(data stored in ACNUC7421 zone)

EMBL: CP000947

ID   CP000947; SV 1; circular; genomic DNA; STD; PRO; 2263857 BP.
XX
AC   CP000947; AACJ01000000-AACJ01000084; AACJ01000086-AACJ01000109;
XX
PR   Project:PRJNA388;
XX
DT   27-FEB-2008 (Rel. 94, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 4)
XX
DE   Haemophilus somnus 2336, complete genome.
XX
KW   .
XX
OS   Histophilus somni 2336
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Pasteurellales;
OC   Pasteurellaceae; Histophilus.
XX
RN   [1]
RP   1-2263857
RG   US DOE Joint Genome Institute
RA   Siddaramappa S., Duncan A.J., Challacombe J.F., Rainey D., Gillaspy A.F.,
RA   Carson M., Gipson J., Gipson M., Bruce D., Detter J.C., Han C.S., Land M.,
RA   Tapia R., Thompson L.S., Orvis J., Zaitshik J., Barnes G., Brettin T.S.,
RA   Dyer D.W., Inzana T.J.;
RT   "Complete sequence of Haemophilus somnus 2336";
RL   Unpublished.
XX
RN   [2]
RP   1-2263857
RG   US DOE Joint Genome Institute
RA   Siddaramappa S., Duncan A.J., Challacombe J.F., Rainey D., Gillaspy A.F.,
RA   Carson M., Gipson J., Gipson M., Bruce D., Detter J.C., Han C.S., Land M.,
RA   Tapia R., Thompson L.S., Orvis J., Zaitshik J., Barnes G., Brettin T.S.,
RA   Dyer D.W., Inzana T.J., Goodwin L., Pitluck S., Richardson P.;
RT   ;
RL   Submitted (14-FEB-2008) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   34598-1698, USA
XX
DR   MD5; 258f2aa4663d52e1df12a39915256ba5.
DR   BioSample; SAMN02598524.
DR   EnsemblGenomes-Gn; EBG00001091046.
DR   EnsemblGenomes-Gn; EBG00001091047.
DR   EnsemblGenomes-Gn; EBG00001091048.
DR   EnsemblGenomes-Gn; EBG00001091049.
DR   EnsemblGenomes-Gn; EBG00001091050.
DR   EnsemblGenomes-Gn; EBG00001091051.
DR   EnsemblGenomes-Gn; EBG00001091052.
DR   EnsemblGenomes-Gn; EBG00001091053.
DR   EnsemblGenomes-Gn; EBG00001091054.
DR   EnsemblGenomes-Gn; EBG00001091055.
DR   EnsemblGenomes-Gn; EBG00001091056.
DR   EnsemblGenomes-Gn; EBG00001091057.
DR   EnsemblGenomes-Gn; EBG00001091058.
DR   EnsemblGenomes-Gn; EBG00001091059.
DR   EnsemblGenomes-Gn; EBG00001091060.
DR   EnsemblGenomes-Gn; EBG00001091061.
DR   EnsemblGenomes-Gn; EBG00001091062.
DR   EnsemblGenomes-Gn; EBG00001091063.
DR   EnsemblGenomes-Gn; EBG00001091064.
DR   EnsemblGenomes-Gn; EBG00001091065.
DR   EnsemblGenomes-Gn; EBG00001091066.
DR   EnsemblGenomes-Gn; EBG00001091067.
DR   EnsemblGenomes-Gn; EBG00001091068.
DR   EnsemblGenomes-Gn; EBG00001091069.
DR   EnsemblGenomes-Gn; EBG00001091070.
DR   EnsemblGenomes-Gn; EBG00001091071.
DR   EnsemblGenomes-Gn; EBG00001091072.
DR   EnsemblGenomes-Gn; EBG00001091073.
DR   EnsemblGenomes-Gn; EBG00001091074.
DR   EnsemblGenomes-Gn; EBG00001091075.
DR   EnsemblGenomes-Gn; EBG00001091076.
DR   EnsemblGenomes-Gn; EBG00001091077.
DR   EnsemblGenomes-Gn; EBG00001091078.
DR   EnsemblGenomes-Gn; EBG00001091079.
DR   EnsemblGenomes-Gn; EBG00001091080.
DR   EnsemblGenomes-Gn; EBG00001091081.
DR   EnsemblGenomes-Gn; EBG00001091082.
DR   EnsemblGenomes-Gn; EBG00001091083.
DR   EnsemblGenomes-Gn; EBG00001091085.
DR   EnsemblGenomes-Gn; EBG00001091087.
DR   EnsemblGenomes-Gn; EBG00001091088.
DR   EnsemblGenomes-Gn; EBG00001091089.
DR   EnsemblGenomes-Gn; EBG00001091090.
DR   EnsemblGenomes-Gn; EBG00001091091.
DR   EnsemblGenomes-Gn; EBG00001091092.
DR   EnsemblGenomes-Gn; EBG00001091093.
DR   EnsemblGenomes-Gn; EBG00001091094.
DR   EnsemblGenomes-Gn; EBG00001091095.
DR   EnsemblGenomes-Gn; EBG00001091096.
DR   EnsemblGenomes-Gn; EBG00001091097.
DR   EnsemblGenomes-Gn; EBG00001091098.
DR   EnsemblGenomes-Gn; EBG00001091099.
DR   EnsemblGenomes-Gn; EBG00001091100.
DR   EnsemblGenomes-Gn; EBG00001091101.
DR   EnsemblGenomes-Gn; EBG00001091102.
DR   EnsemblGenomes-Gn; EBG00001091103.
DR   EnsemblGenomes-Gn; EBG00001091104.
DR   EnsemblGenomes-Gn; EBG00001091105.
DR   EnsemblGenomes-Gn; EBG00001091107.
DR   EnsemblGenomes-Gn; EBG00001091108.
DR   EnsemblGenomes-Gn; EBG00001091109.
DR   EnsemblGenomes-Gn; EBG00001091110.
DR   EnsemblGenomes-Gn; EBG00001091111.
DR   EnsemblGenomes-Gn; EBG00001091112.
DR   EnsemblGenomes-Gn; EBG00001091113.
DR   EnsemblGenomes-Gn; EBG00001091114.
DR   EnsemblGenomes-Gn; EBG00001091115.
DR   EnsemblGenomes-Gn; EBG00001091116.
DR   EnsemblGenomes-Gn; EBG00001091119.
DR   EnsemblGenomes-Gn; EBG00001091120.
DR   EnsemblGenomes-Gn; EBG00001091121.
DR   EnsemblGenomes-Gn; EBG00001091122.
DR   EnsemblGenomes-Gn; EBG00001091123.
DR   EnsemblGenomes-Gn; EBG00001091124.
DR   EnsemblGenomes-Gn; EBG00001091125.
DR   EnsemblGenomes-Gn; EBG00001091126.
DR   EnsemblGenomes-Gn; EBG00001091127.
DR   EnsemblGenomes-Gn; EBG00001091128.
DR   EnsemblGenomes-Gn; EBG00001091129.
DR   EnsemblGenomes-Gn; EBG00001091130.
DR   EnsemblGenomes-Gn; EBG00001091131.
DR   EnsemblGenomes-Gn; EBG00001091132.
DR   EnsemblGenomes-Gn; EBG00001091133.
DR   EnsemblGenomes-Gn; EBG00001091134.
DR   EnsemblGenomes-Gn; EBG00001091135.
DR   EnsemblGenomes-Gn; EBG00001091136.
DR   EnsemblGenomes-Gn; EBG00001091137.
DR   EnsemblGenomes-Gn; EBG00001091138.
DR   EnsemblGenomes-Gn; EBG00001091139.
DR   EnsemblGenomes-Gn; EBG00001091140.
DR   EnsemblGenomes-Gn; EBG00001091141.
DR   EnsemblGenomes-Gn; EBG00001091142.
DR   EnsemblGenomes-Gn; HSM_R0001.
DR   EnsemblGenomes-Gn; HSM_R0002.
DR   EnsemblGenomes-Gn; HSM_R0003.
DR   EnsemblGenomes-Gn; HSM_R0004.
DR   EnsemblGenomes-Gn; HSM_R0005.
DR   EnsemblGenomes-Gn; HSM_R0006.
DR   EnsemblGenomes-Gn; HSM_R0007.
DR   EnsemblGenomes-Gn; HSM_R0008.
DR   EnsemblGenomes-Gn; HSM_R0009.
DR   EnsemblGenomes-Gn; HSM_R0010.
DR   EnsemblGenomes-Gn; HSM_R0011.
DR   EnsemblGenomes-Gn; HSM_R0012.
DR   EnsemblGenomes-Gn; HSM_R0013.
DR   EnsemblGenomes-Gn; HSM_R0014.
DR   EnsemblGenomes-Gn; HSM_R0015.
DR   EnsemblGenomes-Gn; HSM_R0016.
DR   EnsemblGenomes-Gn; HSM_R0017.
DR   EnsemblGenomes-Gn; HSM_R0018.
DR   EnsemblGenomes-Gn; HSM_R0019.
DR   EnsemblGenomes-Gn; HSM_R0020.
DR   EnsemblGenomes-Gn; HSM_R0021.
DR   EnsemblGenomes-Gn; HSM_R0022.
DR   EnsemblGenomes-Gn; HSM_R0023.
DR   EnsemblGenomes-Gn; HSM_R0024.
DR   EnsemblGenomes-Gn; HSM_R0025.
DR   EnsemblGenomes-Gn; HSM_R0026.
DR   EnsemblGenomes-Gn; HSM_R0027.
DR   EnsemblGenomes-Gn; HSM_R0028.
DR   EnsemblGenomes-Gn; HSM_R0029.
DR   EnsemblGenomes-Gn; HSM_R0030.
DR   EnsemblGenomes-Gn; HSM_R0031.
DR   EnsemblGenomes-Gn; HSM_R0032.
DR   EnsemblGenomes-Gn; HSM_R0033.
DR   EnsemblGenomes-Gn; HSM_R0034.
DR   EnsemblGenomes-Gn; HSM_R0035.
DR   EnsemblGenomes-Gn; HSM_R0036.
DR   EnsemblGenomes-Gn; HSM_R0037.
DR   EnsemblGenomes-Gn; HSM_R0038.
DR   EnsemblGenomes-Gn; HSM_R0039.
DR   EnsemblGenomes-Gn; HSM_R0040.
DR   EnsemblGenomes-Gn; HSM_R0041.
DR   EnsemblGenomes-Gn; HSM_R0042.
DR   EnsemblGenomes-Gn; HSM_R0043.
DR   EnsemblGenomes-Gn; HSM_R0044.
DR   EnsemblGenomes-Gn; HSM_R0045.
DR   EnsemblGenomes-Gn; HSM_R0046.
DR   EnsemblGenomes-Gn; HSM_R0047.
DR   EnsemblGenomes-Gn; HSM_R0048.
DR   EnsemblGenomes-Gn; HSM_R0049.
DR   EnsemblGenomes-Gn; HSM_R0050.
DR   EnsemblGenomes-Gn; HSM_R0051.
DR   EnsemblGenomes-Gn; HSM_R0052.
DR   EnsemblGenomes-Gn; HSM_R0053.
DR   EnsemblGenomes-Gn; HSM_R0054.
DR   EnsemblGenomes-Gn; HSM_R0055.
DR   EnsemblGenomes-Gn; HSM_R0056.
DR   EnsemblGenomes-Gn; HSM_R0057.
DR   EnsemblGenomes-Gn; HSM_R0058.
DR   EnsemblGenomes-Gn; HSM_R0059.
DR   EnsemblGenomes-Gn; HSM_R0060.
DR   EnsemblGenomes-Gn; HSM_R0061.
DR   EnsemblGenomes-Gn; HSM_R0062.
DR   EnsemblGenomes-Gn; HSM_R0063.
DR   EnsemblGenomes-Gn; HSM_R0064.
DR   EnsemblGenomes-Gn; HSM_R0065.
DR   EnsemblGenomes-Tr; EBT00001545722.
DR   EnsemblGenomes-Tr; EBT00001545723.
DR   EnsemblGenomes-Tr; EBT00001545724.
DR   EnsemblGenomes-Tr; EBT00001545725.
DR   EnsemblGenomes-Tr; EBT00001545726.
DR   EnsemblGenomes-Tr; EBT00001545727.
DR   EnsemblGenomes-Tr; EBT00001545728.
DR   EnsemblGenomes-Tr; EBT00001545729.
DR   EnsemblGenomes-Tr; EBT00001545730.
DR   EnsemblGenomes-Tr; EBT00001545731.
DR   EnsemblGenomes-Tr; EBT00001545732.
DR   EnsemblGenomes-Tr; EBT00001545733.
DR   EnsemblGenomes-Tr; EBT00001545734.
DR   EnsemblGenomes-Tr; EBT00001545735.
DR   EnsemblGenomes-Tr; EBT00001545736.
DR   EnsemblGenomes-Tr; EBT00001545737.
DR   EnsemblGenomes-Tr; EBT00001545738.
DR   EnsemblGenomes-Tr; EBT00001545740.
DR   EnsemblGenomes-Tr; EBT00001545741.
DR   EnsemblGenomes-Tr; EBT00001545742.
DR   EnsemblGenomes-Tr; EBT00001545743.
DR   EnsemblGenomes-Tr; EBT00001545744.
DR   EnsemblGenomes-Tr; EBT00001545745.
DR   EnsemblGenomes-Tr; EBT00001545746.
DR   EnsemblGenomes-Tr; EBT00001545747.
DR   EnsemblGenomes-Tr; EBT00001545748.
DR   EnsemblGenomes-Tr; EBT00001545749.
DR   EnsemblGenomes-Tr; EBT00001545750.
DR   EnsemblGenomes-Tr; EBT00001545751.
DR   EnsemblGenomes-Tr; EBT00001545752.
DR   EnsemblGenomes-Tr; EBT00001545753.
DR   EnsemblGenomes-Tr; EBT00001545754.
DR   EnsemblGenomes-Tr; EBT00001545755.
DR   EnsemblGenomes-Tr; EBT00001545756.
DR   EnsemblGenomes-Tr; EBT00001545757.
DR   EnsemblGenomes-Tr; EBT00001545758.
DR   EnsemblGenomes-Tr; EBT00001545759.
DR   EnsemblGenomes-Tr; EBT00001545760.
DR   EnsemblGenomes-Tr; EBT00001545761.
DR   EnsemblGenomes-Tr; EBT00001545763.
DR   EnsemblGenomes-Tr; EBT00001545764.
DR   EnsemblGenomes-Tr; EBT00001545765.
DR   EnsemblGenomes-Tr; EBT00001545766.
DR   EnsemblGenomes-Tr; EBT00001545767.
DR   EnsemblGenomes-Tr; EBT00001545768.
DR   EnsemblGenomes-Tr; EBT00001545769.
DR   EnsemblGenomes-Tr; EBT00001545770.
DR   EnsemblGenomes-Tr; EBT00001545771.
DR   EnsemblGenomes-Tr; EBT00001545772.
DR   EnsemblGenomes-Tr; EBT00001545773.
DR   EnsemblGenomes-Tr; EBT00001545774.
DR   EnsemblGenomes-Tr; EBT00001545775.
DR   EnsemblGenomes-Tr; EBT00001545776.
DR   EnsemblGenomes-Tr; EBT00001545777.
DR   EnsemblGenomes-Tr; EBT00001545778.
DR   EnsemblGenomes-Tr; EBT00001545779.
DR   EnsemblGenomes-Tr; EBT00001545781.
DR   EnsemblGenomes-Tr; EBT00001545782.
DR   EnsemblGenomes-Tr; EBT00001545783.
DR   EnsemblGenomes-Tr; EBT00001545784.
DR   EnsemblGenomes-Tr; EBT00001545785.
DR   EnsemblGenomes-Tr; EBT00001545786.
DR   EnsemblGenomes-Tr; EBT00001545787.
DR   EnsemblGenomes-Tr; EBT00001545789.
DR   EnsemblGenomes-Tr; EBT00001545791.
DR   EnsemblGenomes-Tr; EBT00001545792.
DR   EnsemblGenomes-Tr; EBT00001545793.
DR   EnsemblGenomes-Tr; EBT00001545794.
DR   EnsemblGenomes-Tr; EBT00001545795.
DR   EnsemblGenomes-Tr; EBT00001545796.
DR   EnsemblGenomes-Tr; EBT00001545797.
DR   EnsemblGenomes-Tr; EBT00001545798.
DR   EnsemblGenomes-Tr; EBT00001545799.
DR   EnsemblGenomes-Tr; EBT00001545800.
DR   EnsemblGenomes-Tr; EBT00001545801.
DR   EnsemblGenomes-Tr; EBT00001545802.
DR   EnsemblGenomes-Tr; EBT00001545803.
DR   EnsemblGenomes-Tr; EBT00001545804.
DR   EnsemblGenomes-Tr; EBT00001545805.
DR   EnsemblGenomes-Tr; EBT00001545806.
DR   EnsemblGenomes-Tr; EBT00001545807.
DR   EnsemblGenomes-Tr; EBT00001545808.
DR   EnsemblGenomes-Tr; EBT00001545809.
DR   EnsemblGenomes-Tr; EBT00001545810.
DR   EnsemblGenomes-Tr; EBT00001545811.
DR   EnsemblGenomes-Tr; EBT00001545812.
DR   EnsemblGenomes-Tr; EBT00001545813.
DR   EnsemblGenomes-Tr; EBT00001545814.
DR   EnsemblGenomes-Tr; EBT00001545815.
DR   EnsemblGenomes-Tr; EBT00001545816.
DR   EnsemblGenomes-Tr; EBT00001545817.
DR   EnsemblGenomes-Tr; EBT00001545818.
DR   EnsemblGenomes-Tr; HSM_R0001-1.
DR   EnsemblGenomes-Tr; HSM_R0002-1.
DR   EnsemblGenomes-Tr; HSM_R0003-1.
DR   EnsemblGenomes-Tr; HSM_R0004-1.
DR   EnsemblGenomes-Tr; HSM_R0005-1.
DR   EnsemblGenomes-Tr; HSM_R0006-1.
DR   EnsemblGenomes-Tr; HSM_R0007-1.
DR   EnsemblGenomes-Tr; HSM_R0008-1.
DR   EnsemblGenomes-Tr; HSM_R0009-1.
DR   EnsemblGenomes-Tr; HSM_R0010-1.
DR   EnsemblGenomes-Tr; HSM_R0011-1.
DR   EnsemblGenomes-Tr; HSM_R0012-1.
DR   EnsemblGenomes-Tr; HSM_R0013-1.
DR   EnsemblGenomes-Tr; HSM_R0014-1.
DR   EnsemblGenomes-Tr; HSM_R0015-1.
DR   EnsemblGenomes-Tr; HSM_R0016-1.
DR   EnsemblGenomes-Tr; HSM_R0017-1.
DR   EnsemblGenomes-Tr; HSM_R0018-1.
DR   EnsemblGenomes-Tr; HSM_R0019-1.
DR   EnsemblGenomes-Tr; HSM_R0020-1.
DR   EnsemblGenomes-Tr; HSM_R0021-1.
DR   EnsemblGenomes-Tr; HSM_R0022-1.
DR   EnsemblGenomes-Tr; HSM_R0023-1.
DR   EnsemblGenomes-Tr; HSM_R0024-1.
DR   EnsemblGenomes-Tr; HSM_R0025-1.
DR   EnsemblGenomes-Tr; HSM_R0026-1.
DR   EnsemblGenomes-Tr; HSM_R0027-1.
DR   EnsemblGenomes-Tr; HSM_R0028-1.
DR   EnsemblGenomes-Tr; HSM_R0029-1.
DR   EnsemblGenomes-Tr; HSM_R0030-1.
DR   EnsemblGenomes-Tr; HSM_R0031-1.
DR   EnsemblGenomes-Tr; HSM_R0032-1.
DR   EnsemblGenomes-Tr; HSM_R0033-1.
DR   EnsemblGenomes-Tr; HSM_R0034-1.
DR   EnsemblGenomes-Tr; HSM_R0035-1.
DR   EnsemblGenomes-Tr; HSM_R0036-1.
DR   EnsemblGenomes-Tr; HSM_R0037-1.
DR   EnsemblGenomes-Tr; HSM_R0038-1.
DR   EnsemblGenomes-Tr; HSM_R0039-1.
DR   EnsemblGenomes-Tr; HSM_R0040-1.
DR   EnsemblGenomes-Tr; HSM_R0041-1.
DR   EnsemblGenomes-Tr; HSM_R0042-1.
DR   EnsemblGenomes-Tr; HSM_R0043-1.
DR   EnsemblGenomes-Tr; HSM_R0044-1.
DR   EnsemblGenomes-Tr; HSM_R0045-1.
DR   EnsemblGenomes-Tr; HSM_R0046-1.
DR   EnsemblGenomes-Tr; HSM_R0047-1.
DR   EnsemblGenomes-Tr; HSM_R0048-1.
DR   EnsemblGenomes-Tr; HSM_R0049-1.
DR   EnsemblGenomes-Tr; HSM_R0050-1.
DR   EnsemblGenomes-Tr; HSM_R0051-1.
DR   EnsemblGenomes-Tr; HSM_R0052-1.
DR   EnsemblGenomes-Tr; HSM_R0053-1.
DR   EnsemblGenomes-Tr; HSM_R0054-1.
DR   EnsemblGenomes-Tr; HSM_R0055-1.
DR   EnsemblGenomes-Tr; HSM_R0056-1.
DR   EnsemblGenomes-Tr; HSM_R0057-1.
DR   EnsemblGenomes-Tr; HSM_R0058-1.
DR   EnsemblGenomes-Tr; HSM_R0059-1.
DR   EnsemblGenomes-Tr; HSM_R0060-1.
DR   EnsemblGenomes-Tr; HSM_R0061-1.
DR   EnsemblGenomes-Tr; HSM_R0062-1.
DR   EnsemblGenomes-Tr; HSM_R0063-1.
DR   EnsemblGenomes-Tr; HSM_R0064-1.
DR   EnsemblGenomes-Tr; HSM_R0065-1.
DR   EuropePMC; PMC2863524; 20176790.
DR   EuropePMC; PMC2903611; 20644718.
DR   EuropePMC; PMC3096633; 21611187.
DR   EuropePMC; PMC3262788; 22276113.
DR   EuropePMC; PMC3339403; 22111657.
DR   EuropePMC; PMC4445511; 26130851.
DR   EuropePMC; PMC5414144; 28464950.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00022; GcvB.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00506; Thr_leader.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02012; group-II-D1D4-7.
DR   RFAM; RF02221; sRNA-Xcc1.
DR   SILVA-LSU; CP000947.
DR   SILVA-SSU; CP000947.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4042873
CC   Source DNA and bacteria available from Tom Inzana (tinzana@vt.edu)
CC   Contacts: Tom Inzana (tinzana@vt.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-LANL
CC   Draft sequencing was performed at the Oklahoma University Health
CC   Sciences Center (OUHSC)
CC   http://microgen.ouhsc.edu/h_somnus/h_somnus_home.htm) and initial
CC   gap closure was done at Virginia Tech. The finishing was achieved
CC   at the Joint Genome Institute's Los Alamos National Laboratory
CC   (LANL). During final finishing at LANL, reads were assembled with
CC   parallel phrap (High Performance Software, LLC). Possible
CC   mis-assemblies were corrected with Dupfinisher (unpublished, C.
