(data stored in ACNUC30630 zone)

EMBL: CP000944

ID   CP000944; SV 1; circular; genomic DNA; STD; PRO; 57951 BP.
XX
AC   CP000944; ABAY01000000-ABAY01000565;
XX
PR   Project:PRJNA18809;
XX
DT   21-FEB-2008 (Rel. 94, Created)
DT   12-DEC-2013 (Rel. 119, Last updated, Version 2)
XX
DE   Methylobacterium sp. 4-46 plasmid pM44601, complete sequence.
XX
KW   .
XX
OS   Methylobacterium sp. 4-46
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales;
OC   Methylobacteriaceae; Methylobacterium.
OG   Plasmid pM44601
XX
RN   [1]
RP   1-57951
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Chertkov O., Brettin T., Detter J.C.,
RA   Han C., Kuske C.R., Schmutz J., Larimer F., Land M., Hauser L.,
RA   Kyrpides N., Ivanova N., Marx C.J., Richardson P.;
RT   "Complete sequence of plasmid1 of Methylobacterium sp. 4-46";
RL   Unpublished.
XX
RN   [2]
RP   1-57951
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Chertkov O., Brettin T., Detter J.C.,
RA   Han C., Kuske C.R., Schmutz J., Larimer F., Land M., Hauser L.,
RA   Kyrpides N., Ivanova N., Marx C.J., Richardson P.;
RT   ;
RL   Submitted (12-FEB-2008) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 386f1444926637c780d13177ca67d5e7.
DR   BioSample; SAMN00623053.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID:  4003784
CC   Source DNA and bacteria available from Christopher J. Marx
CC   (cmarx@oeb.harvard.edu)
CC   Contacts: Christopher J. Marx (cmarx@oeb.harvard.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..57951
FT                   /organism="Methylobacterium sp. 4-46"
FT                   /plasmid="pM44601"
FT                   /strain="4-46"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:426117"
FT   gene            5..520
FT                   /locus_tag="M446_6965"
FT   CDS_pept        5..520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_6965"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_6965"
FT                   /db_xref="EnsemblGenomes-Tr:ACA21198"
FT                   /db_xref="UniProtKB/TrEMBL:B0UR85"
FT                   /protein_id="ACA21198.1"
FT                   /translation="MLPPTSPTASTRHDFHLDIDIAPPRVNPCPFDRLRNRGELDMDRV
FT                   RNNALYAAGSRLREHAQHAALDGLARARLDGTPGSGPGSRCPITETVERHRHTLLLAKQ
FT                   SMQSHEWQIVIAVVIDEATLEQAGRSAGYGNKAGATAVALDRLRHGLAALVMAWRLLPP
FT                   GEHPLSVA"
FT   gene            734..961
FT                   /locus_tag="M446_6966"
FT   CDS_pept        734..961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_6966"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_6966"
FT                   /db_xref="EnsemblGenomes-Tr:ACA21199"
FT                   /db_xref="UniProtKB/TrEMBL:B0UR86"
FT                   /protein_id="ACA21199.1"
FT                   /translation="MSPQDDRLDLLTGFQTIGDYLGWSYRKTQYRSSIGDLPTFKVGQH
FT                   VCARRSTLRDWAMKMEAKASREGKLADVAP"
FT   gene            1343..1735
FT                   /locus_tag="M446_6967"
FT   CDS_pept        1343..1735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_6967"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_6967"
FT                   /db_xref="EnsemblGenomes-Tr:ACA21200"
FT                   /db_xref="UniProtKB/TrEMBL:B0UR87"
FT                   /protein_id="ACA21200.1"
FT                   /translation="MPRKPASNAVAKSAVSNGTSLFLVDEVDRRSAPARRFRDIVGDVT
FT                   SDLGGRDEVTAVQQQLIRRFATLALTLELQEAAIVEGGQVDLDLYGRLSGQMNRLASTL
FT                   GLKRVMRDANELDLKAYMARKAGVLS"
FT   gene            1732..3132
FT                   /locus_tag="M446_6968"
FT   CDS_pept        1732..3132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_6968"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_6968"
FT                   /db_xref="EnsemblGenomes-Tr:ACA21201"
FT                   /db_xref="UniProtKB/TrEMBL:B0UR88"
FT                   /protein_id="ACA21201.1"
FT                   /translation="MTIIDALTDPHLFGSAIRDPATFTAWRVFLKAFFGLSMNEAELEI
FT                   FRACTGREVPPTTPMAEAHLPTGRRAGKSFVLALIAVYLAAFREYRGYLAPGERATVMV
FT                   LAADRRQARVIFRYCKGLLAGSPLLANLIERETAEALDLANGVTIEIGTASVKTTRGYS
FT                   LAAVLCDEIAFWETSEDSASPDYEILNALRPGMATIPGSVLLCASSPYARKGALWDAFS
FT                   RHFGQDNSDVLVWRAATRVMNPTVPERTIDEAYQRDPAAAAAEYGAEFRSDIESFVSLD
FT                   VVKACIDSGVMERLRHAGRHVAFVDPSGGSADSMTLAIAHHQAGKAVLDAVREIRPPFS
FT                   PEQVVEEFAGLMKSYGIREVTGDRYAGEWPRERFRVHGINYKVSEKSKSDLYRDLLPLL
FT                   NSAKVSLLDHPRLVQQLVALERRTARGGRDSIDHPRGGHDDLANAVAGVLVGLARPQNT
FT                   FQVLPFPF"
FT   gene            3165..3509
FT                   /locus_tag="M446_6969"
FT   CDS_pept        3165..3509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_6969"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_6969"
FT                   /db_xref="EnsemblGenomes-Tr:ACA21202"
FT                   /db_xref="UniProtKB/TrEMBL:B0UR89"
FT                   /protein_id="ACA21202.1"
FT                   /translation="MAYPTKTLPLDDSGNVSGAATAITTLRAAAGTRYANAVTALHAAF
FT                   VDLQALDVLTNNTNVGGNGMAVNTFTGGEAEWRLPLMLRHPVYIPNIPGNPNWAAESRA
FT                   RLDIYFSNLS"
FT   gene            3518..4213
FT                   /locus_tag="M446_6970"
FT   CDS_pept        3518..4213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_6970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_6970"
FT                   /db_xref="EnsemblGenomes-Tr:ACA21203"
FT                   /db_xref="UniProtKB/TrEMBL:B0UR90"
FT                   /protein_id="ACA21203.1"
FT                   /translation="MSNKGNIAEFWQQAVRQQLDQCPALRSDSQTGSPVVAALRSATSR
FT                   AAEISAAFGRIGERTRRDPHLTEAGKRDKITTVATRDTLGPLRRTQREVAEVKAQVAAK
FT                   RAACVVRRGTDPVEEMRRQEVRAFLRSLPDPGKRIGAAMQDPEIARAVVEASPMLSGMD
FT                   AANYQRIHDEVVKAEHGDVLAELDGLKEVIQYAENIMAFCHNSVRDTLGENRETDKLIA
FT                   DFNKEYDAS"
FT   gene            4254..4586
FT                   /locus_tag="M446_6971"
FT   CDS_pept        4254..4586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_6971"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_6971"
FT                   /db_xref="EnsemblGenomes-Tr:ACA21204"
FT                   /db_xref="UniProtKB/TrEMBL:B0UR91"
FT                   /protein_id="ACA21204.1"
FT                   /translation="MEALAAPPSATRRRAAGPTLSFSGGSPSPEREKPSMTDTDRANMG
FT                   ALFREVATKLGGYVPGRGMVFSDCVARALGYYDATLLRAHMRDPNNVEWRRRLIDAVAM
FT                   LKAARP"
FT   gene            complement(4678..5796)
FT                   /locus_tag="M446_6972"
FT   CDS_pept        complement(4678..5796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_6972"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_6972"
FT                   /db_xref="EnsemblGenomes-Tr:ACA21205"
FT                   /db_xref="GOA:B0UR92"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:B0UR92"
FT                   /protein_id="ACA21205.1"
FT                   /translation="MDSDASSGDGQGYDLGLNIGLSKCKGQITPLRVIPSGHVPIDFVH
FT                   VHAVQAICDILVELKIEPEKILKLAGIDTQIFGTIEAISFASLGRLTALAADQTQCAHF
FT                   GLLIGQRVTLASLGLLGTRMRHSETVGDALQAVRTHHDLLNRGAVIELSIDGPVAIVSY
FT                   APYEPDIEGVALHCERAIAALTSVLRSLCSPHWSPEEVLLPRLEPEDTTPYTRFFRAPV
FT                   RFSQEIAALVFPARVLRRPVEGANPLIRAAVERRIQQLEAVIPSGLTDEVRRRVRSTVS
FT                   EKRIERLHVAQSLAIHQRTLARRLKAEGTTFRSVANQTRLAMAKQLLANTNLSLARISA
FT                   ALEFSEPPAFTRAFHRWTGMAPSAWRKDHRGS"
FT   gene            complement(6032..6292)
FT                   /locus_tag="M446_6973"
FT   CDS_pept        complement(6032..6292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_6973"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_6973"
FT                   /db_xref="EnsemblGenomes-Tr:ACA21206"
FT                   /db_xref="UniProtKB/TrEMBL:B0UR93"
FT                   /protein_id="ACA21206.1"
FT                   /translation="MADTLTIGDLYKLKLVTDEQLDAAVMDFLSDPKPGPRPLAEDIAI
FT                   DVCAIMAASSHAREVLAARGSSEAEMRMAVRTAILLARPAR"
FT   gene            complement(6379..6648)
FT                   /locus_tag="M446_6974"
FT   CDS_pept        complement(6379..6648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_6974"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_6974"
FT                   /db_xref="EnsemblGenomes-Tr:ACA21207"
FT                   /db_xref="UniProtKB/TrEMBL:B0UR94"
FT                   /protein_id="ACA21207.1"
FT                   /translation="MIKAALLAASLALLPAAVLAQGGSPYNKAGSQAGGPVGGAERAAG
FT                   APGGTPDTFPGQAKPPGQATRAAAPHRAAGHKAVNERRRRNARD"
FT   gene            7002..7202
FT                   /locus_tag="M446_6975"
FT   CDS_pept        7002..7202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_6975"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_6975"
FT                   /db_xref="EnsemblGenomes-Tr:ACA21208"
FT                   /db_xref="UniProtKB/TrEMBL:B0UR95"
FT                   /protein_id="ACA21208.1"
FT                   /translation="MADDFNIRDALEALLREAGQIFDVCDRDDSWAPTASFVVEIQAHA
FT                   CCEALNGLEGRERYKVTKRAA"
FT   gene            complement(7498..7806)
FT                   /locus_tag="M446_6976"
FT   CDS_pept        complement(7498..7806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_6976"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_6976"
FT                   /db_xref="EnsemblGenomes-Tr:ACA21209"
FT                   /db_xref="GOA:B0UR96"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:B0UR96"
FT                   /protein_id="ACA21209.1"
FT                   /translation="MLRSQFTRRIAELNPHLRSGQANAVVRAVLDRIAEGLADGSRVEL
FT                   RGFGAFKTVTRDARPSRNPRTGELVTVPAKRDVKFKASVEVTKRLNPTDNRLLRVAE"
FT   gene            8098..8304
FT                   /locus_tag="M446_6977"
FT   CDS_pept        8098..8304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_6977"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_6977"
FT                   /db_xref="EnsemblGenomes-Tr:ACA21210"
FT                   /db_xref="InterPro:IPR008462"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:B0UR97"
FT                   /protein_id="ACA21210.1"
FT                   /translation="MADKDRIEGSADQMKGSLKQTAGDLTGDQKLKSEGTMDKVSGKIQ
FT                   NAVGGAKDAIRDTFSSDKDKKPT"
FT   gene            8433..8675
FT                   /locus_tag="M446_6978"
FT   CDS_pept        8433..8675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_6978"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_6978"
FT                   /db_xref="EnsemblGenomes-Tr:ACA21211"
FT                   /db_xref="UniProtKB/TrEMBL:B0UR98"
FT                   /protein_id="ACA21211.1"
FT                   /translation="MAQVRVLDPLTGRVVSVDLPCPLLRVPLHAPPKLFESRVQARCRA
FT                   RRRRRSRRRCRRPPSRQLEDGHHGAFRLPSRSLTI"
FT   gene            complement(8630..9220)
FT                   /locus_tag="M446_6979"
FT   CDS_pept        complement(8630..9220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_6979"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_6979"
FT                   /db_xref="EnsemblGenomes-Tr:ACA21212"
FT                   /db_xref="UniProtKB/TrEMBL:B0UR99"
FT                   /protein_id="ACA21212.1"
FT                   /translation="MNHDQELRDLARAYADGRITEAEYEKADAAIRARMPARRAPATVV
FT                   PLGRLRTLFPPKRRCRSPDRLKTLERRRTIAFSGPLPPATAARFTTGQLAVLGIVGDEI
FT                   AANGDCTLTVGEIAARAGVSHRLAQDAIRLAELDGLVRIEERRRRGDRNLPNRVTVLSR
FT                   EWSAWLKRRRPLDAEMRALQIVRDLLGSRNAPW"
FT   gene            9646..10185
FT                   /locus_tag="M446_6980"
FT   CDS_pept        9646..10185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_6980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_6980"
FT                   /db_xref="EnsemblGenomes-Tr:ACA21213"
FT                   /db_xref="UniProtKB/TrEMBL:B0URA0"
FT                   /protein_id="ACA21213.1"
FT                   /translation="MAEEWFTYSALGERLGISPEAARQKAIRNHWPRRAGNDGKAQVRV
FT                   DIEEVIASTIPRKPREEEPSDACPTPEALPVEPPSDARTFAALEEHIATLKAMAAKAEE
FT                   IAERERQRADQEGVRADAERARADAERARANELVDRITQLQNDERASRATIERELSELR
FT                   GVVDRLKRPWWRRLAG"
FT   gene            10391..10642
FT                   /locus_tag="M446_6981"
FT   CDS_pept        10391..10642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_6981"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_6981"
FT                   /db_xref="EnsemblGenomes-Tr:ACA21214"
FT                   /db_xref="GOA:B0URA1"
FT                   /db_xref="UniProtKB/TrEMBL:B0URA1"
FT                   /protein_id="ACA21214.1"
FT                   /translation="MLANEAAGPGQTYRPGRLVLQTGPERRMQIYRRLRERGFSPVQTL
FT                   AMIGVSVPLLVAGASITLLGTLDAWGLVEPLRASIPRG"
FT   gene            complement(10674..10934)
FT                   /locus_tag="M446_6982"
FT   CDS_pept        complement(10674..10934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_6982"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_6982"
FT                   /db_xref="EnsemblGenomes-Tr:ACA21215"
FT                   /db_xref="UniProtKB/TrEMBL:B0URA2"
FT                   /protein_id="ACA21215.1"
FT                   /translation="MKAYVVALRASVLLASLPGAVFAHAALLAPDQPAPEVSEDAATPD
FT                   RMTDVDPALLARCDAEAVRKRLRGEVRRVFVESCVEPEGDD"
FT   gene            11622..11825
FT                   /locus_tag="M446_6983"
FT   CDS_pept        11622..11825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_6983"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_6983"
FT                   /db_xref="EnsemblGenomes-Tr:ACA21216"
FT                   /db_xref="UniProtKB/TrEMBL:B0URA3"
FT                   /protein_id="ACA21216.1"
FT                   /translation="MRHAPLDYTKPPRPLWQEREARAERAQLHGNFARAVSATGKGAAV
FT                   REFKNAHLFMKGKPSRDFGRER"
FT   gene            11930..12601
FT                   /locus_tag="M446_6984"
FT   CDS_pept        11930..12601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_6984"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_6984"
FT                   /db_xref="EnsemblGenomes-Tr:ACA21217"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0URA4"
FT                   /protein_id="ACA21217.1"
FT                   /translation="MKTLAIISQKGGVGKTTLATALAVEAGRAGKSTVVFDLDPQASAS
FT                   FWKDTRKDELVAMTAIPAARLGHVIKAADAAGCDFAIVDTPPFSKDIAYEAAQHADFVL
FT                   IPTRPAVLDVMATNKTIELLRHYGKPSAVILTFCPPIGREVDDSVEAVNALGARICPVR
FT                   IGNRIAFSRAQQTGQVAQEIEPEGKAAQEIQRLYSYVCMHLNNSERSTADGRKRVSSHT
FT                   G"
FT   gene            12567..12917
FT                   /locus_tag="M446_6985"
FT   CDS_pept        12567..12917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_6985"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_6985"
FT                   /db_xref="EnsemblGenomes-Tr:ACA21218"
FT                   /db_xref="UniProtKB/TrEMBL:B0URA5"
FT                   /protein_id="ACA21218.1"
FT                   /translation="MAGNAFQAILDKAAREPAPEPERKPAARRAPKPANRSAEPAPAPA
FT                   PEAKKFHRPSRDNRRFVGGHFEPAVGKQLRMIAVEDDTTVQALLEEALDLLFVKKGRQK
FT                   IADLAPRTDIGM"
FT   gene            12946..14091
FT                   /locus_tag="M446_6986"
FT   CDS_pept        12946..14091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_6986"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_6986"
FT                   /db_xref="EnsemblGenomes-Tr:ACA21219"
FT                   /db_xref="InterPro:IPR018777"
FT                   /db_xref="UniProtKB/TrEMBL:B0URA6"
FT                   /protein_id="ACA21219.1"
FT                   /translation="MTRRQYIDRQFDLFLPYISDLPLRDQRETMERPFFSLSKNKRLKP
FT                   IEYTSPDGKVFVSVYPNEKFGMATIWDADVLIWAASTLSRLKKAGINDIPRTLHCQPYD
FT                   ILKTIGRATGGQEYRLLREALGRLQSTTIITNIRAERTKTKKRQFSWIESFTDLVDEET
FT                   QQSRGMSITLADWFYEGVVMDGGILSIDPAYFTISGGRERWLYRVARKHAGGANAEGFA
FT                   IPLRTLFEKSGAEGEYRRFKFELQAIVRRNNVPEFVFRLEEDERGGEPLLRMVRRDLIG
