFVDGREIEAGDGTLIDVRNPATGAVIARIPN
FT                   STEADVDRAMRSARAAFESREWGGLDTRARAKLVNRLADAFEANLDTLYRLETLNNGRP
FT                   VNETRAQLSRLPDFFRYFAGLALSRRDAVIPVEGSYLNYTRRTPIGVVANCTPFNHPLM
FT                   ILCKSLAAVLATGCTTVVKPSEYTPLTTLKLAQIFTEAGLPNGVFNIVLGLGPTTGRSL
FT                   AEHRDINKLVLTGGTEAGRIAGSAAARVFAHQTMELGGKTPVMVFDDFDLDQAVNYAAF
FT                   GAFIGAGQTCVCASRHLVQDTIYDAFVEKLAAKAKSIRIGDPFDPATQLGPVISQKQRD
FT                   RVLTYAAHGRDEGARAVAGGRAARIPGFEEGYFVEPTVFADVRAEMRIFQEEVFGPFTS
FT                   VTPFRDEAEALRLANDSPFGLAAAVRTRDVARAHRVAAAVKAGIVWINDHHRLDPASPW
FT                   GGVDDSGLGRECGAESFDDHFNVKSIMVATHDAPFDWYRDTAGQRRLN"
FT   gene            complement(630035..630697)
FT                   /locus_tag="M446_0530"
FT   CDS_pept        complement(630035..630697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0530"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: bja:bll3877 transcriptional regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15092"
FT                   /db_xref="GOA:B0UM67"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM67"
FT                   /protein_id="ACA15092.1"
FT                   /translation="MLRQPERVTIVLLRDTIYEAIRAEILTCRVPPGAEVREQELAERF
FT                   EVSRQPVREALLRLERERLVTVHPRQGYQVNPISVADARDLLQFRLVVEPACAGEAAES
FT                   APPAVLAGLDAFRELPEGGDFIAYNRAFHTALAEASGNRRMAAVTRDLIEQADRLVRVS
FT                   LATIRGRDPAQLIAEHAGIIDAVQRRDARAARRRVRDHVARAERRIIPALERSAVIL"
FT   gene            630806..631600
FT                   /locus_tag="M446_0531"
FT   CDS_pept        630806..631600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0531"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: bja:blr3878
FT                   putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15093"
FT                   /db_xref="GOA:B0UM68"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM68"
FT                   /protein_id="ACA15093.1"
FT                   /translation="MRVTLAGGISAEVLGDGTPLVLLHSLLSDRASFDRVREPLAARFR
FT                   VVVPDLPGFGGSRPAAGGLAAVADRVAEAVRDLGGAAPILLGNGYGGFVALQLAIRHPG
FT                   LAGRLVLADCGACFPEPGRQAFRTMAAVAAEKGLAALTDTAMRRLFAPAFQAANEALMA
FT                   ERRAAFLRTDPAVFRAACEALAGLDLRPDLAGVTVPALVLVGEEDEATPPAMARDLARG
FT                   LPDARLAILPGCAHVPPLQDPALFLAAVTPFLEESPAGSRAA"
FT   gene            complement(631608..631853)
FT                   /locus_tag="M446_0532"
FT   CDS_pept        complement(631608..631853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0532"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15094"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM69"
FT                   /protein_id="ACA15094.1"
FT                   /translation="MAASAVGRERARARESPLRLAKPAGAGLPVTRVADTNPALAEPSR
FT                   RRARSKAGWHSREPAVPRGVAVPMPGTAVEGLAGVG"
FT   gene            632030..633298
FT                   /locus_tag="M446_0533"
FT   CDS_pept        632030..633298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0533"
FT                   /product="adenylate/guanylate cyclase"
FT                   /EC_number="4.6.1.2"
FT                   /note="PFAM: adenylyl cyclase class-3/4/guanylyl cyclase;
FT                   KEGG: ter:Tery_2417 adenylate/guanylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15095"
FT                   /db_xref="GOA:B0UM70"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM70"
FT                   /protein_id="ACA15095.1"
FT                   /translation="MSRDAPSRSSLLSQFPAKLRLEKFDDCIEADFKEEVRKQCIDSVK
FT                   LVLPVTVVLHLLMPVGATYVFPHPQVIITYHFFIALSCVAGVMMLRWKTYRKHILNLGI
FT                   LVWFACASAAVLALIYTENGIYYYIGAIIFTTFYAGGFIRTTFDRASICCILVFTCSNA
FT                   GLFLKSFDTKAFVYVNSFLLYTIFITLATCFFVEKTERQKFKLERELRSERDRIDRILR
FT                   DILPMQIYDRIKGGENHIADLNDHVTISFCDIVGFTHLASRTSPHDVIRLLNDLFSQLD
FT                   DIAAKHGIEKIKTIGDAYMAAAGVGDAIHKDAHAVAGFALDARRAVLETGERHGAAIQM
FT                   RFGIATGQVISGVIGVTRPVFDVWGSTVNLASRLETASPPGAITLDARTAELLDRRFRV
FT                   RPSGCIALKGIGAVATFQLVHSN"
FT   gene            complement(633626..635554)
FT                   /locus_tag="M446_0534"
FT   CDS_pept        complement(633626..635554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0534"
FT                   /product="adenylate/guanylate cyclase"
FT                   /note="PFAM: adenylyl cyclase class-3/4/guanylyl cyclase;
FT                   KEGG: bja:blr6986 putative adenylate cyclase 3"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15096"
FT                   /db_xref="GOA:B0UM71"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM71"
FT                   /protein_id="ACA15096.1"
FT                   /translation="MDKALNRRLAAILVADIVGYSRLMGADEAGTLRRLKALRRELVDP
FT                   RIAAAGGRIVKTTGDGLVVEFPSPLRAVSCAVAIQKGMLTRDAGTPEDRVFRLRIGINV
FT                   GDVVAEPDGDLYGDGVNVAARLEPLAEPGGICISRSVHDQVRDKLRYPFEDRGEQELRN
FT                   IARPLGVFALPAAVIPSLPETDEEPGPGRAERPLRRVALASGLVALLAAGGLGWWLSAP
FT                   ARPPVPNPGALPAAAAVNPAPRLSLVVLPFTNLSNDPEQDFFADAITEDLTTDVSHLAD
FT                   SFVIARNTAFTYKGKPVDVKQIGRDLGVRYVLEGSVRRTGENVVLNAQLISAETGAHLW
FT                   ADRFDGERGRLGDLQVEFVARLARSLDVQLTQAESLRSLRERPTDPGASDLAMRGWAAL
FT                   NKPRSLASNNEAQDYFERALALDPTLPRAILGLSRALITKPSMSWSRDKDKDIKDAEDL
FT                   IDKYLASYPGDAVALVVKGDVFRARRQFDSARSMYEAAIAGNRNYAMAQALKGHVSTLT
FT                   GKASEAISSELQAIRLSPRDPLLNVWYYFVCHAHTHQRHWDEAITWCNKSVALSPYWLS
FT                   SIDLAAAYAWQGRQAEARAAVAEILKLMPGYTVQKWANAGWSDNPVFLEEYQYVVEGLR
FT                   KAGLPEN"
FT   gene            complement(635881..636141)
FT                   /locus_tag="M446_0535"
FT   CDS_pept        complement(635881..636141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0535"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mex:Mext_4377 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15097"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM72"
FT                   /protein_id="ACA15097.1"
FT                   /translation="MWTGCGTLGELYRARIVSDEQLNQAISGYLADTKPGPRVIADGVM
FT                   LDIDAAVLSHGWAHLVAHDRRATEPARRSAIRTALLLAALG"
FT   gene            complement(636279..637208)
FT                   /locus_tag="M446_0536"
FT   CDS_pept        complement(636279..637208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0536"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rxy:Rxyl_2039 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15098"
FT                   /db_xref="GOA:B0UM73"
FT                   /db_xref="InterPro:IPR022270"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM73"
FT                   /protein_id="ACA15098.1"
FT                   /translation="MRAAHPTLAAGPRPVPSRPEAAPLAVLAIAFALTGALPVPTRWEG
FT                   VTALVLLFGVPHGALDGEIARPLLRPRFGRLWFPAFALPYLGLSALVLACWRVAPLATL
FT                   AGFFALSVWHFGSEDAGPGRPIEALVRGGLPIAVPSLLHPDGVARLFSAVTGVPLGESP
FT                   TWLGASSWLWVALACGWVLRGCAERRRATAAEMAGLVAAFAVLPPLSAFGLYFVCVHAP
FT                   RHVRELVRDGRAPRVRSLREATVRALPVTLLTFAIGAALWPLYPGPAPERLVALTLQGL
FT                   AALTLPHMALDALTRAVRGRPSRPGREG"
FT   gene            complement(637214..637972)
FT                   /locus_tag="M446_0537"
FT   CDS_pept        complement(637214..637972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0537"
FT                   /product="rhodopsin"
FT                   /note="PFAM: rhodopsin; KEGG: rxy:Rxyl_2037 rhodopsin"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15099"
FT                   /db_xref="GOA:B0UM74"
FT                   /db_xref="InterPro:IPR001425"
FT                   /db_xref="InterPro:IPR018229"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM74"
FT                   /protein_id="ACA15099.1"
FT                   /translation="MTVQTWLWLTLFAMSLGAAAILFTAKRRTPEEETDGILHGIVPLI
FT                   AAASYLAMACGQGAIRLPLGADPAAQWDFYFARYIDWTFTTPILLYALATDAMHSGMRR
FT                   HGAVFGMLAADVLMIATALFFGASATAWIKWTWYAVSCGAFLGVYYVIWVPLLEESRRE
FT                   REDVRAAFRRNAAFLSVVWLIYPLVLIVGTDGLKLVSPVLTTALIAVLDVVAKVVFGLM
FT                   AVGERARIVDRDLHETRPVRRSAPSLAPAE"
FT   sig_peptide     complement(637910..637972)
FT                   /locus_tag="M446_0537"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.944) with cleavage site probability 0.699 at
FT                   residue 21"
FT   gene            638437..639255
FT                   /locus_tag="M446_0538"
FT   CDS_pept        638437..639255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0538"
FT                   /product="Collagen triple helix repeat"
FT                   /note="PFAM: Collagen triple helix repeat; KEGG: mmu:12842
FT                   collagen, type I, alpha 1"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15100"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM75"
FT                   /protein_id="ACA15100.1"
FT                   /translation="MLGRWLVPAITSAWVGSSPALAEMRILAAKITAGELWVLGSVDEP
FT                   DDEITLDQHFRTRADASGRFEFHVTYHPATCIVMLQTKRQGRRAVVGDCGQRGAAGEPG
FT                   PQGAPGPRGETGAAGQAAAVGTAGPAGPPGPVGPAGPAGPPGEVGAAGPPGPRGETGAA
FT                   GPAGPPGPPGSPGPPGSPGPKGDRGEPGPRGPAGEPGPEGPSGPPGGRGAMGPPGKVGP
FT                   RGPAGPPGPRGPAGSPAAAPRRPPASARPAERREPLPIQPAPAPETQPPY"
FT   sig_peptide     638437..638505
FT                   /locus_tag="M446_0538"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.994 at
FT                   residue 23"
FT   gene            639372..640223
FT                   /locus_tag="M446_0539"
FT   CDS_pept        639372..640223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0539"