CC   Han) or transposon bomb of bridging clones (EZ-Tn5 
CC   Tnp Transposome kit, Epicentre Biotechnologies). Gaps between
CC   contigs were closed by editing, custom primer walking, or PCR
CC   amplification. The completed genome sequence of H. somnus strain
CC   2336 contains 26472 reads, achieving an average of 9.7-fold
CC   sequence coverage per base with an error rate less than 1 in
CC   100,000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2263857
FT                   /organism="Histophilus somni 2336"
FT                   /strain="2336"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:228400"
FT   gene            279..1646
FT                   /locus_tag="HSM_0001"
FT   CDS_pept        279..1646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA domain;
FT                   Chromosomal replication initiator DnaA; SMART: AAA ATPase;
FT                   KEGG: hso:HS_0136 chromosomal replication initiator
FT                   protein, DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30707"
FT                   /db_xref="GOA:B0UUL8"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:B0UUL8"
FT                   /protein_id="ACA30707.1"
FT                   /translation="MDKMSSTVSTLWRDCLSQLQDQVSSNDFTTWLRPLQDDVSESNMI
FT                   LYAPNCFIKGWVENHYLTQITKLAQQLLNNDQFMVKIQDGIKPTEKTTTNVEQKTQNEN
FT                   CHNEITSQQNYRSYLNKNHVFDNFVEGKSNQLARAVAQKVAKNPGEQSANPLFLYGGTG
FT                   LGKTHLLHAVGNGILANNPHAQVVYMHAERFMQSYVKALKSDRMDSFKRFYRTVDALLI
FT                   DDIQFFAGKDGTQEEFFHIFNSLFERGRQIILTSDRYPKEIEKIEDRLKSRFGWGISVA
FT                   IEPPELETRVAILLKKAEEKNMVLPEEVAMFIGGKLRTNVRELEGALNRVHAHAEFTGK
FT                   AITIDFVRETLKDMLALQDKLVTIENIQKIVADYYRIKISDLKSKRRSRNITRPRQLAM
FT                   ALAKELTNRSLPEIGRNFGDRDHTTVLHACKAIAKLREEDNGIQEDWSNLIRTLSV"
FT   gene            1658..2758
FT                   /locus_tag="HSM_0002"
FT   CDS_pept        1658..2758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain; KEGG: hso:HS_0137 DNA-directed
FT                   DNA polymerase, beta subunit (DNA polymerase III, beta
FT                   subunit)"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31798"
FT                   /db_xref="GOA:B0UUL9"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:B0UUL9"
FT                   /protein_id="ACA31798.1"
FT                   /translation="MQFIVSREHLLKPLQQVCGVLSSRPNFPILNNVLLQIEGNVLRIT
FT                   GTDLEVELSTQAQLIQASQDGSYTIPAKKFLDICRSFPDEAEITVIFEEERALVRSGRS
FT                   KFNLTALPADEYPNLADWQSEVDFYLPQSTLRRLIEATQFSMANQDARYFLNGMKFETE
FT                   GNLLRTVATDGHRLAVCTIPLEQDLHTHAVILPRKGILELMRLLENSEHAAHVQIGTNN
FT                   LRIDLGSIIFTSKLIDGRFPDYRRVLPRNATHIMEGNWELLKQAFARMAILSSDKVKTV
FT                   RLQLTSNQLKITATNPEQEVAEEILDVIYNGADMEVGFNVSYILDVLNALKCQQVRLCF
FT                   TDASSSCLLEDADDESAEYVVMPMRL"
FT   gene            2762..3838
FT                   /locus_tag="HSM_0003"
FT   CDS_pept        2762..3838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: hso:HS_0138 DNA replication
FT                   and repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31931"
FT                   /db_xref="GOA:B0UUM0"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UUM0"
FT                   /protein_id="ACA31931.1"
FT                   /translation="MAISRLIINHFRNLTAIDLEFERGFNFIIGNNGSGKTSLLEAIFY
FT                   LGHGRSFKSAVANRIISYQQPHFILHGKIQEQQHQWSVGLQKQRQGNTLMKINGEDAKK
FT                   ISDLAHLLPMQLITPEGLTLLNGGPSYRRAYLDWGLFHHNASFYNAWSSLNRLLKQRNS
FT                   ALQQVCSYEKLKIWDRELTKLAYQVSYWREAYAEALRSEIEKTCQLFLPELEISVSFHQ
FT                   GWDKNMDYADLLQQNFERDRALGYTFSGPQKADFRFKANGLPVEDILSRGQLKLLMCAL
FT                   RLAQGEHLMQQKKRHCIFLLDDFASELDQYKRTLLAERLQKNGSQVFVTAITREQLQQI
FT                   QPEKHRTFYLENGRIKDL"
FT   gene            complement(3895..4539)
FT                   /locus_tag="HSM_0004"
FT   CDS_pept        complement(3895..4539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0004"
FT                   /product="putative transcriptional regulator, Crp/Fnr
FT                   family"
FT                   /note="PFAM: cyclic nucleotide-binding; regulatory protein
FT                   Crp; KEGG: hso:HS_0139 catabolite gene activator (cAMP
FT                   receptor protein)"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32040"
FT                   /db_xref="GOA:B0UUM1"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018335"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0UUM1"
FT                   /protein_id="ACA32040.1"
FT                   /translation="MLEQQGQSAPSMDPTLEWFLSHCHIHKYSAKSSLIHAGEKAETLY
FT                   YLIRGSVAVMVKDEEGKEMILTYLSQGDFFGEAGLFDETQPRSAWVKAKSSCEIAEISY
FT                   KKFRQLIQVNPEILMYLAGQLAHRLQNTSKQVSNLAFLDVTGRIAQTLLNLAKMPDAMT
FT                   HPDGMQIKITRQEIGQMVGCSRETVGRILKMLEDQHLISAHGKTIVVYGTR"
FT   gene            complement(4552..4776)
FT                   /locus_tag="HSM_0005"
FT   CDS_pept        complement(4552..4776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0005"
FT                   /product="protein of unknown function UPF0270"
FT                   /note="PFAM: protein of unknown function UPF0270; KEGG:
FT                   hso:HS_0140 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32146"
FT                   /db_xref="InterPro:IPR010648"
FT                   /db_xref="InterPro:IPR036685"
FT                   /db_xref="UniProtKB/TrEMBL:B0UUM2"
FT                   /protein_id="ACA32146.1"
FT                   /translation="MLIPWEKLEEQTLLNIVDSFILREGTDYGSTELSLAEKRENLFKN
FT                   IRQGKAILVWSELHQSIDIKNKMDFLNGK"
FT   gene            complement(4811..5470)
FT                   /locus_tag="HSM_0006"
FT   CDS_pept        complement(4811..5470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0006"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: hso:HS_0141
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32253"
FT                   /db_xref="GOA:B0UUM3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023769"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B0UUM3"
FT                   /protein_id="ACA32253.1"
FT                   /translation="MEQQQLDIGDAEIVVASKQKTQKIEKRTVKERRQQVLTVLTHMLH
FT                   SERGMERMTTARLAQEVGVSEAALYRYFPSKTKMFEALLDNIENTLFSRINHSIKNETN
FT                   TMNRVRDILQTILDFARKNPGLTRILTGHALMFEDSQLQARVARFFDRLELQFVNILQM
FT                   RKLREGKSFHLDEKIIASHLVTLCEGQFMRYVRNNFRHLPNQGFEQQWKLLESLFA"
FT   gene            complement(5470..5925)
FT                   /locus_tag="HSM_0007"
FT   CDS_pept        complement(5470..5925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0007"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase
FT                   Dut"
FT                   /EC_number="3.6.1.23"
FT                   /note="TIGRFAM: deoxyuridine 5'-triphosphate
FT                   nucleotidohydrolase Dut; PFAM: deoxyUTP pyrophosphatase;
FT                   KEGG: hso:HS_0142 dUTP diphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32362"
FT                   /db_xref="GOA:B0UUW5"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UUW5"
FT                   /protein_id="ACA32362.1"
FT                   /translation="MKKIDVKILDPRIGTEFPLPTYATIGSAGLDLRALVDEGFEVQPG
FT                   ETKLISTGLSIYIADPNLAAVILPRSGLGHKNGIVLGNLVGLIDSDYQGPLMVSLWNRS
FT                   DKPFKIEIGDRIAQLVFVPVVQAEFNIVEEFQQTDRGNGGFGHSGKK"
FT   gene            complement(5922..7148)
FT                   /locus_tag="HSM_0008"
FT   CDS_pept        complement(5922..7148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0008"
FT                   /product="phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase"
FT                   /EC_number="4.1.1.36"
FT                   /EC_number="6.3.2.5"
FT                   /note="TIGRFAM: phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase; PFAM:
FT                   flavoprotein; DNA/pantothenate metabolism flavoprotein
FT                   domain protein; KEGG: hso:HS_0143 coenzyme A biosynthesis
FT                   phosphopantothenoylcysteine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32471"
FT                   /db_xref="GOA:B0UUW6"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:B0UUW6"
FT                   /protein_id="ACA32471.1"
FT                   /translation="MQNLIRGKRIVIGITGGIAAYKTIELIRLLRKAQAEVRVVLTNAA
FT                   TEFVTPLTLQAISGNAVSQSLLDHEAELAMGHIELAKWADLIVIAPASADFIARMAVGM
FT                   ANDLLSTICLATNSPIFLAPAMNQQMYAQTVTQQNLAQLMARGVQFIGPNSGEQACGDV
FT                   GIGKMSEPFEIFTALCQSFLHTQDLLDVSVVITAGPTREAIDPVRYISNHSSGKMGFAI
FT                   AEAFAQRGAKVTLISGPVNLATPHNVQRINVVSAQEMYQHAIQSAEQNQIFIGCAAVAD
FT                   YRVEQIAEQKIKKIPGNDEMVLKLVKNPDILATVANLMENRPFVVGFAAETQNVEQYAK
FT                   DKLQRKNLDMICANDVSGGQVFNSEQNALQLFWQNGQERLTLKHKSDLAKQLVDKIIVR
FT                   YKWKLEESK"
FT   gene            7321..7989
FT                   /locus_tag="HSM_0009"
FT   CDS_pept        7321..7989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0009"
FT                   /product="DNA repair protein RadC"
FT                   /note="PFAM: DNA repair protein RadC; KEGG: hso:HS_0144 DNA
FT                   repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32578"
FT                   /db_xref="GOA:B0UUW7"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UUW7"
FT                   /protein_id="ACA32578.1"
FT                   /translation="MTQQNTTLMPREKLLKYGASSLDDKELLAIFLRTGIKNCPVMQLS
FT                   ELVLAHFSSLRGLINADQKHFCQMKGLGITQFVQLQACTEMTKRYLLQELQFAQEFTSP
FT                   DTVRMYLQTELENKDREIFMVLFLDNQHRLIKKEEMFLGTINQANVYPREIIKTALFCN
FT                   AAALILAHNHPSGVSTPSMADRKMTENIKQLSELMEIRVLDHFIIGKGNYFSFAEQGWI
FT                   "
FT   gene            8210..8446
FT                   /locus_tag="HSM_0010"
FT   CDS_pept        8210..8446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0010"
FT                   /product="ribosomal protein L28"
FT                   /note="PFAM: ribosomal protein L28; KEGG: hso:HS_0145 50S
FT                   ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30708"
FT                   /db_xref="GOA:B0UUW8"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UUW8"
FT                   /protein_id="ACA30708.1"
FT                   /translation="MSRVCQVTGKRPAVGNNRSHAMNATRRRFLPNLHTHRFWVESEKR
FT                   FVTLRLTAKGMRIIDKKGIDAVLAEIRARGEKI"
FT   gene            8458..8628
FT                   /locus_tag="HSM_0011"
FT   CDS_pept        8458..8628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0011"
FT                   /product="ribosomal protein L33"
FT                   /note="PFAM: ribosomal protein L33; KEGG: hso:HS_0145a 50S
FT                   ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30817"
FT                   /db_xref="GOA:B0UUW9"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UUW9"
FT                   /protein_id="ACA30817.1"
FT                   /translation="MAAKGAREKIRLVSTAETGHFYTTTKNKRNMPEKMEIKKFDPVVR
FT                   KHVIYKEAKIK"
FT   gene            8734..9546
FT                   /locus_tag="HSM_0012"
FT   CDS_pept        8734..9546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0012"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /note="TIGRFAM: formamidopyrimidine-DNA glycosylase; PFAM:
FT                   Formamidopyrimidine-DNA glycolase; zinc finger Fpg domain
FT                   protein; KEGG: hso:HS_0146 DNA-formamidopyrimidine
FT                   glycosylase (formamidopyrimidine-DNA glycosylase)"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30922"
FT                   /db_xref="GOA:B0UUX0"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UUX0"
FT                   /protein_id="ACA30922.1"
FT                   /translation="MPELPEVETTLKGVSPYLKGFIIEKIVVRNPKLRWEVSKELSTFK
FT                   HVKILNLTRRAKYLIIHTEQGYIIGHLGMSGSVRIVPHDNPVNKHDHFDIVMNNGKLLR
FT                   YNDARRFGAWLWTNNLSEFHLFFKLGPEPLSETFNSTYLFKKSRQKSTALKTFLMDNSV
FT                   VVGVGNIYANEILFLCGLHPQKIAKTLTKKQTEQLVFTIKQVLNEAIEQGGTTLKDFLQ
FT                   PDGRPGYFAQKLLVYGNKDKPCPRCGTKIKSIIIGQRNSFFCPQCQKK"
FT   gene            9638..11314
FT                   /locus_tag="HSM_0013"
FT   CDS_pept        9638..11314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0013"
FT                   /product="acetolactate synthase, large subunit,
FT                   biosynthetic type"
FT                   /note="TIGRFAM: acetolactate synthase, large subunit,
FT                   biosynthetic type; PFAM: thiamine pyrophosphate protein
FT                   domain protein TPP-binding; thiamine pyrophosphate protein
FT                   central region; thiamine pyrophosphate protein TPP binding
FT                   domain protein; KEGG: hso:HS_0147 acetohydroxy acid
FT                   synthase II, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31031"
FT                   /db_xref="GOA:B0UUX1"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:B0UUX1"
FT                   /protein_id="ACA31031.1"
FT                   /translation="MNGANLVVECLKAHGVTSLFGYPGGAIMPVYDAIYDSGLDHLLCR
FT                   NEQGAAMAAIGYARSTNKVGVCVATSGPGATNLITGLGDALMDSIPIIAITGQVASNFI
FT                   GTDAFQEADILGLSLACTKHSFIVQHIDELPEIIAKAFQIAQSGRPGPVLIDLPKDVQF
FT                   APTSLKPIVYPKIADSLQNLVALEQAKNLLSQAKRPVLYVGGGVGMAKSSDGMSGVKAI
FT                   RTFLDITNIPSVSTLKGLGTIPPKHPLYMGMIGMHGTKAANYAVQECDLLIACGARFDD
FT                   RVTGKLDTFAPHAKVIHIDIDVAEINKLRKADVGLQGDLVEAVTNLAQLLDIEPWRKDI
FT                   EQLKASFDFNYIENTEDKEIEPCALLHTLSERKAKNAVITTDVGQHQMWSAQHMKHYEP
FT                   ENYITSAGFGSMGFGLPAAIGAAKARPQDPVILITGDGSLMMNIQELGSIKRGNLPIKI
FT                   LLLDNQRLGMVRQWQSLFFHGRHSHTVLDDNPDFVTLASAFGIAGERIEKASEVSDALD
FT                   RLLNAKEAYLLHVCIPDEENVWPLVPPNTCNSNMIEEDIGV"
FT   gene            11318..11536
FT                   /locus_tag="HSM_0014"
FT   CDS_pept        11318..11536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0014"
FT                   /product="acetohydroxy acid synthase II, small subunit"
FT                   /note="KEGG: hso:HS_0148 acetohydroxy acid synthase II,
FT                   small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31140"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="UniProtKB/TrEMBL:B0UUX2"
FT                   /protein_id="ACA31140.1"
FT                   /translation="MKTYDLTIQANKRPETLERLLRVVRHRGFEVIILHSESKGNVIDL
FT                   RLTVQSERAIELLIHQLVKLPDVITLS"
FT   gene            11602..12264
FT                   /locus_tag="HSM_0015"
FT   CDS_pept        11602..12264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0015"
FT                   /product="MOSC domain containing protein"
FT                   /note="PFAM: MOSC domain containing protein; KEGG:
FT                   hso:HS_0149 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31251"
FT                   /db_xref="GOA:B0UUX3"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:B0UUX3"
FT                   /protein_id="ACA31251.1"
FT                   /translation="MEGAVLAIKLGLVEEIVFENGSKMSTAIRKKPMEQAIVHELGAEG
FT                   NDVGLKAHHGGIDKALFFMAERSFAKLTALLGKHDSYQGEAIYGENFIVSFFDEENVCV
FT                   GDQYQIGDVQIEISQPRIPCETLSKNANNKNTRAIVVETGLTGWYVRVIKNGVIKKGDK
FT                   IRRLANPYPKLTIKYLNYLLATEATVELKTQLEQAIECPVLAEAFKRYLKMKWRKIS"
FT   gene            12384..12887
FT                   /locus_tag="HSM_0016"
FT   CDS_pept        12384..12887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0016"
FT                   /product="Chorismate lyase"
FT                   /note="PFAM: Chorismate lyase; KEGG: hso:HS_0150
FT                   4-hydroxybenzoate synthetase (chorismate--pyruvate lyase)"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31362"
FT                   /db_xref="GOA:B0UUX4"
FT                   /db_xref="InterPro:IPR007440"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/TrEMBL:B0UUX4"
FT                   /protein_id="ACA31362.1"
FT                   /translation="MNISLFRQILSSTKWQNDIFTLSPQKQDWLLHQGSLTRKLQQYCQ
FT                   QLKVEIVAEKWVSDMSFGFTGHHEPIWLREVILKGDEQAWIFAQTRLPQSTIENVAPDI
FT                   INVGSTPIGLWLFPQQPKRKTLEWIYDTATGLYARRSVLLLNQYPIEIKELFLQDFKFF
FT                   QSKV"
FT   gene            12891..15305
FT                   /locus_tag="HSM_0017"
FT   CDS_pept        12891..15305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0017"
FT                   /product="ribonuclease R"
FT                   /EC_number="3.1.13.1"
FT                   /note="KEGG: hso:HS_0151 exoribonuclease II (ribonuclease
FT                   R); TIGRFAM: VacB and RNase II family 3'-5'
FT                   exoribonuclease; ribonuclease R; PFAM: ribonuclease II; RNA
FT                   binding S1 domain protein; Ribonuclease B OB region domain;
FT                   Ribonuclease R winged-helix domain protein; SMART: Cold
FT                   shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31473"
FT                   /db_xref="GOA:B0UUX5"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR013668"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR040476"
FT                   /db_xref="UniProtKB/TrEMBL:B0UUX5"
FT                   /protein_id="ACA31473.1"
FT                   /translation="MRTPKKTNKKAKKITALTEDPYFFQEQQKYANPIPSREFILQIIR
FT                   DFNAPMSKEDLFKTLAIVDPEQKEGMRRRLRAMENEGQLVFTKRKCYALPEKLDLLKGS
FT                   VIGHREGYGFLQIEGSKSDWFIPNIQMQKVIHGDFVLAQPNGYDRKGRSEVRIVRVLES
FT                   RNKHIVGRFFMEEGIGYVVPDDSRINRDILIPNEFRNGARMGQVVVVELKPRTATFTQL
FT                   VGKIVEILGENMAKGMETEIAIRNHDIPHIFPSAVEKQVRKYTDSVPEEAKQGRRDLRT
FT                   LPLVTIDGEDARDFDDAVFCQRSGDGGWTLWVAIADVSYYVRLRTALDNEAYQRGNSVY
FT                   FPNRVVPMLPEILSNGLCSLNPQVDRLCMVCEIRISPQGKMTDYSFYEAVMNSYARLTY
FT                   TKVAQILAGDELLQQRYHVLVPHLQELHQMYQALLQARYQRGAIDFETIETKFVFNEMG
FT                   RIECIEPMVRNDAHKIIEECMILANIAAANFMERHQEPALFRIHAGPSQEKLSAFRAFL
FT                   RECGLTLKGGINPTTADYAQLLAQVRERPDHELIQTMLLRSLSQAVYHPDNIGHFGLAL
FT                   TEYAHFTSPIRRYPDLTLHRSIKYLLAKQQGSKRKTTDTGGYHYSLEEMDLLGDHCSLT
FT                   ERRADDATREVADWLKCEYMQDHVGDEFDGIISSVTGFGLFVRLDDLFIDGLVHISTLD
FT                   NDYYQFDSIKQRLIGENSGTTYRLGDKVKIRVEAVSLAQRQVDFVLLSSQRKPRRSGKT
FT                   ANKRAKQKSFQEKNRTSKIERHKSAVKITKKLSKKQQSPASKTRKQKKQKG"
FT   gene            15312..16049
FT                   /locus_tag="HSM_0018"
FT   CDS_pept        15312..16049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0018"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /note="TIGRFAM: RNA methyltransferase, TrmH family, group
FT                   3; PFAM: tRNA/rRNA methyltransferase (SpoU); RNA 2-O ribose
FT                   methyltransferase substrate binding; KEGG: hso:HS_0152
FT                   tRNA/rRNA methyltransferase, SpoU family"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31584"
FT                   /db_xref="GOA:B0UUX6"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR024915"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:B0UUX6"
FT                   /protein_id="ACA31584.1"
FT                   /translation="MAENIYGIHAVQAFLINAPERLIEVYVLKGREDKRLQSVLNELYK
FT                   LGISVQFLNRDTLDKKANGEVHQGIIARVQPAKELNENDLVEILQKKANPLLLVLDGIT
FT                   DPHNLGACLRSADAAGVCAVIVPKDKSAQLTAIARKVACGAAEVVPLVRVTNLARTLRD
FT                   LQQQHNIWVVGTAGEAIETLYEAKLTGGLALVMGAEGDGMRRLTRETCDQLISIPMAGS
FT                   VSSLNVSVATGICLFEIVRQRLG"
FT   gene            complement(16190..16516)
FT                   /locus_tag="HSM_0019"
FT   CDS_pept        complement(16190..16516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0019"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="PFAM: Sel1 domain protein repeat-containing protein;
FT                   KEGG: hso:HS_0153 conserved hypothetical protein, with TPR
FT                   repeat (tetratrico peptide repeat)"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31688"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B0UUX7"
FT                   /protein_id="ACA31688.1"
FT                   /translation="MNLKKSLLTALLSFGIVQSTLAETDTERFNRALQFIKQQNYSDAF
FT                   PLFKQLAEQGDANAQHNLGVMYENGQSVQRNVSKAKQYYRLACDNGLNIGCQTYAKLDK
FT                   KGIK"
FT   sig_peptide     complement(16448..16516)
FT                   /locus_tag="HSM_0019"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.985 at
FT                   residue 23"
FT   gene            complement(16560..17357)