FT                   DIADMPKAPRRRKAKTPATSPAPSVSKGHVAASLPLFQAITDETIASVRRDFPGWDVYA
FT                   LKGDFDAWIAENPSKLPDDYNAAFYGFVKRYHARNRHQLRG"
FT   gene            15019..15162
FT                   /pseudo
FT                   /locus_tag="M446_6987"
FT   gene            complement(15164..15496)
FT                   /locus_tag="M446_6988"
FT   CDS_pept        complement(15164..15496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_6988"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_6988"
FT                   /db_xref="EnsemblGenomes-Tr:ACA21220"
FT                   /db_xref="GOA:B0URA7"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B0URA7"
FT                   /protein_id="ACA21220.1"
FT                   /translation="MREPKKRFTPEFRAEAVRLAHTSGRSRREVAEDLGIGLSTLRHWI
FT                   DGQRDREMEAPPSDRQEDMAAELKRLRRENEVLRQEREILKRATALGFWTVFLSRQRAG
FT                   RSRSWR"
FT   gene            complement(15465..16421)
FT                   /locus_tag="M446_6989"
FT   CDS_pept        complement(15465..16421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_6989"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_6989"
FT                   /db_xref="EnsemblGenomes-Tr:ACA21221"
FT                   /db_xref="GOA:B0URA8"
FT                   /db_xref="InterPro:IPR008807"
FT                   /db_xref="InterPro:IPR041920"
FT                   /db_xref="UniProtKB/TrEMBL:B0URA8"
FT                   /protein_id="ACA21221.1"
FT                   /translation="MTRGREADARHPRRGSCRLITVAGKTGAVQVEKTVTPDAIISLED
FT                   GKPYKSLRRHLNTRGLTPEQYPGEVGSAVGLPDGSGELRRPALRARQEHRPRSPHTVEC
FT                   VIGGASPFKKSPLAWACPPTRPAAENNQNSHEISENPERRMRKMGGVGSGQWGGRPTVE
FT                   SGLTLTLGKLLRDGICRPGQSRAGTLTWTNTRTGAQLASIAYEAHLGAEHGRLRLHFTT
FT                   TRSNSEKRHSDDWIELTTTTQPFGGRRWWFICPRTGARVAKLYLPGGALTFASRQAHRL
FT                   GYRSQRETPIGLASGKWRALSVREEVPDARTEEALHP"
FT   gene            complement(16418..17533)
FT                   /locus_tag="M446_6990"
FT   CDS_pept        complement(16418..17533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_6990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_6990"
FT                   /db_xref="EnsemblGenomes-Tr:ACA21222"
FT                   /db_xref="GOA:B0URA9"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B0URA9"
FT                   /protein_id="ACA21222.1"
FT                   /translation="MPQTERLIGDPAAEIRVQTFLKGEPITALAQGCVHVVVFWAPWCG
FT                   SCKVAFSHLTALQVRHPQVPIIGVAVTWTDLGELAAFVRDHGDAIGYRIAADLPLSPGE
FT                   RQGTMDRTWCQAAYNTDVPTAFIIDRDGRIAWIGDPLESDGPLAAVVEGRWDLAAAREA
FT                   QEAVLQRDKVRELWRLEEAVERHLAAGDRSGALQAYDAAFAADPGLEPLRGLHKFALLL
FT                   LPARDAAALDYARHLIGAVVADQIEPLIHLGTMLAEAAEQGTGAPDWPPAAAALALTAI
FT                   TRAEASGEVTRTDQRMQLAEAAARALLVVGRTGEAAARARAARALAPAPAPAPAPDIVR
FT                   AVIIFQLDQLVARCDAAAGRRDGATCRLDEA"
FT   gene            complement(17809..18126)
FT                   /locus_tag="M446_6991"
FT   CDS_pept        complement(17809..18126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_6991"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_6991"
FT                   /db_xref="EnsemblGenomes-Tr:ACA21223"
FT                   /db_xref="GOA:B0URB0"
FT                   /db_xref="UniProtKB/TrEMBL:B0URB0"
FT                   /protein_id="ACA21223.1"
FT                   /translation="MAPAAAAVTVSAAGLVAPAAAAVTVSAAGLVAPAAAAVTVSAAGL
FT                   VAPAAAAVTVSAAGLVAPAAAAVTVSAAGLVAPAAAAVTVSAAGLVAPAAAADGVAPPE
FT                   L"
FT   gene            18451..18921
FT                   /pseudo
FT                   /locus_tag="M446_6992"
FT   gene            19678..19926
FT                   /locus_tag="M446_6993"
FT   CDS_pept        19678..19926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_6993"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_6993"
FT                   /db_xref="EnsemblGenomes-Tr:ACA21224"
FT                   /db_xref="GOA:B0URB1"
FT                   /db_xref="InterPro:IPR005063"
FT                   /db_xref="UniProtKB/TrEMBL:B0URB1"
FT                   /protein_id="ACA21224.1"
FT                   /translation="MRLFCTDNYAPYAAALPAGRHHVGKDQTQLVESNNARQRHWFARF
FT                   RRRTCVVSKSVEMVEATMALFAFYHCNGSELTSALVG"
FT   gene            20072..20330
FT                   /pseudo
FT                   /locus_tag="M446_6994"
FT   gene            complement(20361..20624)
FT                   /pseudo
FT                   /locus_tag="M446_6995"
FT   gene            complement(20626..20835)
FT                   /pseudo
FT                   /locus_tag="M446_6996"
FT   gene            complement(20956..21159)
FT                   /pseudo
FT                   /locus_tag="M446_6997"
FT   gene            21428..22195
FT                   /locus_tag="M446_6998"
FT   CDS_pept        21428..22195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_6998"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_6998"
FT                   /db_xref="EnsemblGenomes-Tr:ACA21225"
FT                   /db_xref="InterPro:IPR021451"
FT                   /db_xref="UniProtKB/TrEMBL:B0URB2"
FT                   /protein_id="ACA21225.1"
FT                   /translation="MPKITRIGFNYAELESSVAKEARDTAHRLREQGNAFIIEVGLTLL
FT                   RMKGLLGHGAFGPWVRTELRWTDRTAQNYMRAAEVFAGKSEIISHLPSTTVYDLAAKSV
FT                   PNDLRNEIIREFQESGCTDKDVAAKKIRDFKLSTKKTVAPNKREKHQAGETQCCVSHPT
FT                   EGGRQKTPGAAAEAAALIVEALGDGTDHLFRLMEKASWNDIKAELMVLISKPKQPEPQA
FT                   SSRVSKPKQPEPQASSRVSKPKQPEPQAPSRVH"
FT   gene            22759..23073
FT                   /locus_tag="M446_6999"
FT   CDS_pept        22759..23073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_6999"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_6999"
FT                   /db_xref="EnsemblGenomes-Tr:ACA21226"
FT                   /db_xref="UniProtKB/TrEMBL:B0URB3"
FT                   /protein_id="ACA21226.1"
FT                   /translation="MMKNCDMKKVALGSIVAVSAVIAYSAAMAGTLHGRSHNSSRHEYT
FT                   GEIGSSCLRLDYEKCQRLRYEKDFDTENQYRNYDQDEDQDQDQDEDQDQDPNQMAQPIL
FT                   "
FT   gene            23422..25173
FT                   /locus_tag="M446_7000"
FT   CDS_pept        23422..25173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_7000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_7000"
FT                   /db_xref="EnsemblGenomes-Tr:ACA21227"
FT                   /db_xref="GOA:B0URB4"
FT                   /db_xref="InterPro:IPR000036"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR020080"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:B0URB4"
FT                   /protein_id="ACA21227.1"
FT                   /translation="MRRSGAYYLLYLPIVGLGFAASAADLPQLTPPMMAFAPLVTPSFT
FT                   WTGPYAGVFFGYGSLDESGTGRCIGPRCVRLPALSPGARAADLSAGSEVGYNLQASPGS
FT                   GLVIGAAVDYQTTRLRGYGESILVREVDENSDFAAFYHLGQRLDTFGAVRGKAGYAFDR
FT                   LFVYGTGGLAYGYVRIDVGTALTVGDRQFAAQGLTSGFRLGYAAGGGAEYAISPHLSVK
FT                   AEGLYYDLGQRTVSIQAALPRSVYGGTIATHGFLARASLNYRFGDGIPGLGLPEHIRTL
FT                   LNPVAYTPLPASDWVFEVGIRYFYSTGRSSLLLGDSENAGHKNSRVIYHDVGAHASENF
FT                   VRVDDNSTGRFAKAFVGSGIITSGRFTDEDFPPRMPLYSHTISKIPGRDIGYAVADVGY
FT                   NVLVGETYRLGAFAGYQYVSEFADSSGCAQKADNSTCGWPFIPRSVEVVTHDMHWHGMR
FT                   IGLAGELRYDRLKLSAEAAYLPIADLSGFDHHWLRPDINPLPVYGLGNGYFLQGVVSYD
FT                   LTPEISIGVGARYWKMVTDRGHTKFPYAEPSALPTPLKYESSRAGVFVQASYKFTDNSF
FT                   DLGPFLR"
FT   gene            complement(25196..25456)
FT                   /pseudo
FT                   /locus_tag="M446_7001"
FT   gene            26260..26460
FT                   /locus_tag="M446_7002"
FT   CDS_pept        26260..26460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_7002"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_7002"
FT                   /db_xref="EnsemblGenomes-Tr:ACA21228"
FT                   /db_xref="UniProtKB/TrEMBL:B0URB5"
FT                   /protein_id="ACA21228.1"
FT                   /translation="MLAWVREWFRGNAGIGGWWTAERQQHAVDVLVKGGVSELGAKALV
FT                   ARWSGVSQTFNARKKSSPNKA"
FT   gene            27105..27272
FT                   /locus_tag="M446_7003"
FT   CDS_pept        27105..27272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_7003"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_7003"
FT                   /db_xref="EnsemblGenomes-Tr:ACA21229"
FT                   /db_xref="UniProtKB/TrEMBL:B0URB6"
FT                   /protein_id="ACA21229.1"
FT                   /translation="MKRLLVRDAMNARSRSLIKRFLDAPLPHQMRTPEQIEAYWKELGA
FT                   EIGPVTETPR"
FT   gene            complement(27381..27800)
FT                   /locus_tag="M446_7004"
FT   CDS_pept        complement(27381..27800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_7004"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_7004"
FT                   /db_xref="EnsemblGenomes-Tr:ACA21230"
FT                   /db_xref="InterPro:IPR018841"
FT                   /db_xref="UniProtKB/TrEMBL:B0URB7"
FT                   /protein_id="ACA21230.1"
FT                   /translation="MDEAAFEWVTARAKRVRQAGPHATSARYLTAGGRLVVGLSTGAEL
FT                   RVPVAIIEGLAGASPEDLREIEVTPAGLGLHFPRLDADVYVPALIEGVTGSGKWMAQHL
FT                   GRAGGSARTERKAQASRENGKLGGRPRTRQRELVD"
FT   gene            complement(27793..28035)
FT                   /locus_tag="M446_7005"
FT   CDS_pept        complement(27793..28035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_7005"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_7005"
FT                   /db_xref="EnsemblGenomes-Tr:ACA21231"
FT                   /db_xref="InterPro:IPR025427"
FT                   /db_xref="UniProtKB/TrEMBL:B0URB8"
FT                   /protein_id="ACA21231.1"
FT                   /translation="MPTVLRIESLRVVIYPNDHRPAHVHVIGEDCEAVFNLNCPDGPVK
FT                   IRENHGFALQRAAALARELEANLTHLCEEWRKIHG"
FT   gene            complement(28095..28646)
FT                   /locus_tag="M446_7006"
FT   CDS_pept        complement(28095..28646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_7006"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_7006"
FT                   /db_xref="EnsemblGenomes-Tr:ACA21232"
FT                   /db_xref="GOA:B0URB9"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:B0URB9"
FT                   /protein_id="ACA21232.1"
FT                   /translation="MARIGYARVSSTDQDLALQLAGLKAAGCDVVRSEKVSGTSTNGRT
FT                   ELATILDFIGRGDVLVVTRIDRLARSIGDLQDIVRSLRVKGAALQATEQPIDTATAAGK
FT                   AFLDMLGVFAEFETNLRRERQLEGIAKAKAEGVYKGRPASIDVAQVRALKAEGIGPAEI
FT                   ARRLGIGRASVYRLLGEANA"
FT   gene            complement(28665..28901)
FT                   /locus_tag="M446_7007"
FT   CDS_pept        complement(28665..28901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_7007"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_7007"
FT                   /db_xref="EnsemblGenomes-Tr:ACA21233"
FT                   /db_xref="UniProtKB/TrEMBL:B0URC0"
FT                   /protein_id="ACA21233.1"
FT                   /translation="MEFADFNSSREHCPITDDRVALIDALQKADDGSLLHHPAEIVIGP
FT                   PHWGIPIRDARVRHSWRLIWIDIAFMRRYNLRV"
FT   gene            28974..29960
FT                   /locus_tag="M446_7008"
FT   CDS_pept        28974..29960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_7008"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_7008"
FT                   /db_xref="EnsemblGenomes-Tr:ACA21234"
FT                   /db_xref="InterPro:IPR007487"
FT                   /db_xref="UniProtKB/TrEMBL:B0URC1"
FT                   /protein_id="ACA21234.1"
FT                   /translation="MRRREFLISLAMSASGLRTSRAEAAGVIRVGVLNTGQESAGRRAR
FT                   AAALRQGIAEQSLASDRQIALDFIWAGAEPEATRLAARALVEARTEVLVGAGTSATAAL
FT                   MRETRTLPIVFVSVSDPIGEGFAASYSKPGGNATGLSNFEPSMTAKWLELLEEIAPGTT
FT                   RPALLFHPKTAAGQGQFFWRPFSAAAASLNLDPIPVSVDRMEDVEAATVELARQPGTAL
FT                   AIAPSSFTSLHGLEIASSANRRGLPTVFPFSEFARGGGLISYGAHVLDLFRRAGSFVIR
FT                   IANGEHPADLPVEAPTHFELVVNARTAKMLGLAVPPLLLARADEVIE"
FT   gene            30585..30800
FT                   /locus_tag="M446_7009"
FT   CDS_pept        30585..30800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_7009"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_7009"
FT                   /db_xref="EnsemblGenomes-Tr:ACA21235"
FT                   /db_xref="UniProtKB/TrEMBL:B0URC2"
FT                   /protein_id="ACA21235.1"
FT                   /translation="MQRFYFDLADGVTTIRDDVGVEAVNLDEALEEAEAVIREMRANGE
FT                   LAHLGDGWTLSIRAEAETVLAILLVE"
FT   gene            30915..31229
FT                   /locus_tag="M446_7010"
FT   CDS_pept        30915..31229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_7010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_7010"
FT                   /db_xref="EnsemblGenomes-Tr:ACA21236"
FT                   /db_xref="UniProtKB/TrEMBL:B0URC3"
FT                   /protein_id="ACA21236.1"
FT                   /translation="MPTADPTADHSTFVSEWNRGLASLSPGQPPCPGFRPEDWATTLEN
FT                   CRRFVDEFGAEAARLGWDTILLFGVHPQAGIIRGDWSGVMMPCSYPVFEVTEAYLKKHL
FT                   "
FT   gene            31394..31543
FT                   /pseudo
FT                   /locus_tag="M446_7011"
FT   gene            complement(31525..32400)
FT                   /locus_tag="M446_7012"
FT   CDS_pept        complement(31525..32400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_7012"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_7012"
FT                   /db_xref="EnsemblGenomes-Tr:ACA21237"
FT                   /db_xref="GOA:B0U9X2"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:B0U9X2"
FT                   /protein_id="ACA21237.1"
FT                   /translation="MSGTGELIPPLVERIKATLVGLKMPRALEIVDTTVRRLERGELSA
FT                   LEAVDALLSEELSLRESRRVKTALVMARLSTVKTLSGFDFAFQPSLDRTRILALAELGF
FT                   VDRCEVLHFLGPPGTGKSHLAVALGVEAVKAGRSVYFTTLADLVGTLARAEREGTLREK
FT                   IRYFCRPALLIVDEIGYLPVVPGGGNLFFQLVNARYERGAMVLTSNRGFAEWGEVFGDP
FT                   VVATALLDRLLHHAVVVQIEGSSYRLRQHTALMPEHIRSKAALQAPPLAPPPRRRGRPP
FT                   KNGGAHLGIA"
FT   gene            complement(32397..33680)
FT                   /locus_tag="M446_7013"
FT   CDS_pept        complement(32397..33680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_7013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_7013"
FT                   /db_xref="EnsemblGenomes-Tr:ACA21238"
FT                   /db_xref="GOA:B0U9X3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:B0U9X3"
FT                   /protein_id="ACA21238.1"
FT                   /translation="MVSLGELMTILDLHRQGLSVTAIARQLGLDRKTVAKYIARGLEPP
FT                   VYGPRSPRARATDAFLPYLRERLAAYPQLTAVRLWRELKERGFAGAYTAVKRAVALLRP
FT                   SAPLPIERRFETPPGEQAQVDLARFEVVFADEPGVTRIVWLFAMVLGHSRYLWARFVVH
FT                   QDLQTVLRCHIAAFQALGGAPREILYDRMKTAVIGEDPDGLVIYNRSLLDLARHYGFLP
FT                   RACRPYRAKTKGKVERPFRYLREDFFLARSFRNLDDLNDQLRHWLDTVANARRHATTKR
FT                   IVADAFAEERSQLRALPPVPYEAVLSLERRVTHEGFVSVAGNLYSVPDTTRRRALEVHV
FT                   LADQIRIYEAGELVACHLPLEGRGLTQVDPAHRRPRSPPPEPRDPAEPVVVRRAGDQVA
FT                   RRPLAIYDAVARQLAGAGVPRTDRGDAA"
FT   gene            33851..34285
FT                   /locus_tag="M446_7014"
FT   CDS_pept        33851..34285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_7014"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_7014"
FT                   /db_xref="EnsemblGenomes-Tr:ACA21239"
FT                   /db_xref="UniProtKB/TrEMBL:B0URC6"
FT                   /protein_id="ACA21239.1"
FT                   /translation="MPIRPEHRGFYPIDWPQLSDVIRFRRAGGRCEGCGRPHLQRIACL
FT                   PDGRWFDAATDTWRDGCGRILRSRMLLENLLYTVRFTRVVLATAHRNHDTSDNAPGNLA
FT                   ALCQRCHMIHDRPEHQRRRRFTLFSRKAAGDLFRGPYRKL"