FT                   /product="protein of unknown function DUF1206"
FT                   /note="PFAM: protein of unknown function DUF1206; KEGG:
FT                   mex:Mext_2038 protein of unknown function DUF1206"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15101"
FT                   /db_xref="GOA:B0UM76"
FT                   /db_xref="InterPro:IPR009597"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM76"
FT                   /protein_id="ACA15101.1"
FT                   /translation="MHRVGTHALALLARFGYAARGVVSCLVGGLAVLAALGSGGQAGGS
FT                   RSALATLLDQPFGRLWLGLIAVGLLGFAVWRVVEAATDADHLGRSAKALAKRAGHVVSG
FT                   VVYGGLAASAAQLALGRRRGGGDDQAARDWTAWVLEKPLGQWAVGSAGLLLIGVGLALV
FT                   VKGWKGDVLQRLAPPETVRRWAVPLGRLGFAARGVVFVLIGGFLVLAAVQSRSSDVKGL
FT                   GGALHVLQRQPYGWALLAVTALGLTAFGLFGLVQARYRRIDPPDMSEAKAAVGGIVSRA
FT                   TR"
FT   gene            641718..644888
FT                   /locus_tag="M446_0540"
FT   CDS_pept        641718..644888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0540"
FT                   /product="peptidase C14 caspase catalytic subunit p20"
FT                   /note="PFAM: TPR repeat-containing protein; peptidase C14
FT                   caspase catalytic subunit p20; Tetratricopeptide TPR_3;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: pmt:PMT0296 TPR
FT                   repeat"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15102"
FT                   /db_xref="GOA:B0UM77"
FT                   /db_xref="InterPro:IPR001309"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029030"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM77"
FT                   /protein_id="ACA15102.1"
FT                   /translation="MRKATALVLALGLLGQASSGARALDAIGHNARGFELQNRGEHEKA
FT                   IAEFNLALRLNPKLVSAYINRGFAFRNKGDYDRAIADYDHALQIDPNSVVAFNNRGDAF
FT                   YHKGEYDRAIADYNRSIKLSSDKAAVYNNRGLAFFSKEEYDRAIADYNQALRLDPKYLS
FT                   AALNRGDAFRSKGEYDRAIADYNQVLQIDPRSVVSYNNRGLAFQGKGEYDRAVADYNQA
FT                   LTLDPGYTIALINRGDVFRIKGQYDSAIENYNQALQLNPKSKIAYNNRGFVFYNKGEYD
FT                   RAIADYNSALQIDPRYVVALVNRGDAFVSKGDYDRAIGDYGHALQINPNYAFAYNGRGV
FT                   ALQNKGEYDRAIMDYDQALRLDPKYVFAFANRGDAFRSKGEHDVAIADYNQALRLSPNY
FT                   AKAYNGRGLSFQNKAQYNRAIEDYEQVIRLDPRFVAAYNNRGFALVSKGEPTLAIADYD
FT                   KALLLDPKSATVYANRGRAFQDKGEYDRAIADYDQALRLNPKDAIALNNRADILRLRHE
FT                   HDRAIASYDQALQLNPKYVGAYNSRGLAFQDKGEYDRAIANYDQALQLNPRYITAYINR
FT                   GDAYRRKGEHARAISDYNQALQIDQNSVIAYNNRGLCFHEQGEYDRAIIDYDRALQIDP
FT                   MYSTGFINRGFAFHKKGEYDRAIADYDRALQIDPRSATAYNNRGFTFQNRGEYDLAIVD
FT                   YDKAILIKPDLANSYYHRGTVLRLKGDLERSVADLTEAIRLNPRYAEAYQDRGLTFHAK
FT                   GEADRALADFAEAARLKPEFENDPAFLAARRVAQEGRAGQASAASVVAAVHAPPVVAPP
FT                   PVSAAAPVSETRVALVIGNGAYASVASLENPTRDARAIARSLREAGFKIVHLENDLRYD
FT                   DLRRALNNFSAEADQADWAVVYYAGHGIEVGGLNYIVPIDARLKTDRAVQFEAVPLDQV
FT                   LSSIEGARKLRLVILDACRDNPFLQQMTRTVAWRSVGRGLAKVEPETSGTLVAFAAKHG
FT                   QVALDAQDGRENSPFATALIRNIARPGIEIRKMFGIVHDDVMSGTGRKQEPFVYGALGG
FT                   EDYFFNVR"
FT   sig_peptide     641718..641789
FT                   /locus_tag="M446_0540"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.905 at
FT                   residue 24"
FT   gene            complement(645261..645539)
FT                   /locus_tag="M446_0541"
FT   CDS_pept        complement(645261..645539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0541"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mex:Mext_0496 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15103"
FT                   /db_xref="GOA:B0UM78"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM78"
FT                   /protein_id="ACA15103.1"
FT                   /translation="MFLLVFAALGGGLTTAVLMRDYGALGALLAAPLGGSACAVLAGLG
FT                   LAMRRGPEAPTLPALDEQTDAMVAALREVSARSGASGTAPGERRGAA"
FT   gene            646715..647227
FT                   /locus_tag="M446_0542"
FT   CDS_pept        646715..647227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0542"
FT                   /product="protein of unknown function DUF336"
FT                   /note="PFAM: protein of unknown function DUF336; KEGG:
FT                   lil:LA0341 GlcG protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15104"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="InterPro:IPR038084"
FT                   /db_xref="UniProtKB/TrEMBL:B0UM79"
FT                   /protein_id="ACA15104.1"
FT                   /translation="MSFLLGCIVLGCTALAPSGRAQQAVPAPAQQAIPPYGPPLSLDTA
FT                   RRVAEGAEAEAKRNGWPVAVAIVDSTGHLVLFEKLDNTQYGSIEVATQKAVTAINYRRP
FT                   GKALQDALANGGVGLRVLTLPGISAYEGGYPLEADGKLVGAIGVSGVLPVQDDQVARAG
FT                   VEAMRAR"
FT   sig_peptide     646715..646786
FT                   /locus_tag="M446_0542"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.555 at
FT                   residue 24"
FT   gene            complement(647370..649451)
FT                   /locus_tag="M446_0543"
FT   CDS_pept        complement(647370..649451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0543"
FT                   /product="flagellin hook IN repeat protein"
FT                   /note="PFAM: flagellin hook IN repeat protein; KEGG:
FT                   rpd:RPD_1670 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15105"
FT                   /db_xref="GOA:B0UNC5"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR010810"
FT                   /db_xref="UniProtKB/TrEMBL:B0UNC5"
FT                   /protein_id="ACA15105.1"
FT                   /translation="MSSITLSAATRQNLLSLQDTASLLATTQNRLATSKKVNTALDNPT
FT                   NFFTADGLSSRSTALSSLLDSVSNGIQTIQAANTGLTKVQTLTDQLKSVAQQALASANS
FT                   FSVKATSVSTALTGASAQNLLSTGATQAVSDTALSANATATAATVTAGTAYSNGVATYT
FT                   AGSYTTLTASATVTLNGTAIALATGDDINAAVTKINAQSATTGVTVAASGGKLVFTGSN
FT                   SGAQFTYAATGSETGLAASGTTTNGAGASSTTLTINGTTITVATGSTESQVINAINAVT
FT                   STTGVTASDNSGKIKLTGAADGSSITVQGGTGSQVGFGTTASTTAGTFSPSAATLAIAV
FT                   GFKAGDNFTVNGQSVNIAAGDTLGSIAQKVSTATSGTVSASYDATNRKFTFTAADTNTA
FT                   ITLGNGSTATSLLSNLGFNSPTTFAAGLGAPGSSSALAGKSLTVQVGSGPSATFTFGSA
FT                   AGQISTLTQLNSALAAANAQASIDTATGRISITTANDSGTDDLKITASGTGNPFNSGTS
FT                   SAVIGGDGLTARNGLVSTFNNLLTQIDQLAADSGYNGVNLLAGDTLKISFNEKNTSTLS
FT                   VQGSTVSYTQLGLSVLSQSDFQENSAINKVIKSINTAASSLKSQASSLGANLAVVQNRQ
FT                   DFTKQMINVLDTGAANLTNADLNEEAANSQALSTRNSLGISALSLANQAQQSVLQLLR"
FT   gene            649860..650126
FT                   /locus_tag="M446_0544"
FT   CDS_pept        649860..650126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0544"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15106"
FT                   /db_xref="GOA:B0UNC6"
FT                   /db_xref="InterPro:IPR009967"
FT                   /db_xref="UniProtKB/TrEMBL:B0UNC6"
FT                   /protein_id="ACA15106.1"
FT                   /translation="MQNVHLDVDPDHALDDLARISAQILARMPEAGPYVSRIEKAIAEG
FT                   QTYLALKHGRALVAHEAAQAPAARPAGAAGARRAARPAPPSGA"
FT   gene            complement(650273..650977)
FT                   /locus_tag="M446_0545"
FT   CDS_pept        complement(650273..650977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0545"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mex:Mext_1284 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15107"
FT                   /db_xref="GOA:B0UNC7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0UNC7"
FT                   /protein_id="ACA15107.1"
FT                   /translation="MLEIRGLHAWYGASHVLHGLSLEVREGEILALIGRNGAGKTTTLR
FT                   AVMGLMPKVSGAVRFRGEELLGRPAHARFPLGLAYVPEDRRIVPGLTVRENLRLGLLRA
FT                   PRNLAEGPAIAAIAETFPRLAERLDQIAVTMSGGEQQMLAIARAMIARPRLILLDEPSE
FT                   GIMPVLVEEMGRLFASLRAGGTTLLLVEQNVEWALNLADRAVIIDQGAVVHESSAAALR
FT                   EDAEIQDRYCAV"
FT   gene            complement(650970..651752)
FT                   /locus_tag="M446_0546"
FT   CDS_pept        complement(650970..651752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0546"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mex:Mext_1285 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15108"
FT                   /db_xref="GOA:B0UNC8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:B0UNC8"
FT                   /protein_id="ACA15108.1"
FT                   /translation="MAQVSTGAGEVLLEARGLGRRFGDFVALDGVSAQFRAGRITAVIG
FT                   PNGAGKSTFFNLLSGALRPTSGTLLFGGRPIAGLPQHRFAHLGIARSYQITSLFPRLTA
FT                   HENLRTAMQAFAARYDLWTRRDALRDLAERADVLLEAIGLAARRDRPAASLSHGEQRAL
FT                   EIGVALAAAPKLLLLDEPTAGMGPEETKAMVALLRRLSEERTILLVEHKMKMILGLSER
FT                   ILVLHHGRLIADGTPAEIQSDAEVRRVYLGQSGGYGHA"
FT   gene            complement(651740..652753)
FT                   /locus_tag="M446_0547"
FT   CDS_pept        complement(651740..652753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0547"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   mex:Mext_1286 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15109"
FT                   /db_xref="GOA:B0UNC9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B0UNC9"
FT                   /protein_id="ACA15109.1"
FT                   /translation="MTALDPAAAPGLPEAASRRSPLAAGALSRWRAPASVAALALLPLV
FT                   LPSQALAVNVLIYGLYATGYNLLYGYTGLLSFGHAAFFGTGAYATGIAIGAFGLHPLAA