FT                   /locus_tag="HSM_0020"
FT   CDS_pept        complement(16560..17357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0020"
FT                   /product="serine O-acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /note="TIGRFAM: serine O-acetyltransferase; PFAM:
FT                   transferase hexapeptide repeat containing protein; serine
FT                   acetyltransferase domain protein; KEGG: hso:HS_0154 serine
FT                   O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31799"
FT                   /db_xref="GOA:B0UUX8"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:B0UUX8"
FT                   /protein_id="ACA31799.1"
FT                   /translation="MSIEVWSLIRAEAAKLAENEPMLASFFHATILKHNNLGSALSYIL
FT                   ANKLANPIMPAIALREIIEEAHQNQPQIIESAACDIRAVRHRDPAVEQYSTPLLYLKGF
FT                   HALQSYRITHYLWQQGRKALAIYLQNQISVAFDVDIHPAARIGCGIMFDHATGIVIGET
FT                   SVIENDVSILQGVTLGGTGKESGDRHPKIREGVMIGSGAKVLGNIEIGRYAKIGANSVV
FT                   LQFVSEYTTVAGVPSQIVGKNKGAKPAFDMDQYFIDDAINLNI"
FT   gene            complement(17359..18522)
FT                   /locus_tag="HSM_0021"
FT   CDS_pept        complement(17359..18522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0021"
FT                   /product="Glycerol-3-phosphate dehydrogenase (NAD(P)(+))"
FT                   /EC_number="1.1.1.94"
FT                   /note="PFAM: NAD-dependent glycerol-3-phosphate
FT                   dehydrogenase domain protein; KEGG: hso:HS_0155
FT                   glycerol-3-phosphate dehydrogenase (NAD(P)+)"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31832"
FT                   /db_xref="GOA:B0UUX9"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0UUX9"
FT                   /protein_id="ACA31832.1"
FT                   /translation="MPYLLSICNVNKHKRSQKLKKKKRKKFINLSGCCNNTLIFLLIPK
FT                   ILRKNMNDNSPSPTPITVIGAGAYGTALAIAFSRNGYPTYLWGHRPQHCQRLRNERKNQ
FT                   AFLPNIHFPDSLYVEDNLAQAIQHSRELLIVVPSHVFGDVIMQIKPHLRSDQRIAWATK
FT                   GLERNTGRLLQEVVEEHVGYGYPLAVLSGPTFAKELAAGMPTAITLASNNEQFALEFQE
FT                   RIHCSKFRVYVNQDMIGVQLGGAVKNVIAIAAGISDGMGFGANARTALITRGIAEISRL
FT                   GISLGANPNTFMGTSGLGDLVLTCTDNQSRNRRFGLMLGQGFDCTTAINELGPVIEGFY
FT                   NTKETFLLAQQQGVEMPITEQVYQILFCGKKPEDAAITLLGRKRKRE"
FT   gene            complement(18437..18952)
FT                   /locus_tag="HSM_0022"
FT   CDS_pept        complement(18437..18952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0022"
FT                   /product="protein-export protein SecB"
FT                   /note="TIGRFAM: protein-export protein SecB; PFAM: protein
FT                   export chaperone SecB; KEGG: hso:HS_0156 protein-export
FT                   protein, subunit SecB"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31843"
FT                   /db_xref="GOA:B0UUY0"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UUY0"
FT                   /protein_id="ACA31843.1"
FT                   /translation="MTEKNQDAVTEEQGTEVVLQIQRIYVKDVSFEAPNLPHIFQQEWK
FT                   PKLDFNLSTETTHLAEDLYEVCLNISVETTMEGSEDVAFICEVKQAGIFAISGLEDVQL
FT                   AHCLTSQCPNMLFPYARELISSLVNRGTFPALNLAPVNFDALFVEYMQRQQAQEESKTE
FT                   EKEKKEVH"
FT   gene            complement(18963..19409)
FT                   /locus_tag="HSM_0023"
FT   CDS_pept        complement(18963..19409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0023"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: hso:HS_0157
FT                   conserved hypothetical protein, with rhodanese-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31854"
FT                   /db_xref="GOA:B0UUY1"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B0UUY1"
FT                   /protein_id="ACA31854.1"
FT                   /translation="MQEYLPLATEFAKNHSLMVIAWIAVFVMLIYTSVKSFTSKVTAVE
FT                   NAEATRLINNEEAIVIDLRTIDEFQRGHIINSINVLPTEIKNQNLGKIEQHKDTPVILV
FT                   CATGMNAGASAELLVKQGFSRVYSLKDGISGWIAANLPLVKKHK"
FT   gene            19652..20962
FT                   /locus_tag="HSM_0024"
FT   CDS_pept        19652..20962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0024"
FT                   /product="anaerobic c4-dicarboxylate antiporter, Dcu
FT                   family"
FT                   /note="TIGRFAM: anaerobic c4-dicarboxylate antiporter, Dcu
FT                   family; PFAM: anaerobic c4-dicarboxylate membrane
FT                   transporter; KEGG: hso:HS_0158 anaerobic C4-dicarboxylate
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31865"
FT                   /db_xref="GOA:B0UUY2"
FT                   /db_xref="InterPro:IPR004668"
FT                   /db_xref="UniProtKB/TrEMBL:B0UUY2"
FT                   /protein_id="ACA31865.1"
FT                   /translation="MFYIQFAIVLVCILIGARIGGIGLGVMGGLGLCILAFGFGLQPAG
FT                   LPIDVMFMIMAVVSVAAAMQAAGGLDYMIKIATNILRRNPKYITFVAPAVTWLFTFLAG
FT                   TGHVAYSVLPVIAEVSRHSGIRPERPLSMAVIASQFAIVASPIAAAVVAVVNYLEPQGI
FT                   NLGSVLMVTIPSTILGIALACVFVNKMGKELKDDPNYQRLLQNPEYVKENSVSNIAEIE
FT                   IKPTAKLSVGLFLFGALLVVVMGAYPELRPSFNDKPMGMAHTIEIVMLTVGALIILTCK
FT                   PNGNAITQGSVFHAGMRAVIAIFGIAWLGDTLMQGHIAGIKESVKLLVETAPWAFAFAL
FT                   FLLSVLVNSQGATVATLFPLGIALGIEPAILIGVFVAVNGYFFIPNYGPIIASIDFDTT
FT                   GTTRIGKFIFNHSFMLPGLLSMAFSLGFGLLFASILL"
FT   gene            complement(21035..21895)
FT                   /locus_tag="HSM_0025"
FT   CDS_pept        complement(21035..21895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0025"
FT                   /product="4-hydroxybenzoate polyprenyl transferase"
FT                   /note="TIGRFAM: 4-hydroxybenzoate polyprenyl transferase;
FT                   PFAM: UbiA prenyltransferase; KEGG: hso:HS_0159
FT                   4-hydroxybenzoate octaprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31876"
FT                   /db_xref="GOA:B0UUY3"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UUY3"
FT                   /protein_id="ACA31876.1"
FT                   /translation="MTIFAKDKLIAYGQLMRLDKPIGTLLLLWPTLWALYLAEKAMPTL
FT                   SVLAIFIFGVFLMRSAGCVINDYADRHIDGKVKRTSLRPLSTGRATPREAKWLFIVLVF
FT                   CSFLLVLCLNLYTIGLSVIAVILAFIYPFMKRYTHLPQFFLGAAFGWSIPMAYGATIEA
FT                   LPLECWLLFIANLSWTVAYDTQYAMVDRDDDLRIGVKSTAILFAQYDNKIIALLQIITL
FT                   IFLFSVGYLSQLNNRYFIVLAIAGLFFVYQCRLTKNRDRESCFNAFLNNNYFGLTVFIA
FT                   VLFGI"
FT   gene            21934..22356
FT                   /locus_tag="HSM_0026"
FT   CDS_pept        21934..22356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0026"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: hso:HS_0160
FT                   thiosulfate sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31887"
FT                   /db_xref="GOA:B0UUY4"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR023695"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B0UUY4"
FT                   /protein_id="ACA31887.1"
FT                   /translation="MYFTVKSFLEKVSLPYKETVLYCEILLLLNYHKMTTFKEINSEQA
FT                   WEILNNKNAVLVDIRDLSHFIYSRPKSAFHLTHQRFSEFQQKYEYDQPIIVSCYHGVSS
FT                   RNVAQFLVEQGYDEVYSLIGGFAGWVQANLPVESGY"
FT   gene            complement(22380..22694)
FT                   /locus_tag="HSM_0027"
FT   CDS_pept        complement(22380..22694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0027"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hso:HS_0161 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31898"
FT                   /db_xref="GOA:B0UUY5"
FT                   /db_xref="InterPro:IPR035333"
FT                   /db_xref="UniProtKB/TrEMBL:B0UUY5"
FT                   /protein_id="ACA31898.1"
FT                   /translation="MKKQNMPTGFSRFSWALVGFCLPVLLWPLALLISPNFIKNPNLDD
FT                   FQMRWMSIFFWAYPFILGIIARYSFKLNQRNSQLAKYVLLLSAVIFYSVLIYVCAAGLN
FT                   "
FT   gene            22738..23601
FT                   /locus_tag="HSM_0028"
FT   CDS_pept        22738..23601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0028"
FT                   /product="Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family protein; KEGG: hso:HS_0162
FT                   GlpG protein, rhomboid family"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31909"
FT                   /db_xref="GOA:B0UUY6"
FT                   /db_xref="InterPro:IPR022732"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:B0UUY6"
FT                   /protein_id="ACA31909.1"
FT                   /translation="MKLLFGSERENFIIWFRDYIRAKYLLELTIQNYIDEKYNRSVRGV
FT                   FIEENHPLLTQLEQEKILFLQDPFNPCYQQAAWEAGDTHSIQYKKTSWVAIWKISSKWF
FT                   QQGKITLFITALCTLIYVLQNLGFEQGIFYFAHYPANPAQQTEIWRYISHSLVHLSPLH
FT                   FLFNLSWFWLFGGAIERQLNAKKLLLLFFVSSILTGVVQNYFSDYRFFGLSGVVYAVLG
FT                   YVFILDKFHYAKFALPSGFFLMLIMGIALGFISPLVGIYMGNSAHISGLLCGILLGLWQ
FT                   VKKREF"
FT   gene            23818..24342
FT                   /locus_tag="HSM_0029"
FT   CDS_pept        23818..24342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0029"
FT                   /product="protein of unknown function DUF177"
FT                   /note="PFAM: protein of unknown function DUF177; KEGG:
FT                   hso:HS_0163 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31920"
FT                   /db_xref="InterPro:IPR003772"
FT                   /db_xref="InterPro:IPR039255"
FT                   /db_xref="UniProtKB/TrEMBL:B0UUY7"
FT                   /protein_id="ACA31920.1"
FT                   /translation="MQKVKLPLTVDPIKDAQRRLDYQGCYVSNQVTRLAESVVKVLSDV
FT                   QVTLSFFVDPQKLTVMKGRASVDVELECQRCGCPFSQSLECEFSYSPVSDLGKINELPE
FT                   IYEPIELNEFGEIDLIGTVEDELIVALPIVPMHSSEHCEVSVAEQVFGELPEELAKKPN
FT                   PFAVLASLKKK"
FT   gene            24360..24530
FT                   /locus_tag="HSM_0030"
FT   CDS_pept        24360..24530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0030"
FT                   /product="ribosomal protein L32"
FT                   /note="TIGRFAM: ribosomal protein L32; PFAM: ribosomal L32p
FT                   protein; KEGG: hso:HS_0163a 50S ribosomal protein L32"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31932"
FT                   /db_xref="GOA:B0UUY8"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UUY8"
FT                   /protein_id="ACA31932.1"
FT                   /translation="MAVQQNKKSRSRRDMRRSHDALTTAAVSVDKTSGETHLRHHVTAD
FT                   GYYRGRKVINK"
FT   gene            24651..24929
FT                   /locus_tag="HSM_0031"
FT   CDS_pept        24651..24929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0031"
FT                   /product="putative fatty acid/phospholipid synthesis
FT                   protein"
FT                   /note="KEGG: hso:HS_0164 possible fatty acid/phospholipid
FT                   synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31943"
FT                   /db_xref="UniProtKB/TrEMBL:B0UUY9"
FT                   /protein_id="ACA31943.1"
FT                   /translation="MLSLLFANNQQNFPLRQRFPIDSQNYLAVCHCSHVIENNQGLVHT
FT                   LVHIFVEYQLGLFYLYAALLNIGIEETKEYKEYKAIRDMALQSSKKG"
FT   gene            24982..25932
FT                   /locus_tag="HSM_0032"
FT   CDS_pept        24982..25932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0032"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase III"
FT                   /EC_number="2.3.1.41"
FT                   /note="TIGRFAM: 3-oxoacyl-(acyl-carrier-protein) synthase
FT                   III; PFAM: 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase
FT                   III domain protein; 3-Oxoacyl-[acyl-carrier-protein (ACP)]
FT                   synthase III; KEGG: hso:HS_0165
FT                   3-oxoacyl-[acyl-carrier-protein] synthase
FT                   (beta-ketoacyl-ACP synthase)"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31952"
FT                   /db_xref="GOA:B0UUZ0"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UUZ0"
FT                   /protein_id="ACA31952.1"
FT                   /translation="MYSRILATGSYIPANIRTNADLEKMVETSDEWITTRSGIKERRIA
FT                   GENETVATMGFEAAKNALQLANICPNDIDLVLVATTSHSYAYPSAACQIQGMLDIDDAI
FT                   SFDLAAACTGFIYALSVADQFIKTGKVKKALVIGADINSRKLDETDRSTVILFGDGAGA
FT                   VILESSDIEGIISTHLHASLDKSNALILPQTQQGEVQSGYIQMQGNATFKLAVRELSNV
FT                   VEETLRDNHLDKADLDWLVPHQANLRIITATAEKLNMSLDQVVITLDKYGNTSAATVPV
FT                   ALDEAVRDGRIKRGQLLLLEAFGGGWTWGSALVRF"
FT   gene            25976..26914
FT                   /locus_tag="HSM_0033"
FT   CDS_pept        25976..26914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0033"
FT                   /product="malonyl CoA-acyl carrier protein transacylase"
FT                   /note="TIGRFAM: malonyl CoA-acyl carrier protein
FT                   transacylase; PFAM: Acyl transferase; KEGG: hso:HS_0166
FT                   [acyl-carrier protein] S-malonyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31963"
FT                   /db_xref="GOA:B0UUZ1"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:B0UUZ1"
FT                   /protein_id="ACA31963.1"
FT                   /translation="MKKFAMVFPGQGSQAVGMLAELATEYPIVEETFQQASSVLGYDLW
FT                   QLVQQGPAEELNKTWQTQPALLAASVAIYRVWQQKYPYLKPEVMAGHSLGEYSALVCAG
FT                   VIDFQDGIKLVQLRGKLMQQAVPEGTGAMYAIIGLDNESIVQACKASEQGEIVSAVNFN
FT                   SPGQVVIAGAKVAVERAAVACKEAGAKRALPLAVSVPSHCALMKPAAEELAVALEKMTF
FT                   SIPQIPVINNVDVKAENETTKIRTALVRQLYSPVRWTEIVENMAREGIELLFEMGPNKV
FT                   LTGLTSRIAKELNAKAVNDLSSLNTVEESLD"
FT   gene            26968..27693
FT                   /locus_tag="HSM_0034"
FT   CDS_pept        26968..27693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0034"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) reductase"
FT                   /note="TIGRFAM: 3-oxoacyl-(acyl-carrier-protein) reductase;
FT                   PFAM: short-chain dehydrogenase/reductase SDR; KR domain
FT                   protein; KEGG: hso:HS_0167 3-oxoacyl-[acyl-carrier-protein]
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31974"
FT                   /db_xref="GOA:B0UUZ2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0UUZ2"
FT                   /protein_id="ACA31974.1"
FT                   /translation="MQGKIALVTGATRGIGRAIAEELASKGAFVIGTATSEKGAESISA
FT                   YLGKQGKGLVLNVADQDSIDAVLSAIKAEVGDVEILVNNAGITRDGLLMRMKDDDWFDI
FT                   MQTNLTSIYRLSKAVLRPMMKKGGRIINIGSVVGSMGNPGQTNYCAAKAGVIGFTKSLA
FT                   KEVAARGVTVNVVAPGFIATDMTDVLTDEQKANILTNVPASRLGQPKDIAKAVAFLASE
FT                   DASYITGTTLHVNGGMYLP"
FT   gene            27948..28178
FT                   /locus_tag="HSM_0035"
FT   CDS_pept        27948..28178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0035"
FT                   /product="acyl carrier protein"
FT                   /note="TIGRFAM: acyl carrier protein; PFAM:
FT                   phosphopantetheine-binding; KEGG: hso:HS_0168 acyl carrier
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31985"
FT                   /db_xref="GOA:B0UUZ3"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UUZ3"
FT                   /protein_id="ACA31985.1"
FT                   /translation="MSIEERVKKIIVEQLGVKEDDVKPEASFIEDLGADSLDTVELVMA
FT                   LEEEFDIEIPDEEAEKITTVQSAIDYVQNNQ"
FT   gene            28327..28755
FT                   /locus_tag="HSM_0036"
FT   CDS_pept        28327..28755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0036"
FT                   /product="ribosomal protein L11"
FT                   /note="PFAM: ribosomal protein L11; KEGG: hso:HS_0169 50S
FT                   ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31996"
FT                   /db_xref="GOA:B0UUZ4"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UUZ4"
FT                   /protein_id="ACA31996.1"
FT                   /translation="MAKKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAR
FT                   TESLEKGLPIPVVITVYADRSFTFVTKTPPAAVLLKKAAGIKSGSSKPNKDKVGKVTLD
FT                   QIRQIAETKAADMTGATIETKMKSIEGTARSMGLVVEG"
FT   gene            28760..29449
FT                   /locus_tag="HSM_0037"
FT   CDS_pept        28760..29449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0037"
FT                   /product="ribosomal protein L1"
FT                   /note="PFAM: ribosomal protein L1; KEGG: hso:HS_0170 50S
FT                   ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32007"
FT                   /db_xref="GOA:B0UUZ5"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UUZ5"
FT                   /protein_id="ACA32007.1"
FT                   /translation="MAKLTKRMKAIKAGVDSTKQYEINEAITVLKQFTSTKFVESVDVA
FT                   VNLGIDARKSDQNVRGATVLPHGTGRSVRVAVFTQGANVDSAKAAGADLVGMEDLAEQI
FT                   KKGEMNFDVVIASPDAMRVVGQLGQILGPRGLMPNPKVGTVTPNVAEAVKNAKSGQIRY
FT                   RNDKNGIIHTTIGKANFSAEQLKENLQALLAALTKAKPATAKGIFIRKVSVSTTQGAGV
FT                   AVDQSSL"
FT   gene            29733..30224
FT                   /locus_tag="HSM_0038"
FT   CDS_pept        29733..30224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0038"
FT                   /product="ribosomal protein L10"
FT                   /note="PFAM: ribosomal protein L10; KEGG: hso:HS_0171 50S
FT                   ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32018"
FT                   /db_xref="GOA:B0UUZ6"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UUZ6"
FT                   /protein_id="ACA32018.1"
FT                   /translation="MALNLQDKQAIVAEVNEAAKGALSAVIADSRGVTVDKMTELRKAA
FT                   REAGVSMRVVRNTLLRRAVEGTDFECLTDTFVGPTLIAFSNEHPGAAARLFKDFAKAND
FT                   KFEIKGAAFEGKIQNVEFLATLPTYEEAIARLMGTMKEAAAGKLARTLAAYRDKLQEAA
FT                   "
FT   gene            30276..30644
FT                   /locus_tag="HSM_0039"
FT   CDS_pept        30276..30644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0039"
FT                   /product="ribosomal protein L7/L12"
FT                   /note="TIGRFAM: ribosomal protein L7/L12; PFAM: Ribosomal
FT                   protein L7/L12; KEGG: hso:HS_0172 50S ribosomal protein
FT                   L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32029"
FT                   /db_xref="GOA:B0UUZ7"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UUZ7"
FT                   /protein_id="ACA32029.1"
FT                   /translation="MSLTNEQIIEAIASKTVTEIVELISAMEEKFGVSAAAAAVAVAAG
FT                   PAEVAEEKTEFDVVLAEAGANKVAVIKAVRGATGLGLKEAKDLVESAPANLKEGISKAE
FT                   AEALKKELEEAGAKVEIK"
FT   gene            complement(30884..32146)
FT                   /locus_tag="HSM_0040"
FT   CDS_pept        complement(30884..32146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0040"
FT                   /product="transcription termination factor Rho"
FT                   /note="TIGRFAM: transcription termination factor Rho; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; Rho termination factor domain protein; Rho
FT                   termination factor RNA-binding; Ribonuclease B OB region
FT                   domain; SMART: AAA ATPase; Cold shock protein; KEGG:
FT                   msu:MS1837 transcription termination factor"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32041"
FT                   /db_xref="GOA:B0UUZ8"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:B0UUZ8"
FT                   /protein_id="ACA32041.1"
FT                   /translation="MHLTELKNKPVSELVELGEKQMGLENLARLRKQDIIFAILKQHAK
FT                   SGEDIFGGGILEILPDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLQTGDKIEGKIRP
FT                   PKEGERYFALLKVDRVNDDKPEVSRSKILFENLTPLHANSRLRMERGNGATEDLTARIL
FT                   DLASPIGKGQRGLIVAPPKAGKTMLLQNIAQSIIHNYPECELIVLLIDERPEEVTEMQR
FT                   SVKGEVIASTFDEPAARHVQVAEMVIEKAKRSVEHKKDVVILLDSITRLARAYNTVTPP
FT                   SGKILSGGVDANALHRPKRFFGAARNVEEGGSLTIIATALVDTGSKMDEVIFEEFKGTG
FT                   NMELHLSRKIAEKRVFPAIDFNRSGTRKEDLLTTPDELQKMWILRKILNPMGEIEAMEF
FT                   LIDKLMMAKTNEEFFEVMKRS"
FT   gene            32341..33600
FT                   /locus_tag="HSM_0041"
FT   CDS_pept        32341..33600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0041"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; SMART: DEAD-like helicases; KEGG:
FT                   hso:HS_0174 ATP-dependent RNA helicase, DEAD box family"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32052"