FT   gene            complement(34297..34848)
FT                   /pseudo
FT                   /locus_tag="M446_7015"
FT   gene            35186..35536
FT                   /locus_tag="M446_7016"
FT   CDS_pept        35186..35536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_7016"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_7016"
FT                   /db_xref="EnsemblGenomes-Tr:ACA21240"
FT                   /db_xref="UniProtKB/TrEMBL:B0URC7"
FT                   /protein_id="ACA21240.1"
FT                   /translation="MTRHPRRAHDDQGREIPPPTIGWLRSEEGDRTAFVHCNATGCGHE
FT                   ATISTDPFPDSLPFPDIALRLRCAACGSREVGVMRDVVGIYARLGRRTGWSMGAAGARP
FT                   VARRDAPDRDRP"
FT   gene            complement(35666..35854)
FT                   /locus_tag="M446_7017"
FT   CDS_pept        complement(35666..35854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_7017"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_7017"
FT                   /db_xref="EnsemblGenomes-Tr:ACA21241"
FT                   /db_xref="UniProtKB/TrEMBL:B0URC8"
FT                   /protein_id="ACA21241.1"
FT                   /translation="MTTPREIPPASALWRARRRALSLPSSYTTTRDTTRASMDDLFKDV
FT                   SITQRRQVDSSIKAGPR"
FT   gene            35914..37113
FT                   /locus_tag="M446_7018"
FT   CDS_pept        35914..37113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_7018"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_7018"
FT                   /db_xref="EnsemblGenomes-Tr:ACA21242"
FT                   /db_xref="GOA:B0URC9"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:B0URC9"
FT                   /protein_id="ACA21242.1"
FT                   /translation="MTDEMMSLRGLLEKSADADLLREMIGFAAERLMELEVGGLTGAAH
FT                   GEKSAERLVQRNGYRDRDWQTRAGTVELRIPKLRKGSYFPAFLEPRRMAEKALTAVIQE
FT                   AYIQGISTRSVDDLVQAMGGTGVSKSQVSRLCQEIDERVGAFLDRPLEGEWPYLWIDAT
FT                   YVKVRQAGRIVSVAVIVAVGVNSDGRREVLGMDVGPSEAETFWTGFLRKLARRGLRGVK
FT                   LVISDAHTGLKASVAKVMNATWQRCRVHFMRTVLAHAGRSGRRVVSAFIATAFAQDDAE
FT                   AARQQWRRVADQLRPKVPKLAALMHEAEPDVLAYMGFPAAHRVKLHSTNPLERLNGEIK
FT                   RRTEVVGIFPNEAAITRLVGALLLEQNDEWAVQRARYLTLESIAPISDDPLVSLPTLAA
FT                   "
FT   gene            complement(37156..37845)
FT                   /locus_tag="M446_7019"
FT   CDS_pept        complement(37156..37845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_7019"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_7019"
FT                   /db_xref="EnsemblGenomes-Tr:ACA21243"
FT                   /db_xref="UniProtKB/TrEMBL:B0URD0"
FT                   /protein_id="ACA21243.1"
FT                   /translation="MCAYAGSIIFSAKNLCDTPRWSAVEARGGPTSVNPRSGAFGIAQW
FT                   LSRDRLAPIRGNTDFDAQLRHALHELHTTERRALAKLNSAKTPFEAATGASMFERAEGY
FT                   NARTGVDLFTGRTAAAMGGLKVGPPGEPVQVASGGDVLWYKRDRYYPSKAGGYSRLRDD
FT                   EVVNDLKDGPPSQKIAMSRVGDDMMQRRFNSAGASAGSGKGHLHITMDGFPTGTRARAS
FT                   VVSPGVV"
FT   gene            complement(38037..39386)
FT                   /locus_tag="M446_7020"
FT   CDS_pept        complement(38037..39386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_7020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_7020"
FT                   /db_xref="EnsemblGenomes-Tr:ACA21244"
FT                   /db_xref="GOA:B0URD1"
FT                   /db_xref="InterPro:IPR000743"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:B0URD1"
FT                   /protein_id="ACA21244.1"
FT                   /translation="MKVLTARAVLVATAGLMTVGATHSAQSQDRRNVQEPVPPTQVCAV
FT                   LSADDAPSAKVGQAKLQAALDGCRTGQAVRLTPSRTKAVFASGPIEMRAGVVLWLDAGA
FT                   VLAAEPDPRLYDLGDGRCGLINNAGGGCRPFLNFHKANGAGLMGDGTIDGQGGAVMIGK
FT                   AETWWALASRAQVEGREQNVPRLVQIDSSNNITVYRITLRNAPNVHIAMNKVQGVTVWG
FT                   VTINTPADARNTDGIDPGAAMDVTIARTFISTGDDDIAIKAGDNGATRHVSILDIHIYS
FT                   GHGLSIGSETNSGVSDVLVRNVTIDGAVSGLRIKSDPSRGGLVQAVRYENVCVRGSRRP
FT                   IDFDTRYDPRAQGTKIPVYSNIVLRQVAGEGGRLVMHGYDAAHPLGVSLDGVRFVDNAT
FT                   WDVVNTQAIVMAGGVTPPIGAPAAAWSAVNGPNCKALWTPFPGDTAVQSH"
FT   gene            complement(39612..40743)
FT                   /pseudo
FT                   /locus_tag="M446_7021"
FT   gene            complement(40740..41564)
FT                   /locus_tag="M446_7022"
FT   CDS_pept        complement(40740..41564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_7022"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_7022"
FT                   /db_xref="EnsemblGenomes-Tr:ACA21245"
FT                   /db_xref="InterPro:IPR010123"
FT                   /db_xref="UniProtKB/TrEMBL:B0URD2"
FT                   /protein_id="ACA21245.1"
FT                   /translation="MDLFDTFKAMGELWGKGTQCFLEAQRNMYGAMTTALDKDGKPSLP
FT                   LIPDWEALEQAQHSYQQGWEAAQAVSATFAKSLKGGGEVRDPIAADVLAKIFDPHGWIC
FT                   ITGAVDEALKRMAEGPRLADLWNVERKFAAVFTAWVALHRRNLEHNALMMEVWKKATAA
FT                   FSAVVNERSKNEQGIASSRELMALWVETANDVLLEAQRSEEFLKSQRETLKASTDLRLA
FT                   QQDIAEFYSQMFGYPTRAELDDVHQSLTQLRREVRALSRQRRTSGKSEGEPT"
FT   gene            complement(41586..42764)
FT                   /locus_tag="M446_7023"
FT   CDS_pept        complement(41586..42764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_7023"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_7023"
FT                   /db_xref="EnsemblGenomes-Tr:ACA21246"
FT                   /db_xref="GOA:B0URD3"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:B0URD3"
FT                   /protein_id="ACA21246.1"
FT                   /translation="MTPFTFQTCPNILFEPGASAKLPDLVASFRAQRIMLVTGKNVRGA
FT                   GLTRAAEAALASAGLQVTVFEDVVADPPSHVIETAAQLAQQQTVDLVLAIGGGSTLDTA
FT                   KLVAYLARSGDQLDRIYGVGLAQGQRLPLILMPTTAGTGSEVTPISIVTTPTGEKKGVV
FT                   SPRLLPDCAVLDPDLTLGLPAHVTAATGIDAMVHAIEAYTSRHKKNPISDQLARKALAL
FT                   LAGSIRTACSDGRNVEARSNMLLGSMLAGMAFANAPVAAVHALAYPIGAVFHVTHGVSN
FT                   ALVLTGVMRFNLPQAEALYAELAPIFDPQAASLPAAEAATRFVDSLAAICRDCGAPASL
FT                   AEVGVREEDLARLATDAMKQTRLLVNNPREVTYPDAFAIYSEALDGKLRTVA"
FT   gene            complement(42799..44496)
FT                   /locus_tag="M446_7024"
FT   CDS_pept        complement(42799..44496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_7024"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_7024"
FT                   /db_xref="EnsemblGenomes-Tr:ACA21247"
FT                   /db_xref="GOA:B0URD4"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B0URD4"
FT                   /protein_id="ACA21247.1"
FT                   /translation="MGASSKIKGSDLIVKALENMGVDYVIGIPGEEILEIIESLHNSKI
FT                   RFIPVRHEQAAVMMAATHGRLTGRPGVCLATCGPGALNLVTGVAYAQLGAMPVLIITGQ
FT                   KPISAPPQSRFQLIDTVSVMRPLTKMTRQIVSAASIPTLVREAFRVATDERRGAVHLEV
FT                   PKDVATEDVATEMAEVALAPSHPIDRPVAAEAAIEHAAAMILSAQSPLIMIGAAGNRPG
FT                   LGEPLSEFVRRTQIPFCDTQMGKGAVTGASSLYLGTAALSERDYVHAAIDRADLIISIG
FT                   HDAVEKPPFLYEKIAGGLKVIHIGYTPASVEQVFHPDAEVVGDISSTVTALADRLGGRL
FT                   EPDPGMLELRQSLLERINGINDGTEEATSSMTVRRIVHAVRTVMPEDGFVCLDNGEYKI
FT                   EFARYYLTYAPNTLLLDNALATMGAGLPSAMMAAELYPERRVLAVCGDGGFMMNSQEME
FT                   TAVRLRLNLVALILDNSAYGMIRRKQREGGFAEYGTTFTNPDFVAYANSYGATGHCVTA
FT                   VRDLAPTLEAAFKAGGVHLVAVPIDDSENKRVLIQEHHHKASNIEPEE"
FT   gene            44925..45350
FT                   /locus_tag="M446_7025"
FT   CDS_pept        44925..45350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_7025"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_7025"
FT                   /db_xref="EnsemblGenomes-Tr:ACA21248"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:B0URD5"
FT                   /protein_id="ACA21248.1"
FT                   /translation="MADLFWLSDAQWAVIAPFMPRNQPGPERKDDRQIISGILHVLTSG
FT                   CRWRDGPSAYGHRTTVYNRFNRWSRRGFWTAMLAALAKAGWSGEAAAIDSTYVRVHRSA
FT                   HGGKGGRQRRRSARRGVARRPRSTPSSTCLAAPVSSC"
FT   gene            45320..45682
FT                   /pseudo
FT                   /locus_tag="M446_7026"
FT   gene            complement(46012..46977)
FT                   /locus_tag="M446_7027"
FT   CDS_pept        complement(46012..46977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_7027"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_7027"
FT                   /db_xref="EnsemblGenomes-Tr:ACA21249"
FT                   /db_xref="GOA:B0URD6"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B0URD6"
FT                   /protein_id="ACA21249.1"
FT                   /translation="MRILAATLVALGIAAPAAEAASPLPGRIEIHAVKSRTLTGEEFLR
FT                   GDAPGREVVLGGELRLPVGAPPKVPVVVLVHGSGGISAGPDAWARVLNEAGIGAFILDA
FT                   FTGRGIVSTIEDQEQLNSLAMMVDAYRALDALAAHPRVRADRIAVMGFSKGAVASVYSA
FT                   AERFHAAYGGPNRFAAHIGLYTPCNVTYREDDKVGPAPIRLFHGTSDDYVSVLPCRDYV
FT                   ARLKQAGADVMLTEYPDTQHSFDTPTSPPLVSIPKAQSTRDCRLKEGPGGTILDAATGR
FT                   PYSLRTDPCVAVGAHVGHNPASTEAARAAVVGFLREVLLK"
FT   gene            complement(47059..47232)
FT                   /pseudo
FT                   /locus_tag="M446_7028"
FT   gene            47450..47632
FT                   /pseudo
FT                   /locus_tag="M446_7029"
FT   gene            complement(47642..47812)
FT                   /pseudo
FT                   /locus_tag="M446_7030"
FT   gene            complement(48073..48237)
FT                   /locus_tag="M446_7031"
FT   CDS_pept        complement(48073..48237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_7031"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_7031"
FT                   /db_xref="EnsemblGenomes-Tr:ACA21250"
FT                   /db_xref="UniProtKB/TrEMBL:B0URD7"
FT                   /protein_id="ACA21250.1"
FT                   /translation="MTGRRTLYLPADQAKAIKATGRGHVPRIEKVLREALQAGKLDAPR
FT                   DLLEQAPKR"
FT   gene            complement(48234..48515)
FT                   /locus_tag="M446_7032"
FT   CDS_pept        complement(48234..48515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_7032"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_7032"
FT                   /db_xref="EnsemblGenomes-Tr:ACA21251"
FT                   /db_xref="GOA:B0URD8"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR039554"
FT                   /db_xref="UniProtKB/TrEMBL:B0URD8"
FT                   /protein_id="ACA21251.1"
FT                   /translation="MTNKHIGSSFDSFLEEEGTREEVNEQATKRVLAWQIEQAMKEQGI
FT                   TKSVMAKRMHTSRAQLDRLLDPENDKVQLDTVKRAAAVVGRKVRLELA"
FT   gene            complement(48505..48864)
FT                   /locus_tag="M446_7033"
FT   CDS_pept        complement(48505..48864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_7033"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_7033"
FT                   /db_xref="EnsemblGenomes-Tr:ACA21252"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="UniProtKB/TrEMBL:B0URD9"
FT                   /protein_id="ACA21252.1"
FT                   /translation="MEQELKKLPAAFYATDSGKEPVREWLKDQTPDDRKVIGQDIATVE
FT                   FGWPVGMPTCRPMGAGLWEVRSDLSDGRISRVLFCIAHGHMVLLHAFIKKTQKTPDAEL
FT                   TKARKRQKKVEKNDK"
FT   gene            49244..49996
FT                   /locus_tag="M446_7034"
FT   CDS_pept        49244..49996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_7034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_7034"
FT                   /db_xref="EnsemblGenomes-Tr:ACA21253"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:B0URE0"
FT                   /protein_id="ACA21253.1"
FT                   /translation="MILNALALKLKREARGDFTGRHFEATLIVQAVSWYLRYALSYRDI
FT                   EEMLLERGMGVDHSTINRWVLAYAPAIERRLRRFRKPHCGSVRVDETYIKVRGQWRYLY
FT                   RAIDKHGEAVDFLLTANRDLEAAKRFFRKMLQDQPLLAPDRIGTDGAGPYPPAIAESRK
FT                   EGLLPRAPIHHVTKHLQQGIESDHFRVKRPMPRVGGFRAFHTARRTIQGFEAMLWLRKG
FT                   FGFSGAWTVREQNRLLAQCFGLPVANKA"
FT   gene            complement(50034..50168)
FT                   /pseudo
FT                   /locus_tag="M446_7035"
FT   gene            50446..51300
FT                   /locus_tag="M446_7036"
FT   CDS_pept        50446..51300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_7036"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_7036"
FT                   /db_xref="EnsemblGenomes-Tr:ACA21254"
FT                   /db_xref="UniProtKB/TrEMBL:B0URE1"
FT                   /protein_id="ACA21254.1"
FT                   /translation="MSLPTTRGSTEGRKAPPWDDCGNQWRADMNTFSEDDAVKSWIHNA
FT                   PQYHDYFLFADNVAATAGGTFLGENTADPNATGTAIYTELSNLPTAVSSILKHSQKRAN
FT                   FHPATTSPEVLAAAFNGYVTEIDNNPFLALSRNTATKMAYEDKNYNALFDQICSLYAGL
FT                   SEDDLRNIEKTISDMAKSVSSENHSEEWKNLFSQSTINMRDPSQPKLYLYYTALYMSHD
FT                   KSKKKEVARQGFEVRCTEFSILTLKIKASAGKLVALDTTNVTDWLRDSTSPTDPNVKLC
FT                   FQA"
FT   gene            51465..52106
FT                   /locus_tag="M446_7037"
FT   CDS_pept        51465..52106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_7037"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_7037"
FT                   /db_xref="EnsemblGenomes-Tr:ACA21255"
FT                   /db_xref="UniProtKB/TrEMBL:B0URE2"
FT                   /protein_id="ACA21255.1"
FT                   /translation="MTETERLYETLSKIAEAANTAVRHWHDWEALEQAQHSYQQGWEAA
FT                   QAVSATFAKSLKGGGEVRDPIAADVLAKIFDPHGWICITGAVDEALKRMAEGPRLADLW
FT                   NVERKFAAVFTAWVALHRRNLEHNALMMEVWKKATAAFSAVVNERSKNEQGIASSRELM
FT                   ALFAICWFCSGWSGGSNPSLVHRCRRTHHTLGHQLLAETREITLSFRARA"
FT   gene            52125..53759
FT                   /locus_tag="M446_7038"
FT   CDS_pept        52125..53759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_7038"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_7038"
FT                   /db_xref="EnsemblGenomes-Tr:ACA21256"
FT                   /db_xref="GOA:B0URE3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B0URE3"
FT                   /protein_id="ACA21256.1"
FT                   /translation="MTAKTIYDHGLDRNPANFQPLTPLTFLERTATVFPDHVAVIYGSL
FT                   RRSYRDFYARTRRLASALAARGIGRGDTVAVMLPNTPALIECHYGVPMTGAVLNTLNTR
FT                   LDAAMIASFLDHGEAKVLITDREFARVIKPALAHAKVRPLVIDYDDPEFSGEGERLGSL
FT                   DYEAFLASGDPAHAWSLPGDERDAITLNYTSGTTGDPKGVVYDHRGACLQAVGNVVTTG
FT                   LGKHPVYLWTLPMFHCNGWCFPWTLSVVAGTHVCLRQVRAKAVYDAIADHGVTHLCGAP
FT                   VVMQQLLNAPAAERRALPHPVSFVVGGAPPPEAGLAGMAEAGFDVTHVYGLTETYGPAV
FT                   VNEWHADWDALTTPEQAARKARQGVRYPPLEALDVLDPKTMRPVPADGQTVGEVMFRGN
FT                   VVMRGYLKNPKATEEAFRGGWFHSGDLGVKHPDGYLQLKDRSKDIIISGGENIWSIEVE
FT                   EALFKHPAVADAGVVGKPDEKWGEAVCAFVERKNGFEMVSAEELIDWCRQSLASYKVPK
FT                   HVFFTELPKNSTGKTNKVQLREMGKAL"
FT   gene            54292..54675
FT                   /locus_tag="M446_7039"
FT   CDS_pept        54292..54675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_7039"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_7039"
FT                   /db_xref="EnsemblGenomes-Tr:ACA21257"
FT                   /db_xref="UniProtKB/TrEMBL:B0URE4"
FT                   /protein_id="ACA21257.1"
FT                   /translation="MQGKSLHERAASGKRDDEAAAKRAEEYLRQHFPGFSGWAPCDDPT
FT                   GHISHGTPEMLAVFAIGCLEGLIAHADMAIRCLQRHDQPGMRAHIRSHIRAEREFERTG
FT                   VEIIGMLFEPKMQAKAAIAGVAA"
FT   gene            54672..56024
FT                   /locus_tag="M446_7040"
FT   CDS_pept        54672..56024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_7040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_7040"
FT                   /db_xref="EnsemblGenomes-Tr:ACA21258"
FT                   /db_xref="InterPro:IPR006500"
FT                   /db_xref="InterPro:IPR014015"