FT                   MALGIVLAGLLALAIGALSIRSRGIYFAMVTLALAQLVYYAALQASGWTGGENGLRGFT
FT                   VARIGLGPVGLDILDPATKYAFVLACVAAALAAMSRILASPFGAVIEAIRENEARARAC
FT                   GFDVERTKLLAFVLSGLFCGLAGALSALHLSIVPLDSLAYPLSGTAVVMTLVGGAGTFF
FT                   GPFLGALAVLVLEDSLSLWTSHWQLALGVVFILFVLFLPRGLGGAALALGRLAWRR"
FT   gene            complement(652764..653654)
FT                   /locus_tag="M446_0548"
FT   CDS_pept        complement(652764..653654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0548"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   mex:Mext_1287 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15110"
FT                   /db_xref="GOA:B0UND0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B0UND0"
FT                   /protein_id="ACA15110.1"
FT                   /translation="MTFEFLDVELVAMQLFSGVALGAVFVMLALGLSIIFGMLGIVNFA
FT                   HGNFFMIGAYAGVFVLERTGSFWLALLLGPLLVGALGLVVERLLIRPLAGRSPDDALLL
FT                   TFGLGYVLVEGVRILFGSDGLPVATPEALSGVADLGIGLFPVYRLFVIGVVALVLLLLW
FT                   WALERTRLGLIVRAGARDPEILRVLGVDIQRLWLWVFGLGIALAALGGVLAAPMRSVNP
FT                   EMGSAVLSEAFAVTVIGGMGSLLGSVAAGLLVGIVVSLTALVAPEMANIAVFAFMALVL
FT                   LARPHGLFGKPGLGT"
FT   gene            complement(653671..654912)
FT                   /locus_tag="M446_0549"
FT   CDS_pept        complement(653671..654912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0549"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   mex:Mext_1288 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15111"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B0UND1"
FT                   /protein_id="ACA15111.1"
FT                   /translation="MGGFLAGGAAPTRRAVIGGGLALGALAGLGRPARAAEPIRIGFPV
FT                   PITGPFGAEAKDQVRSAELAVRQFNEAGGLGGRMAELLVRDDKLNPGEAATRTLELIEK
FT                   DRAHFIVGALSSAVQLSVNEITRSRKVLYVSISQSDTINEAKDFGRTTFHEALNPHMTT
FT                   AAVAKHAFRKGSRIAYLAADYAYGHEMLRGFKRAAAAIGAETAGEILHPFGAPDYSTFM
FT                   PRLRTMRPDILCICNFGRDQANAIKQANDFGMKRASRLVVPVLLHNQRLAAGPDAFEGV
FT                   VGAANYFWRLEETVPSARAFNDAFRAAHGGAVPTDYGAYAYTAVRALLMAVTKAGGTDT
FT                   EAVVTALEGLTYDVAKGPEHYRACDHQAVQSVLVLESKKKSEMAGEADLFTILAIEPGS
FT                   EAALRSCEELGHRA"
FT   sig_peptide     complement(654805..654912)
FT                   /locus_tag="M446_0549"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.905) with cleavage site probability 0.904 at
FT                   residue 36"
FT   gene            complement(654961..657333)
FT                   /locus_tag="M446_0550"
FT   CDS_pept        complement(654961..657333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0550"
FT                   /product="aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding"
FT                   /note="PFAM: aldehyde oxidase and xanthine dehydrogenase
FT                   a/b hammerhead; aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding; KEGG: mex:Mext_1289 carbon-monoxide
FT                   dehydrogenase (acceptor)"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15112"
FT                   /db_xref="GOA:B0UND2"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:B0UND2"
FT                   /protein_id="ACA15112.1"
FT                   /translation="MSPSSDSPHRAPGGYIGAALPRPGAKRLLQGRGRYTDDIVLPRML
FT                   HAAFLRSPYAHARLLALRIEAALALPGVRRVLTGADFEGICAPWTGTLGHFAGMKSSPQ
FT                   RPLATGKVVWAGQPVAMVLAESRAEAEDALEAIEAEFEELDPVVDPEAALAQGAALIDE
FT                   ALGDNLIFRTRIESGSPDSAFAGAETVEAEFRFGRHTAVTLEPRTILADYDPGEERLTV
FT                   HQSTQTPYQFQDLYARHFGLAESRVRVVAPDVGGSFGMKLHLYHEDMAVVGASLLTGRP
FT                   VKFAADRIESFLSDIHARDHRVRARLAVAPDGTLRGIEVEDLTGVGPFSAYPRTSAVEG
FT                   NQVVRLIGAPYRIADYRADLRVVAQTKTQMSQYRAVGHPIACAVTERLVDLAAERVGLD
FT                   PFEIRRRNYVTQDMYPHTTASGYRFERLSLETCLEQLHALMDYPALRAEQAALRARGVH
FT                   RGIGLATYVEITNPSPAFYGVGGAHIAAQDGCVLKLTPSGEVQCLISVTEQGQGTEAIM
FT                   GQIVAEGLGIRREAVRVITGDTDVTPSGGATWACRGAGIGGETALQASRKLRRRVLEIA
FT                   GAILQAAPDALALRDGQILGPEGTARMSLGDLATLVAFRSDLLPPGIAPDLTVAHHHAP
FT                   RGYPFAFSNGIHGSLVEVDAETGLVRILRHWVVEDCGRIINPLLVDEQIRGGVVQGLGA
FT                   AFFEECRYDERGQLLNGSLADYLVPMACEMPDIVIRHVETPTRDSDLGAKGVGEAGTAA
FT                   ASGAALNAVNDALRPFGAALAQLPMTPERILRALGTV"
FT   gene            complement(657330..657818)
FT                   /locus_tag="M446_0551"
FT   CDS_pept        complement(657330..657818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0551"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /note="PFAM: ferredoxin; [2Fe-2S]-binding domain protein;
FT                   KEGG: mex:Mext_1290 (2Fe-2S)-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15113"
FT                   /db_xref="GOA:B0UND3"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:B0UND3"
FT                   /protein_id="ACA15113.1"
FT                   /translation="MTEPLPIRLTVNGAPVRRFVEPRLSLADFLRQDLGLTGTHLGCEM
FT                   GACGACLVRLDGRAVHACLTLAVQADGGTVETVEGLTEAGTLADLQAAFHARNALQCGY
FT                   CTPGMLVAAQDYLAQDGAPSREAIRDALSGNYCRCTGYEAIVDAIAEVARARRAGRQA"
FT   gene            complement(657815..658681)
FT                   /locus_tag="M446_0552"
FT   CDS_pept        complement(657815..658681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0552"
FT                   /product="molybdopterin dehydrogenase FAD-binding"
FT                   /note="PFAM: molybdopterin dehydrogenase FAD-binding; CO
FT                   dehydrogenase flavoprotein domain protein; KEGG:
FT                   mex:Mext_1291 molybdopterin dehydrogenase FAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15114"
FT                   /db_xref="GOA:B0UND4"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:B0UND4"
FT                   /protein_id="ACA15114.1"
FT                   /translation="MKARAFAYRRVESLQEALAAFAACEGEARYLTGGQSLLPALKLRL
FT                   DAPDLLIDIGRIAALRGIADGPGGLRLGALTRHAEILRDPLVAARAPLLAEAAAHVAHP
FT                   AIRNQGTLGGNLALADPASEFPACMLALGARMEIAGAGGARMVAAEDFFRDLYDTALAP
FT                   GEILAAVWVPPPAPGQRHRFDELARRRGDYALAGLAASADLREAGRVAAIRLAFCAVGP
FT                   TPMRAPRAEAALTGRPLDREAIRAAQAALGDDLAPADDASLSGAVRLHLARVLLGRVLA
FT                   SLAGEAP"
FT   gene            658822..659523
FT                   /locus_tag="M446_0553"
FT   CDS_pept        658822..659523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0553"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: mex:Mext_1292
FT                   regulatory protein TetR"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15115"
FT                   /db_xref="GOA:B0UND5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B0UND5"
FT                   /protein_id="ACA15115.1"
FT                   /translation="MSEGVVTGPPARRRRHLPAAERERMIIEGATRFFAARGFEGQTRD
FT                   LARGLGITHSAIFRYFPTKEALIDRVYEHVYVSRWNPDWAGLIQDRSQPLEARLVRFYR
FT                   EYAERIFDYDWVRIFIHSGLKGTDITPRYLTVVRDKLIRPVCAELRASFGLPDPDEVPL
FT                   AEREEEAVWALHGKVFYLAIRRFIYGWPVPDDVAPIIADDVRIFLRGAPAVIAECCRPA
FT                   GGAGEAARDDA"
FT   gene            659757..660392
FT                   /locus_tag="M446_0554"
FT   CDS_pept        659757..660392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0554"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mes:Meso_4140 putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15116"
FT                   /db_xref="GOA:B0UND6"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:B0UND6"
FT                   /protein_id="ACA15116.1"
FT                   /translation="MSEADSRAARQARAYKVTIWSIAGGTFLFALAQAGWAVSLGSAQF
FT                   LKDAVDWIYTVLLYGIAAVVFGRGAAVERLSALAIAAILAVAGLHTLYDLSQKIADPRP
FT                   IDPGLLGFSAASAIAIGSLTAGALARFRHDPNPLITATWLSARNDAVTTTVSAGVTLAL
FT                   RLAPVRWPEYALDVLDAGLAFQAACVTARSAAASASAGESGPPSAPAR"
FT   gene            complement(660411..661910)
FT                   /locus_tag="M446_0555"
FT   CDS_pept        complement(660411..661910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0555"
FT                   /product="Amidase"
FT                   /EC_number="3.5.1.4"
FT                   /note="PFAM: Amidase; KEGG: ade:Adeh_3433 amidase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15117"
FT                   /db_xref="GOA:B0UND7"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:B0UND7"
FT                   /protein_id="ACA15117.1"
FT                   /translation="MSLGEDYPGLDATALADLVRRRQVGPAELVEAAIARLEQVEPHLA
FT                   GMTEWALDQARRAAREPVGGPFAGVPFLLKDNMHVAAGLPYHNGSRIWRGWVPPRDSEM
FT                   VRRFRAAGLIILGSTKVPELSLTPVTEPRHLGPARNPWALDRTAGGSSGGSAAHVAARS
FT                   VPMAHATDGGGSIRIPASCCGLFGLKPSRGRTPNGPYLGEGWHGAAVGHVLTRSVRDSA
FT                   RLLDAVAGPDPGAPCALARPGQSFAAAAARPPERLRIAWSSQAPNGAPVDPECRQAVED
FT                   AAGLCAALGHAVVEAAPRIPDAYFDWFLTVFLAAVAQEFTFAEETTGHRARRAEVEEST
FT                   WLCRALGHGFSAAELSLALERLHRTSRRIASFFDSCDVLLTPTLASPPVRHGDLRSRGL
FT                   DAVLEALAARLGVGRYLRYGPLLRQAAERAFRFIPFTPVWNMTGQPAASLPLHWTPDGL
FT                   PVGVQAVGRVGEEATLLALAAELEQAHPWSHRLPPLGAASA"
FT   gene            662464..664434
FT                   /locus_tag="M446_0556"
FT   CDS_pept        662464..664434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0556"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mex:Mext_1188 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15118"
FT                   /db_xref="UniProtKB/TrEMBL:B0UND8"
FT                   /protein_id="ACA15118.1"