FT                   /db_xref="GOA:B0UUZ9"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR023554"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UUZ9"
FT                   /protein_id="ACA32052.1"
FT                   /translation="MQNSHLSQQRFSDLALHRIVQQAIKEKGFEFCTPIQALSLPITLK
FT                   GQDIAGQAQTGTGKTIAFLTATFHHLLQKNNINSSEQPRALILAPTRELVVQIANDANF
FT                   LVQATGLKTGLAYGGEGYDKQLKVIDRGIDILIGTTGRVIDYVKQGIIRLDYIQVVVLD
FT                   EADRMFDLGFIRDIRYLLRKCPVPQQRLTMLFSATLSYKVRELAFEHMNDPQYVEIEPL
FT                   QKTGHRIREELFYPSNQDKMALLMTLLEEEWPERCIIFSNTKHRCEEIWGYLSADGHRV
FT                   GLLTGDVMQKKRLSLLKQFTDGTLDVLVATDVAARGLHIPDVTHVFNYDLPDDCEDYVH
FT                   RIGRTGRAGESGISISFACEEYAINLPAIEEYIGHSIPVSQYDAKALIEDLPTPHRIKR
FT                   GAFDSRSNLQRTVKRLKKTY"
FT   gene            33714..34400
FT                   /locus_tag="HSM_0042"
FT   CDS_pept        33714..34400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0042"
FT                   /product="Ribulose-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /note="PFAM: ribulose-phosphate 3-epimerase; KEGG:
FT                   hso:HS_0175 ribulose-phosphate 3-epimerase
FT                   (pentose-5-phosphate 3-epimerase)"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32063"
FT                   /db_xref="GOA:B0UV00"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV00"
FT                   /protein_id="ACA32063.1"
FT                   /translation="MTPYLIAPSILSANLARLGEDVENVLKSGADVIHFDVMDNHYVPN
FT                   LTFGPAICKALRDYGIKAPIDVHLMVKPVDRIIPDFAKAGADYITFHPEASEHIDRSLQ
FT                   LIRDCGCKAGLVFNPATPLSYLDYVLDKIDVILLMSVNPGFGGQAFIPSTLEKLKQARK
FT                   IIDESGLDIRLEVDGGVKVNNIAEIAQAGADMFVAGSAIFDQPDYKKVIDEMRQQLSTI
FT                   REKETK"
FT   gene            34397..35071
FT                   /locus_tag="HSM_0043"
FT   CDS_pept        34397..35071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0043"
FT                   /product="phosphoglycolate phosphatase"
FT                   /note="TIGRFAM: phosphoglycolate phosphatase ;
FT                   HAD-superfamily hydrolase, subfamily IA, variant 3;
FT                   HAD-superfamily hydrolase, subfamily IA, variant 1; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; KEGG:
FT                   hso:HS_0176 phosphoglycolate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32074"
FT                   /db_xref="GOA:B0UV01"
FT                   /db_xref="InterPro:IPR006346"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR037512"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV01"
FT                   /protein_id="ACA32074.1"
FT                   /translation="MTQFKLIGFDLDGTLVNSLPDLALSINSALKDVNLPQASENLVMT
FT                   WIGNGADVLSQRAVDWACTQAEKELTEDEFKYFKRQFGFYYGENLCNISRLYPNVKETL
FT                   EALKAQGYILAVVTNKPTKHVQPILTAFGIDHLFSEMLGGQSLPEIKPHPAPFYYLCGK
FT                   FGLYPKQILFVGDSQNDIFAAHSAGCAVVGLTYGYNYNIPIAQSKPDWIFDDFADILKI
FT                   TQ"
FT   gene            35081..36082
FT                   /locus_tag="HSM_0044"
FT   CDS_pept        35081..36082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0044"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="TIGRFAM: tryptophanyl-tRNA synthetase; PFAM:
FT                   aminoacyl-tRNA synthetase class Ib; KEGG: hso:HS_0177
FT                   tryptophan--tRNA ligase (tryptophanyl-tRNA synthetase)"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32085"
FT                   /db_xref="GOA:B0UV02"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV02"
FT                   /protein_id="ACA32085.1"
FT                   /translation="MTKPVVLSGVQPSGELTIGNYLGALRQWVNMQDEYECLYCIVDLH
FT                   AITVRQDPDTLRKATLDVLALYLACGIDPEKSTIFIQSHIPEHTQLAWILNCYTYFGEM
FT                   SRMTQFKDKSARHADNINVGLFTYPVLMAADILLYQANQVPVGEDQRQHLEITRDIAQR
FT                   FNALYGEHFIVPEAFIPKAGARVMSLLEPEKKMSKSDENRNNVIGLLEDPKAVVKKIKR
FT                   AVTDSDEPPVVRYDVKNKAGVSNLLDILSGVTGKSIVQLEAEFEGKMYGHLKSAVADEV
FT                   ATMLTTLQERFYHFRNNEELLNKIAAEGAEKARKRAKETLDKVYRAMGFVTP"
FT   gene            complement(36303..36686)
FT                   /locus_tag="HSM_0045"
FT   CDS_pept        complement(36303..36686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0045"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hso:HS_0178 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32093"
FT                   /db_xref="GOA:B0UV03"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV03"
FT                   /protein_id="ACA32093.1"
FT                   /translation="MKFMLIQQRLIFLVQRHLIDEDIMTITLNIRNRLGKKWRVNLKTK
FT                   QVDMLLIHLAMALGRIKRGYVAKALNPDFFSEIERAVCFTKILKLHQELLTFIPFPVPK
FT                   EEQSHFIANIYSLSLAQPWILTP"
FT   gene            36796..37398
FT                   /locus_tag="HSM_0046"
FT   CDS_pept        36796..37398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0046"
FT                   /product="beta-phosphoglucomutase family hydrolase"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; beta-phosphoglucomutase family hydrolase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; KEGG:
FT                   hso:HS_0179 possible phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32104"
FT                   /db_xref="GOA:B0UV04"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010976"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV04"
FT                   /protein_id="ACA32104.1"
FT                   /translation="MLNKEIIARYEGLIFDMDGTVIDTMPCHKQAWELVGAEMGYALDG
FT                   DVMYQLGGAPVRTIAKAIMEKAQMPLYLMEDVISLKRKYGIELIMKNATLLPAADIVKQ
FT                   YVGQKPLALGTGSHRYVTEMLLEKFQLQSYFGAIVTAEDVINHKPEPDTFLRCAELLNL
FT                   DPLKCLVFEDADLGVQAGLAAEMDVFDVRVNQIITSK"
FT   gene            complement(37776..40529)
FT                   /locus_tag="HSM_0047"
FT   CDS_pept        complement(37776..40529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0047"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: hso:HS_0181 TonB-dependent outer
FT                   membrane receptor"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32115"
FT                   /db_xref="GOA:B0UV05"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV05"
FT                   /protein_id="ACA32115.1"
FT                   /translation="MMTNKFKLTAVAFSVLSTCVYAEEMLDQINVEYKLPPKQEVFKKA
FT                   GATSVRENISTSTQSIDDIIRTVPGAFTNLDKSSGTVSVNVRGQTGFGRVNTMVDGISQ
FT                   TFFATSGDNSEKAGGTSQFGATIDPAFITSVDIQRGSFDGKAGANALVGSANFRTIGVD
FT                   DVISEGRNVGALLNVGGGTNATGPNYMGAVAFRYPFSDTRTLGFMYAYSWRKSSQDFKV
FT                   GGGRSIKDVDAEEVGRIVEEACKGEAFCDRNEKRKLYGLQPYDPSKLLHYPQSHLAKIE
FT                   YNDKYNKAILSYRSLSTALSGRNLENKNYQLNYQLKPKENLQFELILADNTSTQTYHKG
FT                   SVFNGKMLKDVLESKNSAKTTDINMHFSIPFTEKFSYEATLGANILKNKYSKNRHPREL
FT                   GYYFDGGEPNSLDACDEVGKYKNACKYHGIRSNTFQPDGEQRFKTLYFDQTFKYDIYTL
FT                   KVNANRQIYKYEGRIFPLDPKDRFSSRTWHDSHKKMKNGKPIWVNSNSSEIVAKYGVEE
FT                   AEKLGCYTGPNDDDTTWDVYNCPSFYSVHKGDSRSHDNYSMSFSADFHPLFSPFVSYAK
FT                   THRVPNIKEMYFSEFGTLAIRPDLKSEKAKTIQFGINGYKNGIFSDFDALGFKILAYQT
FT                   KIRDYIINIKQECSSNAWRGSNKAPTIYDCVEHLTHINYEGGKTILKTDLVDTGDGKTK
FT                   VPSNQLIPADSSPIVKIQGLELELNYDIGWFYANLSYARQKTNQPSSFSDSSYNVSDDS
FT                   ETGQYLQGFGLSKISSLPKDYGSLDLGTRLFDGKLTLGGTAKYYGKSKRARLDKADGDV
FT                   ILPGTFTSRKTGETFLTYVRISGTEEIKAQPIIFDFYAIYQPTENLTIKGEIQNAFDKK
FT                   YINPLDANNDSANQMTYAMGVGDGYQKALNNYSKGRTFVLNVNYKF"
FT   sig_peptide     complement(40461..40529)
FT                   /locus_tag="HSM_0047"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            complement(40762..41379)
FT                   /locus_tag="HSM_0048"
FT   CDS_pept        complement(40762..41379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0048"
FT                   /product="protein of unknown function UPF0126"
FT                   /note="PFAM: protein of unknown function UPF0126; KEGG:
FT                   hso:HS_0182 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32126"
FT                   /db_xref="GOA:B0UV06"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV06"
FT                   /protein_id="ACA32126.1"
FT                   /translation="MLSVFNFIDLLGTFIFALSGAVAGVKKQFDLFGVFVVSAVTAIGG
FT                   GIIRDLCLSATPPAGLENIAYLLIILLAVCCVSFFQEKITSFSKVSNLLDAVGLGFFAA
FT                   FGANKTWYMTENIQLSIILGCISAVGGGCIRDVLTNKSPLIFQSEIYAGAAIVGATIEL
FT                   LGSTGLISPLLSPWLAIITCTLIRMLAIKYRIQFPFIKDKSL"
FT   gene            41621..43156
FT                   /locus_tag="HSM_0049"
FT   CDS_pept        41621..43156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0049"
FT                   /product="threonine dehydratase, biosynthetic"
FT                   /note="TIGRFAM: threonine dehydratase, biosynthetic; PFAM:
FT                   Threonine dehydratase domain protein;
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   KEGG: hso:HS_0183 threonine ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32137"
FT                   /db_xref="GOA:B0UV07"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005787"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV07"
FT                   /protein_id="ACA32137.1"
FT                   /translation="MISNLTEQPSGAEYLKAILSSKIYELAQVTPLQPMLKLSERLSNT
FT                   VLVKREDRQLVHSFKLRGAYAMIAGLSQPQKNAGVITASAGNHAQGVALSAKNLGLNAL
FT                   IVMPQNTPRIKVDAVRGYGGEVLLYGANFDEAKAKAIELSESKSMTFIPPFDHPAVIAG
FT                   QGSLAMELLQQNSHIDRIFVPVGGGGLAAGVAVLIKQLMPDIKVIAVESKDSACLHAAL
FT                   KVGQPVDLERVGLFADGVAVKRIGNETFRVCQQYIDDVVLVDSDEVCAAMKDMFENVRA
FT                   IAEPSGAVSLAGLKKYVKEHNIQGETLVNILSGANLNFHTLRYVSERCEIGEKHEAIFA
FT                   VTIPEEKGSFLRFCHLLGDRPVTEFNYRYADKEQACIFVGVRISSEKEKLEIIQQLEQN
FT                   DYKVMDLSDDEIAKTHIRYMIGGRTTSNSKERLYSFEFPEQKGALLKFLMMLGTHWNIS
FT                   LFHYRAYGADYGNVLAGFQLDEHDEIRFNGHLEELAYTYQDVTDSPAYKYFLA"
FT   gene            complement(43200..44144)
FT                   /locus_tag="HSM_0050"
FT   CDS_pept        complement(43200..44144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0050"
FT                   /product="hydroxymethylbutenyl pyrophosphate reductase"
FT                   /EC_number="1.17.1.2"
FT                   /note="TIGRFAM: hydroxymethylbutenyl pyrophosphate
FT                   reductase; PFAM: LytB protein; KEGG: hso:HS_0184
FT                   4-hydroxy-3-methylbut-2-enyl diphosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32147"
FT                   /db_xref="GOA:B0UV08"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UV08"
FT                   /protein_id="ACA32147.1"
FT                   /translation="MKIILANPRGFCAGVDRAISIVELALEIHGAPIYVRHEVVHNRFV
FT                   VNGLRERGAIFVEELDEVPNGAIVIFSAHGVSQAVRQEAKERNLKVFDATCPLVTKVHM
FT                   QVARASRKGTKAILIGHEGHPEVIGTMGQYDNDKGGIYLVEDVEDIAKLTLRNDEDITF
FT                   MTQTTLSIDDTAGVIEVLKQKYPAIQGPRKNDICYATTNRQQAVRELAKLSDLVIVVGS
FT                   KNSSNSNRLAELASRMGVTAKLIDDANDIEVSWLDNVTVIGLTAGASAPEILVQSVISR
FT                   LKELGVDKVEELEGCEENTVFEVPKELRIKEVE"
FT   gene            complement(44144..44641)
FT                   /locus_tag="HSM_0051"
FT   CDS_pept        complement(44144..44641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0051"
FT                   /product="lipoprotein signal peptidase"
FT                   /EC_number="3.4.23.36"
FT                   /note="TIGRFAM: lipoprotein signal peptidase; PFAM:
FT                   peptidase A8 signal peptidase II; KEGG: hso:HS_0185 signal
FT                   peptidase II (lipoprotein signal peptidase)"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32158"
FT                   /db_xref="GOA:B0UV09"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UV09"
FT                   /protein_id="ACA32158.1"
FT                   /translation="MNLSKTGLPFLWISAVAFFTDLITKLAVVKNFSLYESVNILPFFN
FT                   LTYVRNHGAAFSFLADHAGWQKYFFILLALAVSFMILFFLYKNQATQKLQNTGYALMIG
FT                   GALANAADRAYHGFVVDFFDFYWQQWHYPVFNVADIAICIGAGLLAIDAFKQNDKKESK
FT                   QN"
FT   gene            45025..45258
FT                   /locus_tag="HSM_0052"
FT   CDS_pept        45025..45258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0052"
FT                   /product="outer membrane protein P1"
FT                   /note="KEGG: hso:HS_1548 outer membrane protein P1"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32169"
FT                   /db_xref="InterPro:IPR005017"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV10"
FT                   /protein_id="ACA32169.1"
FT                   /translation="MKKKITFTKSLIASALALSASYVNASAFQLAEVSSSGLGRAYAGE
FT                   AAIADNAAVVATNPALMSLFKAKQFSWGGGIR"
FT   sig_peptide     45025..45102
FT                   /locus_tag="HSM_0052"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.945 at
FT                   residue 26"
FT   gene            45428..46420
FT                   /locus_tag="HSM_0053"
FT   CDS_pept        45428..46420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0053"
FT                   /product="membrane protein involved in aromatic hydrocarbon
FT                   degradation"
FT                   /note="PFAM: membrane protein involved in aromatic
FT                   hydrocarbon degradation; KEGG: hso:HS_1548 outer membrane
FT                   protein P1"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32180"
FT                   /db_xref="InterPro:IPR005017"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV11"
FT                   /protein_id="ACA32180.1"
FT                   /translation="MNMNFSLRSKYKDDYVGGVLGGTSEMDSINLNLSGSYRVSKGLSV
FT                   GAGLNAIYAKAKFERRAGILKKTIDSLRSDDNELLILLSPSIVSSAYSLTFHENSTVAR
FT                   LQDNNAWGLGWNIGAVYEFNQDNRIGIAYHSKVDIDFKDNDTLGYILGKEEIKLHRAKG
FT                   KLTLHLPSYFEISGFHQLTAKFAMHYSYKYTQWSRLQSLHAAYSNGEVAFHKDENFHDS
FT                   SRVALGATYDVNDKLTLRAGIAYDESADHPTASIPDTDRTWYSLGATYHFTPNLSVDMG
FT                   FAHLRGKKQKFKENHSFTSKDNYEVGRIDADYQSTARANLYGLNLNYRF"
FT   gene            complement(46567..49380)
FT                   /locus_tag="HSM_0054"
FT   CDS_pept        complement(46567..49380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0054"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /note="TIGRFAM: isoleucyl-tRNA synthetase; KEGG:
FT                   hso:HS_0186 isoleucine--tRNA ligase (isoleucyl-tRNA
FT                   synthetase)"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32189"
FT                   /db_xref="GOA:B0UV12"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UV12"
FT                   /protein_id="ACA32189.1"
FT                   /translation="MTDYKNTLNLPETGFPMRGDLAKREPDMLKNWYDKNLYQKVREAS
FT                   KGKKTFILHDGPPYANGTLHLGHAVNKILKDIIMKSKTALGFDTPYVPGWDCHGLPIEL
FT                   KVEGLVGKPNEKISAAEFRQACRDYAKEQVEGQKADFIRMGVLGDWDNPYLTMNFETEA
FT                   EIIRTLGKVIQNGHLYKGSKPVHWCLDCASSLAEAEVEYEDKVSPSIYVRFAAVSAAEV
FT                   EEKFNALGKGQGALSAVIWTTTPWTLPSNRAIAVNAELEYQLVQLGDERVILAAELVQA
FT                   VQNALKIEQLEILGSTTGQDLELVRFHHPFYDFSVPIILGDHVTVDGGTGLVHTAPDHG
FT                   QDDFVVSKKYGLEMAGLVANDGKFISSTPFFAGKGVFEANDLVLEKLKETGALLKLERI
FT                   KHSYPHCWRHKTPIIFRATPQWFIGMETQDLRIKALSEIKSVRWIPSWGEARIDKMVAN
FT                   RPDWCISRQRTWGVPMTMFVHNETEELHPRTLELLEDIAKRVEKAGIQAWWDLDPAELL
FT                   GEDAKTYHKVPDTLDVWFDSGSTYASVVEQRPEFNGKSTDMYLEGSDQHRGWFMSSLML
FT                   STATNNKAPYKQVLTHGFTVDEKGRKMSKSLGNVIVPSEVWNKNGADILRLWVASTDYT
FT                   GEIAVSHKILNSAGDTYRRIRNTARFLLANLNGFDPKNDLVNPEEMISLDRWAVSCALE
FT                   AQNEIKEAYDNYQFHTVVQRLMRFCSIEMGSFYLDIIKDRQYTTKADSLARRSCQTALW
FT                   HISEALVRWIAPILSFTADEIWGYLPKLDNRAEFVFTEEFYDGLFGLDESDKLDDTYWQ
FT                   QLLKVRAEVNRVLEQARNDKLIGAGLEAKVTVYASEEIRPLLEQLGNELRFVLITSQVV
FT                   VKPLSKADVAESELTGLAIKVERADGEKCPRCWHFSTDIGSNKEHSHICGRCIENVEGN
FT                   GEQRQFA"
FT   gene            complement(49399..49947)
FT                   /locus_tag="HSM_0055"
FT   CDS_pept        complement(49399..49947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0055"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hso:HS_0187 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32200"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV13"
FT                   /protein_id="ACA32200.1"
FT                   /translation="MKKLKNLLLILGTFIPCLSFAQNIILDGYKDLKFGMTYQQIADSK
FT                   LCTGWEYYQPLNSYKCQHFLFNGNNREATAYFNGQVLNSIAIDILNYNQNRPPFPREVQ
FT                   EVKDILNGLPQKYGPPTKVVCGADYARSNEECNINTTDINFEDYWMVEFLNGQIRLVNS
FT                   VNQWVILVYSSAKTILDSL"
FT   sig_peptide     complement(49882..49947)
FT                   /locus_tag="HSM_0055"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 22"
FT   gene            complement(50045..50989)
FT                   /locus_tag="HSM_0056"
FT   CDS_pept        complement(50045..50989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0056"
FT                   /product="riboflavin biosynthesis protein RibF"
FT                   /EC_number="2.7.7.2"
FT                   /EC_number="2.7.1.26"
FT                   /note="TIGRFAM: riboflavin biosynthesis protein RibF;
FT                   cytidyltransferase-related domain; PFAM: Riboflavin kinase
FT                   / FAD synthetase; KEGG: hso:HS_0188 bifunctional riboflavin
FT                   biosynthesis protein/riboflavin kinase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32211"
FT                   /db_xref="GOA:B0UV14"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV14"
FT                   /protein_id="ACA32211.1"
FT                   /translation="MQLIRGFHNLPEPLKQQGCAVTIGNFDGVHLGHQSILQHLKAKAK
FT                   QLNLPVVVMLFEPQPYEYFQGDQAPARLMRLRDKLAYLAQLGVDYVFCVKFNRTFAQLS
FT                   AEQFISDCLVKHLKMKFLSIGDDFRFGLNREGDFRLLQKKGQQQSFIVEDNRSLQLNDQ
FT                   RISSTAIRQALSEDNLALAEKLLGKPYRIYGRVAHGNKLGRTIGFPTANIYLHRQVNPI
FT                   KGVYVVKVRLKNGDIFQGVANIGKRPTINGVKQLLEVHLFNFDRDLYGQSLQIEFCHKI
FT                   RHEKKFPSLNALKNQIENDVVVAKKYFQQVLNL"
FT   gene            complement(51075..51560)
FT                   /locus_tag="HSM_0057"
FT   CDS_pept        complement(51075..51560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0057"
FT                   /product="Dihydrofolate reductase"
FT                   /EC_number="1.5.1.3"
FT                   /note="PFAM: dihydrofolate reductase region; KEGG:
FT                   hso:HS_0189 dihydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32222"
FT                   /db_xref="GOA:B0UV15"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR017925"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV15"
FT                   /protein_id="ACA32222.1"
FT                   /translation="MKLSIIVAMTKNHVIGKNNQMPWHLPADLAWFRQNTGGKPIIMGR
FT                   KTFESIGRPLPNRTNIVLSRSPYEHDGIIWKDNLQSAVDFVRENHHEIMLIGGGELFKQ
FT                   YLPQANKLYLTEIQTELEGDTFFPEFNWQEWQIEFEQQRPADEKNPYACRFLILNRK"
FT   gene            complement(51613..52077)
FT                   /locus_tag="HSM_0058"
FT   CDS_pept        complement(51613..52077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0058"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hso:HS_0190 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32231"
FT                   /db_xref="GOA:B0UV16"
FT                   /db_xref="InterPro:IPR024528"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV16"
FT                   /protein_id="ACA32231.1"
FT                   /translation="MDLILKLLDDMFFAAIPAVGFALVFNVPKNVLKYCAFLGALGHGT
FT                   RTFLVHFDIPLVFATFIAASVVGFIGVYLSHRYLAHPKVFTVAAVIPMIPGVFAYKAMI
FT                   AIVHLHHYGFNEQRVAQMTEYFLKTGFLIGALVFGLALPGLLFYRHKPVV"
FT   gene            complement(52080..52868)
FT                   /locus_tag="HSM_0059"
FT   CDS_pept        complement(52080..52868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0059"
FT                   /product="protein of unknown function DUF1212"
FT                   /note="PFAM: protein of unknown function DUF1212; KEGG:
FT                   hso:HS_0191 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32242"
FT                   /db_xref="GOA:B0UV17"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV17"
FT                   /protein_id="ACA32242.1"