FT                   /db_xref="InterPro:IPR014818"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0URE5"
FT                   /protein_id="ACA21258.1"
FT                   /translation="MTANVRPIRRPAPPDNDPVLTESSIAALVVERFRDQLLYDHGQAL
FT                   WFEWAGTCWVPDTTGGVFDRCHTVVQEQMRLLSPKKQVRLGTAKFVSGVEKLCRHARTF
FT                   VAQSEDWDGDPMVLGTPGGVVDLTTGKMRRAEPGDRITKQTAVAPADTADCPRFLRFLN
FT                   EATGSDLGLMRFLQQWAGYSLTGRTTEHAVVFVFGGGGNGKSVYLKVLATALASYAATA
FT                   TMDAFVASKHAQHTTDLAMLKGARFVSASETQEGRAWDEARLKSFTGGDAITARFMHRD
FT                   NMTFVPTCKITIVGNHKPKIRTVDEAMRRRLNIVPFIRKPAEPDPDLERKLLAELPGIL
FT                   RWPIDGCLDWQEHGLIRPDAVLAATDEYLADEDLFGQWVEDRCKVDPGNRQMRTPNQDL
FT                   YASWCDFAERVGARHGTLHELGEKLSKLGLARYKSGGVRGFEGIYVTSTGA"
FT   gene            56815..57489
FT                   /locus_tag="M446_7041"
FT   CDS_pept        56815..57489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M446_7041"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M446_7041"
FT                   /db_xref="EnsemblGenomes-Tr:ACA21259"
FT                   /db_xref="GOA:B0URE6"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:B0URE6"
FT                   /protein_id="ACA21259.1"
FT                   /translation="MATYGYQRVSSEGQEDGTSLDEQGKRIRGLCMMQGLDEPVFFRDV
FT                   CQGKIPLGDRPGGCRLLHALKPGDNLVVLKLDRIFRNATDALTQADAFKAKGVNLYLID
FT                   MGTEPVTNNGTSRMFFGMLALMAEFERERIRERTQDGKAAKAARGGYIGGSRPFGYDVV
FT                   GTGKDAVLRPRESEHEYVQQIVARREAGESLRSISAWLATRGVKLSHVGVANVRERDAN
FT                   PN"
XX
SQ   Sequence 57951 BP; 10192 A; 19012 C; 18722 G; 10025 T; 0 other;
     cccattgctt cccccgacct cacccaccgc ctcgacgcgg cacgattttc atctcgacat        60
     cgacatcgcc ccgccccggg tgaatccctg ccccttcgac cgcctacgca accgcggcga       120
     gcttgacatg gaccgcgtcc gcaacaacgc gctctacgcc gccggcagtc gcctgcgcga       180
     gcacgcgcag cacgccgccc tcgacggcct cgcccgcgct cgcctggacg gcacgcccgg       240
     cagcggcccg ggatcccgct gcccgatcac ggagaccgtc gagcgccacc gccacacgct       300
     cttgctcgcg aagcaatcga tgcagtccca tgaatggcag atcgtgattg ccgttgtgat       360
     cgacgaggcg acccttgagc aggcgggccg gtccgcaggc tacggcaaca aggccggtgc       420
     aactgccgtt gcgctcgacc gcctccggca cggcctcgca gccctggtca tggcctggcg       480
     tctgctcccg cccggtgaac acccgctgtc cgtcgcgtga tacatttcgt catattttga       540
     gcctgacgta ttcttcttga cagggtggac gccagtcggt taggtttggg taccttccgc       600
     aactgcgtcc aaatcctgcc ccgcactcgt gcgggcggtg acgcgttcgc ctgcggcggg       660
     ttctttgagc gtgttagcca aactcacggc cgtcccttcc ggggcggcct ttttcttatc       720
     gagaggagtc cacatgtctc cccaagatga tcgccttgat ctgctgaccg gcttccagac       780
     catcggcgat tatctcggct ggtcttatcg taaaacacag tatcgatcgt caatcggcga       840
     tcttccgacc ttcaaggttg gtcaacatgt ctgcgcccgt cgctcaactt tgcgcgattg       900
     ggccatgaag atggaggcga aagcttcccg agaaggcaag ctcgccgatg tcgcgccata       960
     atgcagccgc gcgagcccga cacgtcgaag cccaacgccg gtacgccaag cgatggcccg      1020
     agaagatcag ggcgcagcgc aaggcacagt acgcccgcaa gcgcggcaag atcatcttcg      1080
     gatcgtgcgc tcactgcggc gagaccgacc gtctcgaagc tcatcacgaa gattacgacg      1140
     cgccgctcgc tgtgatcgtg gtctgcggac cgtgccatcg ggagatccac gcccgcatcc      1200
     ggctccgcac ccttgctgag cgcgcaatgg ccaagctgag aaccctggag gcactgccag      1260
     cggccaagat gcctcgttgg ctacggcacc cactccgaaa ccgcgaacgg ccgtcctggg      1320
     ccatcctgga gcccctaaag ctatgccgcg caagcccgca tccaatgccg tggcgaagtc      1380
     cgcggtcagc aacggcacga gcctgttcct ggtcgatgag gtcgatcgcc ggtcagctcc      1440
     ggcccgccgc ttccgagata tcgtcggcga cgtcacctcc gatctcggcg gccgagacga      1500
     ggtgacggct gtccagcagc agctgatccg ccgcttcgcc acgctcgccc tgaccctgga      1560
     actccaggag gccgcgatcg tggagggcgg gcaagtcgac ctggatctct acggccgcct      1620
     gtccggccag atgaaccggc tcgcctcgac cctcgggctc aagcgggtaa tgcgcgacgc      1680
     caacgaactc gacctcaaag cgtacatggc gcggaaagcg ggggtgttgt cgtgacgatc      1740
     atcgacgcgc tcaccgaccc gcatctgttc ggctcggcca tccgcgaccc ggcgaccttc      1800
     acggcgtggc gggtcttcct gaaagcgttc ttcggcctgt ccatgaacga ggccgagttg      1860
     gagatcttcc gggcctgtac cggccgcgag gtgccgccca ccaccccgat ggccgaggcc      1920
     catctgccga ccgggcggag agccgggaag tcgttcgtcc tcgccctgat cgcggtctac      1980
     ctcgcggcct tccgtgagta ccgcggttac ctcgccccgg gcgagcgcgc caccgtgatg      2040
     gtcctcgccg ccgatcgtcg gcaggcgcgt gtcatcttcc gctactgcaa aggtctgctc      2100
     gccggctcac cgctcctcgc caacctgatc gaacgcgaga cggccgaggc gctggacctc      2160
     gcgaacggcg tcacgatcga gatcggcacc gcctcggtga agacgacgcg cggctacagt      2220
     ctagcggcgg tgctgtgcga cgagatcgcg ttctgggaga ccagtgagga cagcgcgtcg      2280
     ccggactacg agatcctgaa cgcgctgcgc cccggtatgg cgacgatccc gggctcggtg      2340
     ctgctctgcg cctcgtctcc ctacgcccgc aaaggcgcgc tctgggacgc cttctcgcgg      2400
     cacttcgggc aggacaactc ggacgtgctc gtgtggcgag ccgctacccg ggtgatgaac      2460
     cccacggtgc cggagcggac catcgacgag gcgtaccagc gcgaccccgc agccgccgcg      2520
     gccgagtacg gggccgagtt ccgcagcgac atcgagtcct tcgttagtct cgacgtcgtc      2580
     aaggcgtgca tcgactccgg ggtcatggaa cgtctgcgcc acgcgggccg gcacgtcgcg      2640
     ttcgtggatc cctcgggcgg ctcggccgac agcatgacgc tggccatcgc gcaccaccag      2700
     gcgggcaagg ccgtgctgga cgccgtccgt gagatacgcc cgccgttctc gcccgagcag      2760
     gtcgtcgagg aattcgccgg cctcatgaag tcctatggaa tccgtgaggt cacgggcgac      2820
     aggtacgcgg gcgagtggcc gcgggagcgg ttccgagtac acggcatcaa ctacaaggtc      2880
     tcggagaagt cgaagtccga cctctaccgc gacctcctgc cgttgctgaa ctcggcgaag      2940
     gtctcgctcc tcgaccaccc gcgcctcgtt cagcagctcg ttgcgctcga acgccggacc      3000
     gcccgcggcg ggcgcgactc catcgatcac ccgcgcggcg gacacgacga cctggcgaac      3060
     gccgtcgcgg gtgtcctggt cggactcgct cgcccccaga acaccttcca ggtgttgccc      3120
     ttcccgtttt gacatccaaa cagaactaag gatccgacga cccaatggct tatcctacca      3180
     agaccctgcc gctagatgac tccggtaatg tcagcggcgc cgccacggca atcacgacgc      3240
     taagggctgc cgccggcact cgctatgcaa atgccgtcac cgctctacac gcggcgttcg      3300
     ttgacctcca agcactggac gtactcacga acaacacgaa tgttggcggc aacggcatgg      3360
     cggtcaacac cttcacgggt ggcgaggccg aatggcgcct gccgctgatg ctccggcacc      3420
     cggtctacat cccgaacatc ccgggcaatc cgaattgggc cgccgagtca cgtgctcgtc      3480
     tcgacattta cttctcgaac ctgagctgag atacacgatg tccaacaaag gcaacatcgc      3540
     cgaattctgg cagcaggccg tccggcagca gctcgatcag tgtccagcgc tgcggtccga      3600
     ttcccagacg ggcagcccgg tcgtggccgc gctccgctct gccacgtcgc gcgcggcgga      3660
     gatctccgcg gccttcggtc ggatcggcga gcgcacccgc cgcgatcccc atctcaccga      3720
     ggctggcaag cgggacaaga tcacgaccgt ggcgacccgc gacacgctcg gtccgctgag      3780
     gcggacgcag cgcgaggtgg ccgaggtgaa ggcgcaggtc gccgcgaagc gtgccgcgtg      3840
     cgtcgtccgg cgcggcaccg accccgtcga ggagatgaga cgccaggagg tccgcgcttt      3900
     ccttcgcagt ctgcccgatc caggcaagcg gatcggcgca gcgatgcagg atcccgagat      3960
     cgcccgcgcc gtcgtggagg ccagcccgat gctgtccggc atggatgcgg cgaactacca      4020
     gcgtatccac gatgaagtcg tcaaggccga gcatggcgac gtgcttgccg aactggatgg      4080
     gctgaaggaa gtcatccaat acgctgagaa catcatggcg ttctgccaca actcagtccg      4140
     tgatacgctc ggcgaaaacc gggagactga caagctgatc gcggatttca acaaggaata      4200
     cgacgcaagc taagcgtcag agatcgcgcc gtcccgtggt gggtggcggc gcgatggagg      4260
     ccctggccgc tccgccgtca gccacgcggc gtcgagcggc cgggccgacc ctgagttttt      4320
     ccggcggctc cccttcgccg gaacgggaaa aaccatccat gaccgacacc gatcgcgcca      4380
     acatgggcgc tttattccgt gaggtcgcga cgaaattggg cggctacgtg cccggtcgcg      4440
     gcatggtatt cagcgactgc gttgcccgcg ctctcggcta ctacgatgct actttgctca      4500
     gagcgcacat gcgagacccc aacaatgtcg agtggcgccg ccgcctgatc gacgcggtcg      4560
     ccatgctgaa ggcggcgcgt ccgtgagcgg gatcggccga tccgccggat cctcgccgag      4620
     caagaatggc aatgcccacc ggggcccgcg tcgtcgacat tagatcgtct gtggctatca      4680
     actgccgcgg tgatccttcc gccatgcgct cggcgccatg ccagtccagc ggtggaaggc      4740
     acgcgtgaac gcgggcggct ccgagaactc cagggcggcc gagatcctcg ctaagctcag      4800
     gttggtgttg gccagcaact gcttggccat tgcgagtcgc gtctgattcg cgacggaccg      4860
     aaacgtcgtt ccctcggcct tcaggcggcg ggccagtgtg cgctgatgga tcgccagcga      4920
     ctgcgcgacg tgaagcctct cgatccgctt ctcgctcacc gtcgagcgca cgcgccgccg      4980
     gacctcgtcg gtcaggccgg acgggatgac ggcctcaagc tgctggatgc gccgctctac      5040
     ggccgctcga atgagcgggt tggcgccctc gaccggtcgc ctcagaaccc gggctgggaa      5100
     caccagcgcc gcgatctcct gcgagaaccg gaccggggct cggaagaagc gcgtgtaggg      5160
     tgtggtatcc tctggttcca gacgcggtag cagcacctcc tccgggctcc agtgagggct      5220
     gcacagcgac cgcaacacgc tggtcagcgc cgcaatggct ctctcgcagt ggagcgccac      5280
     cccctcgatg tcaggctcat acggcgcata gctcacgatc gcgaccgggc cgtcgatcga      5340
     cagctcaatc acggcaccgc ggttcaggag atcgtggtgc gtccgcacgg cctgcaaggc      5400
     gtcgccgacc gtctctgagt gacgcatccg cgtcccgagc agaccaagcg aggcgagagt      5460
     gacgcgctga ccaatgagga ggccgaagtg ggcgcactgc gtctggtcgg cggccagcgc      5520
     cgtcaagcgg cccaacgacg cgaacgagat tgcttcgatg gtaccaaaga tctgcgtgtc      5580
     aatgccggcc agcttgagga tcttctcggg ctcgattttc agctcaacca gaatgtcgca      5640
     gatcgcctgt accgcatgaa cgtgaacgaa atcaatagga acatgtcctg aaggaatgac      5700
     ccgcaaaggg gtgatttgcc ccttgcattt agacaaacct atatttaatc ctaagtcata      5760
     gccttgaccg tcgccagacg acgcatcaga gtccatggct gcgtctccag tgtttctggg      5820
     tcagctaact cacgtagatc acgatctcat cgtcttcgca atagagaagc aaggggtcaa      5880
     acccgtagct gtaacagcta cgggcttgac ccaaagcata tcattggcat tgaattgcga      5940
     acaatcgatt tgcgctgagg gcgtttgaga ccttctcatc gtagcctcga cccgcgccac      6000
     agcggtgtgg gcctcaggaa gctctgcttc ttcaccgcgc gggccgcgcc agcaggatcg      6060
     ccgtcctgac tgccatccgc atctcggcct cggacgagcc cctcgctgcc aagacctcac      6120
     gagcgtgaga gctggccgcc ataatcgcgc aaacatcgat cgcgatgtcc tccgcgagcg      6180
     ggcgagggcc gggcttcgga tcgctcagga agtccattac ggctgcgtcg agttgctcgt      6240
     cggtgacgag cttgagcttg tagaggtcgc cgattgtcag ggtatcagcc acgcttgaac      6300
     tcccggaccg catcgggatg cggactggcc gatgcgggtc tcgatcacgc cttcggtggt      6360
     gatctggacg tccccctatc agtctcgcgc gtttctgcga cggcgctcgt tcaccgcctt      6420
     atggccggcg gcgcggtggg gcgccgcggc gcgtgtcgcc tggcccgggg gcttggcctg      6480
     cccggggaaa gtgtcggggg tgccgcccgg ggcgccggct gcgcgctccg cgccgcccac      6540
     gggacctccg gcttgcgacc ccgccttgtt gtaaggcgag ccaccctgcg cgaggaccgc      6600
     tgcgggcagt agggccaacg acgcggcgag aagagctgct ttgatcacgg gcggtatcct      6660
     cagcactatc cttgtctctg tacgatgcca tgctgcggta tgcgccactt gacccagtgg      6720
     gactccgctg acaccagccg atcctgccag ggcgggcggg ctcttgtcgt ccaaacgggc      6780
     acccatgcga acggccggct tctcggacgc cgcactcagc ctgcggaacg tccagaccgc      6840
     gatgggctag ctcaggtgaa tgcgccgccc cggcgggcgt ggtcgggtag caacctcatg      6900
     cgaaccctcg aactggcccg cccggcgccc ccgtcgaggc gggcttcctt ctgcaaggcg      6960
     tcacgctcta cggctaagcc gctcgtggca ggaggcagcg catggccgac gacttcaaca      7020
     tccgggacgc gcttgaggcg ctcctccgcg aggccggcca gatcttcgac gtatgcgacc      7080
     gggacgacag ctgggccccg acggcgtcgt tcgtcgtcga gatccaggct cacgcctgct      7140
     gcgaagcgct gaacggcctg gagggccgcg agcggtataa ggtgacgaag cgggcggcct      7200
     aagggtcccc tcccgagccg gcgttccttt gtgcgggccg ggtccttgag gacccaggga      7260
     gcccgacccg cggcccgtcc gggagttggg acctaggagc aggcgcgcac agactagcac      7320
     agtttagccg cccgcccgcg acgccccgcc ggaggccgat caactggccc tcgactggcg      7380
     cccggcccga ggcccgcgcg agaccttcgg aatgctgtcc tgagggccca taacgcgcac      7440
     catactgcca cttatgcgaa tgggccgccg tcacgcgcgt gagggcgagc acaaccctca      7500
     ttccgctaca cgcaacagcc ggttgtcggt gggattcaga cgcttcgtca cctcaaccga      7560
     ggctttgaat ttcacgtcgc gcttggccgg aaccgtgacc agttctcccg tgcgagggtt      7620
     gcggcttggc cgggcatctc tcgttaccgt tttgaacgcc ccgaagccgc gcagctcaac      7680
     cctgctacca tcggccaagc cctctgcgat cctgtccaag accgcgcgta cgaccgcgtt      7740
     agcctggcca gagcggagat gcgggttcag ttccgcgatg cgtcgggtga actgcgatct      7800
     aagcatatag ccatggtgga gcgcggctcg acgagggcaa ccctgtcgat ggttggatcc      7860
     tgcacggccc ttcgcgcgcg aggccgagca caacctacat tccagcagta ccaacctgaa      7920
     gcttgggcgc gttccaaggt cggtggcggt ctcaagcggc agtccggtct gcggacgtcc      7980
     gttcacccgg accggctcgc ctgtctggga acagtagaca ccccagccac caccgatgcc      8040
     gtcacggaac gggcctcggc cgcgagccgt ttaacggtct cataggagga gatcgccatg      8100
     gccgacaaag accgcatcga agggtccgcc gatcagatga agggctcgct caaacagacc      8160
     gccggcgact tgaccggtga ccagaaattg aaaagcgaag ggacgatgga caaggtctcc      8220
     ggcaagatcc agaacgcggt cggaggagcc aaagacgcga ttcgcgacac gttctcgtcc      8280
     gacaaggaca aaaagcccac gtaaccacaa cgagggagcc cgcgggctcc ctttctcgtt      8340
     gaaccaatcc cgttcctgta caaacggccg gaccccaata cgcgccgacc cacgccagcc      8400
     aagctgtcta ctcctcccat cgggggcaca gcatggcgca ggttcgcgtc ctcgacccgc      8460
     tgacgggccg cgtcgtctcg gtcgacctgc cctgccccct gctacgcgtc ccgctccacg      8520
     ccccgccgaa gctgttcgag agccgcgtcc aagcccggtg cagggcgcga cggcgccgga      8580
     gaagccgcag acggtgccgc cgaccgccgt cccggcagct tgaggacggt caccacgggg      8640
     cgttccggct tcctagtagg tctctgacta tctgaagggc gcgcatttct gcatccaggg      8700
     ggcggcggcg ctttagccaa gccgaccatt cccgcgagag cacggtcacc cggttcggca      8760
     ggttacggtc accgcgtcgg cggcgctctt cgatccgcac caagccgtcc agctcggcga      8820
     gccggatcgc gtcctgggcg agccggtgcg agacgccggc ccgggccgcg atctcgccga      8880
     ccgtcagggt gcagtcgccg ttcgccgcga tctcgtcgcc gacgatgccc aggaccgcga      8940
     gctggcccgt cgtgaagcgc gcagccgtgg cgggcggcag cggcccggag aaggcgatcg      9000
     tgcgacgcct ctccagggtc ttgaggcggt cagggctcct acagcggcgt ttcgggggga      9060
     agagggtccg cagtcgaccg agcggcacga cggtcgctgg cgcgcgtctg gcgggcatcc      9120
     tggccctgat cgcggcgtcg gctttctcat actcggcctc ggtgatccgc ccgtccgcgt      9180
     aggcgcgggc gaggtcccgt agctcttggt cgtgattcat cagtcccggc cctcataggg      9240
     ccgcggcaga tcgatcgggc gcgccggtca gggcggtccg tctccagaca aagcctcgcc      9300
     gtgccggaac tgccacgttc cggcttgact cccgagggag gctctggcga tatccggagt      9360
     gcgaactttc ggacatcgcc gcttcggcgg ttcagcggcc tcccggtgcc acccgggggg      9420
     ccgttggctt tttaggggtt cactgcggcg gcggtggatc tcctgcgtgt cgactcggcg      9480
     gaatgcgggc cgcacgacgt ggcatcaggc cccaagcggc gccgttcgtc aaaccgacgc      9540
     acgaacacct ggccgccacc cgttcgacac caattcgcaa tccttcgtta accatcacgt      9600
     gccagcgtcg gacgcccgtc catcgggtgt acggcgggtg tctagatggc agaggaatgg      9660
     tttacataca gtgcgttagg cgaacgcctt ggcatctcac ctgaagcagc gagacagaag      9720
     gcgatccgca accactggcc tcgccgggca ggcaatgatg ggaaggcgca ggtccgagtc      9780
     gacatcgaag aggtgatcgc ctcgaccatt ccccggaagc cgcgggaaga ggagccgtcc      9840
     gacgcctgtc cgacacccga agcactgccc gtcgaacccc cgtcggacgc ccgcaccttc      9900
     gcagccctgg aggagcacat agccacgctc aaggctatgg ctgcaaaggc ggaagagatc      9960
     gcggaacgtg agcgccagcg tgcggaccag gagggtgtac gggccgacgc cgaaagggct     10020
     cgcgcggatg ccgaacgtgc ccgagccaac gagctggttg accgcatcac gcagctccag     10080
     aacgacgagc gcgcgagccg cgccacgatc gaacgcgaac tgtccgagct gcgcggcgtc     10140
     gttgaccgtc tgaagcgccc atggtggcgg cgtctggccg gctgacgccc gttcgacacc     10200
     cgtcgtacgc gcgaacccac gtgggccgag cacagcctcg tgaacgggcg tacggcttcc     10260
     acggtgtgtg ggtgtcggcc gggcgtcgga caggtgatcg cctcgggcgc ggctcctccc     10320
     atcgctgccc gccggcttac accccacctt aaccccacgg ccccaagctc cccgacaggc     10380
     aagcgccccc ttgcttgcca acgaggcggc cgggcctggc cagacttatc ggcccggccg     10440
     cctcgttctc cagaccggcc ccgagcggcg aatgcagatc taccgccggc tgcgggagcg     10500
     cggcttcagc cccgtccaga cgctcgccat gatcggcgtc agcgttccgc ttctggtggc     10560
     cggcgcgagc atcaccctgc tcggcacgct cgacgcatgg ggcctggtcg aaccgctccg     10620