FT                   /translation="MWKVATALLGAFVCGHWAQPAQARITAIEVRTVEPFAEGQSFGES
FT                   GPYERVIGTARGELDPADPRNAGIADIALAPRNARGLVEYRTDFFMLRPSDPARGSGTL
FT                   LYEVVNRGRKFLFNWVLDAPPQGAQAVNDPRTLQDAGTALVLRRGDTIVWSGWEADALR
FT                   QQGGMAIDVPVATRGGKPIVETVRDELVSATRGPPEAPFLLTFKAASLDRAGASLTVRR
FT                   READAPRPVPESAWTLASAGELRLLPEGLKPEPGTLYEFTYRAINPKVLGLGFAATRDV
FT                   VAFLRGPQAAPANPAGGAVKHAVALGISQSGRFLRDFIRQGFNQDEEGRRVFDGMLLHI
FT                   SGVGGVFLNARFGQPSRTNTQHEDHLYPENTFPFSAAAMRDPVTGLSGALLRGDGFDPL
FT                   LMEVNTSTEYWQKGASLLTTDPLGRADAALPATARAYLVSSGFHYGRAGLTSTRGPCAL
FT                   PRSTLNPAPALRALLVALEEWVTTGAAPPESRVPRLSDGTLVPAEDAGFPYIPGMRVPE
FT                   APNAIARFSTYVDPRPESGPQYRPLVPKTDADGHDVAGIRLPEVAAPRATFTGWNLYAE
FT                   PFPGGELCDREGSRILLARSRAERQASGDPRPSLEERYAEAGAYLDRVRRAADALVAER
FT                   LLLREDAERLVEAARAADGQP"
FT   sig_peptide     662464..662535
FT                   /locus_tag="M446_0556"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.996 at
FT                   residue 24"
FT   gene            664461..665528
FT                   /locus_tag="M446_0557"
FT   CDS_pept        664461..665528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0557"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: xfa:XF1743 esterase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15119"
FT                   /db_xref="GOA:B0UND9"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B0UND9"
FT                   /protein_id="ACA15119.1"
FT                   /translation="MTVRSRRFPRPGGLLAGALAGALAAGAAAQEPPPLQVPAKSVPVP
FT                   ADVSPQLAKIIGAPLRTNWNIHPRTGEEWKPVAEAGAAALGKLVPGMLERLHVKVERTT
FT                   IDGVRAFILTPETIPPENRDRLLVHVHGGCYVLNPGEAGLPEAIFMAGFGRFKVISVDY
FT                   RMPPEAYYPAAHDDAMTVWRAATRMADPRKMGIFGTSAGGALTLAMVLRAKQEGVPLPA
FT                   AIAPGTPMSDTTKVGDSFVTNAMLDNVLVSPDGFCDDGAKVYAAGHDLKDPMLSPVYGD
FT                   MHGFPPTILTTGTRDLLLSNTVRVHRKLRDAGVEAYLQVGEGQSHAHYIRDDTAPETRK
FT                   VFEEIAWFFDRHLGK"
FT   sig_peptide     664461..664550
FT                   /locus_tag="M446_0557"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.944 at
FT                   residue 30"
FT   gene            665576..666853
FT                   /locus_tag="M446_0558"
FT   CDS_pept        665576..666853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0558"
FT                   /product="Amidohydrolase 3"
FT                   /note="PFAM: amidohydrolase; Amidohydrolase 3; KEGG:
FT                   bra:BRADO2131 conserved hypothetical protein; putative
FT                   signal peptide; putative aminohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15120"
FT                   /db_xref="GOA:B0UNE0"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR020043"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B0UNE0"
FT                   /protein_id="ACA15120.1"
FT                   /translation="MSDVTRRTWLGGLSAAGILAAAGARGAIGPNDKFDLVIKGGEVVD
FT                   PSQSLRAKRDVGIRFGVIEALDPEIPAARAQRVLDASGKLVLPGLVDLHAHTYPYGSAI
FT                   GIPADETVPFSGVTTVVSAGDAGANNLAALRRHIAAQTRTRMFAFVHIANNGLSAFPVA
FT                   ELYNIDNAQVEACALALAENPDFVIGVKVRMSENVIFKHGAEPLRRAIQACEMSGRPAK
FT                   IMVHIGGVETAALMSQILDLLRPGDILTHCYSGAPNLAGQFTNIVQDGKLLPAALEAKR
FT                   RGVIFDIGHGGGSFDFTVAEAAIAQGAPPDTISSDLHVVSGNTPGMPFLPWVMSKFLPL
FT                   GFSPEQVVAMATSAPARVIDRGPKLGTLQVGAPGDVSVMEWVEGPVTFVDTRGNTRGGT
FT                   AFLKPVQTVNTGVVFGRPFQAPFAVR"
FT   sig_peptide     665576..665656
FT                   /locus_tag="M446_0558"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.889 at
FT                   residue 27"
FT   gene            667244..667894
FT                   /locus_tag="M446_0559"
FT   CDS_pept        667244..667894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0559"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: pla:Plav_2526 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15121"
FT                   /db_xref="GOA:B0UNE1"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B0UNE1"
FT                   /protein_id="ACA15121.1"
FT                   /translation="MGFYERHVGPRLVRCACAMANVSAEREKIVPRAAGTVLEVGFGPG
FT                   LNLPFYDPARVSRVIGVDPNEAFLKLGAARRRAAKIPVEIRTAPAESLPLEDACVDTAV
FT                   ITYTLCSVHDPMRSLSEVRRVLRPGGRALFLEHGLSRDPKVARWQSRLNPLWRAVAVGC
FT                   NLIRPVAASFRAAGFALTELEEYYLPGTPKPLSYFSRGVAHAVQGGPASGGGP"
FT   gene            complement(668102..669979)
FT                   /locus_tag="M446_0560"
FT   CDS_pept        complement(668102..669979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0560"
FT                   /product="TRAP C4-dicarboxylate transport system permease
FT                   DctM subunit"
FT                   /note="PFAM: Tripartite ATP-independent periplasmic
FT                   transporter DctQ component; TRAP C4-dicarboxylate transport
FT                   system permease DctM subunit; KEGG: azc:AZC_1897 TRAP
FT                   dicarboxylate transporter DctM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15122"
FT                   /db_xref="GOA:B0UNE2"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:B0UNE2"
FT                   /protein_id="ACA15122.1"
FT                   /translation="MSAAADMPGRADALPVPHSDWLSLADRVLRAAVEGPAALLVAAEV
FT                   AILFAGIVARALGHPIIWSDELASILFLWLAMLGSVVAIQRGEHMRLTFVVGKLPPRAQ
FT                   AWCEALAVGTVFVFLVLLLRAASDYTEDQSFVETPALGWPGTVRALAVPVGFVAALLGC
FT                   SLRLARHGIADLLGVGLVLAGLAGLLALGAPLLTDLGNWALVVFFIGLLGLGILAGVPI
FT                   AFSFALATSAYLLTVTSTPLTIVVGRMDEGMSGLILLAIPLFVLLGQLVEATGMARVMV
FT                   AFLASLLGHVRAGMSYVLLGAMLLVSGISGSKTADMAAVAPVLFPEMRRRGMKDGELLS
FT                   LLAASGAMSETIPPSIVLIAIASVTGVSIAALFTAGILPALVLALVLAAVARYRAGREE
FT                   DAVRVARAPASVVGRTLLAALPALLLPFLIRTAVVEGIATATEVSTIGIAYSLVLGLLV
FT                   YRGGLRWRAVLPMLARTASLSGAILFIVGAASAMAWALTQSGFSHDLARAMAAVPGGQV
FT                   GFLLISVVAFMVLGSLLEGIPAIVLFGPLLFPIAHQFGIHEVHYAMVVILAMGLGLFAP
FT                   PFGLCYYAACIIGQVSPESGMRRIWIYLGALFLGLLVLTFVPWFSTGFL"
FT   gene            complement(669976..671010)
FT                   /locus_tag="M446_0561"
FT   CDS_pept        complement(669976..671010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0561"
FT                   /product="TRAP dicarboxylate transporter, DctP subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctP
FT                   subunit; PFAM: TRAP dicarboxylate transporter- DctP
FT                   subunit; KEGG: azc:AZC_1896 TRAP dicarboxylate transporter
FT                   DctP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15123"
FT                   /db_xref="GOA:B0UNE3"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:B0UNE3"
FT                   /protein_id="ACA15123.1"
FT                   /translation="MTETDSKPKGGLSRRSLLTAAAAVPLVAIRTRPARAAEFTYKLAT
FT                   GQSLTQPINARLDQATQRIREASGGRLELKFFPASQLGSDTDLITQVRSGGIEFLNIAG
FT                   SVISTVAAGAAITNVGFAFADYDQAWRGADGPIGQYVRTQIEKAGLLVAAKAADNSFRQ
FT                   ITSASKPIRTPDDLKGYRIRVPVSPIFTSLFSALGASPTSINFNELYTALQTRLVDGQE
FT                   NGLVAIDAGKLYEVQKYVSETNHIWDPFWIVANRRAFGRLPEPLQEIVRRELDRAAQEQ
FT                   REDVARLNGTLKTQLVAKGLVFEAADKDAFRRSLTQAGFYRDWKEKFGPEAWKALESVT
FT                   GALA"
FT   sig_peptide     complement(670900..671010)
FT                   /locus_tag="M446_0561"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.992 at
FT                   residue 37"
FT   gene            671271..672173
FT                   /locus_tag="M446_0562"
FT   CDS_pept        671271..672173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0562"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: azc:AZC_1895 transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15124"
FT                   /db_xref="GOA:B0UNE4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0UNE4"
FT                   /protein_id="ACA15124.1"
FT                   /translation="MPVPLRAITVFHAVARSGSITRAAEELGVTPSAVSQQIQTLEVGL
FT                   GTALIGKAGRNVVLTEAGERYFEMIGGEIDRIMEATQRIQGFRSVTTLTVRATPSLSTK
FT                   WLLPRLARFLDAHPDLELRLDGTNEPTAFQKESVDIEIRHGTGGWPGLYAEGLVEECFR
FT                   PVCAPALAAPGSLAPGELHRHRLIHSVKSQMQWAHWFKLAGTAPAARWRRLLFDRTHMA
FT                   IDAAAGGLGIALESDLMLWDDLRSGRLACPVRDPPRTALVTQWVTCPPDHLRLRKVQAF
FT                   LDWIRRERDEWARARAETL"
FT   gene            672457..673815
FT                   /locus_tag="M446_0563"
FT   CDS_pept        672457..673815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0563"
FT                   /product="SAF domain protein"
FT                   /note="PFAM: oxidoreductase domain protein;
FT                   dihydrodipicolinate reductase; SAF domain protein; KEGG:
FT                   azc:AZC_1894 putative homoserine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15125"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0UNE5"
FT                   /protein_id="ACA15125.1"
FT                   /translation="MNLSTLLLARASAGRPVRVGLIGAGKFGSMVLAQAQRIAGLHVVG
FT                   VADLNVGRARDSLARVGWPEERYAAPTLGDAVRSGRTCVLDDAAALSACDEIECIIEAT
FT                   GHPIAGIRHALQAIDAGKHVVMVNVEADVLCGPLLAERARRKGVVYSMAYGDQPAIICE
FT                   LVDWARSCGFELTSAGKGMNFEPRYRYSTPDTVWGFFGWSEEEVRKGDFNPKMYNSFTD
FT                   GTKAAIEMAAVANGTGLDCPDDGLAFPPTGLHDLARVFRPVADGGRLPRSGLVDIAASQ
FT                   EPDGREVFNNIRYGVFVTFKATSEYTRACFRQYGLLTDPSGWYGSMWRPFHMIGLETSV