FT                   /translation="MNTTEDNSSFRQREITRTCAQVAQMLLQHGAESTLIVQMAQRLGF
FT                   ALGIDSVECALTPNAVIITTLYDHNCITTVRKNLDKGINMQVVTEVQRLVIMAEKGLYD
FT                   LQQIRKKLDGIKPLKYNRFVVVTMIGLSCACFAHLSGGDIIVFLITFIASSIAMFIRQT
FT                   LALRHYNPLIVFAITAFVASMVAGLAVKYELGNDPQIALASSVLLLVPGFPLINSLADI
FT                   LKGHINMGIARWTLATVLTFGTCLGIVFALSFLHIANWGR"
FT   gene            53026..54138
FT                   /locus_tag="HSM_0060"
FT   CDS_pept        53026..54138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0060"
FT                   /product="glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /note="TIGRFAM: glutamate 5-kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase; PUA domain containing
FT                   protein; KEGG: hso:HS_0192 glutamate 5-kinase
FT                   (gamma-glutamyl kinase)"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32254"
FT                   /db_xref="GOA:B0UV18"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV18"
FT                   /protein_id="ACA32254.1"
FT                   /translation="METQKTNKTIVVKFGTSTLTQGSSKLNRPHMMEIVRQITQLHRAG
FT                   FRIIIVTSGAMAAGRHYLNHPQLPPTIASKQLLAAVGQSQLIQTWEQLFAIYDIHIGQI
FT                   LLTRADIEDRERFMNARDTLHALLDNRIIPVINENDAVATAEIKVGDNDNLSALVAILA
FT                   QAEQLYLLTDQRGLFDSDPRKNPQAKLISIVDKITDHIRSIAGGSGTTLGTGGMTTKIS
FT                   AADIATRSGVETIIAPGNLENVIVNLAYGKDIGTKFVVQTDRLESRKQWIFAAPVAGIV
FT                   TIDEGAESAVLIQHKSLLPAGIISVEGCFSRGEVVKICGSNGKKIALGVPRYNSDSLIQ
FT                   IKGKKSQDIEQILGYEYGSVAIHRDDMVVY"
FT   gene            complement(54299..54853)
FT                   /locus_tag="HSM_0061"
FT   CDS_pept        complement(54299..54853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0061"
FT                   /product="NusG antitermination factor"
FT                   /note="TIGRFAM: transcription termination/antitermination
FT                   factor NusG; PFAM: transcription antitermination protein
FT                   NusG; KOW domain protein; SMART: NGN domain protein; KOW
FT                   (Kyrpides Ouzounis Woese) domain protein; KEGG: hso:HS_0193
FT                   transcription antitermination protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32263"
FT                   /db_xref="GOA:B0UV19"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV19"
FT                   /protein_id="ACA32263.1"
FT                   /translation="MTENTAKKRWYVLQAFSGFEGRVAATLREYIKLHQMEEQFGEVLV
FT                   PTEEVVENVGGKRRKSERKYFPGYVLVQMEMNDYTWQLVRSVPRVMGFIGGTPDKPAPI
FT                   SQKEAERILNRVQETADKPRHRKEFQPGEEIRVTEGPFADFNGTVEEVDYDKGRLKVSV
FT                   LIFGRATPVELEFSQVEKANG"
FT   gene            complement(54855..55262)
FT                   /locus_tag="HSM_0062"
FT   CDS_pept        complement(54855..55262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0062"
FT                   /product="preprotein translocase, SecE subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecE subunit; PFAM:
FT                   protein secE/sec61-gamma protein; KEGG: hso:HS_0194 protein
FT                   export protein (preprotein translocase)"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32274"
FT                   /db_xref="GOA:B0UV20"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV20"
FT                   /protein_id="ACA32274.1"
FT                   /translation="MALEITKNKAAPEIEQKSKGLNGFLWLLVVAIVIVAAVSNIYLVE
FT                   KFSTALRVVGIVVALLIALGIAAITNQGMKARRFFSDSRIELRRITWPTRPEAMQTTLI
FT                   VFAVTVIASLILWGLDSVIVSLITFLTDLRF"
FT   gene            complement(55438..56622)
FT                   /locus_tag="HSM_0063"
FT   CDS_pept        complement(55438..56622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0063"
FT                   /product="translation elongation factor Tu"
FT                   /note="TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain protein;
FT                   elongation factor Tu domain 2 protein; KEGG: hso:HS_1644
FT                   elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32285"
FT                   /db_xref="GOA:B0UV21"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UV21"
FT                   /protein_id="ACA32285.1"
FT                   /translation="MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLSKHFGGAAR
FT                   AFDQIDNAPEEKARGITINTSHVEYDTATRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVAATDGPMPQTREHILLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDF
FT                   PGDDTPIVRGSALQALNGVAEWEEKILELASHLDNYIPEPERAIDQPFLLPIEDVFSIS
FT                   GRGTVVTGRVERGIIRTGEEVEIVGIKETTKTTVTGVEMFRKLLDEGRAGENIGALLRG
FT                   TKREEIERGQVLAKPGSITPHTDFESEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTG
FT                   TIELPEGVEMVMPGDNIKMTVSLIHPIAMDQGLRFAIREGGRTVGAGVVAKIIK"
FT   gene            complement(56725..56800)
FT                   /locus_tag="HSM_R0001"
FT                   /note="tRNA-Thr2"
FT   tRNA            complement(56725..56800)
FT                   /locus_tag="HSM_R0001"
FT                   /product="tRNA-Thr"
FT   gene            complement(56804..56878)
FT                   /locus_tag="HSM_R0002"
FT                   /note="tRNA-Gly3"
FT   tRNA            complement(56804..56878)
FT                   /locus_tag="HSM_R0002"
FT                   /product="tRNA-Gly"
FT   gene            complement(56921..57005)
FT                   /locus_tag="HSM_R0003"
FT                   /note="tRNA-Tyr1"
FT   tRNA            complement(56921..57005)
FT                   /locus_tag="HSM_R0003"
FT                   /product="tRNA-Tyr"
FT   gene            complement(57037..57112)
FT                   /locus_tag="HSM_R0004"
FT                   /note="tRNA-Thr1"
FT   tRNA            complement(57037..57112)
FT                   /locus_tag="HSM_R0004"
FT                   /product="tRNA-Thr"
FT   gene            57327..58280
FT                   /locus_tag="HSM_0064"
FT   CDS_pept        57327..58280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0064"
FT                   /product="pantothenate kinase"
FT                   /EC_number="2.7.1.33"
FT                   /note="TIGRFAM: pantothenate kinase; PFAM:
FT                   phosphoribulokinase/uridine kinase; KEGG: hso:HS_0196
FT                   pantothenate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32296"
FT                   /db_xref="GOA:B0UV22"
FT                   /db_xref="InterPro:IPR004566"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UV22"
FT                   /protein_id="ACA32296.1"
FT                   /translation="MEELNTIKLSDHLTPFLTFNRQQWAELRKSVPLKLTEQDLKPLLG
FT                   FNEELSLEEVSTIYLPLARLINYYIEENLRRQTVLKRFLSGHNPKVPYIISIAGSVSVG
FT                   KSTSARILQSLLANWPVARKVDLITTDGFLYPLEILQKKNLLQKKGFPISYDTQRLIRF
FT                   LADIKSGKKNVKAPIYSHLTYDIIPNQFDIVDRPDILILEGLNVLQIGSNKSNQMFVSD
FT                   FVDFSIFVDAEEDQLKEWYIKRFLKFCRSAFTDPNSYFKHYANLSEQEAIETASQIWDN
FT                   INGLNLKQNILPTRERANLILKKGENHKVELVKLRK"
FT   gene            complement(58334..59542)
FT                   /locus_tag="HSM_0065"
FT   CDS_pept        complement(58334..59542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0065"
FT                   /product="sodium/glutamate symporter"
FT                   /note="PFAM: sodium/glutamate symporter; KEGG: hso:HS_0197
FT                   sodium/glutamate symporter (glutamate permease)"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32307"
FT                   /db_xref="GOA:B0UV23"
FT                   /db_xref="InterPro:IPR004445"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV23"
FT                   /protein_id="ACA32307.1"
FT                   /translation="MTFGTYETVALACLVLLLGYFLVKRVHFLSEYNIPEPVVGGFIVA
FT                   IILSIVHHFWDMSFSFDTKLQTTMMLVFFSSIGLSANFARLAKGGKPLVIFLFAALGLI
FT                   ILQNTVGIGTSMLVGLDPAYGLIAGSVTLTGGHGTGAAWAETLSNRFGIQGALELAMAC
FT                   ATFGLVFGGIIGGPVARFLLKRLHKAEVLEDENVDDIEEVFEKPVYRRKINTRSIIETI
FT                   TMMSVCLIVGQYLDVLTKGTALQLPTFVWCLFTGTVIRNALAHVVKFKVADEAIDVLGT
FT                   VGLSLFLAIALMSLKLWELAGLALPILVVLVAQVVVMAAYSIFVTYRMMGRDYDAVVLS
FT                   AGHCGFGLGATPTAVANMQAVTSHFGPSHKAFLIVPMVGAFFIDLLNSVALNIFLNIVD
FT                   VLH"
FT   gene            complement(59724..63200)
FT                   /locus_tag="HSM_0066"
FT   CDS_pept        complement(59724..63200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0066"
FT                   /product="DNA polymerase III, alpha subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: hso:HS_0198 DNA-directed DNA polymerase, alpha
FT                   subunit (DNA polymerase III, alpha subunit); TIGRFAM: DNA
FT                   polymerase III, alpha subunit; PFAM: PHP domain protein;
FT                   nucleic acid binding OB-fold tRNA/helicase-type; DNA
FT                   polymerase III alpha subunit; SMART: phosphoesterase PHP
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32318"
FT                   /db_xref="GOA:B0UV24"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV24"
FT                   /protein_id="ACA32318.1"
FT                   /translation="MSQPRFVHLRVHSDFSMINGITKVKPLIKACVQHEMVAMALTDFT
FT                   NFCGLVRFYGEAQSSGVKPIIGADVLVKSDLLGDELFELTLLAKNNEGYHNITLLLSKA
FT                   YERGYYNLPYIDQSWLAEHHEGIIILSGGRNGDVGKKLLKNNSADVETAVAFYQEYFPD
FT                   HFYLSLSRTGRSDEDRYIQSALILAQQKQLPLVATNDVCFLSPEDFEAHEIRVAIHDGY
FT                   TLDDPKRPKLYSSQQYFRSEQEMCELFADIPTALENTVLIAQRCNVTIRLGTYFLPKFP
FT                   TGDLSPEDFLIQKSKEGLEERLQTLFPDPQVRSEKRKEYDDRLQTELDVINKMGFPGYF
FT                   LIVMEFIQWSKDNDIPVGPGRGSGAGSLVAYALKITDLDPLEFDLLFERFLNPERVSMP
FT                   DFDVDFCMDKRDRVIEHVAETYGRGAVSQIITFGTMAAKAVIRDVGRVLGHPYGFVDRI
FT                   AKLIPADPGMTLTKAFEAEPRLSEIYNNDEEVKALIDMARKLEGVTRNAGKHAGGVVIS
FT                   PSLITDFSPLYCDSEGKHPVTHFDKNDVEYAGLVKFDFLGLRTLTIIKWALDMINARLV
FT                   KEGKSAVDISTIPLNDPDSFNLLKKAETTAVFQLESRGMKDLIKKLQPDCFEDIIALVA
FT                   LFRPGPLESGMVQNFIDRKHGVEPVSYPDVKYQHESLKPILEPTYGVIVYQEQVMQIAQ
FT                   VLAGYSLGGADLLRRAMGKKKPEEMAAQRDIFEKGAIAKGIDGDLAMKIFDLVEKFAGY
FT                   GFNKSHSAAYALVSYQTLWLKTHYPAEFMAAVMTSEMDNTDKIVSFYDECLRMGLTIVP
FT                   PDINTGKHHFSVNDNGEIVYGIGAIKGVGEVPINAIVSAREQGGIFKDLFDLCARVDLK
FT                   QINRRTFENLIKSGAFDKLGPHRAALAQNLEDALKASDQHAKDEAIGQVDMFGVLTSSH
FT                   EDVETAYAHTPRWSEKQILDGERETLGLYLSSHPITRYLKELSHYSSTRLNELSPNTRG
FT                   KISTVCGLIVALRFAVTKKGNRLGIATLDDRSGLLDITLFADALERFGDKLQKDTVVIV
FT                   SGTVSFDDFSQGLKMSVRELMTLDEARSRYAKNLAISLSQEQITPHFIRQLKGIIEPCS
FT                   GGSLPIHLYYQSKDGRALIRFGVQWSVYPTDELLSALVTMLGENAVELEFD"
FT   gene            complement(63366..65936)
FT                   /locus_tag="HSM_0067"
FT   CDS_pept        complement(63366..65936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0067"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="PFAM: AAA ATPase central domain protein; Clp domain
FT                   protein; ATPase associated with various cellular activities
FT                   AAA_5; ATPase AAA-2 domain protein; SMART: AAA ATPase;
FT                   KEGG: hso:HS_0199 ATP-dependent Clp protease, subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32329"
FT                   /db_xref="GOA:B0UV25"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV25"
FT                   /protein_id="ACA32329.1"
FT                   /translation="MNIDKLTTKFQQAIAEAQSLAIGKDHQFIEPVHLMTALLNQQDGS
FT                   IPPLLTASGGNLALLHNDLAAELSRLPQVSGNNGDIQVSRSLVKLLNLCDKLAQQRQDK
FT                   FISSELFLLAILEDKGALSESLKKCGIKQENLLQAIDKLRGGEKVNEQGAEENRQALEK
FT                   YTIDLTARAESGKLDPVIGRDEEIRRAIQVLQRRTKNNPVLIGEPGVGKTAIVEGLAQR
FT                   IVNGEVPEGLKGKRVLSLDMGALIAGAKYRGEFEERLKAVLKELAQEEGRVILFIDEIH
FT                   TMVGAGKTDGAMDAGNLLKPSLARGELHCVGATTLDEYRQYIEKDAALERRFQKVFVGE
FT                   PTVEDTIAILRGLKERYEIHHHVQITDPAIVAAATLSHRYISDRQLPDKAIDLIDEAAS
FT                   SIRMEIDSKPQPLDRLERRIIQLKLEQQALQKEDDEASRKRLDLLEEELGEKEREYAEL
FT                   EDVWKAEKAALSGAQHIKAELDNAKIQMEQARRISDFAKMSELQYGRIPELEKQLAQAE
FT                   SAEGKEMTLLRNRVTDEEIAEVLSRATGIPVAKMMEGEKDKLLRMEQELHKRVVGQSEA
FT                   VVAVANAIRRSRAGLSDPNRPIGSFLFLGPTGVGKTELCKTLANFMFDDENAMVRIDMS
FT                   EFMEKHSVSRLVGAPPGYVGYEEGGYLTEAVRRRPYSVILLDEVEKAHSDVFNILLQVL
FT                   DDGRLTDGQGRTVDFRNTVVIMTSNLGSDLIQGNKELDYNAMKEVVMSVVGQHFRPEFI
FT                   NRIDETVVFHPLAKENIRAIATIQLQRLVKRMETHGYQLEFTDATLDFIGEVGYDVIYG
FT                   ARPLKRAIQQEIENPLAQQILSGQLLPGKKVIVDYVDGKVVAKQ"
FT   gene            complement(66120..66581)
FT                   /locus_tag="HSM_0068"
FT   CDS_pept        complement(66120..66581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0068"
FT                   /product="protein of unknown function DUF606"
FT                   /note="PFAM: protein of unknown function DUF606; KEGG:
FT                   hso:HS_0200 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32340"
FT                   /db_xref="GOA:B0UV26"
FT                   /db_xref="InterPro:IPR006750"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV26"
FT                   /protein_id="ACA32340.1"
FT                   /translation="MLLPFILIALCAGIALAAQAAINTQLAQSLSGQPVFAAFVSFAMG
FT                   TIALFFICWWKMDLFSALQQVPKQPLWKLIGGLLGALAVFTTIFLAPKIGVTNMLFFII
FT                   VGQLLTALIIDHFGLIGMTQRAVNVWQLIGFVVIGFGLLLFFFGKKLFH"
FT   sig_peptide     complement(66519..66581)
FT                   /locus_tag="HSM_0068"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 21"
FT   gene            66765..67022
FT                   /locus_tag="HSM_0069"
FT   CDS_pept        66765..67022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0069"
FT                   /product="sodium pump decarboxylase, gamma subunit"
FT                   /note="TIGRFAM: sodium pump decarboxylase, gamma subunit;
FT                   PFAM: sodium pump decarboxylase gamma subunit; KEGG:
FT                   hso:HS_0201 oxaloacetate decarboxylase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32351"
FT                   /db_xref="GOA:B0UV27"
FT                   /db_xref="InterPro:IPR005899"
FT                   /db_xref="InterPro:IPR023424"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV27"
FT                   /protein_id="ACA32351.1"
FT                   /translation="MTNTNVQLIQEGVNLMLSGMGFVLVFLLILIFAIKLMSKLIGYFS
FT                   SEPTLPQQAFIPTTELNDLERLRPVIVAAIAHHRRQQNLQ"
FT   gene            67035..68834
FT                   /locus_tag="HSM_0070"
FT   CDS_pept        67035..68834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0070"
FT                   /product="oxaloacetate decarboxylase alpha subunit"
FT                   /note="TIGRFAM: oxaloacetate decarboxylase alpha subunit;
FT                   PFAM: biotin/lipoyl attachment domain-containing protein;
FT                   pyruvate carboxyltransferase; Conserved carboxylase region;
FT                   KEGG: hso:HS_0202 oxaloacetate decarboxylase, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32363"
FT                   /db_xref="GOA:B0UV28"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR005776"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV28"
FT                   /protein_id="ACA32363.1"
FT                   /translation="MATHEKKISITDVVLRDAHQSLFATRLRLDDMLPIAAELDKIGYW
FT                   SLEAWGGATFDACIRFLGEDPWVRLRELKKAIPNTPLQMLLRGQNLLGYRHYADDVVNK
FT                   FVERAVANGMSVFRVFDAMNDPRNMQQALRAVRKNGGHAQGTLSYTTSPVHTLETWLDT
FT                   TEQLLEIGIDSLVIKDMSGILSPVEAYKLVSEIKKRYDVRLHMHCHSTTGMAEMALLKA
FT                   IEAGADGIDTAISSMSGTYGHPATEALVATLDNTQYDTGLSIPQLERIADYFRNVRKKY
FT                   AKFEGQLRGVDSRILVAQVPGGMLTNLENQLKQQNASDKLDKVLQEIPKVRADLGYIPL
FT                   VTPTSQIVGTQAVINVLMGERYKTIAKETAGILKGEYGRTPAPVNAELQAQVLAGEQPI
FT                   TDRPADHLAPEMDKLSTEIKRMVKEKGIQLAENEIDDVLIVALFPQVGLKFLENRGNPN
FT                   AFEPVPTNEVKTSEKPTALSSRNDSAVYTVEVEGKSFVVKVTEGGDISHITPVSTAPST
FT                   QSTEPATSATTKNIPVNAPMAGNIWKVLVKEGQQVAEGEVLLILEAMKMETEIRAATSG
FT                   TVQGIKVKAGDTVAVGDILLTLA"
FT   gene            68847..70151
FT                   /locus_tag="HSM_0071"
FT   CDS_pept        68847..70151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0071"
FT                   /product="sodium ion-translocating decarboxylase, beta
FT                   subunit"
FT                   /EC_number="4.1.1.70"
FT                   /note="TIGRFAM: sodium ion-translocating decarboxylase,
FT                   beta subunit; PFAM: Na+transporting
FT                   methylmalonyl-CoA/oxaloacetate decarboxylase beta subunit;
FT                   KEGG: hso:HS_0203 oxaloacetate decarboxylase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32374"
FT                   /db_xref="GOA:B0UV29"
FT                   /db_xref="InterPro:IPR005661"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV29"
FT                   /protein_id="ACA32374.1"
FT                   /translation="MESILALLQGTGIMHLSWGQAIMLVISLLLLYLAVVKKFEPLLLL
FT                   PIGFGGLLSNIPEANMAFSALENLLHSNNNQHLSTLANLLHSDTDVQAIKQVLEKAPAL
FT                   LHVQAELLAKDLGYTDGVLSTFYDVAINSGAAPLIIFMGVGAMTDFGPLLANPKTLLLG
FT                   AAAQFGIFATVLGALALNGLGIIEFTLPQAAAIGIIGGADGPTAIYLASKLAPELLGAI
FT                   AVAAYSYMALVPLIQPPIMRLLTTKQERKIKMVQLRNVSNREKILFPIVLLVLVALLLP
FT                   DAAPLLGMFCFGNLMRVSGVVERLSDTAQNALINIVTIFLGLSVGAKLVADKFLQPQTL
FT                   GILLLGIIAFAIGTASGVLMAKLMNCFSKDKINPLIGSAGVSAVPMAARVSNKLGLEAD
FT                   HQNFLLMHAMGPNVAGVIGSAIAAGVMLKYIAAMM"
FT   gene            complement(70224..71177)
FT                   /locus_tag="HSM_0072"
FT   CDS_pept        complement(70224..71177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0072"
FT                   /product="transaldolase"
FT                   /EC_number="2.2.1.2"
FT                   /note="TIGRFAM: transaldolase; PFAM: Transaldolase; KEGG:
FT                   hso:HS_0204 transaldolase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32385"
FT                   /db_xref="GOA:B0UV30"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004730"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UV30"
FT                   /protein_id="ACA32385.1"
FT                   /translation="MTTQLDALRNMTVVVADTGDIDAIKKYQPQDATTNPSLILSASSL
FT                   PQYAPLIDEAIAYAKAKSADKTQQLIDAEDKLAVNIGLEILKIVPGRISTEVDARLSYD
FT                   TQATVEKARKLIALYNEAGISNDRILIKIASTWQGIRAAEILEKEGINCNLTLLFSKAQ
FT                   ARACAEAGVYLISPFVGRILDWYKANSDKKEYAPAEDPGVISVTKIYNYYKQYGYNTVV
FT                   MGASFRNVGEITELAGCDRLTIAPALLKELQENSTALVRKLAFKGEVKAKPQPLTESQF
FT                   YWQHNSDPMAVEKLADGIRKFAIDQEKLEKMLLEKF"
FT   gene            71365..73710
FT                   /locus_tag="HSM_0073"
FT   CDS_pept        71365..73710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0073"
FT                   /product="Organic solvent tolerance protein"
FT                   /note="PFAM: OstA family protein; Organic solvent tolerance
FT                   protein; KEGG: hso:HS_0205 organic solvent tolerance
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32396"
FT                   /db_xref="GOA:B0UV31"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR007543"
FT                   /db_xref="InterPro:IPR020889"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV31"
FT                   /protein_id="ACA32396.1"
FT                   /translation="MKKNYYTVLSLSILTALYSTSSQANLQQQCLIGVPHFQGEIVQGD
FT                   PNELPVYIEADHAKMNQSTHAQYEGNVNVKQGNRHLTAGMIEIEQHGKDNAKRYAYAKN
FT                   GFDYKDNLIQLNGDNAKIHLDSKDANIQDADYQLVGRQGRGTADEVELREHYRVMKNAT
FT                   FTSCLPNSDAWSIEAKEMRQHIQEEYAEMWHARFKVSGIPIFYTPYLQLPIGDRRRSGL
FT                   LIPKAGISTRHGYWYAQPFYWNIAPNFDATFTPKYMSHRGWQLNAETRYLTRIGEGKFV
FT                   VEYLKTDRHSDYLNTARSRHLFYWGHNSHFLKDWRLNVNYTKVSDKHYFNDFESEYGNS
FT                   TDGYVDQQASISYYQPNYNLSISAKQFQIFDKVDIGPYRALPQIDFNYYRNEIANGLVD
FT                   FSLFSQVVRFDNDSALMPTAWRFHIEPSLTFPLSNRYGSLNIETKLYATRYLQKRGKGE
FT                   NAEEIKKTVNRVLPQIKLDFQTVLANRQSFIEGYTQTLEPRFQYLYRPYKDQSDIGLKQ
FT                   QNNDYLGFGYDSTLLQQDYFSLFRDRRYSGLDRIVSANQITLGGTTRFYDKNANERFNL
FT                   SIGQIYYLKDSRTDNNPQNMAQGRSSSWSLESNWRINSKWNWRGSYQYDTHLNQTSLAN
FT                   TVLEYNSEKNNLIQLSYRYVNQSYIDQNLIGKNTYGQSIKQLGMTTAWELTDHWTLVGR