     ggcgagcatc ccccgcgggt agcagggacc tgtcggtcct ccgcaagcga cgtttaatcg     10680
     tcgccctcgg gctcgacaca ggactcgacg aacacccggc gcacctcgcc ccgcagccgc     10740
     ttcctcacag cttcagcgtc acatcgcgcc agtagggcgg gatccacatc agtcatgcga     10800
     tccggggtgg cggcgtcttc gctgacctcc ggggctggtt ggtcaggagc aagcaaggcg     10860
     gcgtgtgcga ataccgcgcc gggcaagctc gccaggagca ctgaggcgcg gagcgcaacg     10920
     acgtaagcct tcatcagccc cccaccctga actgccaaga ttggccttga acttgcggca     10980
     tagcgtaggc gagtggggcc agtcactaca cactgcttga gtccaagcgc gctgggcttc     11040
     tggactcaca tgatggacag gccgcgtcgg ctcggcaggg ccagcgcggc gctggtggtg     11100
     gggaccagcg ggctgaagcc tcgcggtacc gcgaaactca agccggattg acgcgtcaca     11160
     acccaaatcg ctcccgcgca actacgaggc gggcttgagt aatcgagccc gcccctgacg     11220
     ggatgtcgca attgtcgcac cagaacaaat agtgtccgag ccgcgcggcg ccggcattga     11280
     cggtcaatcc ctgtcgtcgc acccttacgt ccgtgcgcgg gctcggaaac gcaatgcggt     11340
     cctggccgga gacgtggaac atggacggcg aaggagatct tgatggctag gagaaagccg     11400
     aagcccgact ggcctgcaca gggccggatc agagcctgga gggcgtgtcg caaacgttca     11460
     acgcccgaaa aaatcgtctc cgaacagggc gtgacgaggc ctgctcaccg cctgctgacc     11520
     ccctccgacg aggctggcga agcagtttga cgagcccggt atcggcctga cggaccggtg     11580
     tgcgcctacg cggggagcat aattttctcc gccaaaaatc tttgcgacac gccccgctcg     11640
     attacaccaa gccgccgcgt cctctgtggc aggagcgtga ggccagggcc gaacgggcgc     11700
     aactgcacgg caacttcgcc cgcgcggtca gtgccactgg caagggcgca gccgttcggg     11760
     agttcaagaa cgctcacctg tttatgaagg gcaagccgag ccgtgacttc gggcgggaga     11820
     ggtagcactg caacgcgcag acgtgtatgc acgtatgata aaatacgggc atagccgtag     11880
     tggtgtgtgc gtggtacgct cctaggcgga tgattcgaac aggccgccca tgaagacgct     11940
     tgccatcatt tcccagaaag gcggcgtcgg aaaaacgacg ctcgcgaccg ccctcgctgt     12000
     cgaggcgggc cgtgccggca aaagcaccgt cgtcttcgat cttgatcctc aggcaagcgc     12060
     gtcgttctgg aaggacaccc gcaaggacga actggtcgcc atgaccgcca ttccggccgc     12120
     acgcctgggc catgtgatca aggcggccga tgcggctggc tgtgatttcg ccatcgtcga     12180
     caccccgccg ttctcgaagg acatcgccta tgaggccgct cagcacgccg acttcgtgct     12240
     gatccctact cggccggctg tgctcgacgt gatggcgacc aacaagacga tcgagctgtt     12300
     gcgccactac ggcaaaccat ccgccgtgat cctcaccttc tgcccgccga tcggccgtga     12360
     ggtcgacgac tccgtggagg cggtcaacgc gcttggagcc cgtatctgcc cggtgcggat     12420
     cggcaaccgc atcgcattca gtcgcgcaca gcagaccggc caggttgccc aggagattga     12480
     acccgagggc aaggcggcgc aggaaatcca gcgcctatac tcgtatgtgt gtatgcactt     12540
     aaacaactcg gagaggagca cggctgatgg ccggaaacgc gtttcaagcc atactggata     12600
     aggcggcacg cgagcccgcg ccggaacccg agcgtaagcc tgcggcgcgg cgcgcgccca     12660
     agcctgcgaa ccgatcggct gagccggccc ctgccccggc tcccgaggcc aagaagtttc     12720
     atcgtccgtc gcgggacaac cggcgcttcg tgggtggcca cttcgagccg gccgtgggca     12780
     agcagctgcg catgatcgcg gtcgaggacg acacgaccgt gcaggctctc ctggaggagg     12840
     ctttggacct cctgttcgtg aagaagggcc ggcagaaaat cgccgacctg gctccacgca     12900
     ccgatattgg tatgtagcca caggggcata cgtgcataca ccaaaatgac gcggcggcag     12960
     tacatcgatc ggcagtttga cctcttcctg ccctacatct ccgatctgcc gctgcgcgat     13020
     cagcgggaga cgatggagcg gccgttcttc agcctgtcga agaacaaacg gctcaagccg     13080
     atcgagtaca ccagcccaga cggcaaggtg ttcgttagcg tctacccgaa cgagaagttc     13140
     ggcatggcga cgatctggga tgcagacgtg ctcatatggg ctgcatcgac gctctcacgg     13200
     ctcaagaagg ccgggatcaa cgacattccc cgcacgctgc attgccagcc ctacgacatt     13260
     ctcaagacca tcggccgcgc gaccggcggc caggagtaca ggctgttgcg cgaagcgctc     13320
     ggccgcctcc aatcgacgac gatcatcacc aacatccgcg ccgagcgtac caagaccaag     13380
     aagcggcagt tttcctggat cgagtccttc acggatctgg tcgacgagga gacgcagcag     13440
     agccgcggca tgagcatcac gcttgccgac tggttctatg agggcgtggt gatggacggg     13500
     ggcatcctgt cgatcgaccc ggcttatttc acgatcagcg gcggccgtga gcggtggctt     13560
     taccgcgtcg cccgcaagca cgccggcggc gccaacgccg agggcttcgc gatcccgctg     13620
     cgcaccctgt tcgagaagtc cggcgccgaa ggcgaatacc ggcggttcaa gttcgagctg     13680
     caggcgatcg ttcgccgcaa caacgtgccc gagttcgtgt tccgcctcga ggaggacgag     13740
     cggggagggg agccgcttct gcgtatggtg cgccgcgacc tgatcggcga catcgcggac     13800
     atgcccaaag ccccccggcg ccggaaggcg aagacgccgg ctacgtcccc tgcacctagc     13860
     gtatccaaag gccatgtggc ggccagcctg cccctgttcc aggcgatcac ggacgagacg     13920
     atcgcaagcg tgcggcgcga ttttccgggt tgggatgtgt atgccctcaa gggcgacttc     13980
     gatgcctgga tcgcagagaa cccgtcaaag ctgccggacg actacaacgc ggctttctat     14040
     ggtttcgtga aacgctacca cgcccgcaat cgccatcagc tgcgcggctg atcccgttcc     14100
     cgatatcccg acaggcgcgt ccgcctgggc agcagaacga atcgctaagc gcctgcatcc     14160
     cttacaatat tacatattgt catgtctggg gacgacgagt cacgcacccg cgctatcggg     14220
     agatcaggaa cgctcttcgg gagatcagga acggatcgac gggagatcag gaacgctaag     14280
     ttcgggagat caggaacaaa ccgtcgggag atcaggaacg aagcggccgc acaagcagct     14340
     gtaaaataag gacgattcag cgcgaatcag ctccttaact ctttaactga ttcatattta     14400
     actctttaac ccgcaaaccg ggcccaaaca gaccacggtg cgttcctgat gtcccgagag     14460
     atgcggaatg gcctacggcc atgctctgtc ggtgtcgctc gcagaggcga gcgacaacat     14520
     tcttcccgac caagtgaagg atgccatcgt gctcactccg gggaagccct ccctgcggcc     14580
     acccatccgc tgcgcggacg ggtccctgcg cctcgggatc gcgctacgcg cgacaagggg     14640
     cttcccctac gctgcgcgcg gcggcctgcc tgaaggcagg tcgggacgaa ggaatggtca     14700
     gattcccgcc tccggcgggg tcgaacaaag gaattggctt ggcggggatg gagctgcctc     14760
     gccgctgagc cctacaggag gcccgtggaa ggggtccaac ccctcggagg ggggagagga     14820
     ccaaaaaacg atccaggcgc ttcaacggcc acgctaagcc cgggaaaggg ctatccggag     14880
     tgacgccatc gtccgaccgt gatcggaatg tcggaatcgt atggcctgcg caaattcaga     14940
     atcttggggt caacgcgcgg gaaaaccttg cccaagtggt aacaccagag tcaccatcgg     15000
     cgcctggacg atccaccgat gccgctgaca cgcacattca agaaaaccat tcaagcccgc     15060
     gccgagcgcg atgccgcctt ccgcgaaaac cttctcaccg aaggcgtgca ggcgcttgtc     15120
     gccggcgacc tcgagacagg gaaatctgtg atccgcgact acatcaacgc cacgatcggc     15180
     ttcgaccagc tcgctgccgc gacaggaaca ccgtccaaaa gcctaaagcc gtggcccgct     15240
     tcaggatctc gcgttcctgg cgcaacacct cgttctcccg ccgcagccgc ttcagctcgg     15300
     cggccatgtc ctcctggcgg tcggagggcg gcgcctccat ctcgcgatcg cgctgtccgt     15360
     cgatccagtg gcgcaacgtc gagaggccga tgccgagatc ctcggcgacc tctcggcggc     15420
     tgcgcccgct cgtgtgagca aggcgcacgg cttcggcgcg aaactcaggg gtgaagcgct     15480
     tcttcggttc tcgcatcggg aacctcctcc ctcacggaaa gagctctcca ctttcccgaa     15540
     gcaagtccaa tcggcgtctc gcgctgggag cggtagccga gcctgtgagc ctgacgcgac     15600
     gcgaaggtca gggcaccgcc cgggagataa agcttggcga cccgcgcgcc ggtgcggggg     15660
     catatgaacc accagcgccg cccgccgaag ggctgggtcg tggtggtgag ctcgatccag     15720
     tcgtccgagt ggcgcttctc gctgttcgag cgcgtggtgg tgaagtgcag gcgcaggcgg     15780
     ccgtgttcgg cgccgagatg ggcctcgtag gcgatggagg cgagttgggc gccggtgcgg     15840
     gtgttggtcc aggtcagggt gccggctcgg ctctggcccg gtcggcagat accgtcgcgc     15900
     aagagcttgc cgagggtgag ggtcagcccg ctctcgacgg ttggccgacc accccattgt     15960
     ccgcttccga cgccgcccat tttccgcatt cgcctttctg gattttccga aatctcgtgt     16020
     gaattttggt tgttttcagc cgccggccgg gtgggtgggc aggcccaagc gagagggctc     16080
     ttcttgaacg gggaggcgcc gccaattacg cactcgaccg tgtgcggcga ccgaggccga     16140
     tgctcttggc gagctcggag cgctgggcgg cgtagttcgc cgctaccatc gggtagtccg     16200
     acggcagacc ccacttcacc cgggtactgc tcgggcgtga ggccgcgcgt gttcaggtgg     16260
     cgcctgagcg acttgtaggg cttgccgtcc tccaggctga tgatcgcgtc cggcgtcacc     16320
     gtcttctcga cctgaaccgc cccggttttt ccggcaactg taatcaggcg gcagctgccc     16380
     cggcgcggat gtcgcgcgtc ggcttcccgc ccgcgggtca cgcctcgtcg agccggcaag     16440
     tcgctccatc gcggcgcccg gcggccgcgt cgcagcgcgc gacgagctgg tcgagttgga     16500
     agatgatcac cgcccggact atgtcgggcg cgggcgcggg cgcgggcgcg ggcgcgaggg     16560
     cccgggccgc ccgggcgcgg gcggcggcct cgccggtccg gccgacgacg agcagggccc     16620
     gggcggcggc ctccgcgagc tgcatccgct ggtcggtgcg agtcacttcg ccggaggcct     16680
     ccgcccgggt gatcgccgtc agcgccaggg ccgcggcagc cggaggccag tctggcgccc     16740
     ccgtgccctg ctcggccgcc tcggccagca tggtgccgag gtggatgagc ggttcgatct     16800
     ggtccgcgac gaccgccccg atcaggtgcc gcgcgtaatc cagggccgcc gcatcgcgag     16860
     cgggcagcag cagcagcgcg aacttatgca gacctcggag cggctcgagg ccgggatcgg     16920
     ccgcgaacgc ggcgtcgtaa gcctgcaggg cgccgctgcg gtctcccgcg gcgagatggc     16980
     gctcgacggc ctcctccagt ctccagagct cccgcacctt gtcgcgctgc aggaccgcct     17040
     cctgcgcctc ccgggccgcc gcgaggtccc agcgcccctc gaccaccgcg gcgagcgggc     17100
     cgtcgctctc caggggatcg ccgatccagg cgatccggcc gtcgcgatcg atgatgaagg     17160
     cggttgggac gtcggtatta taggccgcct ggcaccaggt ccggtccatc gtgccctgac     17220
     gctcgccggg cgagagcggc agatcggccg cgatccggta gccgatcgcg tcgccgtgat     17280
     cgcgcacgaa ggccgcgagc tcgccgagat ccgtccatgt gacggcgacg ccgatgatcg     17340
     gaacctgcgg atgccggacc tgcagggcgg tgagatgcga gaaggccacc ttgcaggagc     17400
     cgcaccacgg tgcccagaac acgaccacat ggacgcagcc ttgcgcgagg gccgtgatcg     17460
     gctcgccctt caggaaggtc tggacgcgga tctccgcggc ggggtcgccg atcaaccgtt     17520
     ctgtctgggg catggaagat cttctcgtgc gagtgtgggt gggaatgccg ggcgtgtcgc     17580
     aaaattcgag gactggcccg tcgtatcgac ctgcggcaat cgggcttgat tcagatcatg     17640
     gcccgacggc cagcgctccg cggcctctgg agaggactgg cccgggagag cgccgcgatg     17700
     ggtggcgcgg gcaatcccgc ggcaagggcc gagtctattt gtctggctat tcgcagccac     17760
     gacaaccttg agcgctccgg gttaggctgc tgcagcaggg aggcgctctc agagttcagg     17820
     gggcgccacc ccgtccgccg ccgccgccgg ggccaccaat cccgccgcgg acaccgtcac     17880
     cgccgccgcc gccggggcca ccaatcccgc cgcggatacc gttaccgccg ccgccgccgg     17940
     ggccaccaat cccgccgcgg acaccgtcac cgccgccgcc gccggggcca ccaatcccgc     18000
     cgcggatacc gttaccgccg ccgccgccgg ggccaccaat cccgccgcgg acaccgtcac     18060
     cgccgccgcc gccggggcca ccaatcccgc cgcggatacc gttaccgccg ccgccgccgg     18120
     ggccaccaat cccgccctga ccgacggcga aagcctgctg agagatggcg aacatgccga     18180
     ctgctgatat ggtcattatt atcaacttct tcatggtgct ctccactctt cgtaagcgtg     18240
     aacgcctatc tgcttgcggg gggctcacta ttttagaccc cagccgatct tcacttcttt     18300
     caggcgagtc atttcgacct gaaacagccg ccgcactcga tagccagagc gtcaagacga     18360
     ccgcgagcgg cggcccacgc cgctatgacg cgggaaagaa gatgtccttc gacaaactca     18420
     ggatgagggg gccgcaagcg tcaggccctg gtggacacgg acggccgcgc ccttgtgctg     18480
     gagccgccgc ccgcagacgt tcaggatcgc gatggcgctg gaccggtgct gcgcctgtcg     18540
     cgccgcttgt tcccgttcat cgctacggcg tttgccgaca cgggctacgc tggtgacgcg     18600
     ccggccagcg ccacgatcat caccgtcgag atcgtgcgca agccgtctgg gcaggtcggt     18660
     ttcgccgtgc agccccgcag gtgggttgtg gaacgcttct tcgcctggat cagccgcaac     18720
     cggcgccttt ggaaggatcc tgaggcgccc ctcgcctgga ccaaggcctt cttctgcgcc     18780
     actgctgtca tgatcctagt cgagccggct ccgagaatca tatgtttcac gcgcgtctca     18840
     tggtgcgccc gatacccgtg cgtccacatc tgctcttctc tcctttggat tgttaactat     18900
     attataggtt gcgccatttg attggggtct tggtcttggt cttcgtcttg gtcgtaattc     18960
     ctgtactgat tttcggtgtc aaagtctttc tcgtacctta gcctctggca tttctcgtag     19020
     tctagcctca ggcaggagct accgatctcg ccggtatatt cgtgtcttga actattatgc     19080
     gagcgcccat gaagagtgcc cgccatagct gccgaatagg ctatcacagc gctcacagca     19140
     acaattgaac ccagagccac cttcttcata tcgcagtttt tcatcattat gctccatatt     19200
     ttctcagcac ctgttggctg tagagctatc agcgttctgg cgacaggatg aaatcacatg     19260
     cgcagcaaca gattttattc atgcgtcagc atgctggaca aattgttatg atgtcaagta     19320
     ggtataatca gattttttgg ggaattttct ctatgtaaga atttggcggc ggaaatcaaa     19380
     gcttggacag aaggtgtaga tttgccttgt caaaagcagg atgtcccagg acaagagagc     19440
     ttcaccaagc taacgttggg cccaggtgaa gaacgcgatc ggcgggcgcc tcagcgtctc     19500
     ggcgcagagc gtcatgcgct gggtcaggga tcacgcccgg gcattgcccc aagccggagc     19560
     cgatcggccg ggcggtcgtc gtcgagatcg acaaggtctg gctcttcgtc aaaaaaagac     19620
     gcgcaaactc tggatctgga aggccctcga gcgcgcgacc ggctggagcc ctgggacgtg     19680
     cgcctgttct gcaccgacaa ctatgcgccc tacgccgccg ccctgcccgc gggtcggcat     19740
     cacgtcggca aggaccagac gcagcttgtc gagagtaaca atgccaggca acggcactgg     19800
     ttcgcccgct tccgccgccg cacttgcgtc gtctccaagt cggttgagat ggtcgaggcg     19860
     accatggcgc tcttcgcctt ctaccactgc aacgggagcg aactcacctc agcattagtc     19920
     gggtgaaacc ctcggacaaa tggcagtatc cgactacgcg tctcggcaat cctgaatttc     19980
     ctcttgcgtc gaaggggcgt ccacagcgat gggaaaggac ctgaccagcg cgtgggccgg     20040
     cgagggccag gtcgcgacgt tcgtggccgt cctggcgttc ctcggaatcg cgagttcgcc     20100
     cactttcgtg cgcgccgccc gagggcaacg gctgcgccga gcgcttcatc cgcacgctca     20160
     aggagaacct gccctgggtg gagcgcttcg gcacggtcga ggagctccgc cgcgcgcttc     20220
     tggtatttcg tgagaccgac aacgcgacct ggctgatcga gcgccgcggt ttccgaccac     20280
     cggcagccat tcgcgccgca cagcattcat ccgccgccct ggcagcgtag gccccaaatc     20340
     ggggtctcat accgacgcgc ttatgaattg atttgttgca ggtagggata ggcgcagagg     20400
     gacttgatgc gtccggtctc tgccgcgagc gcattccagg cccggcagca cgcctcgacc     20460
     acggccttgt agtcagccag gagccgatga gagagggagc gctcgcgtag gtagagccag     20520
     acgcgctcga ccgggttcaa ctccgggctg taaggcggca gcggcacgaa ggtgaggttg     20580
     ggcgggagcg tgaccgcgcg cgggtcgtgc cagcccggcc agcccctcgg cgttgaaccg     20640
     gatcaccgcg tcgcgcagag cttggcgctc catgccggcc gcccgggccg cgtcggcacg     20700
     gctcatgccc tccagcgcgt tggccacggc caggaggcgc tgcatcgtgc ggcggcgggg     20760
     ctcgcgccgg gccaagcgac gcaactcagc ggggctcgcg agatcggtgc ggatcgtcag     20820
     gcccggtcgt gccatcgcgg cctcctgctg cacaggcagc aggccagcac agacgcgcct     20880
     cacaaccaac tcacgttcga gtcaccgaca aagcgcggcg gtatcacaaa ccgcgggcgg     20940
     tacacttgcg gcctatcacc ggcctatcac cttcctgtca gcatcggagc cgcacccgct     21000
     ctgcggcgcg tcgcgcttca ccgattgtgc atcgacgatc gcgagagttg ggctgtcttc     21060
     tctccccgct ttttctcaat agcgcatcac cagatgatgg gtaacccgct ccaggccgcc     21120
     actatcggtc agtacgcgcc agcaatcgaa agagatgctc gcggcggaaa atcccttaga     21180
     atcgtattgt aatctcttca gcacctcatg cagccttttt ccatagaaca cgcatgggtt     21240
     tcccagtatt cctcttgata aacatctcgc ttcaggtcag ggtgtacact gaccaatcct     21300
     gatagatgcc gggagcggtc tgacacaagg ggcatgcaat gtcgcgtgcc ccagtcgcga     21360
     gtgggcgcag accagtctaa tcgaaactgg tcgcgatcct ctccgcatga tgtcttggac     21420
     agcaagtatg cctaaaatca cgaggatcgg cttcaactac gcggagcttg aaagcagtgt     21480
     ggcgaaagag gcgcgcgaca ccgcgcatcg ccttcgcgag caggggaatg ccttcatcat     21540
     cgaggttggt ctcactcttc tccgcatgaa gggtctcctc ggccacggtg cgttcggccc     21600
     ctgggtccgc acagaactcc ggtggaccga tcgcacagcg cagaactata tgcgtgcggc     21660
     tgaggtcttc gccggcaaat ccgaaatcat ttcgcatttg ccgagcacaa cagtgtatga     21720
     cctcgcggcc aagagcgtac caaacgacct ccggaacgag atcatccgtg agttccagga     21780
     gagcggctgc accgacaagg acgtggccgc caaaaagatc cgggatttca agctctccac     21840
     gaagaagaca gtcgccccga acaagcggga gaaacaccaa gcgggagaaa cacaatgctg     21900
     tgtctcgcac cccacagagg gagggcggca gaagacgccg ggggccgccg cggaggccgc     21960
     agcgctgatt gtcgaagcgc tcggggacgg caccgaccat ctcttcagat tgatggagaa     22020
     ggcgtcctgg aatgatatca aagcagagtt gatggtgctt atcagcaagc cgaagcagcc     22080
     cgagccccag gcttcctcgc gggtcagcaa gccgaagcag cccgagcccc aggcttcctc     22140
     gcgggtcagc aagccgaagc agcccgagcc ccaggctccc tcgcgggtcc actgacgcat     22200
     caggggggcc cacattgggg ctgtggcctc gctgcgcccc gtcctgcgca tctggaggcg     22260
     caccgcccac agctgccctg ggtgcgcagc ttcaggcgct caaacgagct tgccttgctg     22320
     agaagggggg aagggcaccc gtcgattacg gtcgatgggt gccctgcatc gtcggcttgt     22380
     ctatgatccg ccagccacgt ggtggcactt tcttttgtgc gtgcgagaaa aatggcccag     22440
     atcttgtcga aaaatctacc gcaacataaa ttaaaagcac atgctttgct atgttccatt     22500