FT                   SVLSAVLRQEPTGCSKEFRGDAVATAKRDLKAGEMLDGEGGYAVWANAIPAAKSLALGA
FT                   LPIGLAHNVALKRPVGKDQVVRFDDVELVNDLDVVALRRQMEDAARQAPPKAA"
FT   gene            674017..674349
FT                   /locus_tag="M446_0564"
FT   CDS_pept        674017..674349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0564"
FT                   /product="Antibiotic biosynthesis monooxygenase"
FT                   /note="PFAM: Antibiotic biosynthesis monooxygenase; KEGG:
FT                   azc:AZC_1893 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15126"
FT                   /db_xref="GOA:B0UNE6"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B0UNE6"
FT                   /protein_id="ACA15126.1"
FT                   /translation="MTESPPRPFVVIAEFKVRPGCLDAFLDLAREDARASVAREPGCRS
FT                   FDVAVGESDPQTVLFYEVYDDRAAFAAHLETPHLARFRAGFPALVAEERPVRFLALACA
FT                   GAQVSR"
FT   gene            674346..675239
FT                   /locus_tag="M446_0565"
FT   CDS_pept        674346..675239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0565"
FT                   /product="6-phosphogluconate dehydrogenase NAD-binding"
FT                   /note="PFAM: NADP oxidoreductase coenzyme F420-dependent;
FT                   6-phosphogluconate dehydrogenase NAD-binding; KEGG:
FT                   azc:AZC_1892 3-hydroxyisobutyrate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15127"
FT                   /db_xref="GOA:B0UNE7"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0UNE7"
FT                   /protein_id="ACA15127.1"
FT                   /translation="MTSAATIGFLGTGLMGAPMARRLCAAGHAVRVWNRTPDKAAALVA
FT                   EGARVAQDPRDAAREADAVICMVSSGPVSDEVLLGPEGALAAMRPGSVLAVMSSIPVET
FT                   ARRQAGIAAAAGLLYVDAPVSGGEAGAVAGTLAIMAGGSPDAFARIRPILAAMGRPTHV
FT                   GPAGSGQLAKLANQAIVASTIVTVAEAITFVERGGADPAKVREALLGGFADSTILKQHA
FT                   LRMIERTFAPGGPAKYQLKDTGTALAHAASLGLDLPVLSLVDRLFAGLVAHGDGDLDHS
FT                   AVIREIRRRNGLSDQA"
FT   sig_peptide     674346..674423
FT                   /locus_tag="M446_0565"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.608) with cleavage site probability 0.480 at
FT                   residue 26"
FT   gene            675831..676202
FT                   /locus_tag="M446_0566"
FT   CDS_pept        675831..676202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0566"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mex:Mext_4709 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15128"
FT                   /db_xref="GOA:B0UNE8"
FT                   /db_xref="UniProtKB/TrEMBL:B0UNE8"
FT                   /protein_id="ACA15128.1"
FT                   /translation="MAFRNDVPPHLSAQRGDDPAPVDEARPNPAMLKGDIDAGRAGDKV
FT                   EVFDPGMAMLGTCEEAGGNALSPVDIARARRAETRERWRWSGRKPGYAHRRSPVTIAYF
FT                   GGFIAAAGTGMAGLIWYLS"
FT   gene            676599..676823
FT                   /locus_tag="M446_0567"
FT   CDS_pept        676599..676823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0567"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15129"
FT                   /db_xref="UniProtKB/TrEMBL:B0UNE9"
FT                   /protein_id="ACA15129.1"
FT                   /translation="MSALDAYNVFLRKETPALRCAVRQDRPVPDFVRGDVWEYAGTVDA
FT                   GTAPAGFKVAAARQATSHVGYYVFFALTA"
FT   gene            676880..677353
FT                   /locus_tag="M446_0568"
FT   CDS_pept        676880..677353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0568"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: lma:LmjF35.0290 hypothetical protein,
FT                   conserved"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15130"
FT                   /db_xref="UniProtKB/TrEMBL:B0UNF0"
FT                   /protein_id="ACA15130.1"
FT                   /translation="MRATSALVSIALAGAAIGAWAATRSPQVPPPPPAVAASAVPWVTP
FT                   PTRDPVADEAGDAPARPAPPDAVAPSVAATGSLAAARPRAPAEGAARPRAARGTRVHQL
FT                   AARRATVPRRAVPVAHAALPGRARAVAEPAEAERAEIPAGPEAEPIQFGLASR"
FT   sig_peptide     676880..676945
FT                   /locus_tag="M446_0568"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.989 at
FT                   residue 22"
FT   gene            677452..677724
FT                   /locus_tag="M446_0569"
FT   CDS_pept        677452..677724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0569"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15131"
FT                   /db_xref="UniProtKB/TrEMBL:B0UNF1"
FT                   /protein_id="ACA15131.1"
FT                   /translation="MTPESPHIPPEHLPAIRAARVLREALTGSMHLLPRRSVMRGIYRT
FT                   LIENIDEFAFTVTREPDYFSLKAHSATPFYGRRDGDPGDGSADGA"
FT   gene            677811..678014
FT                   /locus_tag="M446_0570"
FT   CDS_pept        677811..678014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15132"
FT                   /db_xref="UniProtKB/TrEMBL:B0UNF2"
FT                   /protein_id="ACA15132.1"
FT                   /translation="MTPLHSLPSDQADPRADAPARAAPAEIADADLDAVVGGADPWVII
FT                   RMWGMVNFPPKTIGQSYKSPSL"
FT   gene            complement(678119..678376)
FT                   /locus_tag="M446_0571"
FT   CDS_pept        complement(678119..678376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0571"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: swi:Swit_5308 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15133"
FT                   /db_xref="UniProtKB/TrEMBL:B0UNF3"
FT                   /protein_id="ACA15133.1"
FT                   /translation="MLVNTAGPDHQGCLLFVDRRLVAVLVRLEQDAFLDPEFWGHWFLE
FT                   AGFGPCQPRGRAPSFATTDEALGWARQQVEQYVREAVCLH"
FT   gene            678664..679020
FT                   /locus_tag="M446_0572"
FT   CDS_pept        678664..679020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0572"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpe:RPE_1606 protein of unknown function
FT                   DUF1476"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15134"
FT                   /db_xref="InterPro:IPR009945"
FT                   /db_xref="InterPro:IPR038293"
FT                   /db_xref="UniProtKB/TrEMBL:B0UNF4"
FT                   /protein_id="ACA15134.1"
FT                   /translation="MLMTRLFEEREKAAELLFVRAEEARFLSYCQAVRSLAVYVMEKIG
FT                   LDRYSAGPYAHELLSCLVYGLDKSALIERVAADLEANGVAVDRDDLRRELERSATQAIY
FT                   AEEAPARRGNAALH"
FT   gene            complement(679070..679714)
FT                   /locus_tag="M446_0573"
FT   CDS_pept        complement(679070..679714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0573"
FT                   /product="protein of unknown function DUF159"
FT                   /note="PFAM: protein of unknown function DUF159; KEGG:
FT                   rpd:RPD_0010 protein of unknown function DUF159"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15135"
FT                   /db_xref="GOA:B0UNF5"
FT                   /db_xref="InterPro:IPR003738"
FT                   /db_xref="InterPro:IPR036590"
FT                   /db_xref="UniProtKB/TrEMBL:B0UNF5"
FT                   /protein_id="ACA15135.1"
FT                   /translation="MCNLYSLTRSPDEIRRIFGVSRDETGNLPALPAIFPDQMAPVVRA
FT                   VDGARVLTMMRWGFPPPPKAGSQPVTNLRNPASPYWRPWLKPAQRCLVPVSSFSEYADT
FT                   KPRKTPVWFALSEARPLFAFAGIWRPWTGPRGPRREEPAEEEHRLYAFLTTEANGVVGP
FT                   VHPKAMPVLLTDEAAWRTWLEAPAEEALRLQRPLPDEAMREVARGERQDGA"
FT   gene            679826..680377
FT                   /locus_tag="M446_0574"
FT   CDS_pept        679826..680377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0574"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mlo:mll8493 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15136"
FT                   /db_xref="UniProtKB/TrEMBL:B0UNF6"
FT                   /protein_id="ACA15136.1"
FT                   /translation="MRWRRVAGAAIIVGSTPLVPGSAGAQQLDIQNLVPCAQEGGVCRM
FT                   PHPTNVYYGIPGKTVGRPFPQGGSIACTNQSFGDPVPGQRKMCWYAPRVGERGRGEGRA
FT                   RGGDEDPGYGRRGAPERWERGYDRRIPGEEMSPRFRRERESDDEYLGPPRDRGYGRYAP
FT                   SPGGYGSREGRPYRPDPDDE"
FT   sig_peptide     679826..679903
FT                   /locus_tag="M446_0574"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.988 at
FT                   residue 26"
FT   gene            680578..680793
FT                   /locus_tag="M446_0575"
FT   CDS_pept        680578..680793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0575"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15137"
FT                   /db_xref="UniProtKB/TrEMBL:B0UNF7"
FT                   /protein_id="ACA15137.1"
FT                   /translation="MRVELRRLLNLLDHVGDWISLSELDGDPYLLPDDDLFVPGLVARG
FT                   WVTHDRVTGSIRINAAGRAAFERLEL"
FT   gene            681488..681733
FT                   /locus_tag="M446_0576"
FT   CDS_pept        681488..681733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0576"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15138"
FT                   /db_xref="UniProtKB/TrEMBL:B0UNF8"
FT                   /protein_id="ACA15138.1"
FT                   /translation="MTHSFETKTARQEARSAAPEQDSLPAPVVLTPEELDAAVGGVLAT
FT                   GGLSNTLSGLRNPTSTMGVIIGPLGPLGALGGLQAR"
FT   gene            681784..682215
FT                   /locus_tag="M446_0577"
FT   CDS_pept        681784..682215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0577"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cvi:CV_3566 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15139"
FT                   /db_xref="UniProtKB/TrEMBL:B0UNF9"