FT                   YYQDLALKKPVEQYLGIQYNSCCWSIGVGARRYVTNRANQRNDEVLYDNSLSLTFELRG
FT                   LSPSDHKNNIDEMLKKGKLPYIKAFSLY"
FT   sig_peptide     71365..71439
FT                   /locus_tag="HSM_0073"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 25"
FT   gene            complement(73787..74866)
FT                   /locus_tag="HSM_0074"
FT   CDS_pept        complement(73787..74866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0074"
FT                   /product="fructose-bisphosphate aldolase, class II"
FT                   /EC_number="4.1.2.13"
FT                   /note="TIGRFAM: ketose-bisphosphate aldolase;
FT                   fructose-bisphosphate aldolase, class II; PFAM:
FT                   ketose-bisphosphate aldolase class-II; KEGG: hso:HS_0206
FT                   fructose-bisphosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32407"
FT                   /db_xref="GOA:B0UV32"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006411"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV32"
FT                   /protein_id="ACA32407.1"
FT                   /translation="MAKLLDIVKPGVLTGDDVQKVFAYAKANNFAIPAVNCVGTDSVNA
FT                   VLETAARVKAPVIIQFSNGGAAFYAGKGIKPASGIRPDVLGAIAAAKHVHTLAAEYGVP
FT                   VILHTDHAAKKLLPWIDGLLEAGEKHFCETGKPLFSSHMIDLSEEPMAENMAICREYLA
FT                   RMDKMGMTLEIEIGITGGEEDGVDNSDVDESKLYTQPEDVLFVYDQLSPISPRFTIAAA
FT                   FGNVHGVYKPGNVKLKPSILGASQEFVSKERNLPAKSLDFVFHGGSGSSTEEIREAISY
FT                   GAIKMNIDTDTQWATWEGVLNFYKANEAYLQGQLGNPEGPDAPNKKYYDPRVWLRKAEE
FT                   SMSKRLEKSFEDLNCVDVL"
FT   gene            complement(74958..76127)
FT                   /locus_tag="HSM_0075"
FT   CDS_pept        complement(74958..76127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0075"
FT                   /product="Phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="PFAM: phosphoglycerate kinase; KEGG: hso:HS_0207
FT                   phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32418"
FT                   /db_xref="GOA:B0UV33"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UV33"
FT                   /protein_id="ACA32418.1"
FT                   /translation="MSVIKMTDLDLAGKRVFIRADLNVPVKEGKVTSDARIKATIPTLK
FT                   LALEKGAKVMVTSHLGRPTEGEFKPEDSLQPVVDYLKGAGFNVRLAQDYLNGVEVNEGE
FT                   IVVLENVRVNKGEKKNDPELSKKYAALCDVFVMDAFGTAHRAQASTYGVAEFAPVACAG
FT                   PLLAAELEALGKALKEPQRPMLAIVGGSKVSTKLTVLDSLSKIADQLIVGGGIANTFIA
FT                   AEGHNVGKSLYEADLIPEAQRLSKVTNIPVPVDVRVGTEFSETALSTEKSVADVSGEES
FT                   IFDIGDKSAEQLADIIRNAKTILWNGPVGVFEFPNFRKGTEIVSNAIAEATANGAFSIA
FT                   GGGDTLAAIDLFGIKDKISYISTGGGAFLEFVEGKVLPAVEILEKRANG"
FT   gene            76366..76626
FT                   /locus_tag="HSM_0076"
FT   CDS_pept        76366..76626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0076"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: hso:HS_0208 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32429"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV34"
FT                   /protein_id="ACA32429.1"
FT                   /translation="MALLITDKCTNCDMCLPECPNDAISIGDEIYIIDPHLCTECVGHY
FT                   DTPTCQNVCPITNCIKIDPEHIETEEQLWERFVLIHHADKI"
FT   gene            complement(76675..88866)
FT                   /locus_tag="HSM_0077"
FT   CDS_pept        complement(76675..88866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0077"
FT                   /product="YadA domain protein"
FT                   /note="PFAM: YadA domain protein; Haemagluttinin domain
FT                   protein; Hep_Hag repeat-containing protein; KEGG:
FT                   hso:HS_0790 possible large adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32440"
FT                   /db_xref="GOA:B0UV35"
FT                   /db_xref="InterPro:IPR005594"
FT                   /db_xref="InterPro:IPR008635"
FT                   /db_xref="InterPro:IPR008640"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR024973"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV35"
FT                   /protein_id="ACA32440.1"
FT                   /translation="MNKIFKTKYDVTTGQCKAVSELASNRQIASSSKSKPKCGVFLGNF
FT                   LGIFKFSPLVLLMSGMLGVSSVSYADITYIDMDGNTGAAGVRENWREADYWKKNGRENT
FT                   LLTQVQNSPRKYDKDVNTNVYKSVIIGPHSAGVNTNRDQSTGVGMTILGHGAVGFASQT
FT                   TAIGNNVYSGGQQATALGSDVMAAGYASIAIGNDDIANTYRDKLPEKTIMKIYGYDTNT
FT                   RYSGTTYKNILNEQNFKMKYGINNGVDNRIYSPTYAAGVASIAIGSRSVAYGNASLAIG
FT                   TLSFALANDSTAVGVRAFVNDDATGGVAIGDESRVFAANSFAIGNETEATNQGALTFGS
FT                   GSKAVGIGSIAIGSNVASNALIASNGYETFQNSIMQHTQNSSPVVEVDRHNEYNTLFKI
FT                   DENNLKYGDENHIVKLGFNASNPSNSKNPISEIIEKVISDKKRIAFSHERDEVIETTSK
FT                   IYKTTKEGDHSISLGYHLSNNGDNTITIGSASVVRGANSVVLGALNNIGKYARNTIALG
FT                   IGTNVYKENSVAIGTGINVIGAGAVAIGSGVGVTKDNTISIGYGSHGLSSESIVLGNSA
FT                   SLKDHSKKSILIGNSAKVENQSQNKNVKIANLKKGKFGLEAEKVELEMSAISIGTESYV
FT                   YSEKGIALGDNAKIEANSENAIAFGTNSKASKKSAIALGNETEATMENSVALGYKSHTK
FT                   YFYQDANKNTATLTGKEAIDLTPYVPEGSSYSLRTDKSAGIISVGWTKGNSGSQELGLR
FT                   RIVGVAPGALDSDVATIGQLKALEYVKREGLVVYYTEDNGKIYKLVKGTDGKFYKVNTK
FT                   NGTPLDKQEIPKEKVLVGAKGHNEKIQYINADKQIADIGEKIRFGHLADGEISQTSDQA
FT                   ITGNQLKNVGDILGVSVNTPNNTQFDRYKFTAVDYKGSQKKQKTIFKDAIEELITAVNK
FT                   GIVIQDADSHTGTLNLGSTLTIKAGNIDKPKSDVDGFSSDNIKTSYQPTRKELLIGIKD
FT                   KPIFKEVTISGTVNDRSDKKTLTTKEYVDGKLANVATSFTVNGNMGNYIVQSALNIKGK
FT                   ADASQHKNITTEAKTNEKELEISLNKDLKDIASITGEGIKSGKNTVYSKIAFNSTNGSN
FT                   ATTNVTISSNGANYTFDRTGFDMSDRRITRLQSGLNTQHHGPKGANGNPENVSKILDGS
FT                   YITTIKGNAVNVSDLSNVAKAIVEKGLKFAGDSGSEITRKLGEKLTIKGNGTDLTSKTD
FT                   SNKGEITFTLHKATSIDDNTATNSNKDKVVTAGAVKTYLDSKIDEVSTTLGLEADNSKN
FT                   SGPTGKVNLKNEKLKVAGTSDEIETKVEQDKQSITLSFAQNTKNKLGMITVDGDKLALG
FT                   KNAKTVDKMTAPKEAKVTVGNDSLKFNWTGGVSADDKEQSKKSVISVGDTGKEHLITHV
FT                   AAGKVEVNSTDAINGSQLYGVVDAFSKLAINVLGAKADLTSGFKKSSFDVVKYNGNTNT
FT                   QTSKEMTFKDAIGQNTTAINKGFIFGVGDSNNEQGTHYLGDKLIIKAGAVDKPTSTSDD
FT                   GYSPDNIKTAYLAKSKELLIGIKDKPTFKEVKVSGTVDDSSDGKTLTTKTYVDGKLANV
FT                   AANFDVKGDNNVVYTLNKQNNVLNINGDTKNITTAVDKNAKKVSITLKEALTGITSIGK
FT                   DTNNQIAFSDSGTILKAGGSSLNLTGSSGKVKISNVANGTSDNDAINKSQLNSVVSALG
FT                   GEAKIGADGNVIAPSYTLANGNKAPYTTVGEALSALDEVLTSVNGAGITFSDGTTNNDF
FT                   VRKNSENDKKVVIKSGSNINVSLSKTNSDKTGEFTVALNKDLEDINSITLKDSGGHSAT
FT                   NKTGKITIDGVTGDVKVQHGDGRASKIVIESGLNALTGNDEIQVTGGGKVFGNASLSLK
FT                   DASIAGTKLKDNTIAEAKLDQGIKDKLNKTFMVKAEGATSDNLIGNTLEFAAKDSNLTV
FT                   ELDKSNKKISYGLSSTLTGIESIAKDKTKISLADTKIKLMPEEGAALTLTKSDTDKVKI
FT                   SGLGDGQIDGASNEAITGKQLHDLAGKLGVTVDNAKAGFTQPSFTKVNYQGQTETNGKT
FT                   TFKEAINDLIVAVNKGLVVGDGTVKGTLQLGDTLQIKAGNIDKKSTSDDGFSSDNIKTS
FT                   YQQNTKELLIGIKDKPSFKQVTVTEEINEKSPKTALTTKKYVDSKATQNEQAIANQEIK
FT                   YKANGAGDNKVKLSEGLDFKNDDNITVTADAGGAITHKLNADLKNITSIAGKGDSGTAP
FT                   KIDFANGDGLKISSKGTDLTLKADGLDLNNKQITGIASGLDQKMNGASGRQDLDELLKL
FT                   VATGQPQNGGTSNDGKLNKAINAGDLLHIANELKNKGLSFQGNDGKDVTRKLGETLKIV
FT                   GETSATTPTDSTQPAMETAPDNITVAKKTGNGDDTLEIKLSKNLKGIASIANGDKAKIA
FT                   LDKDKGTITFTAGDQARSKDVTLSAGKFSGVSEINKEEGKGALKLTENTATLESAKDNS
FT                   KLELKDKAVTLESTKDGSSVTLDGTSATLSAGKNKGSIKVTNGADNKIELSPENGSTVM
FT                   LKKDMTNGGVQATGLSTIGKDDDNALVFKNSTSGTDKTAELKVGGSALTFTKATTGNTV
FT                   KISNVEDGKIDTSSTEAITGKQLHDLASKLGVEVESETGFKQPSFTAIKGGTSSTGGTT
FT                   NSNTGPTTFKEAINQLITAVNGGLTFKGNDNGSSPSSTTLQLGGTLTIDSSTSKVKADG
FT                   MAEATQKDITVSLAPSNGNNPQSAGTLTLKLNKATTVSETDEKVVTSKAVATKLKEYTT
FT                   TAQLQTDFLKVDGSNIGDKKLALGKNVGIDTIKLGETEKSTTELVQADAVIKYLKGTGD
FT                   KSVKVSDNPETKADGEGSIAIGDKAVAENEGAIAIGYDTSAKNRRSVAIGREAQVLGEH
FT                   ATAIGYKNNVSGNDSGAFGKDNEIIGKHSYAVGAYNKIEGDHVYALGSNITTTKDITNA
FT                   VILGNKSTGVSNAVSVGGAGKDEQRRIVYVATPTDKYDAVNKKYVDDLTLSYKTNSDDK
FT                   TKQSINLKTGALDFKKSENISVSVEADGKITHTLNNNLQEITSIKGGKDESGAKITLET
FT                   AKKEISFNDSKLTNLADGEIGDSSKEAVTGKQLADLAKQLGIAVDTSDKTKFTAPTFDN
FT                   FKLKDINGTDGTAPKNIVEGLKNAVSKLNEGLKFSADMPSAVANGTQSTPHYLGSTLSI
FT                   VRLDMNQAGSSATPAPAGTSSQPNIAEFKGDNLITQYTREANGNAKIEIGFKNAPTFSK
FT                   VMLAEEQTYNGVNGNSGSTDWKKELITKGYLEQALDKFKFKVENGSGKTIEIGRNDTLK
FT                   FTSGQNIKVDLAKNGTTPSSTGSTSPSASAPAPTPAAPASVSSAAPSSSSGGAGSNGGG
FT                   SNSMASSGGSNGAGMATTTPTSAPTTTPTTTTPTTTAVVTIGTTEELKNITSISSKPKA
FT                   GSAGGSGTGSSAVGNQDEVTKLTLDAEKGATFQVGNQGTEVNINKDGISLTPQSKDGKA
FT                   TLNKDGLTVGDKEAANGDKTHTVYGKDGLTVKGKDSSKEVVSLKVADGENSQGNNGGNG
FT                   QSATLAFAKIGNGSGAGTGADAKGTGTGKITGLADIKPDEKDGTLATNKNYVDGKVSDL
FT                   NNNRPFDFYLNGEKVVKDKDGNFKKLKDGKPDQLLTEEEKKQVVIKAEPSTAPIGISNV
FT                   ASGLGITTPTKDEKKQLSELAEKVNEKVEALGEKAKTLSDTATKLADLELMVDSLKQTI
FT                   DTLPDGEAKEKIRENLKKYETQLSDAQEAKKNAEEAVESARNELIEANGDYNAFSEAMA
FT                   KVEELVEPDSQANLSNVATVGDLQAVARAGLNFVGNDDVTVHKNVGETLSITGEGTFNS
FT                   NRTATGNIKVEMAQDGKGLEVKLSDQLKNMTSFETREVEGRKSTLDSNGLRVVNKGKDG
FT                   TDDKAKSATYGAEAVVLEDKNKSDKAVITAGGIRFADSSTQTTALSTELNKNGLTVNGA
FT                   GGQIHIDGTKGVITVPNIKPNADGHVVVNKNYVDTKNNELRTQMNNNDRNMRAGVAQAV
FT                   AQANLPINILPGKSTLSLATGNYMGSQAFAVGYSRVSDNGKLSVKFSLGHGDKKTSVGA
FT                   GVGYSW"
FT   gene            complement(89145..89384)
FT                   /locus_tag="HSM_0078"
FT   CDS_pept        complement(89145..89384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0078"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmu:673901 hypothetical protein LOC673901"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32451"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV36"
FT                   /protein_id="ACA32451.1"
FT                   /translation="MYITYHRNKMSLQPTAYSLQPTAYSLQPTAYSLQPTAYSLQPTAY
FT                   SLQPTAYSLQPTAYSLQPTAYSLQPTAYSLQPTA"
FT   gene            complement(89441..90190)
FT                   /locus_tag="HSM_0079"
FT   CDS_pept        complement(89441..90190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0079"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: hso:HS_0210 polar amino acid ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32462"
FT                   /db_xref="GOA:B0UV37"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV37"
FT                   /protein_id="ACA32462.1"
FT                   /translation="MIKIRNIHKTFDNNPVLRGIDLDIEKGQVVVILGPSGSGKTTFLR
FT                   CLNALELPEQGTIEFHKENPLYIDFTDKHIRKNILPLRKKSGMVFQQYNLFPHKTALEN
FT                   IMEGPVQVQQRKPDEVRQEAETLLCKVGLIDKANLYPHQLSGGQQQRVGIARALAIRPE
FT                   LMLFDEPTSALDPELVQDVLNTMKGLANEGWTMVVVTHEIKFALDVADVVVVMDKGIIV
FT                   EQGSPKTLFENPQHERTKAFLHQIRFN"
FT   gene            complement(90204..90935)
FT                   /locus_tag="HSM_0080"
FT   CDS_pept        complement(90204..90935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0080"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: hso:HS_0211 amino
FT                   acid ABC transporter, permease"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32472"
FT                   /db_xref="GOA:B0UV38"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV38"
FT                   /protein_id="ACA32472.1"
FT                   /translation="MVEISVLNNFLASLPFMTEARAELVINGFFPMVKAAVLVSIPLAI
FT                   VSFILGMVIAIAVALIRVSPSHSIIHRLFLFITKIYISIIRGTPMLVQISIVFYGLPAL
FT                   GIFIDPIPAAIIGFSLNVGAYASETVRAAIQSVPKGQWEAGYTIGMTYMQTFRRIIVPQ
FT                   AFRVAVPPLSNTFISLFKDTSLASVVTVTEMFRVAQQVANMSYDFLPVYIEAALIYWCF
FT                   CFILFLWQARIEKKLARYVTR"
FT   gene            complement(90910..91692)
FT                   /locus_tag="HSM_0081"
FT   CDS_pept        complement(90910..91692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0081"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   KEGG: hso:HS_0212 amino acid ABC transporter,
FT                   substrate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32483"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV39"
FT                   /protein_id="ACA32483.1"
FT                   /translation="MLKKITFLFTTVFAIVANTQALAQASLLDRINNKGTITVGTEGTY
FT                   APFTYHDSTGKLTGYDVEVTRAVAKKLGVTVEFKETQWDAMLAGLKAGRFDLVANQVAL
FT                   TTPERQATFDKSEPYSWSGAMLVARDNETRIKQVEDVKGLKAAQTLSSNYGELAQKYQA
FT                   KIVPIDGMAQGLLLIQQKRADMTFNDALALLDYLKKYPNSGLKPVWESKDKVGAGLIVN
FT                   KNNDEALAKISAAIEELRNDGTLKQLGEQFFGRDISVK"
FT   sig_peptide     complement(91621..91692)
FT                   /locus_tag="HSM_0081"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.980 at
FT                   residue 24"
FT   gene            92084..92572
FT                   /locus_tag="HSM_0082"
FT   CDS_pept        92084..92572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0082"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hso:HS_0218 Haemophilus-specific protein,
FT                   uncharacterized"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32494"
FT                   /db_xref="GOA:B0UV40"
FT                   /db_xref="InterPro:IPR025911"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV40"
FT                   /protein_id="ACA32494.1"
FT                   /translation="MTMNDKLKLYRVTDHYLDFLRDVEPKIPMNKDNGKKRPFVGIVLS
FT                   INGVKYIAPLSSKICKSQSDFKVKSGGEQKATIRFAYMFPIVDSALIEIDYTEEFKIDF
FT                   KYTALLIKEDLYINQHKARIHEIATKTYTNAITKRFGFENFCCDFAKLEEKHRAYEAQ"
FT   gene            complement(92735..94123)
FT                   /locus_tag="HSM_0083"
FT   CDS_pept        complement(92735..94123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0083"
FT                   /product="anion transporter"
FT                   /note="TIGRFAM: anion transporter; PFAM: sodium/sulphate
FT                   symporter; Citrate transporter; KEGG: hso:HS_0219 conserved
FT                   transporter, NadC family"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32505"
FT                   /db_xref="GOA:B0UV41"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="InterPro:IPR031312"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV41"
FT                   /protein_id="ACA32505.1"
FT                   /translation="MSKTVSKSIFNQNALIFILDVIVFFVLLYVLPFDEKANKGLALLV
FT                   FIAVLWLTEALHVTVTALLVPFIAIALGLVTTKTALASYSAPTIFLFFGGFALATALHI
FT                   QKLDRMIANKIMMLAKGNLFIGVIYLFSITAFLSMWMSNTATASMMLPLAMGILSQLDR
FT                   TKEHNTYVFVLLGIAYSASIGGMGTVIGSPPNAIVASQLKLSFSDWLYFGLPIMLILMP
FT                   IMIGTLYIIFKPNLKASFKQNFEKVEMNNQRIITLLIFVTIAFCWIFSAKLNPMLSSLL
FT                   GLEKNIASFDSVIALLAAIAVCVSGVISWKQLQDNTDWGVLMLFGGGLTLSAVLQDSGA
FT                   SKVLADGIVFMIEGGNFYLIGLLVAAFIIFLTEFTSNSASAALLVPIFISIARSLGMPE
FT                   LGLALIIGLGASCAFMLPVATPPNAIVFGTGEIKQKEMVRAGVVLNIICVLFIGTFAYL
FT                   FWLH"
FT   gene            complement(94307..94807)
FT                   /locus_tag="HSM_0084"
FT   CDS_pept        complement(94307..94807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0084"
FT                   /product="Ribonuclease E inhibitor RraA"
FT                   /note="TIGRFAM: regulator of ribonuclease activity A;
FT                   Ribonuclease E inhibitor RraA; PFAM: Dimethylmenaquinone
FT                   methyltransferase; KEGG: hso:HS_0220 regulator of
FT                   ribonuclease activity A"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32512"
FT                   /db_xref="GOA:B0UV42"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR010203"
FT                   /db_xref="InterPro:IPR014339"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UV42"
FT                   /protein_id="ACA32512.1"
FT                   /translation="MYIDTAELCDIYLDQIDVVEPIFSSFGGKSTFFGKITTIKCFENN
FT                   GLISEILEENGEGRVLLIDGGGAVRRALIDANLAQLAADNGWEGIIVYGAIRQLQQLEN
FT                   INIGIQALAPIPVGSDEQSIGETDVPVNFGGVTFFPDDYIYADLTGIILSQEPLDLEEF
FT                   DSL"
FT   gene            complement(94854..95759)
FT                   /locus_tag="HSM_0085"
FT   CDS_pept        complement(94854..95759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0085"
FT                   /product="1,4-dihydroxy-2-naphthoate octaprenyltransferase"
FT                   /note="TIGRFAM: 1,4-dihydroxy-2-naphthoate
FT                   octaprenyltransferase; PFAM: UbiA prenyltransferase; KEGG:
FT                   hso:HS_0221 1,4-dihydroxy-2-naphthoate
FT                   octaprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32523"
FT                   /db_xref="GOA:B0UV43"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR004657"
FT                   /db_xref="InterPro:IPR026046"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV43"
FT                   /protein_id="ACA32523.1"
FT                   /translation="MANNNVKMWFETARPKTLPLAAASIMTGSALAYWSQQFSWTTTLL
FT                   CLLTTLLLQILSNFANDYGDHQKGSDTQERIGPLRAIQQGAINAKQLKQGLILVVFLSL
FT                   ISGSLLIVSAYQTIVDLVAFALLGLLAILAAITYTVGTKPYGYLGLGDVSVLIFFGLLG
FT                   VGGTYYLQTHQLNWLIFLPATATGLLATAVLNINNLRDIEQDRKAGKNTLVVRLGAENA
FT                   RIYHCIILLLSALSYIIFALYTFTHWSNFIFILSFPLLIKHAHFVYRNKNPLHLRPMLA
FT                   QMSLLALFTNLLFSLSLLVN"
FT   sig_peptide     complement(95661..95759)
FT                   /locus_tag="HSM_0085"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 33"
FT   gene            95866..96588
FT                   /locus_tag="HSM_0086"
FT   CDS_pept        95866..96588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0086"
FT                   /product="protein of unknown function UPF0066"
FT                   /note="PFAM: protein of unknown function UPF0066; KEGG:
FT                   hso:HS_0222 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32534"
FT                   /db_xref="InterPro:IPR023368"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="InterPro:IPR041369"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV44"
FT                   /protein_id="ACA32534.1"
FT                   /translation="MSKFLLHLTPIAIIHTPYKEKFSVPRQANLVQDGTGIVELLPPFN
FT                   CPEAVRGLEQFSHLWLIFQFDNVPTGKWQPTVRPPRLGGNKRIGVFASRSTHRPNPLGL
FT                   SKVELREVEYKNGKILLHLGSVDLIDGTPILDIKPYIAYADNEPNARSGFAQEKPKQEL
FT                   RVEFSPEVQATLEKLEKKRPHLKRFIREVIQQDPRPAYQKGKCFHKIYGIALYEFNIRW
FT                   RIKNDDFTVAEVIEIQNI"
FT   gene            96870..98171
FT                   /locus_tag="HSM_0087"
FT   CDS_pept        96870..98171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0087"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY2532 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32545"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV45"
FT                   /protein_id="ACA32545.1"
FT                   /translation="MKRTILHALQKWKEKPNRKPLIIQGARQVGKTWVMKHFGEQAFAK
FT                   VAYINFDNNPRMKSLFAGDYDIQRLLLGLKIESGVDIQAEDTLIIFDEIQEAPQALSSL
FT                   KYFYENAPQFYIMAAGSLLGVSLHHQVSFPVGKVDFLPLYPMDFYEFLTALGKQDLVEL
FT                   LELQDWILISAMKSRYIDLLRQYYFVGGMPEAVKTFVQTQNLDEVRQVQRNLLMAYEQD
FT                   FSKHIQDGHTVQRVRALWHAIPEQLAKENKKFVYSLLQKGARSKDYELALQWLKDSGLV
FT                   HLVPRIKKPHLPLSAYQDGAFKLFGLDVGLLTAQTHLDKSVLLEGNRLFTEFKGALTEQ
FT                   YVLQQLIASQENPVFYWATERGTAEVDFVLQYKQAVIPIEVKAEENLKAKSLKVYVEQF
FT                   QSEKAIRFSMADYREQDWMVNVPLYVVKNMFFKI"
FT   gene            98140..98292
FT                   /locus_tag="HSM_0088"
FT   CDS_pept        98140..98292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0088"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hso:HS_0222 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32556"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV46"
FT                   /protein_id="ACA32556.1"
FT                   /translation="MWLKICFLKFKGILFMHKIYGMALYEFNIRWRIKHDDDVTVAEVI
FT                   HIQHV"
FT   gene            98452..98871
FT                   /locus_tag="HSM_0089"
FT   CDS_pept        98452..98871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0089"
FT                   /product="RbsD or FucU transport"