     atgtggcgca tttgtcctgg gacatcctgc ttttgacaag gcaaatctac accttctgtc     22560
     caagctttga tttccgccgc caaattctta catagagaaa attccccaaa aaatctgatt     22620
     atacctactt gacatcataa caatttgtcc agcatgctga cgcatgaata aaatctgttg     22680
     ctgcgcatgt gatttcatcc tgtcgccaga acgctgatag ctctacagcc aacaggtgct     22740
     gagaaaatat ggagcataat gatgaaaaac tgcgatatga agaaggtggc tctgggttca     22800
     attgttgctg tgagcgctgt gatagcctat tcggcagcta tggcgggcac tcttcatggg     22860
     cgctcgcata atagttcaag acacgaatat accggcgaga tcggtagctc ctgcctgagg     22920
     ctagactacg agaaatgcca gaggctaagg tacgagaaag actttgacac cgaaaatcag     22980
     tacaggaatt acgaccaaga cgaagaccaa gaccaagacc aagacgaaga ccaagaccaa     23040
     gaccccaatc aaatggcgca gcctatacta tagttaacaa tccaaaggag agaagagcag     23100
     atgtggacgc acgggtatcg ggcgcaccat gagacgcgcg tgaaacatat gattctcgga     23160
     gccggctcgc gagttcgcga gccccctgga acgcgacgat ccaccggcca gccgggggcg     23220
     cggccgatgc gccaagtcgt agcggccctc gcctcgcatc tgcgggtggg ttgggtcctg     23280
     acgcgccatt ccgaggggca taaagtttac tggcagagca atcggcggtt taatcccagt     23340
     gcactaacgc cttcaaaacg tacaaagctc agcgtgattt ctcgcgcgct cgcaagcggc     23400
     ttaagttctt cgtcccataa tatgcgaaga agtggcgctt attacctact ttacctaccc     23460
     attgttggtc tgggcttcgc cgcctctgcg gcggacctgc cgcagcttac gccacccatg     23520
     atggcgttcg cgccactggt cacgccgtcg ttcacatgga ccggccccta tgcaggcgtg     23580
     ttcttcggct acggctcgct ggacgagagc ggcaccggac ggtgcatcgg tccgcgctgt     23640
     gtccggctcc cggcgttgtc accgggcgcc cgggcggccg atctctcggc gggaagcgag     23700
     gttggctaca atcttcaagc atcgccgggc tctggcctcg tgatcggtgc cgccgtagac     23760
     taccagacga cccggctacg cggctacggc gagagcatac tcgtccgcga ggtcgacgaa     23820
     aactctgatt ttgctgcgtt ttatcatcta ggccagcgcc tagatacctt cggggcagtg     23880
     cgcggcaagg ccggatacgc ttttgaccgc ttgtttgtct acggcaccgg cggcctcgcc     23940
     tatggctatg tccgcatcga cgttggcact gccctcactg tcggtgaccg ccaattcgcg     24000
     gcgcaggggc tcacgagcgg atttcgcctc ggctacgcgg ccggcggtgg cgccgagtac     24060
     gcgatcagcc cgcacctgtc ggtcaaggcg gaaggtctct actacgacct cggccagcgc     24120
     acggtcagca tccaggctgc cctgccccgc tccgtctatg gaggcacaat cgccacgcac     24180
     ggcttcctcg cccgcgccag cctgaactat cggttcggcg atggcatccc gggcctcggc     24240
     ctgccggagc acatccgcac tctgctgaac ccggtcgcgt acacgccgct tccggcctcg     24300
     gattgggtgt tcgaagtggg aatacgctac ttttacagca ccggtcggtc tagcctcctg     24360
     ctcggcgact ccgaaaacgc cgggcataag aactcgcgcg ttatctacca cgatgtcggc     24420
     gcgcatgcga gtgaaaactt tgtgcgcgtc gacgacaatt cgaccggacg gtttgccaaa     24480
     gctttcgtcg gctccggtat cattacctcc ggccgcttta ctgacgagga cttccctccg     24540
     agaatgccgc tctactcgca cacgatatcg aagatccctg gccgagacat cggctacgcg     24600
     gtcgcggatg tcggctacaa cgtcctagtc ggcgaaacgt acaggctcgg cgcgttcgcc     24660
     ggctatcagt acgtctcgga attcgccgac tcctccggct gcgcgcagaa ggccgacaac     24720
     agcacctgcg gctggccttt tataccgcgg agtgtagaag tagtcaccca cgatatgcat     24780
     tggcacggca tgaggatcgg tctggcgggc gagctgcgct acgatcgcct gaagctttcc     24840
     gccgaggccg cctacctgcc gattgcggat ctctcaggtt tcgaccatca ctggctgagg     24900
     cctgacatca accctttgcc ggtgtatgga ttgggtaacg gctactttct gcaaggcgtg     24960
     gtctcttacg acctcacccc ggagatcagc atcggcgtcg gcgcccgcta ctggaaaatg     25020
     gtaaccgacc gcggtcacac gaaattcccg tatgccgagc cgagcgcact gccgacccca     25080
     ctaaagtacg agagcagccg tgccggcgtg ttcgtgcagg cttcctacaa gttcaccgac     25140
     aacagcttcg atctgggccc cttcctacgg tagccttgag agtccgtccg ataactcagg     25200
     ctgagtgagc gaggcgtcgg acgaggatca tgacagctgc cgcgtagagg aaggccttgg     25260
     ctgaggcgag ggccgcctcc ggatccttcc agaggcggcg gttgcggctg atccaggcga     25320
     agaagcgttc gaccacccac ctgcggggat gcacggcaaa gccgacctgt ccgggcggct     25380
     tgcgcacgat ctcgacctcg atgagggtcg ctgctgcggg cggtacactg gccggcagcg     25440
     tcccggccgc gcccatactc cagcccgtgc gcgccttcag ccgggcgtag atcccgacgg     25500
     cggcgctgta tggggtgcgc gtggcgggag agggctacag gacgcggcag gactacgaga     25560
     agcagcgcgc cgcgtgtgaa cggggcgact atggcccggc cgggcctgct gtcccctgtg     25620
     cgcctaaaga tcgttagacg gtagcaagtc gagaacttgg ctgcggatga ggtaggtgaa     25680
     aaactcctga tccgtcatgc cgtgcgatgc ggccacagct tcaaagactt tgcggccgcg     25740
     ctcgctcatc accggctcaa cgatactgcc gccgtcaggc tctttgacga tgcggatatc     25800
     tcaatcttca cggggcagtc ttttaaatac tgtgtctagg tcgggcatca tggggcgagt     25860
     gccgggggcg gttcctgcat ctcgcccggc tcccatgcgt ccgggtcgaa ctcgcgttcc     25920
     ttccgctcgg tcgtgtccat gtagaaccgc aacaggccat tgatttcctg cgttgtcgtt     25980
     catcgcaccg tgtcgagttc ctgctttcta cccggccata ataccataaa aatctaggcg     26040
     ctcatggaag agctgcctcc ctcgaaggca atggggtggt gcggccgggt gccgtttccg     26100
     gccgttttaa gcggccgtgg atggcctcca gatttccggg ggtagttggc gtagggtcgg     26160
     gaagcgagag gctatcaggc ggcccggaaa tcggccgcca tccccctgcc cgcttccggt     26220
     gctgcatggg ggcttcggca ccgttaccgg gggcgggtca tgctggcatg ggtaagagag     26280
     tggttccggg gcaacgcggg catcggcggc tggtggacgg cggagcggca gcagcacgcg     26340
     gtcgacgtgc tggtgaaggg cggcgtctcg gagctgggcg cgaaagccct ggtggcgcgc     26400
     tggtcgggcg tgtcgcaaac gttcaacgcc cgaaaaaaat cgtctccgaa caaggcgtga     26460
     cgaggcctgc tcaccgcctg ctgaccccct ccgacgaggc tggcgaagca gtttgacgag     26520
     cccggtatcg gcctgacgga ccggtgtgcg cctacgcggg gagcataatt ttctccgcca     26580
     aaaatctttg cgacacgccc cataaggact gcgtgtcttg ttttcagcga aggctgacca     26640
     gccaggcgcg gtacgcaccc ggtacgcagg cccaacacac gcgaccgcgt acctcaaatg     26700
     tggcgccgtt cggccgggac acgcatggcg gcggctcttg cgcttcagcg cagcacacgt     26760
     ccggttacag ccggggttac aggctgcaag cgtagggagg atgtaaccgt ggcaaccgag     26820
     atcccgtccg aagcccgccg tctgtgtttt gcgtcacggc agttcaaatc tgccgcgacg     26880
     cctgggtggg gagcggaccg atattttcat gctttgagtt ttgaaaacaa tcaaagaaaa     26940
     tcaaatcagg ttcgacccac cgggggcgag tgatccgcct cacggacaag cgatttatca     27000
     gggcaggtca gggcttccac tctgcacggc tcggcgccga gcgcgctgcg acgaggcgca     27060
     ttctcgtggt tggtacatca tgaggatgac ggtaattccc gcctatgaaa aggctgctcg     27120
     tgcgagatgc gatgaacgcg cgctcgcgct cgctgatcaa acggttcctc gatgcaccgc     27180
     tcccgcatca gatgcggacc cccgagcaga tcgaggcgta ctggaaggag ctgggggcgg     27240
     agatcggccc cgtcaccgaa acgccgcggt aacgcccgag gccccgcgaa cgacaaaggt     27300
     cccaccagcg cgggccggta gggccttcgt ttagggccag tcgcgtcaac ggccgacccc     27360
     ttaggtcccc gaaggaatgg ttagtccacc agctcgcgct ggcgcgtgcg cggacggccg     27420
     ccgagcttcc cgttctcccg ggaggcttgc gccttgcgct ccgtccgggc gctgccgccc     27480
     gcgcggccga ggtgctgcgc catccacttg cccgagcctg tcacgccctc gatcagtgcc     27540
     ggcacgtaca cgtcggcgtc gaggcgcggg aagtgcaggc cgaggccggc cggcgtgacc     27600
     tcgatctcgc gcaggtcctc cggcgaggcg ccagccagcc cctcgataat ggcgacgggc     27660
     acgcgcagct cggctcccgt cgagagcccc acgacaaggc gcccgccggc ggtcaggtag     27720
     cgcgcagagg tcgcgtgcgg acccgcctgc cggacgcgct tcgcccgagc ggtgacccac     27780
     tcgaatgcag cctcatccat ggatcttcct ccactcctca cagaggtggg tgaggttcgc     27840
     ctcaagctcc cgggcgaggg ccgcggcgcg ctggagggcg aacccgtggt tctctcggat     27900
     cttgaccggc ccgtcagggc agttgaggtt gaacaccgcc tcgcagtcct cgccgatgac     27960
     gtggacgtgc gcggggcgat ggtcgttggg gtagatcacc acgcggagcg attcgatccg     28020
     aagaaccgtt ggcatggtga tagcagaaac ccaaccgctt aggaacaggc gaaacgtcgc     28080
     gcggttccct cgcctcaggc gttggcctcg ccgaggaggc ggtagacgct cgcccggccg     28140
     atgccgaggc gccgggcgat ctcggccggg ccaatgcctt ccgccttgag cgcccggacc     28200
     tgcgccacgt cgatggaggc cgggcgcccc ttgtagacgc cctccgcctt cgccttggcg     28260
     atgccctcaa gctggcgctc gcggcgaagg ttcgtctcga actcggcgaa gacgcccagc     28320
     atgtcgagga acgccttgcc ggccgcggtg gcggtatcaa tgggctgttc cgtggcctgg     28380
     agggccgcac ccttcacccg caggctccgc acgatgtcct ggaggtcccc aatcgagcgg     28440
     gcgagccggt cgatgcgggt gaccaccagc acgtcgcctc ggccgatgaa gtcgaggatg     28500
     gtggcgagtt cggtccggcc gttggtgctg gtgccggaga ccttctcgga ccgcaccacg     28560
     tcacagcccg cggccttgag gccggcgagc tggagggcga ggtcctggtc ggtggagctg     28620
     acgcgggcgt agccgatgcg ggccatggaa tgtctcggac gggtctagac ccggagatta     28680
     tagcgtctca taaatgcgat atcaatccat atgagacgcc aagagtgtct cacgcgggcg     28740
     tctcggatgg gtatacccca atgaggcggt cctatcacga tctcggcagg gtggtgaagg     28800
     aggctgccgt catcggcctt ctgcaaggcg tcgatcaatg ccactctgtc atcggttatc     28860
     gggcagtgct cccggcttga gttgaagtcc gcgaactcca tctttgccgc gccgcccgtc     28920
     ttctcagagc cttgccgggg gtcaatccag cccgagcatc gcgaggtgat ggaatgagac     28980
     ggcgcgagtt tctcatttct cttgcgatga gcgcgagtgg gctgcgcacc agccgggccg     29040
     aggcggcagg ggtcatccgg gtgggcgttc tgaatactgg acaagagagc gccggtagaa     29100
     gggcgcgtgc ggcagcgctt cggcaaggaa tagcagagca gagccttgct tctgatcgac     29160
     aaatcgctct cgacttcatc tgggctggag cggagcctga ggctacacgc ctggcagcga     29220
     gagcccttgt cgaggcgcga accgaagtgc tggtcggtgc ggggacatcg gctactgctg     29280
     cgctaatgcg ggaaacgcgc actctcccga tagttttcgt ctccgtgtcc gacccgatcg     29340
     gtgagggatt tgcagcgagc tactccaagc ctggcggtaa cgccaccgga ctatctaact     29400
     tcgagccgtc tatgacagcg aagtggttgg aattgctcga agagatcgcg ccgggcacga     29460
     ctcgtcctgc gctcctgttt caccctaaaa cggcggcagg gcagggtcag ttcttttggc     29520
     ggcccttcag tgccgcggcc gcgtccctca atctcgatcc cattccagtt tccgtggacc     29580
     gcatggagga cgtcgaagca gcgaccgtcg aactggctcg acaacccggg actgctttgg     29640
     cgatcgcacc gagcagtttc acaagccttc acgggcttga gatcgctagt tcagccaatc     29700
     gccgtggctt gcccacggtg tttccatttt ctgagttcgc caggggagga ggtctgatct     29760
     cctacggggc gcatgtcttg gacttgtttc gacgtgcagg aagcttcgtg atcaggatcg     29820
     ccaatgggga gcatccagca gacctccccg tcgaggcacc gacgcatttc gaactggtcg     29880
     tgaacgccag aaccgcaaag atgctgggcc tggcggtccc gccgctgctc ctcgcccgcg     29940
     ccgacgaggt aatcgagtaa cgtctcggat ggctgcttcc gacacgtctc agaattgaag     30000
     atcggacctc aacgggacac atacgcccgc ttgggtatac ccatcgagaa ccgacgtggc     30060
     cgcatggctg gagccgggcg gcaatctccg caatggctct acgatgggga acgaccgaca     30120
     cactgcacga caaatgtctt agatctcttc gactatggtt ttgtgtttcg gttttggttg     30180
     tctattgctt ttcttataac tttcctaata tgttctcgaa ttcgcgcgct tcgctccgct     30240
     gaattatccg tcgcttcatg ggtttcgggt ttgatcggat cgcgcatcga ttgggttccc     30300
     ggcgccagag agcctgcata ctcaacaagg agcccagcct cttaggcagg gcggcatgtc     30360
     ggtgtgacta cacaacctac tctgccctga acctgctaga tagtgcagcg atcccgaagt     30420
     cacgtagtca ttatgcccca catttgatct ttcagttaat ttaacaaata ttcggtaggc     30480
     atattaagct tccgtaaacc aagtatgcgt atttacttgc tgtcgaatac gtaggctgcc     30540
     ggacggagcc gcgcactccc gaccgcccag aaaagggtca cctgatgcag cgcttctact     30600
     tcgacctcgc tgacggggtg acgactatcc gggatgacgt aggggtcgag gccgtaaatt     30660
     tggatgaggc gctggaggag gccgaagccg tgatccggga gatgcgagcc aatggcgagc     30720
     tggcgcacct cggagacggc tggaccctct ccatccgcgc ggaggccgag accgtcctgg     30780
     cgatcctgct cgtggagtag cggctggtcg cagagggtgt ggtgctcgac ctcgcggcga     30840
     tcctgctggc gcggcccgca taagccagaa cccacggcaa gccccaccac acctcggtgc     30900
     cgtaccaccc cgtcatgccg accgccgacc cgaccgccga tcactccacc ttcgtctccg     30960
     agtggaaccg cgggctcgcc tccctctcgc ccgggcagcc gccgtgcccc ggcttccgcc     31020
     cggaggactg ggccaccacc ctggagaact gccgccgctt cgtcgacgag ttcggcgccg     31080
     aggcggcccg gctcggctgg gacacgatcc tgctgttcgg cgtgcacccg caggccggca     31140
     tcatccgggg cgactggagc ggggtgatga tgccgtgctc ctaccccgtg ttcgaggtca     31200
     ccgaggcgta cctgaagaag cacctctaga cgtcgtggaa gcgcaagccg gggcgctacc     31260
     gcggcgtgcc ggtctgggag ttcgggaaga agacctaagc cctgttgtgg cggccggacg     31320
     gtgaagcgcc aatccggccg cccactgcgc cgccccgcaa ccgggtgaag cacgacgatg     31380
     cagcgtccga cactgtagga accagctaca aagaaatcgt agcgggaccg caagctcggc     31440
     cctagcctgc accgattgtc aacgggcttc gaaccttccg caatttcggg cgcgcaattt     31500
     tcctcagatc ggcgggctcg gcggtcaggc gatgccgagg tgagcacctc cattcttggg     31560
     cgggcgtccg cgccgacgcg gaggcggggc gagcggcgga gcctgcaggg ctgccttcga     31620
     gcggatgtgc tcgggcatga gcgcggtgtg ctggcgcagc cggtagcttg agccctcgat     31680
     ctgcaccacc acggcgtggt gaagcaaccg gtccagcagc gcggtcgcca ccaccggatc     31740
     gccgaacacc tccccccact ctgcaaagcc gcggttcgag gtcaggacca tcgcgccccg     31800
     ctcgtagcgc gcgttgacga gctggaagaa caggttgccc ccgcccggca ccaccggcag     31860
     gtagccgatc tcgtccacga tcagcagcgc cggccggcag aagtagcgga tcttctcgcg     31920
     caacgttcct tcccgctcgg cccgcgccag cgttcccaca aggtcggcca gggtggtgaa     31980
     gtacacgctg cggcccgcct tcaccgcctc gaccccgagg gccaccgcca agtggctctt     32040
     gccggtgccg ggcgggccga ggaagtgcag cacctcgcag cggtccacga agcccagctc     32100
     ggccagggcc aggatgcggg tgcggtcgag cgagggctgg aaggcgaagt cgaagcccga     32160
     cagcgtcttg accgtcgaga gccgcgccat caccagcgcg gtcttcaccc gccggctctc     32220
     gcgtaggctc agctcctcgc tcagcagggc atcgaccgcc tccagcgcgc tgagttcgcc     32280
     gcgctccagc cgccgcacgg tggtgtcgac gatctccagg gcgcgcggca tcttcagccc     32340
     taccagcgtg gccttgatcc gctcgaccag tggggggatc agctcgccag ttccgctcat     32400
     gccgcgtctc cccggtcggt cctgggcacg ccggctcccg cgagttggcg ggctacggcg     32460
     tcgtagatgg ccagcgggcg acgcgcgacc tggtcgccgg cgcgcctgac gaccaccggc     32520
     tcggcagggt ctcgtggctc gggcggggga gatcgcggcc gccgatgggc tggatcgacc     32580
     tgcgtcagcc cacgcccttc caggggcagg tggcaggcaa cgagctcacc cgcctcgtag     32640
     atgcggatct gatcggccag cacgtgcacc tccagggcgc ggcggcgggt ggtgtcgggc     32700
     acgctgtaga gattgcccgc caccgagacg aagccctcgt gggtgacgcg ccgctccagg     32760
     ctgagcacgg cttcgtaggg cacgggcggc agcgcccgca gctggctgcg ctcctccgcg     32820
     aaggcgtcgg cgacgatccg cttggtcgtg gcgtgccggc gggcgttggc cacggtgtcg     32880
     agccagtgcc gcagctggtc gttcaggtcg tcgaggttgc ggaacgagcg ggcgaggaag     32940
     aagtcctcgc gcaggtagcg gaacgggcgc tcgaccttgc ccttggtctt ggcccggtag     33000
     ggacggcagg cgcgcggcag gaacccgtag tggcgcgcga gatcgagaag gctgcggtta     33060
     tagatgacca agccgtcggg atcctcgccg atcacggcgg tcttcatgcg gtcgtagagg     33120
     atctcgcgcg gggcgcctcc aagggcctgg aaggcggcga tgtggcagcg caggaccgtc     33180
     tgcagatcct ggtggacgac gaagcgggcc cagagatagc gcgagtggcc cagcaccatc     33240
     gcgaacagcc agacgatgcg ggtcacgccc ggctcgtcgg cgaagacgac ctcgaagcgg     33300
     gcgaggtcga cctgggcctg ctcgcccggc ggggtctcga agcggcgctc gataggcaga     33360
     ggagctgagg ggcgaagcag ggccacggct cgcttcacgg cggtgtaggc ccctgcgaag     33420
     ccgcgctcct tcaactcgcg ccagagacgg acggccgtaa gctgcgggta ggcggccagg     33480
     cgctcgcgca ggtagggcag gaaggcgtcg gtggcccgcg cgcgggggga tcgcggtccg     33540
     tagacgggcg gctcgaggcc gcgggcgatg tacttggcga cggtcttgcg gtcgaggccg     33600
     agctggcggg cgatggcggt gaccgagagg ccctgccggt ggaggtccag gatcgtcatg     33660
     agttccccga ggctgaccac cgcgccgctc cctcccgcca cggggaccag cttcggtgag     33720
     acggccgccg cgcgggcatc ccgcctcaaa caggaggctc aggggcggcc gggagggtgg     33780
     ggaaaattgc aggcccacaa gtgaggagga tccaacgccc gctcacaccg atcacagcgt     33840
     gaccgtgccc atgccgatcc gacccgagca ccgcggcttc tacccgatcg actggcccca     33900
     gctctcggac gtgatccgct tccggcgcgc gggcgggcga tgcgagggct gcggtcggcc     33960
     gcacctgcaa cggatcgcat gcttgccgga cgggcgatgg ttcgacgccg ccaccgacac     34020
     gtggcgcgac gggtgcggcc ggatcctgcg cagccggatg ctcctggaga acctgctcta     34080
     cacggtgcgc ttcacccgcg tggtcctggc gaccgcgcac cggaaccacg acacgtccga     34140
     caacgcgccc ggcaacctcg cggcgctctg ccagcgctgt cacatgatcc acgaccggcc     34200
     ggagcaccag cggcggcgcc ggttcaccct gttcagccgt aaggcggcgg gcgacctctt     34260
     ccgcggtccg taccgtaagc tttaagcgca atacgattat ccgccggccc cgccctcaac     34320