FT                   /protein_id="ACA15139.1"
FT                   /translation="MTTRIDCPSAQPGSRASRIFGVATGPLAERRIGYLTAPVEAAPEV
FT                   LAKAGDAKPTELFRIAAPCAKAACRHYNGACTLGQRIVTSLPPVVSGPPPCQIRPTCRW
FT                   HHEHGDAACLRCPQVVTDKVGASEAEIRIAEGPARTEPA"
FT   gene            complement(682287..682490)
FT                   /locus_tag="M446_0578"
FT   CDS_pept        complement(682287..682490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0578"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15140"
FT                   /db_xref="UniProtKB/TrEMBL:B0UNG0"
FT                   /protein_id="ACA15140.1"
FT                   /translation="MLAISRLIFNQNTVVMLCALAVALAVFGALRAAVPARAFAGEGLH
FT                   EVARSDGTCGITAMGDVAFCGP"
FT   sig_peptide     complement(682392..682490)
FT                   /locus_tag="M446_0578"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.618 at
FT                   residue 33"
FT   gene            complement(682619..682918)
FT                   /locus_tag="M446_0579"
FT   CDS_pept        complement(682619..682918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0579"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15141"
FT                   /db_xref="UniProtKB/TrEMBL:B0UNG1"
FT                   /protein_id="ACA15141.1"
FT                   /translation="MANAVDPFAALRRSEADRARWSKERPTDFAKLMWRSDIAQAGRAG
FT                   GRVPEDVPQTSNIPKDKSGRTVRDLAEDRYSGEVRLDQLEKTSQKTMKPICNGC"
FT   gene            683487..684161
FT                   /locus_tag="M446_0580"
FT   CDS_pept        683487..684161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0580"
FT                   /product="OmpW family protein"
FT                   /note="PFAM: OmpW family protein; KEGG: bra:BRADO6590
FT                   conserved hypothetical protein; putative signal peptide;
FT                   putative outer membrane protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15142"
FT                   /db_xref="GOA:B0UNG2"
FT                   /db_xref="InterPro:IPR005618"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:B0UNG2"
FT                   /protein_id="ACA15142.1"
FT                   /translation="MSKRILAAVAAVLAATTAQAADLPSTAAPPPVPDLALWSPWMLRL
FT                   RALAVVPDPGARLSARGAPIVGAGVAVTDSVIPELDISYFFTKNIATELILGVTRHGVR
FT                   GTGALAGTRIGSTWILPPTLTLQYHFTDFGPFKPYIGAGVNYSVFFGEQERLGFTSFKL
FT                   SNSVAPAVQFGFDYMLDAHWGINVDVKKVFLDTHVKLSPGLIRGRVDLDPWIVGAGVTY
FT                   RF"
FT   sig_peptide     683487..683549
FT                   /locus_tag="M446_0580"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 21"
FT   gene            684420..684932
FT                   /locus_tag="M446_0581"
FT   CDS_pept        684420..684932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0581"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: atc:AGR_L_450 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15143"
FT                   /db_xref="GOA:B0UNG3"
FT                   /db_xref="UniProtKB/TrEMBL:B0UNG3"
FT                   /protein_id="ACA15143.1"
FT                   /translation="MPPSRSLPLRALIALADVAVAAFVIGIELLRPLYRPLYEALSRLA
FT                   LVRRLEAGVARLPRFAILALLAVPFLGVEPLKLVGVVWIAEGRPGRGLALLAGAYLVSF
FT                   VLVERIYHAGRAKLLTIGWFAVAIGFAARVRGALLAYARATRAWGMAAATARRVRALLR
FT                   RLIARAA"
FT   gene            685163..686563
FT                   /locus_tag="M446_0582"
FT   CDS_pept        685163..686563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0582"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   sen:SACE_5091 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15144"
FT                   /db_xref="GOA:B0U7J3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR001598"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="UniProtKB/TrEMBL:B0U7J3"
FT                   /protein_id="ACA15144.1"
FT                   /translation="MAGRRRSDRALREKLRSPGRPGVGLRETRRGFWAFLAQGLSSEVA
FT                   AMKLGISPPVGSRWFRTAGGMAPSHLSPSSKSPSARYLSLAEREEIAILQAQGHGVRDV
FT                   ARRLGRAASTISRELRRNAATRSGGLDYRATTAQWHAERAARRPKPAKLAGNAALRTYV
FT                   QERLAGTVATPGGSALPGPSVAWKGRRHGRRQSRRWGRSWSPQQIAERLRLDFPGDTTM
FT                   RISHEAIYQALYIQGRGALKRELTACLRTGRALRVPRARSLGRGRSFVTPEVLISERPP
FT                   EVEDRAVPGHWEGDLILGLKSSAIGTLVERTTRFTMLLHLPPMDGHGVTPRAKNGPALA
FT                   GHGAQAVREAIAGTIARLPEQLRRSLTWDQGTEMAEHARLRIDAGLQVYFCDPRSPWQR
FT                   GTNENTNGLLRQYFPKGTDLSAHSANDLAAVAAALNSRPRKTLNWKTPAEALDAVLAAV
FT                   QDGVATTA"
FT   gene            686572..689052
FT                   /pseudo
FT                   /locus_tag="M446_0583"
FT   gene            689196..689447
FT                   /locus_tag="M446_0584"
FT   CDS_pept        689196..689447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0584"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mex:Mext_4254 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15145"
FT                   /db_xref="UniProtKB/TrEMBL:B0UNG5"
FT                   /protein_id="ACA15145.1"
FT                   /translation="MTPRITAAVLGLLALQAPALAQGTPEQRQACTPDAMSLCGPFIPD
FT                   AVRVKACLLHNRQRLTPACRAAIVPDEPRRPRRRRRAR"
FT   sig_peptide     689196..689261
FT                   /locus_tag="M446_0584"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 22"
FT   gene            complement(689457..689729)
FT                   /locus_tag="M446_0585"
FT   CDS_pept        complement(689457..689729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0585"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15146"
FT                   /db_xref="GOA:B0UNG6"
FT                   /db_xref="UniProtKB/TrEMBL:B0UNG6"
FT                   /protein_id="ACA15146.1"
FT                   /translation="MWYSNAARRSPRMTLAVPLAEAALFTLGCAVIHAQRDRPERLTRT
FT                   LAVLACLAFLAVVALATPGPNLRAGAVAEMGGVLPLSGEPAQDPP"
FT   gene            689848..690240
FT                   /locus_tag="M446_0586"
FT   CDS_pept        689848..690240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0586"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mex:Mext_1785 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15147"
FT                   /db_xref="UniProtKB/TrEMBL:B0UNG7"
FT                   /protein_id="ACA15147.1"
FT                   /translation="MKVPTLLTAAAILTLSAGSVLAGPCNTGTTKGKSPEQHATNASSS
FT                   DVDKGSKNLAGGQQPASPGTVGAMNNVGAGQATGDKGGSSADARGNQTDPASKNLAGGQ
FT                   QPASPGTVGAMNNAGADQKLGQKDDC"
FT   sig_peptide     689848..689916
FT                   /locus_tag="M446_0586"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.969 at
FT                   residue 23"
FT   gene            690678..691151
FT                   /locus_tag="M446_0587"
FT   CDS_pept        690678..691151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0587"
FT                   /product="transcriptional regulator, MucR family"
FT                   /note="PFAM: ROSMUCR transcriptional regulator; KEGG:
FT                   xau:Xaut_1838 transcriptional regulator, MucR family"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15148"
FT                   /db_xref="GOA:B0UNG8"
FT                   /db_xref="InterPro:IPR008807"
FT                   /db_xref="InterPro:IPR041920"
FT                   /db_xref="UniProtKB/TrEMBL:B0UNG8"
FT                   /protein_id="ACA15148.1"
FT                   /translation="MGDRMSEIKAESTAPDSGALAGLTAGIVTAYVTGNALRASDMPHL
FT                   VRSVYSTLATLGGPAKPAVAEAPVPPIPIKKTVTRDAIISLEDGKPYKSLKRHLTARGL
FT                   SPEEYRRKWNLPPDYPMVAEVYAQRRSDLARVLGLGQIRSRKAAERRAAAAAE"
FT   gene            691244..691498
FT                   /locus_tag="M446_0588"
FT   CDS_pept        691244..691498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0588"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15149"
FT                   /db_xref="GOA:B0UNG9"
FT                   /db_xref="UniProtKB/TrEMBL:B0UNG9"
FT                   /protein_id="ACA15149.1"
FT                   /translation="MSPSPLLPLIVTAVFAAGLFVITRLEKWADLVGGILGLTAVGLLC
FT                   LLLLAVTPPAPSGPNPARGRPGVPVSMMAGADLGWPARP"
FT   sig_peptide     691244..691294
FT                   /locus_tag="M446_0588"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.630) with cleavage site probability 0.510 at
FT                   residue 17"
FT   gene            complement(691501..691779)
FT                   /locus_tag="M446_0589"
FT   CDS_pept        complement(691501..691779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0589"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15150"
FT                   /db_xref="UniProtKB/TrEMBL:B0UNH0"
FT                   /protein_id="ACA15150.1"
FT                   /translation="MHSAPVLPPAAEPPAPAARPASPLPAFLTPRPPLRRFGSAWDAVL
FT                   SGIADGLAERLRPEPLAEAPALVREAHRLVREPPAPAAGPAGRTEPA"
FT   gene            692005..692286
FT                   /locus_tag="M446_0590"
FT   CDS_pept        692005..692286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15151"
FT                   /db_xref="InterPro:IPR011690"
FT                   /db_xref="UniProtKB/TrEMBL:B0UNH1"
FT                   /protein_id="ACA15151.1"
FT                   /translation="MTHSRSALAAAALLAGLSAAPAKDALAKDTLAKDAPARNAPAKPA
FT                   GRPEPAGEESFPGVDPAVLAQCRGEAEAKRLRGEARQLFMKTCVEPED"
FT   sig_peptide     692005..692088
FT                   /locus_tag="M446_0590"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.677 at
FT                   residue 28"
FT   gene            complement(692504..693409)