FT                   /note="PFAM: RbsD or FucU transport; KEGG: hso:HS_0223 high
FT                   affinity ribose transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32567"
FT                   /db_xref="GOA:B0UV47"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023064"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UV47"
FT                   /protein_id="ACA32567.1"
FT                   /translation="MKKTKLLNASLSHYIATLGHTDSLVICDAGLPISNQVERVDLALE
FT                   AGVPGFLQTVDVVISEMFVEHAVVAKEIREKNPQIHDALLDSLRKLSEQQGNCIAVEYV
FT                   EHEEFKVLSSESKAAVRTGEFSPYANIILYSGVPF"
FT   gene            98892..100385
FT                   /locus_tag="HSM_0090"
FT   CDS_pept        98892..100385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0090"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: hin:HI0502 D-ribose transport system ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32579"
FT                   /db_xref="GOA:B0UV48"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015861"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV48"
FT                   /protein_id="ACA32579.1"
FT                   /translation="MQVETLLKITGVDKSFPGVKALSNACLSVYAGRAMALMGENGAGK
FT                   STLMKVLTGIYSKDSGSIEYLGDVVNFKGPKDSETAGISIIHQELNLVANLTVAENIFL
FT                   GREFTTSWGAIDWKKMYREADKLLAHLGVSFRSDQLCSELSIGEQQMVEIAKALSFKSK
FT                   VIIMDEPTDALTDTETETLFNVIRELKEQHCGIVYISHRIKEIFEICDDVTVLRDGQFI
FT                   GESAVQDLTEERLIEMMVGHRLEEQYPHVEQDRGSVRLEVNQLFGSGICDVSFKLYSGE
FT                   ILGVSGLMGAGRTELMKVLYGALPKEEGEVRLNNKVISNDSPQDGLRNGIVYISEDRKG
FT                   DGLILGMSVKENMSLTALDHLSKAGKINHQAEKMVVDDFIELFNIKTPNREQQIGLLSG
FT                   GNQQKVAVAKGLMTRPDVLILDEPTRGVDVGAKKEIYQLINKFKQEGLSIILVSSEMPE
FT                   VLGMSDRILVMHEGRISAEFSREEATQGKLLAAALGKHN"
FT   gene            100395..101354
FT                   /locus_tag="HSM_0091"
FT   CDS_pept        100395..101354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0091"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   hit:NTHI0631 ribose transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32590"
FT                   /db_xref="GOA:B0UV49"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV49"
FT                   /protein_id="ACA32590.1"
FT                   /translation="MKSSFKLGKMLLEQRSVIALLILIAIVSMINPDFFSIDNILNILR
FT                   QTSINAIIAVGMTFVILIAGIDLSVGSILALTGAVAASLVSMELSIFMVIPLTLLLGTF
FT                   LGSVSGFIVAKGKVQAFIATLVTMTLLRGVTMVYTEGRPISTGFSETADSFAYLGTGYL
FT                   LGIPLPIWLMVIVFAVAWYVLKHCKIGRYIYALGGNENATQLSGINVNRIKIFVFAVSG
FT                   FLSALAGLIVTARLSSAQPTAGVSYELDAIAAVVVGGTSLMGGKGRVMGTLIGALIIGF
FT                   LNNALNLLDVSSYYQMIAKALVILIAVLADNYLGNKKA"
FT   gene            101383..102261
FT                   /locus_tag="HSM_0092"
FT   CDS_pept        101383..102261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0092"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: hit:NTHI0632
FT                   ribose-binding periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32601"
FT                   /db_xref="GOA:B0UV50"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV50"
FT                   /protein_id="ACA32601.1"
FT                   /translation="MKKLTTIASAVMLSLAFSGVAMAKETIALAVSTLDNPFFVSLKDG
FT                   AQKKADELGYKLVVLDSQNDPAKELANVEDLMVRGAKVLLINPTDSEAVSNAVAIANRR
FT                   NVPVITLDRGAAKGKVVSHIASDNVAGGKMAGDFIAQKLGANAKVIQLEGIAGTSAARE
FT                   RGEGFKQAIAEHKFDVLASQPADFDRTKGLNVMENLLASKSAVQAVFAQNDEMALGALR
FT                   AINAANKKVLVVGFDGTDDGVKAVKSGKLGATIAQQPELIGSLGVETADKVLKGETVAE
FT                   KIPVDLKVIVK"
FT   sig_peptide     101383..101454
FT                   /locus_tag="HSM_0092"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            102345..103298
FT                   /locus_tag="HSM_0093"
FT   CDS_pept        102345..103298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0093"
FT                   /product="ribokinase"
FT                   /note="TIGRFAM: ribokinase; PFAM: PfkB domain protein;
FT                   KEGG: hso:HS_0225 ribokinase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32612"
FT                   /db_xref="GOA:B0UV51"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV51"
FT                   /protein_id="ACA32612.1"
FT                   /translation="MSKTLTVLGSINADHVISVPHFAKPGETLSGKQYHIAYGGKGANQ
FT                   AVAAARLADFSQGATVNFVGCIGSDDIGRAMKKAFAQDGINVATITEIPNEMTGIAMIQ
FT                   VADSGENSIVISAGANAYLTPEIVDKFATEIERADYLLMQLETPLNAILEAAKLAKKHG
FT                   ATVVLNPAPANQLPDELLSLLDMITPNETETEILTGVKVTDEQSAAKAASVLHQKGVAT
FT                   VLITLGSKGVYVSRKSSTQELGQNKVIAGFRVNAVDTTAAGDTFNGAFLTALLENKSLD
FT                   EAIRFAHAAAAISVTRQGAQPSIPTRRETLDFLAQH"
FT   gene            103319..104329
FT                   /locus_tag="HSM_0094"
FT   CDS_pept        103319..104329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0094"
FT                   /product="Alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: hso:HS_0226
FT                   ribose operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32623"
FT                   /db_xref="GOA:B0UV52"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV52"
FT                   /protein_id="ACA32623.1"
FT                   /translation="MATMKDIARIAQVSTSTVSHVINNSRFVSEEIRQKVMAVVEQLNY
FT                   TPSALARSLKVKETKTIGMLVTTSDNPFFAEVVASVERYCRQHHYHLILCNTNDDSICL
FT                   QENLQNLIRKQVDGLLLMCTDSAFETSPLNLTVPTVIMDWWPTELSADKIFEDSEQGGY
FT                   LATRTLIEHQHHDIAIITGNLKKPLARNRLKGYKQALQEYNIPIRDKWIIESHFNFEGG
FT                   IKGMEQLLQLKQRPSAVFACSDTIAVGAYQAVWRHGLSVPEDISIIGYDNIHLAQYLSP
FT                   PLSTVHQPKDEFAHLAVDTLLQRIKNPTESYRTLTLKPEIVLRQSICSCFLPKSA"
FT   gene            complement(104358..104771)
FT                   /locus_tag="HSM_0095"
FT   CDS_pept        complement(104358..104771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0095"
FT                   /product="SmpA/OmlA domain protein"
FT                   /note="PFAM: SmpA/OmlA domain protein; KEGG: hso:HS_0227
FT                   conserved small protein A"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32634"
FT                   /db_xref="GOA:B0UV53"
FT                   /db_xref="InterPro:IPR007450"
FT                   /db_xref="InterPro:IPR026592"
FT                   /db_xref="InterPro:IPR037873"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV53"
FT                   /protein_id="ACA32634.1"
FT                   /translation="MRLKFIIPAMILGLSVTACSSVQKIVYRIDVPQGNYLESTAVEQV
FT                   KVGMNAQQVQYLLGTPMLIDPFSNQTWYYVFLQQKSYNAPEQHTFIVNFDRRGIVTDVN
FT                   LDKPLPDVEKEYINNTIIQGPEAKRTSWWKFWR"
FT   sig_peptide     complement(104709..104771)
FT                   /locus_tag="HSM_0095"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.522 at
FT                   residue 21"
FT   gene            complement(104839..105852)
FT                   /locus_tag="HSM_0096"
FT   CDS_pept        complement(104839..105852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0096"
FT                   /product="37kDa nucleoid-associated protein"
FT                   /note="PFAM: 37kDa nucleoid-associated protein; KEGG:
FT                   hso:HS_0228 possible nucleoid-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32645"
FT                   /db_xref="GOA:B0UV54"
FT                   /db_xref="InterPro:IPR007358"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UV54"
FT                   /protein_id="ACA32645.1"
FT                   /translation="MSIIVNQIVLHQLVKTSQDENTVQLKTHLRDELLPITAETEQMML
FT                   QLHQEYQNKTKAYGVFQETSNFAQILNRTLENDIDFLAFSHQSAELLRQELGKYSFAND
FT                   GTLILCQYNFLATDYLFIALLDSRYSMLVDENLEIKQTHYLDITQFDIACRINLTELHL
FT                   DAKSTRYLTFIKGRVGRKIADFFMDFLGAEEGLNPQVQNQCLLQAVSDYCQQADLTKEQ
FT                   TQAVKKQVFDYCKGQINVGEEIVVTELSANIPTLNEQSFVDFAVSQNYGLEENIPPVRT
FT                   ALKSLTKFSGSGKGITLSFDAELLNSRIFWDEATDSLTITGLPPNLRDQLQRQTKE"
FT   gene            105970..106191
FT                   /locus_tag="HSM_0097"
FT   CDS_pept        105970..106191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0097"
FT                   /product="protein of unknown function DUF1414"
FT                   /note="PFAM: protein of unknown function DUF1414; KEGG:
FT                   hso:HS_0229 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32656"
FT                   /db_xref="InterPro:IPR009857"
FT                   /db_xref="InterPro:IPR023202"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UV55"
FT                   /protein_id="ACA32656.1"
FT                   /translation="MAKISKFQDKQVEAILNDMIAVLEKHQAPVDLSLVVLGNMVTHLL
FT                   NSSVGSQQRIVLAKVFSDALMNSVKNSK"
FT   gene            106193..107935
FT                   /locus_tag="HSM_0098"
FT   CDS_pept        106193..107935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0098"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; KEGG: hso:HS_0230 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32665"
FT                   /db_xref="GOA:B0UV56"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012159"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024588"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV56"
FT                   /protein_id="ACA32665.1"
FT                   /translation="MFGIKTSKQYRDELSRKITWGHWFAFFNILWAIVIGSRYAFIIDW
FT                   PHTLFGKIYFFISLLGHFSFIVFALYLLALFPLSFIIKNERTFRGISVILTTIGATLLL
FT                   VDTEVFSRFNLHLSTLVWNLLVNPDDGKLSYKWQIFFAPMPLILFVQMLFSRWAWYKLR
FT                   SLERQKWIKGVALVFVVSFIATHILYAWADAYIYRPITMQKSNFPLSYPMTARSFLEKH
FT                   GFLNKSEYEKTLNEQGRLDALKVNYPKQKLTFSDELPKTNIVLITISGLRHDAVRQDIM
FT                   PNLFAFSENSTDFTHHYSSGNSLNQGLTGLFYGLNANYADSLLSNKTTPVLIERLKQGK
FT                   VRYEIGLFGQNLSRSILLKKSIFANEKIRNDNNTSTRRFIEFVNTRQQQQKLFFAYLNY
FT                   SLNSNLTIEQYYQKLSEIDDEIGSAFKSIDFTHTIVIVTSEYGYSFDFSDKKRPTNYFA
FT                   REVIQVPMIIRWENLPIGKVNKLSSHTDLVPALMKHIFKVKNPISDFSQGQDLFDLDDN
FT                   RSWVLAGNYRWNVIITPDDSQYHIDRNGHYQKYNQHYQKISSTQPPLGLFLEVFSQNTA
FT                   FIEK"
FT   gene            complement(108151..108867)
FT                   /locus_tag="HSM_0099"
FT   CDS_pept        complement(108151..108867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0099"
FT                   /product="sugar fermentation stimulation protein"
FT                   /note="PFAM: sugar fermentation stimulation protein; KEGG:
FT                   hso:HS_0231 sugar fermentation stimulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32676"
FT                   /db_xref="GOA:B0UV57"
FT                   /db_xref="InterPro:IPR005224"
FT                   /db_xref="InterPro:IPR040452"
FT                   /db_xref="InterPro:IPR041465"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UV57"
FT                   /protein_id="ACA32676.1"
FT                   /translation="MQLPNLQSATLLRRYKRFLADVELNNGEILTLHCANTGAMTGCGE
FT                   KGDTVWFSTSDSKTRKYPHSWELTQLKNGQTVCINTHRSNQLTLEALQNKIITELAEYD
FT                   EILPEVKYGVENSRIDFLLKGKNLPDCYVEVKSVTFVKNHLGLFPDAVTTRGQKHLREL
FT                   IAMKKRGHRAVVFFAGLHDGFNRFTVAKSIDPDYAELLQQAVKEGVEVYSYAVKFDFSH
FT                   QKPTALYLTNLVSYLE"
FT   gene            109076..110608
FT                   /locus_tag="HSM_0100"
FT   CDS_pept        109076..110608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0100"
FT                   /product="NAD(P) transhydrogenase, alpha subunit"
FT                   /note="TIGRFAM: NAD(P) transhydrogenase, alpha subunit;
FT                   PFAM: alanine dehydrogenase/PNT domain protein; KEGG:
FT                   hso:HS_0232 NAD(P)(+) transhydrogenase, alpha subunit
FT                   (pyridine nucleotide transhydrogenase)"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30709"
FT                   /db_xref="GOA:B0UV58"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008142"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="InterPro:IPR026255"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV58"
FT                   /protein_id="ACA30709.1"
FT                   /translation="MLIGVPRELLDNESRVAATPKTVQQILKLGFEVIVENNAGFNASF
FT                   EDQAFVNAGAKIGSAQDIWNADIIFKVNAPTDAEIAQIKEGATLISFIWPAQNSELMAK
FT                   LSSKKINVLAMDAVPRISRAQALDALSSMANISGYRAVIEAAHEFGSFFTGQITAAGKV
FT                   PPAKVLVIGAGVAGLAAIGAANSLGAIVRAFDSRPEVKEQVKSMGADFLEIDFQEEGGS
FT                   GDGYAKVMSEEFNRRAMALYAEQAKEVDIIITTAAIPGKPAPRLITKEMVDSMKPGSVI
FT                   VDLAALTGGNCDYTQAGEIVVTENQVKVIGYTDFPSRLPTQSSQLYGTNLVNLLKLLCK
FT                   EKDGNIHIDFEDVVLRGVTVIRDGEVTWPAPPIQVSAQTQQKITAPVVDKKEKTPINPK
FT                   VKYGVMALAGAAFLWLGSVMPAAFLSHFTVFVLACVVGYYVVWNVSHALHTPLMAVTNA
FT                   ISGIIIVGALLQIAQGNFFISLLAFIAILVAAINIFGGFKVTQRMLAMFRKG"
FT   gene            110621..112081
FT                   /locus_tag="HSM_0101"
FT   CDS_pept        110621..112081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0101"
FT                   /product="NAD(P)(+) transhydrogenase (AB-specific)"
FT                   /EC_number="1.6.1.2"
FT                   /note="PFAM: NAD(P) transhydrogenase beta subunit; KEGG:
FT                   hso:HS_0233 NAD(P)(+) transhydrogenase, beta subunit
FT                   (pyridine nucleotide transhydrogenase)"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30720"
FT                   /db_xref="GOA:B0UV59"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV59"
FT                   /protein_id="ACA30720.1"
FT                   /translation="MSEGLVQAAYIVAALLFIMSLAGLSKHETAKAGCWYGIVGMAIAL
FT                   VATIFGPYSQGLFWIIIAMAVGAVIGIQRAMKVEMTEMPELVAILHSFVGLAAVLVGFN
FT                   SFGLHETAQFLVPEGVEYVTDAAQALLAQQKADFVAEQSVLATIHNVEVFLGIFIGAVT
FT                   FTGSIVAFGKLRGIINSKALMLPHRHKLNLAALIISALLMVAFLNSPDNIFPVLLMTAI
FT                   ALAFGWHLVASIGGADMPVVVSMLNSYSGWAAAAAGFMLNNDLLIVTGALVGSSGAILS
FT                   YIMCKAMNRSFISVIAGGFGNDVVASSEAEQGEHRETTAEEVAEMLKNASSVIITPGYG
FT                   MAVAQAQYPVAEITAKLRERGVNVRFGIHPVAGRLPGHMNVLLAEAKVPYDVVLEMDEI
FT                   NEDFADTDVVLVIGANDTVNPAAMDDPNSPIAGMPVLEVWKAANVVVFKRSMAVGYAGV
FT                   QNPLFFKENTQMLFGDAKERVEDILKAL"
FT   gene            112162..113811
FT                   /locus_tag="HSM_0102"
FT   CDS_pept        112162..113811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0102"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; KEGG: hso:HS_0234 phosphoglycerol
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30731"
FT                   /db_xref="GOA:B0UV60"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV60"
FT                   /protein_id="ACA30731.1"
FT                   /translation="MVQYALLILFSLASIIFIINSHYRWTYFFAISQFLLFIGIMFTIT
FT                   GQWQRAVNFSSTLFIVFVLFHRIKIHFYKQPLLISDFFLVIDWRNWETLLHYRQAFFAI
FT                   MGLLVLLAYGIFGWQNTPALPFYWQIISGLISIILIVSICHCTKNKQAIKQWLDSLPDD
FT                   GRDVFLNLPMSCRGIFYKSPVFSGGSQYFLEKAESIESHKQSNSEQKADIVVWLQESTL
FT                   NPHSFLFKQHNIPPITMYENQDDTKCNSHLRVHTLGGATWKSEFAFLSGLPSTDFGAMA
FT                   NAVFYSVVPHLKYSFVKNLKAQGYYCVALSPFTKGNYNAKSAYDHFGFDLMLQPQDLGY
FT                   PAPLSKNLWTIGSDEMSQYVQKILDKKDVPQLKDLQNPLFVYVLTMREHGPYYNCGNIF
FT                   QIQMDCATERGIGELNDYIQRIVNLNQVMEDFNLYMQRRNKPYILGYFGDHQISIKEAV
FT                   PSYSFNYPYPEYITQFAVRSNLETDFEKHDFLDLAFIAGAILEIAGLPVDEFMQTNIKM
FT                   RKLSGGKLQDCTDQQLLESYRHYIYSELKVAE"
FT   gene            complement(114180..115190)
FT                   /locus_tag="HSM_0103"
FT   CDS_pept        complement(114180..115190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0103"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: inner-membrane translocator; KEGG: pmu:PM1040
FT                   galactoside ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30742"
FT                   /db_xref="GOA:B0UV61"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR030158"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV61"
FT                   /protein_id="ACA30742.1"
FT                   /translation="MSALKQNKSLDFLKQNAIYFVLLILLGIIIMQDSSFLSLRNFSNI
FT                   LTQSSVRLIIALGVAGLLVTQGTDLSAGRQVGLAAVISATLLQAMDNINRVFPELGEIP
FT                   IPVVIIVVCVIGAIIGLVNGVVIAFLNVTPFIATMGTMIIVYGINSLYYDAVGSSPIAG
FT                   FNESFSTFAQGFFRIGSFKLSYITIYAALASFFVWVLWNKTRFGKNIFAIGGNPEAAKV
FT                   SGVNVTRNLVVIYMIAGIFYAFGGMLEAGRIGSATNNLGFMYELDAIAACVVGGVSFAG
FT                   GVGTVLGVVTGVLIFTVINYGLTYIGVNPYWQYIIKGSIIIFAVAIDSLKYAKKK"
FT   gene            complement(115207..116727)
FT                   /locus_tag="HSM_0104"
FT   CDS_pept        complement(115207..116727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0104"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: msu:MS0642 ABC-type sugar (aldose) transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30753"
FT                   /db_xref="GOA:B0UV62"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015862"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV62"
FT                   /protein_id="ACA30753.1"
FT                   /translation="MTGQTLHQSSEILLTMINVSKSFPGVKALDKANLTIRSHSVHALM
FT                   GENGAGKSTLLKCLFGIYAKDEGDILFLNKPINFKTSKEALENGISMVHQELNLVRQRN
FT                   VMDNLWLGRYPLKGIFVDHGKMYRDTKAIFDELGIDIDPKEKVANLSVSQMQMVEIAKA
FT                   FSYNAKIVIMDEPTSSLSEKEVEHLFKIIAKLKKRGCGIVYISHKMDEIFKICDEITIL
FT                   RDGKWINTVEVQKTTMDEIVSMMVGRELTQRFPPKTNQPKEVILEVKNLTALNQPSIQD
FT                   VSFELHKGEILGIAGLVGAKRTDIVETIFGIRERKSGTIKLYNKEMKNRTALEAINNGF
FT                   ALVTEERRSTGIYANLSIEFNSLISNMKSYLGHFGLLKSIKMKSDTQWVIDAMNVKTPS
FT                   HQTHIGSLSGGNQQKVIIGRWLLTQPEILMLDEPTRGIDIGAKYEIYQLIMELAKKDKG
FT                   IILISSEMPELLGVTDRILVMSNGKVTEIVETAKTSQEEILQLAAKYL"
FT   gene            complement(116780..117766)
FT                   /locus_tag="HSM_0105"
FT   CDS_pept        complement(116780..117766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0105"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: pmu:PM1038 d-galactose
FT                   binding periplasmic protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30764"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV63"
FT                   /protein_id="ACA30764.1"
FT                   /translation="MKKTILSAVTLAVGFSAISAQSADRIGVTIYKYDDNFMALMRQEI
FT                   DKEAKAVGGLELLMNDSQNAQSVQNDQVDVLISKGIKTLAINLVDPAAAPTVIKKAKSE
FT                   DIPVIFFNKDPGAKAIGSYNHAYYVGTDPKESGLIQGNLIAKHWKANPAYDLNKDGKIQ
FT                   YVLLKGEPGHPDAEARTKYVIEALNAQGIQSEQLFIDTGMWDAAMAKDKVDAWLSSSKA
FT                   NEIEVIISNNDGMAMGALEATKAHGKKLPIFGVDALPEVLQLIKKGEMAGTVLNDGVNQ
FT                   GKAVVQLAKNLAQGKPATEGTNWKLEKRVVRIPYVGIDKDNLNEFLK"
FT   sig_peptide     complement(117698..117766)
FT                   /locus_tag="HSM_0105"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.803 at
FT                   residue 23"
FT   gene            complement(117925..118915)
FT                   /pseudo
FT                   /locus_tag="HSM_0106"
FT                   /note="Alanine racemase"
FT   gene            119165..120214
FT                   /locus_tag="HSM_0108"
FT   CDS_pept        119165..120214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0108"
FT                   /product="galactose-1-phosphate uridylyltransferase"
FT                   /EC_number="2.7.7.12"
FT                   /note="TIGRFAM: galactose-1-phosphate uridylyltransferase;
FT                   PFAM: galactose-1-phosphate uridyl transferase domain
FT                   protein; KEGG: pmu:PM1036 galactose-1-phosphate
FT                   uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30795"
FT                   /db_xref="GOA:B0UVG9"
FT                   /db_xref="InterPro:IPR001937"
FT                   /db_xref="InterPro:IPR005849"
FT                   /db_xref="InterPro:IPR005850"
FT                   /db_xref="InterPro:IPR019779"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVG9"
FT                   /protein_id="ACA30795.1"
FT                   /translation="MSEMTEFVATEHPHRRYNPLTEQWVLVSPHRAKRPWQGQQEKIAD
FT                   ENKPCYDSACYLCPGNKRITGEQNPNYTKPFVFKNDFSALLEDTPEPLKTDDPLFQSSL
FT                   ARGESRVVCFSPDHSKTLPLLTVEEIFAVVKVWQEQLEELGKKYQWVQIFENKGAVMGC
FT                   SNPHPHGQIWANSFLPNEVARTDKAQRNYFNKQGSVLLMDYQKRERDLQERVVIETEYW
FT                   VAVVPYWAVWPFEILLLPKIHVKRLIDLNETQAKDLALALKIITTKYDNLFETSFPYSM