     gagatcaatg attgtccgta taggaataag catctttggc gcaatattgt cccgagtgta     34380
     gggctcaaaa cctaaactct cgtagaacat ggttgactgt ctatcaatag actgtaaagt     34440
     aagcgcatag agaccggcaa gcagggagac tttataggct ttatctataa catccttcag     34500
     taaaattgtt cctacaccct ttctctgata ttctttttgc actcctaagt acgccaaatg     34560
     cagcgccgga aaagcggtat aattcttggt gtggtcgtcc ggcttgttct caagttcggc     34620
     catgctctcg ctgcctatct ggagagcatg gaaaccggca accgcattcg tgtcttcgtc     34680
     tacagcaata gtaatgcgtg cttctgcgcg atcagaccac ttctttgagt ggtttctgta     34740
     ccattgatca ataccccttc tgccgcactc gaatgtattg cgagagcggg tcctatcaaa     34800
     cggctgtaca ataattcttc cggtcaagcg gcagatgctt ttttgataac tctaccatca     34860
     cgctcaagct ggtcagcttt attgtaaaga tcgcgaagct tttgattagg tgccccgttt     34920
     tgattatata tacgacgcac aaattcggct gcttcgcgct ggctcttgaa ttctagcttc     34980
     tctgccttgt cgctggattg ggtaaaccag cgcagaaatt ccctgaaggt atacattccg     35040
     cgcccctgcc cccagacctc taccagactg ccgccgattg agctgtcaag cagttaatcg     35100
     cagaacggcc catttgttca catgtcgctc ctacgcagcg tgcgtacgca atcgtcgcgc     35160
     aacgagcgag gtctacatct cggtgatgac ccgccacccg cgccgcgccc acgacgacca     35220
     gggccgcgag atcccgccgc ccacgatcgg ctggctccgg tccgaggagg gcgaccgcac     35280
     cgccttcgtc cactgcaacg cgaccggctg cggccacgag gcgacgatca gcaccgatcc     35340
     gtttccggac agcctgccct tccccgacat cgccttgcgc ctgcgctgcg ccgcctgcgg     35400
     gtcgagggag gttggggtca tgcgcgacgt cgtggggatc tacgcccggc tcggacggcg     35460
     cacggggtgg agcatgggcg cggccggggc gcggccggtc gcccgaaggg atgcgcctga     35520
     tcgcgaccgc ccctgaaacg cagaaaggcc cgccgcggcc ggagccgggc gggccgtgga     35580
     gatccaacat gatcgaaagc atcgagagcc tgcgcgtcaa gcgggcgcac ggcgtgccgc     35640
     tgccccggac ccggatctgc ggggcctagc gcggccccgc cttgatcgag ctgtcgacct     35700
     gccggcgctg ggtgatcgag acgtccttga acagatcgtc catcgaggcc cgggtcgtgt     35760
     ccctggtggt ggtgtagctc gacgggagcg agagagcccg tctgcgcgcc ctccacagcg     35820
     ccgaagcagg cgggatctct cgcggggtgg tcatcggcgg ttgccgggta gggtcggggt     35880
     gcgagcacca acctcgaacc cgagagacct ccgatgaccg acgagatgat gagcctgcgc     35940
     gggctgctgg agaagagcgc cgacgccgac ctgctgcgcg agatgatcgg ctttgcggcc     36000
     gagcggctga tggaactgga ggtgggcggc ctgaccgggg cggcccacgg cgagaagagc     36060
     gccgagcggc tggtccagcg caacggctat cgtgaccggg attggcagac gcgggccggc     36120
     acggtcgagc tgcgcatccc caagctgcgc aagggctcgt acttcccggc tttcctggag     36180
     ccgcgccgga tggccgagaa ggcactcacg gcggtgatcc aggaggcgta catccagggc     36240
     atctcgaccc gctcggtgga tgacctcgtc caagccatgg gcggcacggg cgtgtccaag     36300
     agccaggtca gccggctctg ccaggagatc gacgagcgcg tgggcgcgtt cctcgaccgg     36360
     ccgctcgagg gggagtggcc ctatctctgg atcgatgcga cctacgtgaa ggtgcgccaa     36420
     gccgggcgca tcgtctccgt cgcggtgatc gtggcggtcg gtgtgaacag cgatggccga     36480
     cgcgaggtgc tcggcatgga cgtcggcccc tccgaggccg agacgttctg gaccgggttc     36540
     ctgcgcaagc tggcgcgccg cggcctgcgc ggtgtgaagc tggtgatttc ggacgcccac     36600
     acgggcctca aggcgtcggt cgccaaggtg atgaacgcga cttggcagcg gtgccgcgtc     36660
     cacttcatga ggaccgtgct cgcccacgct ggccgcagcg ggcggcgcgt cgtgtccgcc     36720
     ttcatcgcca ccgccttcgc ccaggacgac gccgaggccg cccgtcagca atggcgacgc     36780
     gtggccgacc aactccgacc caaggtgccc aagctcgcag ccctgatgca tgaggcggaa     36840
     cccgacgtgc tggcctacat gggcttcccg gccgcccacc gggtcaagct tcacagcacg     36900
     aacccgctgg agcgcctcaa cggcgagatc aagcggcgca ccgaggtggt cggcatcttc     36960
     cccaatgagg cggccatcac ccgcttggtc ggcgcgctcc tgctcgaaca gaacgacgag     37020
     tgggccgtcc agcgcgcccg ctacctgacc ctggaaagca tcgccccgat cagcgatgat     37080
     cctcttgtca gcctgcccac cctggcagcc tgatcgtccc ggccccgccc ggtgaccgtg     37140
     gccgccacgc cgcagctaca ccacgcctgg ggacacgacc gaggcccggg cgcgcgtccc     37200
     ggtcgggaag ccgtccatgg tgatgtgcag gtggcccttg ccgctaccgg ccgaggcgcc     37260
     cgcgctgttg aagcggcgct gcatcatgtc gtcgccgacg cgcgacatcg cgatcttctg     37320
     agacggcggt ccgtccttga ggtcgttcac gacctcgtcg tcgcgcaggc gcgagtagcc     37380
     accggccttg gacgggtagt agcggtcgcg cttgtaccag agcacgtcgc caccgctcgc     37440
     gacctgcacc ggctcacccg gagggccgac cttcagcccc cccatcgccg cggccgtgcg     37500
     gccggtgaac aggtcgacgc ccgtgcgcgc gttgtagccc tccgcccgct cgaacatcga     37560
     agccccggtc gcggcctcga acggggtctt ggcggagttg agcttcgcga gcgcccggcg     37620
     ctcggtcgtg tgcagctcgt gcaaggcgtg ccggagctgc gcgtcgaagt cggtgttgcc     37680
     gcggatcgga gccagacggt cccgagacag ccactgcgcg atcccgaacg cgcccgagcg     37740
     cgggttcacc gaggtcgggc cgccgcgggc ctccacggct gaccagcggg gcgtgtcgca     37800
     aagatttttg gcggagaaaa ttatgctccc cgcgtaggcg cacaccggtc cgtcaggccg     37860
     ataccgggct cgtcaaactg cttcgccagc ctcgtcggag ggggtcagca ggcggtgagc     37920
     aggcctcgtc acgccttgtt cggagacgat ttttttcggg cgttgaacgt ttgcgacacg     37980
     cccccccgcg attacccgat gtccacccca tcacgcccgg tcgaagccat cccctctcaa     38040
     tgggactgca ccgccgtgtc gcccggaaac ggcgtccaaa gagccttgca gttcggcccg     38100
     ttgaccgccg accacgccgc cgccggggcg ccaatcggcg gggtcacgcc acccgccatg     38160
     acgatggcct gggtgttgac cacgtcccac gtcgcgttgt cgacgaagcg aacgccatcc     38220
     agcgaaacgc ccaaggggtg agcggcgtcg tacccgtgca tgaccagccg accgccctct     38280
     ccggcaactt ggcgcaggac gatgttgcta tacacgggga tcttcgtacc ctgagcgcgt     38340
     ggatcatagc gcgtgtcgaa gtcgatcggc cgccgacttc cgcgcacgca aacgttctcg     38400
     tagcggaccg cctgcaccaa accgccccga ctcggatcgc tcttgattct caggcctgac     38460
     accgcgccgt cgatggtgac gtttcggacg aggacgtcgc tgacgccact gttcgtctca     38520
     ctgccaatcg agagcccgtg ccccgaatag atgtggatgt ccaagatgga gacgtggcgg     38580
     gtcgctccgt tgtcgccggc cttgatggcg atgtcgtcgt cgccggtgct gatgaaggtg     38640
     cgggcgatgg tcacgtccat cgccgcgcct ggatcaatcc cgtccgtgtt tcgggcatcg     38700
     gccggggtgt tgatggtgac gccccacacc gtcacgccct ggaccttgtt catggcgatg     38760
     tgtacgttcg gcgcgttgcg cagcgtgatc cggtatacgg tgatgttgtt cgagctgtcg     38820
     atctgcacca gccgggggac gttctgctcc ctaccctcga cctgagcgcg actggccagg     38880
     gcccaccagg tctccgcctt gccgatcatg accgccccgc cctggccgtc gatcgtgccg     38940
     tcgcccatca ggcccgcgcc gttggccttg tgaaaattga ggaaaggccg gcatcccccc     39000
     cccgcgttat tgatcagtcc gcaacggccg tcgccgaggt cgtagaggcg aggatcgggc     39060
     tcggcggcga gcacggcccc ggcgtcgagc cagagaacca cgccggcccg catctcgatc     39120
     ggcccgctcg cgaacaccgc cttcgtcctg ctgggcgtga gccgcaccgc ttggcccgtc     39180
     cggcagccgt ccagggcggc ctgcaatttc gcttgtccga ccttggccga cggagcgtcg     39240
     tccgcactca ggactgcgca gacctgcgtc ggcggaaccg gctcctggac gtttcgcctg     39300
     tcctgggact gtgccgaatg agtggcgccg acggtcatca agcctgccgt tgcaaccaga     39360
     acggcgcgtg cggtaagaac tttcattgcg agccgtgctc gccctggtgc ccccggacca     39420
     tccggaccgc cccgctcgcg gatctcaggc gagagggggg gtatgcttcc tcatggctcc     39480
     atcctctcaa gagttggagc ctcctgtctg tcgggattga cctactctgc gctcgcggac     39540
     ggcatcccgc gagcctccgg aaatcccggg gcggttcaat cttgttcttg agcgccacgg     39600
     tcgttcgtcc cttactcgcg cccagtcaac cactcggcga tgccggtccc aagcaggctc     39660
     tgcgccctcc cgccgacgaa tacgccgacg tgcccgcctg ggagcggcag ctcggtatag     39720
     tccgacgtgc ctacgaattg cttgagtgcc cgcgatgttg ccggtggaat aatatgatca     39780
     tattttgcgt agatgttcaa gactgggcat ttgatgttgc caagatcgac ggttctgccg     39840
     gctagctgga acgagttttg caccagcttg ttgtcctgat acagattttt cagccactgc     39900
     ttggcggcct caccgggatg gtgcggccga tcggaaatcc acttttccat acgcaagaag     39960
     ttcataaacc ttttcttatt gtcgattacg tcaagaagat caaggttgta cttggtcatc     40020
     gtgcgcatcg gcgtcatcag cgcgaacacc gagcccatga attcacccgg caacgtgccg     40080
     tgcgcctcga tgaggcggtc aatgtcatca ggctcaaggc tgcgcgtcca catgttgatg     40140
     aagccgtgac ctttgcggtt ctcgacagtg tcggcgtgga agtcgatcgg cgtgatcgtc     40200
     agcaccatcg cgttgacgtc ctcggggtgc agcgccgcgt agcaagtcgt gaaggtccca     40260
     ccctcgcaaa tcccgagtag attgatcttc gccccccccc cccccccccc cccccccccc     40320
     cccattcgcc tcggagatga cgttcacgca ttcagcgaga tagccgtcga tgtagtcatc     40380
     aagcgtcacg aagcggtcgg ctcggctcgg attgccccag tccactacgt agaggtcaac     40440
     accgagcttc agcagattgc gaacgagcga gcgatcctcc tgcaggtcgg ctatcgtgtg     40500
     gcgaccgata agcccataga cgatgaggac gggtgtcctg accttctgct cggcaagaga     40560
     tcggtagcgg tacagtgtga ccttatcctg ctgccagatt acaactttct cgctcgtcgc     40620
     aatctgaacg tcctcgtcgc ggacctcctg gaagagcttg gctccttccg cgagccgctt     40680
     tccaagcgct gccgcctccg cgacggggtc aagcgcggct ttggatttgg cagagcggct     40740
     catgtcggct ctccttctga ttttccgctg gtccgcctct ggcgactgag cgccctgact     40800
     tcccggcgca gctgcgtgag gctctgatgc acgtcgtcga gttcggcgcg ggtcgggtag     40860
     ccgaacatct ggctgtagaa ctcagcgata tcctgctgag caagccgcaa atccgtcgag     40920
     gctttcagcg tctcgcgctg gctcttgaga aactcctccg accgctgcgc ctccagcaga     40980
     acgtcgttgg cagtctcgac ccagagcgcc atcagctcgc ggctcgacgc gatcccctgc     41040
     tcgttcttgg accgttcatt gaccacggcg gagaaggctg ccgtcgcctt cttccagacc     41100
     tccatcatca gggcgttgtg ttcgaggttg cgccggtgca gcgccaccca ggccgtgaac     41160
     acggccgcga acttgcgctc gacgttccag agatcggcga ggcgcggtcc ttcggccatc     41220
     cgtttcagcg cttcatcgac cgcgcccgtg atgcagatcc atccgtgcgg gtcgaagatc     41280
     ttggccagga catcggccgc gattggatct cgcacctcgc ctccgccctt caggctcttg     41340
     gcaaaggtcg ccgagaccgc ctgagcggcc tcccagccct gctgatacga gtgttgggcc     41400
     tgttccaggg cttcccagtc cgggatgagg ggaaggctcg gcttgccatc cttgtccaag     41460
     gccgtcgtca tggccccgta catgttgcgc tgagcttcga gaaagcactg ggtgcctttg     41520
     ccccagagct ctcccattgc cttaaaggta tcgaatagat ccatggcttg agctcctcaa     41580
     gcgactcaag caacggttct gagcttgccg tcgagtgcct cggagtagat cgcgaaggcg     41640
     tccgggtagg tgacctcgcg tgggttgttc acgagaagtc gcgtctgctt catggcatcg     41700
     gttgcgaggc gcgcgagatc ctcctcgcga acaccgacct cggcgagtga ggcgggcgca     41760
     ccgcagtccc ggcagatggc cgcgaggctg tcgacgaatc gggtggcagc ctcggcggcc     41820
     gggagactgg ctgcctgcgg atcgaagatc ggggcgagtt ccgcgtagag ggcctccgct     41880
     tgcgggaggt tgaagcgcat cacgcccgtc agcacgaggg cgttcgacac cccgtgcgtc     41940
     acgtggaaga cggcgccgat cggataggcc agcgcatgga ccgcggcgac gggagcgttg     42000
     gcaaaggcca tgcccgcgag catggagccg agcagcatgt tggagcgcgc ctcgacgttg     42060
     cggccgtcgc tgcaggccgt gcgaatgctg cctgcgagca gcgccaaggc cttccgggcg     42120
     agctggtccg agatcgggtt cttcttgtga cggctggtgt aggcctcgat cgcgtgcacc     42180
     atcgcgtcga tgccggtcgc ggccgtcacg tgggccggca gtccgagggt cagatcggga     42240
     tcaaggaccg cgcagtccgg cagcagccgg ggcgagacca cgcccttctt ctcgcccgtc     42300
     ggcgtcgtca cgatcgagat cggcgtcacc tcggagccgg tcccggccgt ggtcggcatc     42360
     aggatgagcg gcaagcgctg gccctgggcg aggccgaccc cgtagatgcg gtcgagctga     42420
     tcgccgctgc gcgcgaggta cgccacgagc ttggcagtgt cgagagtgga gccgccccca     42480
     atcgcgagca caaggtccac tgtctgctgc tgggcaagtt gcgctgcagt ctcgatgacg     42540
     tgcgagggcg ggtcggccac gacgtcctcg aagacggtga cctgaaggcc cgccgaggcc     42600
     agggcagcct ccgcagcgcg ggtcagaccc gcgccgcgaa catttttgcc ggtcaccagc     42660
     atgatccgtt gagcgcggaa gctcgccacg aggtcgggca gcttcgccga ggcgccgggc     42720
     tcgaacagaa tattggggca ggtttggaac gtgaatgggg tcatgatgag ctccgggagc     42780
     acgtcggtga gctagaactt attcttccgg ctcgatattg ctggccttat ggtgatgttc     42840
     ttggatcagg acccgcttgt tctcggagtc gtcgatcggt accgccacga ggtgaacccc     42900
     accggccttg aaggcggcct cgagcgtcgg agccaggtcg cggaccgcgg tgacgcagtg     42960
     gcccgtcgcc ccataggaat tggcgtacgc gacgaaatcc gggttggtga acgtcgtgcc     43020
     gtattcggcg aagcccccct ccctctgctt cctgcggatc atgccgtatg ccgagttgtc     43080
     caggatcagc gccacgaggt tgagcctgag ccggacagct gtctccatct cttggctgtt     43140
     catcatgaag ccaccatcgc cgcacaccgc caacacgcga cgttctggat agagctccgc     43200
     cgccatcatg gcggagggca gccccgctcc catcgtggca agcgcgttgt cgagcagcag     43260
     cgtgttggga gcgtacgtca ggtagtagcg cgcaaactcg atcttgtact cgccgttgtc     43320
     gaggcagacg aagccgtcct ccggcattac cgtacgaacg gcatgcacga tgcgccgcac     43380
     cgtcattgaa gaagtggcct cttcggtccc atcgttgatg ccgttgatgc gctccaggag     43440
     cgactggcgc agctcgagca tgccgggatc cggctcgagc cgcccgccga gccggtcggc     43500
     gagcgccgtc accgtcgaac tgatatcgcc caccacctcg gcatccgggt gaaagacctg     43560
     ctcgacgctc gccggagtgt aaccgatgtg gatgaccttg aggccgcccg cgatcttctc     43620
     gtacaggaag gggggtttct cgaccgcgtc gtgcccgatc gagatgatca ggtccgcccg     43680
     gtctatcgcc gcatgcacgt aatcccgctc ggagagcgcc gcggtgccga gatagaggct     43740
     cgaggcgccc gtgaccgcgc ccttgcccat ctgcgtgtcg cagaagggaa tctgggtccg     43800
     ccgcacaaac tcggagagcg gctcgcccag ccccggccgg ttgccggccg cgccgatcat     43860
     gatcagcggg ctttgcgcac tcaggatcat cgcagccgcg tgctcgatgg cggcttccgc     43920
     cgccactggc cggtcgatcg ggtgagaggg cgccagggcg acttcggcca tttcggtagc     43980
     aacgtcttcg gtagcaacgt ccttgggcac ttcgagatga accgcgcccc ggcgctcgtc     44040
     ggtggcgacc cggaaggcct cgcgcaccag cgtcgggatc gaggccgccg agacgatctg     44100
     gcgcgtcatc ttggtgagcg ggcgcatcac cgagacggta tcgatgagct ggaagcggga     44160
     ctggggtggg gcgctgatcg gcttctggcc ggtgattatc aacaccggca tggcgccgag     44220
     ctgcgcgtag gccacgcctg tcaccaagtt cagcgcgccc gggccgcagg tcgcgaggca     44280
     gacgcccggc cggccggtca gccgcccgtg cgtggcggcc atcatgacgg ccgcctgctc     44340
     gtggcggacg gggatgaacc tgatcttcga gttgtgcaag ctctcgatga tttcgaggat     44400
     ctcctccccg ggtatgccga tgacgtagtc gacgcccatg ttctcgaggg ctttgactat     44460
     gagatcagaa cccttaattt tagacgatgc tcccacgttc tcatcctcgc aagctggcat     44520
     taagcaaccc gcccgactgt cgtcgggctc tggctgtcgt cgagctcttg ctccgcccag     44580
     gcggcgacat cgctccccac gtcacggcca gcagcgactt ccgccgccgt cgcaccctcg     44640
     ttgcgcaagc gatgtgccag cgccgcccga cgaacttttc gcaattattg caatgcttta     44700
     tggctgccgt gggggattgg cgcagacgcc accgggctgt cgggagcccg acaaagtccg     44760
     acaggccatg gaggcgcggc gggccggatg gggtgtagcc gggcggtagc gccctgtacg     44820
     aggccggcaa gccgtccgga gggctagggc ctgaaccgaa ccaaggtgtt gcagggtcta     44880
     tggttttgtg attcagggcg gccgcttgca gcacggaggc ggccatggcg gacctgttct     44940
     ggctctcgga cgcgcagtgg gcggtgatcg cgccgttcat gccgcgcaac cagcccggcc     45000
     ccgagcgcaa ggacgatcgc cagatcatct ccggcatcct gcacgtgctg acctccggct     45060
     gccgctggcg cgatggcccg tccgcgtatg gacaccgcac cacggtctac aaccgcttca     45120
     acaggtggtc gcggcgtggc ttctggacgg cgatgctggc ggccctggcc aaagctggat     45180
     ggtcgggcga ggcggctgcc atcgacagca cctacgtgcg ggtccatcgc tcggctcacg     45240
     ggggcaaagg ggggcgacag cgcaggcgat cggcccgtcg cggggtggcc agacgaccaa     45300
     gatccacgcc ctcgtcgacg tgcttggccg ccccggtgtc ctcctgctga cacccggcaa     45360
     cgccagcgac gtgcgcaccg ccccggcggt gctggccgag gctcccggcc ggatccgccg     45420
     cctgatcgcc gacaagggct acgacgccga ttggctgcgg gctgatctgc gggagaaggg     45480
     catcaccccg gtcatccccg gcacccgcgc ccgcaagcgc aggctgcgcc acgacaagcg     45540
     ccgctcccgg aaacgctggc gcatcgaggc cgccttttgt cgtctcaagg acttccgccg     45600
     gatcgccacc cgctacgaca agctggcccg caactacgcc tccgctctcg ccctggccgc     45660
     cgtgatcgcg ttctggtgct gattgagtcc tgaccccaat cctccggcgg cacgcaggtt     45720
     ttcacgaagg tggtccgggc cccgcccctg agccgcttct cggcggcgtg ccggcggcac     45780
     tgggcgagga gggccgggtc gacttccgcc atgtcgtcct cggccggcgc gggggccggc     45840
     ttggccgcct gcggggcgtg acggggcacc tgcgccgccg ccgacccggc gaggcccgcc     45900
     gccaggatca gcgcgcaggc ggcagggagg tgtctcatgg gctcggagcc ccggttctcc     45960
     ggccgcttcg tggcgagggg agggcgagct ccgacggggc ggccgcggct cttacttcag     46020
     cagcacctca cgaaggaagc cgaccaccgc cgcccgcgcc gcctcggtcg aggccgggtt     46080
     gtggcccaca tgggcgccga cggcgacgca ggggtctgtc cgcaggctgt agggccggcc     46140