FT                   /locus_tag="M446_0591"
FT   CDS_pept        complement(692504..693409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0591"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; response regulator
FT                   receiver; KEGG: mex:Mext_3383 response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15152"
FT                   /db_xref="GOA:B0UNH2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B0UNH2"
FT                   /protein_id="ACA15152.1"
FT                   /translation="MPEPGRDVILVVDDSPETLSFLTSAIEATGATVLVAVSGEAALTL
FT                   VQEITPDIILLDAVMPGLDGFETCRRLKANAALAHVPVIFMTGLSETEHIVRGLEAGGV
FT                   DYVAKPISATEILARIRVHLANARAAQSARLALDSAGRYLFAVDGAGSVRWCTPQAARL
FT                   LRDLAESSAAGDPALPPAARAWLRAAAPGPVALATPDGRRLQLSRIGQVGGDEILLRLA
FT                   LDGGGEIERLRRALGLTQREAEVLLWVSRGKASRDIGEILSLSPRTVTKHLEQVYAKLG
FT                   VENRTSASALVVRALQEQGG"
FT   gene            complement(693402..696743)
FT                   /locus_tag="M446_0592"
FT   CDS_pept        complement(693402..696743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0592"
FT                   /product="integral membrane sensor hybrid histidine kinase"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; KEGG: mex:Mext_3382 ATP-binding region ATPase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15153"
FT                   /db_xref="GOA:B0UNH3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:B0UNH3"
FT                   /protein_id="ACA15153.1"
FT                   /translation="MQGRQRIIPVRRDYNRWVANETLEDFALRFTAKRARRWSVLRVAQ
FT                   TALGSVAFLALEAIGGTLILAYGFTNTMAAILAVGLVIFLAGVPVGATAARHGLDVDLL
FT                   TRGAGFGYIGSTLTSLIYASFTYLFFAIEAAIMALALELCLGLPLPVGYLVSALAVIPL
FT                   VTYGIALISRFQLVTQPVWLLLNLLPLAFIAVAADRPVEAWMAHAGLAGARGEGFDPLL
FT                   FGAACGILFSLLAQVGEQVDFLRFVPPPQPNRELRWWAAVLGAGAGWVVPGMLKILLGS
FT                   FLAVLALGQGVPAERASEPTQMYAAAFGYGLPAGGAILVTGLFVVISQLKINVTNAYAG
FT                   SIAWSNFFSRLTHSHPGRVVWLVFNVAIALLLMELGIYKTLERTLGLYALVAAAWMGAL
FT                   MADLAVNKPLGLSPPGIEFKRAHLYDVNPVGTGAMALACLVAFLAYAGLLGAGPQAFAA
FT                   FIALGTAFAAAPLIAWATDGRYYFARRPRRHWQRRGEITCGVCEHSFEPEDMAYCPAYA
FT                   VPICSLCCSLDVRCGDLCKPHARLSAQVSHVAARLSPRVAAVVESRLGRYAGIMLALCA
FT                   AAGLILGVVYAEAAHRAPAHGAVLAQALEAVFFVMAVIFGVVAWLFVLAQESRRVAQEE
FT                   TARQTALHRAEIAAHKITDAKLQKAKEAAEAANLAKSRYVVGISHELRTPLNAVLGYAQ
FT                   LLENDPAIPPQRQSGIRVIRRSAEHLSGLIDGLLDISRMEAGRLQLHRNAVRLPDFLDQ
FT                   IVDMCRPQAEAAGLEFRFTRPAILPALVATDEKRLRQILLNLISNAIKFTARGHVGLDL
FT                   TYRNQIAEFAVTDTGSGIPEADLPRIFEPFVRGTLPAATSTPGTGLGLTIAHLLAQVMG
FT                   GEITVASALGRGSTFRLRLMLSSLAESGRAAPAEAPVRGYAGRRRTIFVVDDDPAHRDL
FT                   MREILTPLGFTLLSAADGPSCLDLAAGCRPDLFLLDIAMPGMNGWELARRLRAEGHGPA
FT                   RIAMMSANVHEISPVRGEDAPHDAIIAKPFDLRDFLSRIQALLGLDWITAEAPPVRTGP
FT                   RRATPEQVAELIRLGRIGHVRGIEAKLAEIEAETPAPFVAELRGLVQAYDLPRYMAVLE
FT                   GMSGDA"
FT   gene            697011..698267
FT                   /locus_tag="M446_0593"
FT   CDS_pept        697011..698267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0593"
FT                   /product="urea ABC transporter, urea binding protein"
FT                   /note="TIGRFAM: urea ABC transporter, urea binding protein;
FT                   KEGG: bja:blr0967 ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15154"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017777"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B0UNH4"
FT                   /protein_id="ACA15154.1"
FT                   /translation="MADENDRGLESALRRRLLMGLAAVPAVAALPRLALAAPPTSAVNT
FT                   TGLAVTDTEVTVGILHSVTGTMAISETGAQQAEKLAIEQINAEGGVLGRKIKIIQEDGA
FT                   SDWPTFAEKAKKLLVNDKCAAVFGCCTSASRKAVLPVFEQYNGMLYYPTFYEGLEESKN
FT                   VIYTGQEATQQILAGLDWVAKEKGGKTFFFIGSDYIWPRTSNKIARKHVENVIKGKVVG
FT                   EEYFPLGHTQFNSVINKIKLTKPNVIFADVVGGSNVAFYKQLKAAGIDLSKQVLMTISV
FT                   TEDEIDGIGGENIAGAYACMKYFQSLKNPNNEKFVPAFKKMWGEKTVIGDVTQAAYLGP
FT                   YLWKLTAEKVGSFDVDKIAAGSAGVEFKGAPEGYVRIHPNHHLWSKTRVGLAKADGQFE
FT                   VVYESADLIEPNPFPVGYQ"
FT   sig_peptide     697011..697121
FT                   /locus_tag="M446_0593"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.972 at
FT                   residue 37"
FT   gene            698369..699295
FT                   /locus_tag="M446_0594"
FT   CDS_pept        698369..699295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0594"
FT                   /product="urea ABC transporter, permease protein UrtB"
FT                   /note="TIGRFAM: urea ABC transporter, permease protein
FT                   UrtB; PFAM: inner-membrane translocator; KEGG:
FT                   mex:Mext_3380 UreA ABC transporter, permease protein UrtB"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15155"
FT                   /db_xref="GOA:B0UPV6"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR017779"
FT                   /db_xref="UniProtKB/TrEMBL:B0UPV6"
FT                   /protein_id="ACA15155.1"
FT                   /translation="MFGDYSLGDLGSIFAMQGFAGLILFSVYVLMALGLAIIFGQMGVI
FT                   NMAHGEFMILGAYMTYLCSNVFQSHLPSLFPVSFFVAMGLAFLASGALGMLVEWALIRH
FT                   LYKRPLDTLLATWGLSLILQQAYRSIFGAREVGVELPSWMMGSVQATETIEIQINGMVV
FT                   MGVTALITLAVALLLFRSGYGKRVRAVMQNRVMAGAVGIDTDKVDRLTFGLGCGIAGIA
FT                   GAAFTMIGSTGPTSGQLYIVDTFLIVVFGGAASLAGTIASAFSISQTQSTLEFFLSGST
FT                   AKVLTLLGVVAILMMRPQGLFTLKVRR"
FT   gene            699310..700464
FT                   /locus_tag="M446_0595"
FT   CDS_pept        699310..700464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0595"
FT                   /product="urea ABC transporter, permease protein UrtC"
FT                   /note="TIGRFAM: urea ABC transporter, permease protein
FT                   UrtC; PFAM: inner-membrane translocator; KEGG:
FT                   mex:Mext_3379 UreA ABC transporter, permease protein UrtC"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15156"
FT                   /db_xref="GOA:B0UPV7"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR017778"
FT                   /db_xref="UniProtKB/TrEMBL:B0UPV7"
FT                   /protein_id="ACA15156.1"
FT                   /translation="MTSPTLNDNAFMKPMEWASLAVLAALILVVLPLALDIFRLNLVGK
FT                   YLTYAFVALGLVICWGYCGILSLGQGVFFGLGGYCMAMYLKLEASSVENTKIQSTPGIP
FT                   DFMDWNQVTALPWFWKPFHSLPLTLLAVVAVPTLFALVISAAMFKRRVGGTYFAIITQA
FT                   IAAILTILIVGQQGYTGGINGITDLRTLHGWDIRTDHAKTVLYFVNGGLLIACILAAQY
FT                   VKRSKLGRILVAMRDKEDRVRFSGYSVASFKIFAFCLAAAFAAIGGAMFTLQVGFMSPS
FT                   FVGIVPSIEMVIYTAVGGRLSLFGAVYGTLLVNWAKTSFSESFPELWLFGLGALFIGVV
FT                   LAFPNGLAGIWRQFVAPRLSATPDPAKPGAPVLPAALPHGAPAE"
FT   gene            700476..701246
FT                   /locus_tag="M446_0596"
FT   CDS_pept        700476..701246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0596"
FT                   /product="urea ABC transporter, ATP-binding protein UrtD"
FT                   /note="TIGRFAM: urea ABC transporter, ATP-binding protein
FT                   UrtD; PFAM: ABC transporter related; KEGG: mex:Mext_3378
FT                   UreA ABC transporter, ATP-binding protein UrtD"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15157"
FT                   /db_xref="GOA:B0UPV8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR017781"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:B0UPV8"
FT                   /protein_id="ACA15157.1"
FT                   /translation="MNAAHVPAAPGQQDFLLAVEALTVSFDGFKAVNDVSFYVDPNEIR
FT                   VIIGPNGAGKTTVLDLICGRTKATSGSIKYRGQELTRMSESAIVLAGVGRKFQTPSIYD
FT                   DLTVFENLEISYPRGRTVFGALTFKRDAAVRDRVHEIAEMIFLKDHLDARAEYLSHGQK
FT                   QWLEIGMLLIQDPELLMLDEPVAGMSVAERKKTADLLHQIIKGRSVLVIEHDMKFVEDI
FT                   AHRVTVLHQGRVLSEGSMERVKNDPKVVEVYLGH"
FT   gene            701259..702017
FT                   /locus_tag="M446_0597"
FT   CDS_pept        701259..702017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0597"
FT                   /product="urea ABC transporter, ATP-binding protein UrtE"
FT                   /note="KEGG: mex:Mext_3377 UreA ABC transporter,
FT                   ATP-binding protein UrtE; TIGRFAM: urea ABC transporter,
FT                   ATP-binding protein UrtE; PFAM: ABC transporter related;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15158"
FT                   /db_xref="GOA:B0UPV9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017780"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0UPV9"
FT                   /protein_id="ACA15158.1"
FT                   /translation="MLETAIATPPAAPPAGPQVGPAPLLAVTGLHAAYGQSEVLHGIDL
FT                   AVAPGEIVALMGRNGMGKTSFMKTLMGILPARSGTIRIGERDVTGLKTFQRVAAGLAYV
FT                   PQGRMIFSAMTVQENIETGLTVTGSSRVPGDLYEMFPVLLEMKGRRGGNLSGGQQQQLA
FT                   IARALASRPKVLLLDEPTEGIQPSIIREMGRTLKRIRDERGLAIVVSEQVLSFALDVAD
FT                   RVLVIENGAIVHEDRRADVDEAKVARFLSV"
FT   gene            702175..703404
FT                   /locus_tag="M446_0598"
FT   CDS_pept        702175..703404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0598"
FT                   /product="Formamidase"
FT                   /EC_number="3.5.1.49"
FT                   /note="PFAM: Acetamidase/Formamidase; KEGG: mex:Mext_3375
FT                   formamidase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15159"