     cgtcgcggcg tcgaggatcg tgccgcccgg cccctctttc agtcggcagt cgcgcgtgct     46200
     ctgcgccttc gggatcgaga ccagcggcgg gctcgtcggc gtgtcaaagc tgtgctgcgt     46260
     gtcgggatac tcggtcagca tcacgtccgc gccggcctgc ttcagccggg cgacgtagtc     46320
     ccggcagggc aagacgctga cgtagtcgtc gctggtgccg tggaacagcc ggatcggcgc     46380
     cgggccgacc ttgtcgtctt cccgataggt cacgttgcag ggcgtgtaga ggccgatatg     46440
     ggcggcgaag cggttcgggc cgccataggc cgcgtggaac cgctccgccg ccgagtagac     46500
     cgacgcgacc gcccccttgg agaagcccat cacggcgatg cggtccgccc gcacccgcgg     46560
     gtgcgccgcg agcgcgtcga gggcgcggta ggcgtcgacc atcatggcga gggagttgag     46620
     ctgctcctgg tcctcgatcg tgctgacaat gccgcggccc gtgaaggcgt cgaggatgaa     46680
     ggcgccgatc cccgcttcgt tgagcacccg cgcccaggcg tccgggccgg cgctgatccc     46740
     gcccgagccg tggacaagca ccaccaccgg caccttcggc ggcgcgccga cgggcaggcg     46800
     caactcgccg ccgagcacca cctcgcgccc cggcgcgtcg ccgcgcagga actcttcccc     46860
     ggtcagggtc cggctcttca ccgcgtggat ctcgatgcgg ccgggcaggg gggaggcggc     46920
     ctcggcggcc ggtgcggcga tgccgagggc gacgagcgtg gcggccagga tgcgcatggt     46980
     tcctcccgag gatgcgttgc ccccaccctc gaccgggcgc cgcccgtgtc aacggcggat     47040
     ctcccgccgc ggaaggcttc aggcctcgac cggcgcctcg cgcagccagc acagcatgtg     47100
     agggaagggc ggcacgcccc gcgccgcggc cgcgcgcgca tcgagggtca ggcccatcca     47160
     ttgcagcagc ggcagcccgg gatactggcc ctcaaagaag accctgatgt ggaacggcga     47220
     ggcgccgcgg tcttttgacc gcagccgcgc ccgaggcgcc ggccgcgtcc ggcgaagccg     47280
     ccggacaaca tacggccata cgacattacg acgatagcag cgtacggtgc taacgcggta     47340
     cggaaaggtg tcacggggtg cggctctcta gttgtctgga tgcgagacct ccttggcgtc     47400
     tgcgaccacc ttgagcgctg cggggagtgc gtccggatca ggcggcctag tgacgggctt     47460
     ggccagctcc ggcttcgcct tcagccgctc acgcaggacc ctgtccggtg agcggctgaa     47520
     ggcgaagccg gagctggcca agcccgtcac taggccgcct gatccggacg cgctccccgc     47580
     agcgctcaag gtggtcgcag acgccaagga ggtctcgcat ccagacaact agtgcagtga     47640
     ctcagacgga tggtgcagcc tggctgttga ggatagcggc cgcgggcttg gtccagacga     47700
     agggcctggg ctgctcgttg ttctcggcga tgtagcgctt gatcgccgct tgcaggtcca     47760
     cgatcccggt gaacgtcccg cgccgcagcc gccgaggggc tatggtcggc catcgggagg     47820
     ctcgtcgaca ccatcacgcc cgacgagtgt gcccacttct tcgccgctgc aggctacgat     47880
     ccagattaaa ccgaaaacgc tctagacggt ccagaagatc ggcgtcgatc gtcagtgtca     47940
     cctcaagccg cggcgggact ggtgcagcgg caatatcaaa ttcagcggat ggcctttcca     48000
     gtacatcgac catggcaggc ctattatact acgagatcga tttaaaaact gcttaagcct     48060
     cgtgctggca ggtcatcgct ttggcgcctg ctccaggagg tcgcgcggtg catccagctt     48120
     tccggcctgt aaggcttcgc gcagcacctt ttctatgcgg gggacatgac cacggcccgt     48180
     cgctttgatt gcctttgcct gatcggcggg gaggtacagc gtgcgccgtc cggtcatgcc     48240
     agctccagcc gcactttgcg gccaacgacg gcggcggcac gcttcacagt gtcgagctgc     48300
     accttgtcat tctccgggtc cagcaggcgg tcgagctggg cgcggctggt gtgcatgcgc     48360
     ttcgccatga cgctttttgt gatgccctgc tccttcatgg cctgctcgat ctgccaggcc     48420
     aggacgcgct tggtcgcctg ttcgttgacc tcctcgcggg tgccttcctc ttcgaggaag     48480
     ctgtcgaacg acgatccgat atgtttattt gtcatttttc tccaccttct tctgtcgttt     48540
     gcgggctttg gtcagttcgg catcgggcgt cttctgcgtt ttcttaatga aggcgtgcag     48600
     cagaaccata tgaccgtggg caatgcagaa caggacgcgc gaaatccgcc cgtccgaaag     48660
     gtcgctgcgc acctcccaca ggcctgcgcc catgggccgg cacgtcggca tgccgaccgg     48720
     ccagccgaat tcgaccgtgg caatgtcctg gccgatgacc ttgcgatcgt ccggggtctg     48780
     gtccttcaac cattccctga ccggctcctt gccgctgtcg gtggcgtaga acgccgccgg     48840
     cagctttttc agctcctgct ccatccgcac cttctacggt acatcgtacc ttaaaagata     48900
     cagggtttgc cagcagaaaa gcgattttct ccataaagcc cctcggatgc cgttcccccc     48960
     tcgccaagcc ccttacgctg gcgccgcctg gcgcgatttc cggctccgtg gctgcggtgt     49020
     gatgcttcga gggtgtcgga gtagggtcag aagaccagag gcccacaggc ggcgattttt     49080
     gagccgccac gccgccgccg cgcttccagt gctcaatggc cagccgggag gtcgccatgc     49140
     tgttacgcgt gatccagggg cctgtcgcaa acgcgaacgg gctcgcgttc atgggtcgtt     49200
     agccataccc gcccagcttg ccgctccgcc tcggagccgg cccatgatcc tgaacgccct     49260
     cgccctcaag ctgaagagag aggcccgcgg cgacttcacg ggccggcact tcgaagccac     49320
     tctcatcgtc caggccgtct cctggtacct gcgctacgcg ctcagctacc gcgacatcga     49380
     ggagatgctg ctggagcggg gtatgggggt ggaccactcc accatcaacc gctgggtgct     49440
     ggcctacgcg cccgccatcg agcggcgcct gcgccggttc cgcaagccgc attgcgggtc     49500
     cgtgagggtg gacgagacct atatcaaggt gcgtggccag tggcgctatc tgtaccgggc     49560
     catcgacaag catggcgagg cggtcgactt cctgctcacc gccaaccgcg acctggaagc     49620
     ggccaagcgc ttcttccgca agatgctaca ggatcagccg cttctcgcgc ccgaccgcat     49680
     cggcaccgat ggtgctggcc cttacccgcc ggcgatcgcc gagagccgca aggagggcct     49740
     gctgccacgc gcgcccatcc accacgtcac caagcacttg cagcaaggga ttgagagcga     49800
     ccacttccgg gtcaagcggc cgatgccacg ggtcgggggc ttccgcgcgt tccacacggc     49860
     gcggcggacg atccagggct tcgaggccat gctttggctg cgcaagggtt tcgggttctc     49920
     aggggcgtgg acggtccggg agcagaaccg actgctcgcg cagtgcttcg gacttcccgt     49980
     ggcgaacaaa gcgtgaaagc gggacggcag agacccttct gcggcctgga ccccagtttg     50040
     cgacaggccc gggcgtagcg caggtaccag gagacggcct ggacgatgag ggtggcttcg     50100
     aagtgccggc cccggaagtc gccacgggcc tctctcttca gcgcgagggc gagggcgttc     50160
     aggatcatgg gccggctccg aggcggaggc ggcaaactgg gcaggtatgg ctaacgatcg     50220
     gtgaatgccg gcccgttcgc gtttgcgaca ggcccgacgc gcctccatgg cttgtcggac     50280
     tttgtcgggc tcccaacagc ccggtggcgt ctgcgccaat cccccacggc agccataaag     50340
     cattgcaata attgcgaaaa gttcgtcggg cggcgctggc acatcgcttg cgcaacgagg     50400
     gtgcgacggc agcggaagtc gctgccggcc gtgacgtggg gagcgatgtc gctaccaacc     50460
     acgcgcggtt cgaccgaggg taggaaggcg ccaccctggg acgactgcgg caatcagtgg     50520
     agagctgata tgaatacgtt cagtgaagac gatgctgtga agagctggat ccataatgct     50580
     cctcagtatc acgattattt cttgttcgcc gacaacgtcg cggcgacggc gggcgggacg     50640
     tttctcggtg agaacactgc cgatccgaat gcgaccggca cggcgatcta cacggaactc     50700
     agcaaccttc cgaccgccgt ctccagcatc ctcaagcaca gccagaagcg cgccaatttc     50760
     cacccggcca cgaccagccc ggaggtgctg gcggcagcgt tcaacggcta cgtgaccgag     50820
     atcgacaaca accctttctt ggccctctcg aggaataccg ccaccaagat ggcctatgaa     50880
     gacaaaaatt acaacgccct cttcgatcaa atctgcagcc tgtacgcagg actttcggag     50940
     gatgacctga gaaatattga gaaaaccatc tctgatatgg cgaaatctgt ctccagcgag     51000
     aaccattcag aagaatggaa gaatttgttc tctcaatcta ccatcaacat gagggaccca     51060
     tcgcagccta agctctattt gtactacact gcactgtaca tgtcccacga caagagtaaa     51120
     aagaaggagg ttgcgcggca gggctttgag gtgcgttgca ccgagttctc tatcctgact     51180
     ctgaaaatca aggccagcgc cggcaagctt gtggcgctcg atacgacgaa cgtcaccgac     51240
     tggctgcgcg actccacgag tcccacggac cccaacgtca agctctgctt ccaggcgtaa     51300
     cccgtccggg gccggcccgc ccgccgacga gcgagggccg gcaccacgga tcgtcggctc     51360
     ccccccgctc gccggggttc gcgagccggg cgacctcggc gaggcgttgt ggcggatcgg     51420
     tgctcatggg tcaccttgcc cgcagctcta gggggagaat ggacatgaca gaaaccgaga     51480
     ggctttatga gaccctgtcc aagatcgccg aggcggccaa caccgccgtc aggcattggc     51540
     acgactggga agccctggaa caggcccaac actcgtatca gcagggctgg gaggccgctc     51600
     aggcggtctc ggcgaccttt gccaagagcc tgaagggcgg aggcgaggtg cgagatccaa     51660
     tcgcggccga tgtcctggcc aagatcttcg acccgcacgg atggatctgc atcacgggcg     51720
     cggtcgatga agcgctgaaa cggatggccg aaggaccgcg cctcgccgat ctctggaacg     51780
     tcgagcgcaa gttcgcggcc gtgttcacgg cctgggtggc gctgcaccgg cgcaatctcg     51840
     aacacaacgc cctgatgatg gaggtctgga agaaggcgac ggcggccttc tccgccgtgg     51900
     tcaatgaacg gtccaagaac gagcagggga tcgcgtcgag ccgcgagctg atggcgctct     51960
     tcgccatctg ctggttttgt tccggttggt ctggcggttc caatccttcg ctagtgcaca     52020
     gatgccgacg aacgcatcac acgctcggtc atcaacttct tgctgaaaca cgagaaatca     52080
     cgctgagctt tagagctcgc gcctagatcg caggaggcat cctcatgact gccaagacca     52140
     tctacgacca tggcctcgac cggaacccgg ccaatttcca gccgctgacg cccctcacct     52200
     tcctggagcg caccgcgacg gtcttcccgg accatgtcgc ggtcatctac ggttctctgc     52260
     ggcgcagcta ccgcgacttc tatgcccgca cgcggcgtct cgcctcggcc ctcgcggccc     52320
     gcgggatcgg gcgcggcgac acggtggcgg tcatgctccc caacacgccc gccttgatcg     52380
     agtgccacta cggcgtgccg atgaccggcg ccgtgctcaa caccctcaac acccgtctgg     52440
     acgcggcgat gatcgcctcc ttcctcgatc atggcgaagc caaggtgctg atcaccgacc     52500
     gggaattcgc gcgggtgatc aagccggcgc tcgcgcacgc gaaggtcaga cccctcgtca     52560
     tcgactacga cgacccggaa ttcagcggtg agggcgagcg cctgggcagc ctggactacg     52620
     aggcgttcct ggcctccggc gaccccgccc atgcctggtc cctgcccggc gacgagcggg     52680
     acgcgatcac gctcaactac acgtccggga ccacgggcga tcccaagggg gtggtctacg     52740
     atcaccgcgg cgcctgtctg caagcggttg gcaacgtcgt gaccaccggc ctcggcaagc     52800
     acccggtcta tctctggacg ctgccgatgt tccactgcaa cggctggtgc tttccctgga     52860
     cgctgtcggt ggtggcgggc acgcatgtct gcctgcggca ggtgcgggcc aaggcggtgt     52920
     acgacgcgat cgcggaccac ggcgtcacgc atctctgcgg cgccccggtc gtgatgcagc     52980
     agctgctgaa cgcgcctgcg gcggagcgcc gggcactgcc gcacccggtg tcgttcgtcg     53040
     tcggcggcgc gcccccgccc gaggcgggct tggccggaat ggcggaggcg ggcttcgacg     53100
     tgacccacgt ctacggcctc accgagacct acgggccggc cgtggtcaac gagtggcacg     53160
     cggattggga cgcgctgacc acgcccgagc aggcggcccg caaggcgcgc cagggcgtgc     53220
     gctacccgcc cctcgaggcg ctcgacgtgc tcgatcccaa gacgatgcgg ccagtgccgg     53280
     cggacggcca gaccgtcggc gaggtgatgt tccgcggcaa cgtggtgatg cgcggctacc     53340
     tcaagaaccc gaaggccacc gaggaggcat tccggggcgg ctggttccat tcgggcgacc     53400
     tcggcgtgaa gcacccggac ggctacctcc agctcaagga ccgctcgaag gacatcatca     53460
     tctcgggggg cgagaacatc tggtcgatcg aggtcgagga ggcgttgttc aagcacccgg     53520
     cggtcgcgga cgccggggtg gtcggcaagc cggacgagaa gtggggcgag gcggtctgcg     53580
     ccttcgttga gcggaagaac ggcttcgaga tggtctcggc cgaggagctg atcgactggt     53640
     gccgccagtc gctcgccagc tacaaggtgc ccaagcacgt cttcttcacc gagcttccga     53700
     agaactcgac cggcaagacc aacaaggtcc aacttcggga aatgggcaag gcactgtgag     53760
     ggcaagtggc cgtcggcaca actggagagg cgacggcccg agagggccgg ggatgaaccc     53820
     tgccgtttga cgagccgctc gcgccggctg acgctgttcg gtcgcaaggc gtcgggcgac     53880
     ctcttccggg accttaccag tcctgatgct caggcggttt gccggggcgt gtcgcaaacg     53940
     ttcaacgccc gaaaaaatcg tctccgaaca gggcgtgacg aggcctgctc accgcctgct     54000
     gaccccctcc gacgaggctg gcgaagcagt ttgacgagcc cggtatcggc ctgacggacc     54060
     ggtgtgcgcc tacgcgggga gcataatttt ctccgccaaa aatctttgcg acacgcccgg     54120
     atgaagcgcc agggcgccgc ctagcacggc agcagcacgc acaacctaaa gtcaccaacc     54180
     cgatttgcga gagcagatcc gggaacagga aacctatgtt caaatcaaac gacggaagac     54240
     ccggcggttt ggttggctcc cggccgccgg gtctgaagtg taggagtaaa tatgcaagga     54300
     aaatctctac acgagcgcgc tgcctctggc aagcgtgacg atgaagccgc ggccaagcgc     54360
     gcggaagagt acctgcggca acatttcccc ggcttcagcg gctgggctcc ctgtgacgac     54420
     ccgaccggcc acatcagcca cggcacgccc gagatgctgg ccgtgttcgc aatcgggtgc     54480
     ttggagggct tgatcgctca cgcggacatg gcaatccgct gcctgcagcg gcacgaccag     54540
     cccggcatgc gggcgcacat ccgcagccac atccgcgccg agcgcgagtt cgagcggact     54600
     ggcgtcgaga tcatcggcat gctgttcgag ccgaagatgc aggccaaagc cgcaatcgcc     54660
     ggggtggccg catgacggcg aacgtgcgcc ccatccgccg ccccgctccg cccgacaacg     54720
     atccggtgct caccgagagc agcatcgcgg ccctggtcgt ggagcgattt cgcgaccagc     54780
     tcctctacga ccacggccag gccttatggt tcgagtgggc cggcacctgc tgggtgccgg     54840
     acaccaccgg gggcgtcttc gaccgctgcc acaccgtggt gcaggagcag atgcgcctcc     54900
     tctcccccaa gaagcaggtg cggcttggca cggccaagtt cgtgtccggc gtcgagaagc     54960
     tgtgccgtca tgcccggacc ttcgtcgcgc agagcgagga ttgggacggc gacccgatgg     55020
     tgctcggcac gcccggcggc gtcgtggacc tcaccaccgg caagatgcgt cgggccgagc     55080
     cgggcgaccg gatcacgaag cagacggcgg tggcgccggc cgacacggcg gattgcccgc     55140
     gcttcctgcg cttcctcaac gaggcgaccg gctcagacct ggggctgatg cggttccttc     55200
     aacagtgggc cggatacagc ctcaccggcc gcaccaccga gcacgccgtc gtcttcgtgt     55260
     tcggcggcgg cggcaacggc aagtcggtct acctgaaggt gctcgcgacc gcgctggcgt     55320
     cctacgccgc gacggcgacc atggacgcgt tcgttgccag caagcacgcc cagcacacga     55380
     ccgacctcgc gatgctcaaa ggcgcccggt tcgtgtccgc gtccgagacg caggaaggcc     55440
     gagcgtggga tgaggcccgg ctgaagtcgt tcacgggcgg cgacgcgatc accgcgcgct     55500
     tcatgcatag ggacaacatg accttcgtgc cgacgtgcaa gatcacgatc gttgggaacc     55560
     acaagcccaa gatccgcacc gtggacgagg cgatgcggcg ccgcctcaac atcgtgccgt     55620
     tcatccgcaa gcccgccgag cccgatcccg atctggagcg caagctgctg gccgagttgc     55680
     ccggcatcct gcggtggccc atcgacggct gcctggactg gcaggagcac ggtctcatcc     55740
     ggcccgacgc cgtcctggcc gcgacggatg agtacttggc cgacgaggac ctgttcggtc     55800
     agtgggtcga ggaccggtgc aaggtggatc ccggcaatcg gcagatgcga acgccgaacc     55860
     aggacctcta cgcctcgtgg tgcgacttcg ccgaacgggt cggggcgcgg cacggcacgc     55920
     tgcacgagct gggcgagaag ctgagcaagc tcgggctcgc gcgctacaag tcgggcggcg     55980
     tccgcggctt cgaaggcatc tacgtgacga gcacgggcgc gtaggcccag aggccaggga     56040
     caccttggga cggcattggg acgcgggcct cggtctgcgt cctttttcgt tcgcgaaccg     56100
     ttcggcggcc tgccgatcga ttgggacacc tgccctggat ttgggacacg tcagggacgc     56160
     ctgctccgac cggtgtccca acctcctgcc ctaaaattga taggccatga aagggcttaa     56220
     gccacgtctt ggggcatttg ggacgcttgg gacaccgaaa tcgggtatct cagagatacc     56280
     gcgcacacac aggcgcacga tcagggattt gccgcttttg gtgtcccagg tgtcccagtg     56340
     tcccaacctc ccagccgctt cgcgtgagag aaccgtcgca ggctgccggg ggatcagtgc     56400
     ttcccgtggc caccgacacg acgttctgag gatggatcgc gggatgctgt gtctcccggt     56460
     agccctacga cggtgccgac gctctgatgc tcaaaggatg ccagacagtc gccagcgcaa     56520
     cggttcggtg aaggcgaggg gtcaggagag cagttctggc ggggctcggg gacggcacat     56580
     gagaggccgg atccttatgg atcaaagact tggcctgaat gacgcgaatc gaagtacggt     56640
     ggaatggtca gccgcacagc caaacctcga cggcgaccgt aacctgcccc tcgtaacgtg     56700
     acgcagcgtc atagattagc aggtcagctg ttctagccgt aaacctctct tgatggcttt     56760
     acagacgggt cggaataatg taagcctgat gcagcagttt agtggtttac agtcatggcg     56820
     acctacggct atcagcgggt gtcgagcgag ggccaggagg acggcacgtc gctcgacgag     56880
     cagggcaagc gcatccgcgg cctgtgcatg atgcagggcc tcgacgagcc ggtgttcttc     56940
     cgggacgtat gccagggcaa gatcccgctc ggggaccgcc caggcggttg ccgcctcctt     57000
     cacgcgctga agccgggcga caacctcgtc gtcttgaagc tcgaccgcat cttccgcaac     57060
     gcgaccgacg cactcacgca ggcggacgcc ttcaaggcca agggcgtgaa cctctatctc     57120
     atcgacatgg gcaccgagcc ggtgacgaac aacggcacga gccgcatgtt cttcggcatg     57180
     ctggctttga tggccgagtt cgagcgcgag cggatccggg agcgcacgca ggacggcaag     57240
     gcggccaagg cagccagggg cggctacatc ggggggtcga ggcccttcgg gtacgacgtc     57300
     gtcggcaccg gcaaggacgc cgtcctgagg ccccgtgaga gcgagcacga gtacgtccag     57360
     cagatcgtag cgcgacgcga ggccggcgaa tccctgcgca gcatcagcgc gtggctggcg     57420
     acccggggcg tgaaactctc gcatgtcggt gtcgccaacg tgcgagagcg cgatgcgaac     57480
     cccaattgaa tggtggcgag cgttgttgct atcttgaaaa tgaagtaaca agcataaaca     57540
     aaacaaagaa gaataatata gatccgccaa tcatgagtgg catggcaaaa tcttttcctt     57600
     ccggatcatg tctctctgtc tctgacatat tgaatcccct ctctttatgg tcggacctac     57660
     gtagcgcgcc ggcatgcggc cagccaagct gagccgaaga tcttaaagtg tgcctgaggg     57720
     tggcggcccg gctgaggccc gtctgcaaca cctcgtctcc gcttcgacgc gcacgttcca     57780
     gaccggctcg gtttgctgta gtctagatac cgggccccga aggtccgcgc cggtgcccgc     57840
     gtgatgcggg gtaccggtcc gctggtagat ccagcaccgg gacgttgcgc acgcctgcgc     57900
     atgacgccgt ggtccacatg gaccgcaccc tcaggccgct cagtggagcg c              57951
//

If you have problems or comments...

PBIL Back to PBIL home page