FT                   /db_xref="GOA:B0UPW0"
FT                   /db_xref="InterPro:IPR004304"
FT                   /db_xref="UniProtKB/TrEMBL:B0UPW0"
FT                   /protein_id="ACA15159.1"
FT                   /translation="MPETLIKVDLTQSPYENDMVHNRWHPDIPMVAMVKPGDDFIIETY
FT                   DWTGGFIKNDDSADDVRDIDLSIVHFLSGPVGVEGAEPGDLLVVDLLDIGAKPDSLWGF
FT                   NGFFSKKNGGGFLTDHFPLAQKSIWDIEGLFTRSRHVPGVRFPGLIHPGLIGCLPDPKL
FT                   LATWNARETALIATNPTRVPGLANPPFGPTAHMGRLKGEAKDKAAAEGARTVPPREHGG
FT                   NCDIKDLSRGSKIYFPVYVPGGGLSMGDLHFSQGDGEITFCGAIEMAGWVHLRVDVIKD
FT                   GMAKYGIKNPIFKPSPITPRYDDYLIFEGISVDESGGQHYLDVTVAYRQACLNAIEYLK
FT                   KFGYSGAQAYSILGTAPVQGHVSGVVDVPNACATLWLPTGIFEFDINPSAAGPQKFLDG
FT                   SVQMPLSPDT"
FT   gene            703406..703726
FT                   /locus_tag="M446_0599"
FT   CDS_pept        703406..703726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0599"
FT                   /product="regulatory protein, FmdB family"
FT                   /note="TIGRFAM: regulatory protein, FmdB family; PFAM:
FT                   Putative regulatory protein FmdB; KEGG: mex:Mext_3374
FT                   regulatory protein, FmdB family"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15160"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:B0UPW1"
FT                   /protein_id="ACA15160.1"
FT                   /translation="MPVYDYSCESCGPFTVLRPMAQFRDPHDCPDCGQSCERAFLTAPR
FT                   LSGMEAGVRAAHAANERSRHAPRRSHGAGCGCCAPGKAAGGSANGSPAKSFPAARPWMI
FT                   SH"
FT   gene            703805..704851
FT                   /locus_tag="M446_0600"
FT   CDS_pept        703805..704851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0600"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: mex:Mext_3372 nitrilase/cyanide
FT                   hydratase and apolipoprotein N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15161"
FT                   /db_xref="GOA:B0UPW2"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:B0UPW2"
FT                   /protein_id="ACA15161.1"
FT                   /translation="MHHGDISSSHDSVGVAVVNYKMPRLHTKAEVLENCRKIADMVVGV
FT                   KAGLPGLDLIVFPEYSTHGIMYDAAEMYETASCIPGEETAIFAEACRKAKVWGVFSLTG
FT                   ERHEEHPHKAPYNTLILMNDRGEIVQKYRKIMPWVPIEGWYPGHCTYVSEGPKGLKVSL
FT                   IICDDGNYPEIWRDCAMRGAELIIRCQGYMYPAKEQQILMSKAMAFANNVYVAVANASG
FT                   FDGVYTYFGHSALVGFDGRTLGECGEEENGIQYAALSKFLIRDARANWQSENHLFKLLH
FT                   RGYTGMINSGEARHGMAACPYDFYRRWIEDPDATRDAVRAITRASVGTPECPIEGIPLV
FT                   GEGEAPHR"
FT   gene            704903..705700
FT                   /locus_tag="M446_0601"
FT   CDS_pept        704903..705700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0601"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_5"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities AAA_5; CbbQ/NirQ/NorQ domain protein; KEGG:
FT                   rsq:Rsph17025_4065 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15162"
FT                   /db_xref="GOA:B0UPW3"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR013615"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0UPW3"
FT                   /protein_id="ACA15162.1"
FT                   /translation="MLTDPLLRSEPYYRPVGDEVALFEAAYAARLPMILKGPTGCGKTR
FT                   FLEHMAWRLGRPLVTVACHEDMCAADLVGRWLLEAGGTVWHDGPLTRAVRQGAICYLDE
FT                   VVEARADTIVAIHPLADARRILPLERSGEVVPAHPDFLLCLSYNPGYQAAQKDLKESTK
FT                   QRFGALAFAYPEAPVEAEIVGREAGIGPAVAERLVRVGAASRALVAEGLAEGASTRMLI
FT                   HAGRLIAGGIGFAPACALAVATPLTDDPALRDALASCIAAQVP"
FT   gene            705697..707295
FT                   /locus_tag="M446_0602"
FT   CDS_pept        705697..707295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0602"
FT                   /product="von Willebrand factor type A"
FT                   /note="SMART: von Willebrand factor type A; KEGG:
FT                   bra:BRADO5860 conserved hypothetical protein; putative Von
FT                   Willebrand factor type A domain"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15163"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:B0UPW4"
FT                   /protein_id="ACA15163.1"
FT                   /translation="MTAAAPAGERRRAALLRALWGRGHPILSLPAPAPDAPPQRPTFDE
FT                   AALRLPHGAAPAAAREDRLAEASLAHLGAHLAFGGGRFPIGRLRPTQIALVSLIEDARV
FT                   EALALRERPGLVRLWRPFHAGAAEEAGTAAGLMARLARALLDPDHPDPDAFVARGRALF
FT                   YADPRAWADPGLSRSLGDRLGNDLGQMRLPFGPRAGWSEPAYRDDHAGMWERREIEAAA
FT                   RPERVPGPGDGADAPAADALPPRPGGRVWRYPEWDRRIRRARPGWVSLREESAAPALGR
FT                   PTPSEPRLAAALAAMRPRRPRRMRRRIDGDELDLAAATDALADLRAGRAPDPRVYSRVL
FT                   RRAEGVPLLLLVDASRSMGDPLPRGGRVIDAARGAAAALLGALAASGGPVAIQAFRSAG
FT                   RHDVRVAWIKRWDEPPAAAWPRLAGLAPAGSTRLGAALRHAGRSLPPGRGAVILLTDGE
FT                   PSDIDVHDPAFLAEDARMACRALAARGVGAFALALAPAPPPALVRAFTPGRCVAVAGPE
FT                   RLAGALVGLAARTRA"
FT   gene            complement(707471..708070)
FT                   /locus_tag="M446_0603"
FT   CDS_pept        complement(707471..708070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0603"
FT                   /product="lipolytic protein G-D-S-L family"
FT                   /note="PFAM: lipolytic protein G-D-S-L family; KEGG:
FT                   nve:NEMVE_v1g200840 predicted protein Pfam: LipaseGDSL"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15164"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:B0UPW5"
FT                   /protein_id="ACA15164.1"
FT                   /translation="MTRPLGLAPPVKPSALRRHARLAVRVPAAADLVLLGDSQAAGWPE
FT                   AALPPRSFNFGLPGDRVETTRWRLRAVDLSGLRPRRALLWVGTNNLADGDPVAEIVAGL
FT                   GLLAAELLALWPGARPILVTLPWRAPRAGRPDADRRALNRGIVGLARGCGADLLDAAAL
FT                   LGGEAEAAHTLAADRLHVAPEGYRRLGARLVGPGPS"
FT   gene            complement(708067..709044)
FT                   /locus_tag="M446_0604"
FT   CDS_pept        complement(708067..709044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0604"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15165"
FT                   /db_xref="UniProtKB/TrEMBL:B0UPW6"
FT                   /protein_id="ACA15165.1"
FT                   /translation="MPSSEPARRFLGLTALLLAGLLLLVAARVVWFDAYWIFRADPPWR
FT                   AATGGGNRLLDRQTRRAKVLQALTRPCATVLVGSSTVYHGLDPRDLDAAPLPVFNAGIS
FT                   AILAEELPLVASVVASRPGVSRVVIGLDYSMFSRPSVPVRLDPSLASATGRLTALMGSV
FT                   LGRYALMDSRIEAVSGAEDPGAWTRDGFRETPPLPPALTRENDAARRRSTAPFRPETLE
FT                   ALGLVLDRLAGLRVEAYLSPVSDAQRRVLADLGLLDDFARWREAVLRVGAARGVAIRDL
FT                   TALGASFPFDPAAGSTEAWLDNLHYTPRIGRLVLAALGLRRAPP"
FT   sig_peptide     complement(708961..709044)
FT                   /locus_tag="M446_0604"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.975) with cleavage site probability 0.470 at
FT                   residue 28"
FT   gene            complement(709031..710431)
FT                   /locus_tag="M446_0605"
FT   CDS_pept        complement(709031..710431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0605"
FT                   /product="membrane bound O-acyl transferase MBOAT family
FT                   protein"
FT                   /note="PFAM: membrane bound O-acyl transferase MBOAT family
FT                   protein; KEGG: mex:Mext_3038 membrane bound O-acyl
FT                   transferase MBOAT family protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15166"
FT                   /db_xref="GOA:B0UPW7"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="InterPro:IPR024194"
FT                   /db_xref="InterPro:IPR028362"
FT                   /db_xref="UniProtKB/TrEMBL:B0UPW7"
FT                   /protein_id="ACA15166.1"
FT                   /translation="MPFNALTFLLVALPLALALQALCLAWRPAWHARLLAGLSLAYYGW
FT                   WDLRALPLLLGAIAGTWLAGEAYRRSGDGRVITLALVLDVALLGLFKYLGFFAGLGAAL
FT                   TGAAVPVPLLLAPLGLSFLTFQHVAYLVDLRRGTGPALGPTDYVLYAAFFPRVIAGPLV
FT                   RPAAFAAAPPRPGAESAARGLLLLAAGLAKKAALGDPLAAAIDPLWAAAGAGLGPEAAA
FT                   QAVLGYALQLYVDFSGYTDMALGLALLFGIVLPENFRAPYRATSIQDFWRRWHITLSQF
FT                   LRDYLYIPFGGSRHGLPRQAAALLATMTLGGLWHGAGLTFVAWGAAHGAALALHVLWRR
FT                   AGLALPPLAGWAATFAFVALAWVPFRAPDFATALAVYRGLAGLAEPAAGLAAPAAGLAA
FT                   PAAGPVPEAWPLAALAFALAVIGPTAHDLAHRLPLSGRVAAATALLLAALLVQVGNDAN
FT                   QAFIYAQF"
FT   sig_peptide     complement(710354..710431)
FT                   /locus_tag="M446_0605"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.636 at
FT                   residue 26"
FT   gene            710611..711141
FT                   /locus_tag="M446_0606"
FT   CDS_pept        710611..711141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0606"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   cvi:CV_3201 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ACA15167"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B0UPW8"
FT                   /protein_id="ACA15167.1"
FT                   /translation="MTSDTPEPSPARRRLVEWADPRLTARAGLGRAGLDFLRALMSEEV
FT                   PRPPISALVGMEMVSAESGQVIMRMAPGEHLYNPIGCVHGGAIATLLDSAMGCAVHSLL
FT                   PEGRGYTTLEMKVNYLRALTRETGVVTAVGEVLHAGRQQAVAEARLTDEEGRLCATATS
FT                   TCLLFDLPARPSA"
FT   gene            711209..711616
FT                   /locus_tag="M446_0607"
FT   CDS_pept        711209..711616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_0607"
FT                   /product="globin"
FT