FT                   GFHFAPFNGEKNEHWQLHAHFYPPLLRSATVRKFMVGYEMLGESQRDLTAEQAAARLRE
FT                   LSDVHYKNK"
FT   gene            120233..121399
FT                   /locus_tag="HSM_0109"
FT   CDS_pept        120233..121399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0109"
FT                   /product="galactokinase"
FT                   /note="TIGRFAM: galactokinase; PFAM: GHMP kinase; GHMP
FT                   kinase domain protein; KEGG: msu:MS0648 galactokinase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30806"
FT                   /db_xref="GOA:B0UVH0"
FT                   /db_xref="InterPro:IPR000705"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006206"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR019539"
FT                   /db_xref="InterPro:IPR019741"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022963"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVH0"
FT                   /protein_id="ACA30806.1"
FT                   /translation="MTQQNPKQRAKQLFSEKFNRTSELNVYAPGRVNIIGEHTDYNDGF
FT                   VMPCAINYGTAISGAKRDDHLFCVYAADLQEYDEFDLTRPIEPKMEAKWTGYVRGMVKF
FT                   IQQHCPDFQQGADLVICGNIPLSAGLSSSASLEIAVGKFCQQLADLSLTNIEIALIGQQ
FT                   AENKFVGANCGNMDQLISALGQKDHFLMIDCRSLDIVTIPVPENIVVMIVNSHVKHDLV
FT                   NGEYNIRRRQCEMAAQFFGVKALRDVSVELFKQKEAELTALDPEIAKRAKHVVTENERV
FT                   LQSVQALQQGDLQKLGELMYQSHDSMRDDFEITVPEIDYLVELAQVVIGKNGGARMTGG
FT                   GFGGCIVAIAPQDKVEAVRQIIADNYEKQTGLKEDFYVCTASKGVTIC"
FT   gene            121393..122436
FT                   /locus_tag="HSM_0110"
FT   CDS_pept        121393..122436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0110"
FT                   /product="galactose mutarotase"
FT                   /EC_number="5.1.3.3"
FT                   /note="TIGRFAM: galactose mutarotase; PFAM: Aldose
FT                   1-epimerase; KEGG: hso:HS_0236 aldose 1-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30818"
FT                   /db_xref="GOA:B0UVH1"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013458"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR015443"
FT                   /db_xref="InterPro:IPR018052"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVH1"
FT                   /protein_id="ACA30818.1"
FT                   /translation="MLIDCFEKEHKQGMAPDGQPFRIFTLTNTKGMKVQVMDWGATWIS
FT                   CQVPVGKEVREVLLGCQINDYPIQQVYLGASIGRYANRIANSRFELNGKRYLLNANQHQ
FT                   HQLHGGKGFHNERWYLEKCGVNSITFSHFSPDGDQGFPGNLHAFVTYSLSETNNVRIEY
FT                   EAICDQDCPINLTNHAYFNLNDATFGCDIRGHSLQLNSDYFLPVDSAGIPNAKLKAVEG
FT                   TSFDFREEKPIGLDFLQEEQKLVKGYDHSFLLNLDTEKPCAILTALDRSLRMQVLTSQP
FT                   ALQIYTGNFLSATPTRQNGQYADYAGIALETQCLPDTPNHPEWWKYGGITKVGEKYSHK
FT                   TEYQFIR"
FT   gene            122612..123505
FT                   /locus_tag="HSM_0111"
FT   CDS_pept        122612..123505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0111"
FT                   /product="CBS domain containing protein"
FT                   /note="PFAM: CBS domain containing protein;
FT                   transporter-associated region; KEGG: hso:HS_0237 magnesium
FT                   and cobalt efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30829"
FT                   /db_xref="GOA:B0UVH2"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVH2"
FT                   /protein_id="ACA30829.1"
FT                   /translation="MSNDEQINTITENESKKNFFHSLFGRFFQGELKNRQELVDVIRDS
FT                   EQNELIDQNTREMIEGVIEISELRVRDIMIPRSQIIFIENDQDLEACLDVIIASAHSRF
FT                   PVISDERDNIAGILHAKDLLKFFRSNAEQFELQSLLRPAVIVPESKRVDRMLKDFRAER
FT                   FHMALVVDEFGAISGLVTIEDILEQIVGDIEDEFDEEDVADIRQLSRHTYVVRALTDID
FT                   DFNEQFKTNFADEEVDTIGGLIMQAFGYLPKRGEEVVLDNLNFKVTSADSRRIIQVRVT
FT                   VPDEQLTDSKKQNTEE"
FT   gene            123502..125034
FT                   /locus_tag="HSM_0112"
FT   CDS_pept        123502..125034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0112"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /note="TIGRFAM: apolipoprotein N-acyltransferase; PFAM:
FT                   Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: hso:HS_0238 apolipoprotein
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30840"
FT                   /db_xref="GOA:B0UVH3"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVH3"
FT                   /protein_id="ACA30840.1"
FT                   /translation="MRNYLVYFIAILTGGVGVLAFSPFDLWAIAYLSLAGLIWIAKKSQ
FT                   KKTALLASFLWGLSFFGIGVNWLNVSIYQFGGTPLIVSYLLVILLAGYLALYPVLFTYL
FT                   VQRFRVQSLAIFPAIWTLTESLRSWVFTGFPWLQFGYTQLDSPFANLAALFGVEGLTFF
FT                   VMWISAVIFSLISQLIQSKKQWAIIITHSVLLVVMLGLSTSTALLKFTQENPQKSLNVT
FT                   LVQGNIEQQLKWDPDYFYQTLTIYQRLINRSLDDSDLIILPEAALPALENHIQPYLQTL
FT                   QQLAQEKGVEVVIGTIYQEESEDKLLNSIVNLGNADEPYHLNTKNRYAKHHLVPFGEYV
FT                   PLDKILRPLGSVFNLPMSSFASGDFVQKPFLAKNRHFTPAICYEIIFGSQLQQNLTKQS
FT                   DFILTISNDAWFGDSIGPWQHLQMARMRAIELGRPVIRATNTGITAFIDAQGKIVAQAP
FT                   QFTETTLRHKIVATEGMTPYAILGTKPLYLLISLLVLFRSLGALIRKKLTQG"
FT   sig_peptide     123502..123564
FT                   /locus_tag="HSM_0112"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.756) with cleavage site probability 0.561 at
FT                   residue 21"
FT   gene            complement(125042..125833)
FT                   /locus_tag="HSM_0113"
FT   CDS_pept        complement(125042..125833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0113"
FT                   /product="TatD-related deoxyribonuclease"
FT                   /note="PFAM: TatD-related deoxyribonuclease; KEGG:
FT                   hso:HS_0239 deoxyribonuclease, TatD family"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30851"
FT                   /db_xref="GOA:B0UVH4"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVH4"
FT                   /protein_id="ACA30851.1"
FT                   /translation="MHFFDTHTHLDYVQQVTQENLAQLIHNAHRIGVEKMLIVAVLQRD
FT                   FENIVNMTALYPTQLYYGLGLHPLYIEQHSKNDLDILSQALEQGSAACTAIAEIGLERG
FT                   KSDLISERLWKKQCEFLEVQLSFAQRFNLPVSLHSRQSHDHLFTFLKRIKVNKCGVIHG
FT                   FAGSYDQAKRFVDLGYKIGVGGTITYERANKTRNTIAKLPLDSLLLETDSPDMPICGFQ
FT                   GQPNRSERIIHVFHELCQLRKEPAELIASTIWKNSCNLFAK"
FT   gene            complement(126026..126535)
FT                   /locus_tag="HSM_0114"
FT   CDS_pept        complement(126026..126535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0114"
FT                   /product="peptidyl-prolyl cis-trans isomerase cyclophilin
FT                   type"
FT                   /note="PFAM: peptidyl-prolyl cis-trans isomerase
FT                   cyclophilin type; KEGG: hso:HS_0241 peptidylprolyl
FT                   isomerase (peptidyl-prolyl cis-trans isomerase)"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30862"
FT                   /db_xref="GOA:B0UVH5"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVH5"
FT                   /protein_id="ACA30862.1"
FT                   /translation="MITLHTNFGDIKLALNFEKAPITAENFLTYCKEGFYNNTIFHRVI
FT                   DGFMIQGGGMESGLREKNTKAPIKNEASNGLSNKRGTIAMARTSDPHSATAQFFINVAD
FT                   NTFLDYRAKEMFGKTVVQEWGYAVFGEVVEGMDIVDKIKGVKTGNKGFHQDVPVEDVII
FT                   TSVTIE"
FT   gene            126674..128053
FT                   /locus_tag="HSM_0115"
FT   CDS_pept        126674..128053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0115"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="TIGRFAM: cysteinyl-tRNA synthetase; PFAM:
FT                   Cysteinyl-tRNA synthetase class Ia DALR; tRNA synthetase
FT                   class I (M); Cysteinyl-tRNA synthetase class Ia; KEGG:
FT                   hso:HS_0242 cysteine--tRNA ligase (cysteinyl-tRNA
FT                   synthetase)"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30873"
FT                   /db_xref="GOA:B0UVH6"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UVH6"
FT                   /protein_id="ACA30873.1"
FT                   /translation="MLKIFNTLTREKEVFKPISENKVGMYVCGVTVYDLCHIGHGRTFV
FT                   CFDVIARYLRYLGYELTYVRNITDVDDKIIRRALENKETCEQLVDRMVVEMYKDFDALN
FT                   VLRPDFEPRATHHIAEIIALVEKLIARGHAYVADNGDVMFDVESFKEYGKLSRQDLTQL
FT                   QAGARVEISEIKKNPMDFVLWKMSKENEPSWNSPWGAGRPGWHIECSAMNCKHLGEHFD
FT                   IHGGGADLMFPHHENEIAQSCCAHGNRYVNYWIHSGMIMVDKEKMSKSLGNFFTIRDVL
FT                   NHYDAESVRYFLLTAHYRSQLNYSEENLDLAHGALERLYTALRGTDKSAVSFGGENFIA
FT                   QFTEAMNDDFNTPNAISVLFEMAREINRLKNEDKLLADGLAARLRELASILGLLDQDPE
FT                   DFLQAGSDDAEIAKIEELIKQRNDARQAKDWARADAARNELTTMGVILEDSSNGTMWRK
FT                   M"
FT   gene            complement(128105..128848)
FT                   /locus_tag="HSM_0116"
FT   CDS_pept        complement(128105..128848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0116"
FT                   /product="protein of unknown function DUF208"
FT                   /note="PFAM: protein of unknown function DUF208; KEGG:
FT                   hso:HS_0243 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30884"
FT                   /db_xref="GOA:B0UVH7"
FT                   /db_xref="InterPro:IPR003828"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVH7"
FT                   /protein_id="ACA30884.1"
FT                   /translation="MKIDMHRTKLEQKQPHFDAQKRRKKECKNSNTPFVRPKLELPHGH
FT                   NKLLLHSCCAPCSGEVMEAIHASGIDFTIYFYNPNIHPLKEYLIRKEENIRFAEKWGIP
FT                   FIDADYDRQNWFDRAKGMEDEPERGIRCTMCFDMRFEKAAQYAHENGFPVFTSCLGISR
FT                   WKDMNQINGCGHRAAEKYDDVVYWDYNWRKGGGSQRMIEISKRERFYQQEYCGCVYSLR
FT                   DTNKWREANGRQKIEIGKLYYSADK"
FT   gene            complement(128970..129962)
FT                   /locus_tag="HSM_0117"
FT   CDS_pept        complement(128970..129962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0117"
FT                   /product="Polyprenyl synthetase"
FT                   /note="PFAM: Polyprenyl synthetase; KEGG: hso:HS_0244
FT                   octaprenyl-diphosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30895"
FT                   /db_xref="GOA:B0UVH8"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVH8"
FT                   /protein_id="ACA30895.1"
FT                   /translation="MIEKMNPMNIHAIQSLIKTDMDKVNATILAQLNSDVALINQLGYY
FT                   IVQSGGKRIRPMIALLAARALNYQGDEPITCAAFVEFIHTATLLHDDVVDESDMRRGNP
FT                   TANAEFGNAASVLVGDFIYTRAFQLMTKLNSLRILQIMSDATNIIAEGEVQQLMNVNDP
FT                   ETSEDNYMKVIYSKTARLFEVATQCAAITAQSNAEQEIALQHYGRYLGTAFQLVDDVLD
FT                   YSANAATLGKNIGDDLAEGKPTLPLLHAMRNGTPQQSALIREAIEQGGKRDFLDDVLAI
FT                   MTEQKSLDYAMSKAKEEAQKAVDSISCLPENQYKQALISLAYLSVERHY"
FT   gene            130182..130493
FT                   /locus_tag="HSM_0118"
FT   CDS_pept        130182..130493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0118"
FT                   /product="ribosomal protein L21"
FT                   /note="PFAM: ribosomal protein L21; KEGG: hso:HS_0245 50S
FT                   ribosomal protein L21"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30903"
FT                   /db_xref="GOA:B0UVH9"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UVH9"
FT                   /protein_id="ACA30903.1"
FT                   /translation="MYAVFQSGGKQHRVSEGHVVRLEKLELATGSTVEFDSVLMIVNGE
FT                   DIKIGTPVVTGAKVVAEVVSQGRGEKVKIVKFRRRKHSRKQQGHRQWFTEVKITGIQA"
FT   gene            130514..130771
FT                   /locus_tag="HSM_0119"
FT   CDS_pept        130514..130771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0119"
FT                   /product="ribosomal protein L27"
FT                   /note="PFAM: ribosomal protein L27; KEGG: hso:HS_0246 50S
FT                   ribosomal protein L27"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30913"
FT                   /db_xref="GOA:B0UVI0"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UVI0"
FT                   /protein_id="ACA30913.1"
FT                   /translation="MATKKAGGSTRNGRDSEAKRLGVKRFGGESVLAGSIIVRQRGTKF
FT                   HAGSNVGMGKDHTLFATADGKVKFEVKGEKSRKYVSVVAE"
FT   gene            130907..131827
FT                   /locus_tag="HSM_0120"
FT   CDS_pept        130907..131827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0120"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: hso:HS_0247 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30923"
FT                   /db_xref="GOA:B0UVI1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVI1"
FT                   /protein_id="ACA30923.1"
FT                   /translation="MKQKPLLGFIFALTTAIAWGSLPIALQQVMNAMSMQTIVWFRFMV
FT                   ATVALAILLKLANRLPKLSDLNRYFFGLVILGVIGLSGNFSLFNSSLKFIEPSVTQIFV
FT                   HFSSFAMMFCGVVIFKERLGLHQKIGLVILIIGLILFFNERADQLFDINIYSIGVFLSM
FT                   SASLIWVTYGLAQKLLLRRFNSQQILLMIYTGCAFVFTPFVEIEQLQNLNTFTLICFIY
FT                   CCLNTLIGYGAYAEALNHWDVAKVSVVITLVPLFTILFAHLLNLIYPQYFSAPELNTLS
FT                   YIGAFIVVFGAMTSAIGYKFIKNKI"
FT   sig_peptide     130907..130969
FT                   /locus_tag="HSM_0120"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.820 at
FT                   residue 21"
FT   gene            131837..133015
FT                   /locus_tag="HSM_0121"
FT   CDS_pept        131837..133015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0121"
FT                   /product="GTP-binding protein Obg/CgtA"
FT                   /note="TIGRFAM: small GTP-binding protein; GTP-binding
FT                   protein Obg/CgtA; PFAM: GTP-binding protein HSR1-related;
FT                   GTP1/OBG sub domain protein; KEGG: hso:HS_0248 GTP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30934"
FT                   /db_xref="GOA:B0UVI2"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UVI2"
FT                   /protein_id="ACA30934.1"
FT                   /translation="MKFIDEALIRIEAGDGGNGCVSFRREKFIPKGGPDGGDGGDGGDV
FT                   YLIADENLNTLIDYRFEKSFAAERGENGRSSDCTGRRGKDITLRVPVGTRAIDNDTKEV
FT                   LGDLTKHGTKMLVAKGGYHGLGNARFKSSVNRAPRQKTNGTPGEKRDLQLELMLLADVG
FT                   MLGLPNAGKSTFIRAVSAAKPKVADYPFTTLVPSLGVTRVDTSRSFVIADIPGLIEGAS
FT                   EGAGLGVRFLKHLERCHVLIHLVDIAPIDESDPADNIAIIEGELFQYSEKLANKPRWLV
FT                   FNKIDILSDEEATARAKNIMQRLGGEDDYYLISAATGKNVDVLCRDIMDFIEENPRQEQ
FT                   EKIDAQEVKFKWDDYHQEQLSEQVFTEDDQEEDDWDDWSEDDEEGVEIIYKP"
FT   gene            complement(133257..133826)
FT                   /locus_tag="HSM_0122"
FT   CDS_pept        complement(133257..133826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0122"
FT                   /product="N-acetylmuramoyl-L-alanine amidase family 2"
FT                   /note="PFAM: N-acetylmuramoyl-L-alanine amidase family 2;
FT                   KEGG: hso:HS_0249 N-acetyl-anhydromuramyl-L-alanine
FT                   amidase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30945"
FT                   /db_xref="GOA:B0UVI3"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVI3"
FT                   /protein_id="ACA30945.1"
FT                   /translation="MNNKQKNICTGWFSEARKLPSPHFDQRPENSDISLLVIHYISLPP
FT                   EQFGGSYIDDFFLGNLDPLAHPYFATIANIRVSAHCLITRDGAITQYVNFNDRAWHAGL
FT                   SSFEGREKCNDFSIGIELEGSDLQPFTEEQYQSLERLTLDIMHSYPLITKQRIVGHCHI
FT                   SPNRKIDPGQYFDWQRYFNNLEEETS"
FT   gene            133949..134407
FT                   /locus_tag="HSM_0123"
FT   CDS_pept        133949..134407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0123"
FT                   /product="fimbrial subunit"
FT                   /note="KEGG: hso:HS_0250 fimbrial subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30956"
FT                   /db_xref="GOA:B0UVI4"
FT                   /db_xref="InterPro:IPR001082"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVI4"
FT                   /protein_id="ACA30956.1"
FT                   /translation="MKITYIFSSVKKGFTLIELMIVIAIVAILATIAIPSYQNYTKKAA
FT                   ITELLQASAPYRAEVELCVYNNDAPTNCNAGTNGIQAAINTPKGKVKSVSVQGGAITVT
FT                   GNGNLKDITYTLTPTGDASTGVTWSANCNNKADLFPAGFCSSTSTNSP"
FT   gene            134553..135290
FT                   /locus_tag="HSM_0124"
FT   CDS_pept        134553..135290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0124"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: hso:HS_0251 arginine ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30967"
FT                   /db_xref="GOA:B0UVI5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVI5"
FT                   /protein_id="ACA30967.1"
FT                   /translation="MTISVKNLNFFYGASQALFDINLTAEDGDTVVLLGPSGAGKSTLI
FT                   RTLNLLEVPTSGELSIANNKFDLSQDIANPKQMRQLRQDVGMVFQQYNLWPHLTVMENL
FT                   IEAPIKVLGIAKEKAKEQAIELLKRLRLEEFAERFPLHLSGGQQQRVAIARALMMKPQV
FT                   LLFDEPTAALDPEITAQIVSIIQELQEMGITQVIVTHEVAVAKKVATKVVYMEQGRIVE
FT                   MGDSSCFEQPSTEQFKQYLSHSH"
FT   gene            135308..136033
FT                   /locus_tag="HSM_0125"
FT   CDS_pept        135308..136033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0125"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   KEGG: hso:HS_0252 arginine ABC transporter,
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30978"
FT                   /db_xref="GOA:B0UVI6"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVI6"
FT                   /protein_id="ACA30978.1"
FT                   /translation="MKKLLLATMLAGATIGANAQDITFAMEPSYPPFELTNEKGEIIGF
FT                   DVDIANAICKEIQANCSFKAQAFDALIPSLIKGRGGFDAAISAIDITEARAKQVAFTDS
FT                   YYESSASFIALKGKADLTTAKVVGVQNGTTYQQYANKEAKQYQSKSYASLQDAILDLKN
FT                   GRIDLIFGDTDVLRDMFDKNPELQFVGERVTDKRYFNNGLGIAVNKKNTALVEQLNKGI
FT                   SAIKANGEYQKIYDKWMTK"
FT   sig_peptide     135308..135367
FT                   /locus_tag="HSM_0125"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT   gene            136038..136709
FT                   /locus_tag="HSM_0126"
FT   CDS_pept        136038..136709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0126"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: hso:HS_0253
FT                   arginine ABC transporter, permease"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30989"
FT                   /db_xref="GOA:B0UVI7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVI7"
FT                   /protein_id="ACA30989.1"
FT                   /translation="MFIDYLPLMYTATLMTLGLAVCSLLLGLALSIFFVVLETHKWACI
FT                   RKPTATIVTLLRGLPEILVVFLIYFGVPEILEWVIGEYVEFGAFGCGVVALSIIFASYA
FT                   SQSLRGAIQAIPLGQWESGAALGLSRSYTFIFLIMPQVWRHALPGLSNQWLVLLKDTAL
FT                   VSLIGVHDLMRQAELINTNTHQPFTWYGFAALLYLLITLFSQFIIRKLERRVTRFERAT
FT                   N"
FT   gene            136720..137403
FT                   /locus_tag="HSM_0127"
FT   CDS_pept        136720..137403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0127"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: hso:HS_0254 arginine ABC
FT                   transporter, permease"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30998"
FT                   /db_xref="GOA:B0UVI8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVI8"
FT                   /protein_id="ACA30998.1"
FT                   /translation="MIKDYFLTIAQGIPTSLILTIVALLVAFFLALTLTFALSMEKKWL
FT                   SLPINLFLTIFTGTPLLVQFFLIYAGPGQFSWIVNSFLWPLLSSAWFCAILTLALNSTA
FT                   YSTQLFYGAVKAISKGQWESCVALGLSRWQTLKILVPYALKRALPSYSNEIILVFKGTS
FT                   LASIITILDIMGYARQLYGTEYDALTIYGIAGVIYLIITGIATLLLRRLERKVLVFERL
FT                   ETERV"
FT   sig_peptide     136720..136839
FT                   /locus_tag="HSM_0127"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.864) with cleavage site probability 0.609 at
FT                   residue 40"
FT   gene            complement(137509..137796)
FT                   /locus_tag="HSM_0128"
FT   CDS_pept        complement(137509..137796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0128"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hso:HS_0255 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31009"
FT                   /db_xref="InterPro:IPR020493"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVI9"
FT                   /protein_id="ACA31009.1"
FT                   /translation="MNIMLKPRSVMIILASVFATITTTHVQANTLPEQCQKLFKETENL
FT                   IAEAEKQPGTHVQLAKIKSKLKQSKQQILAMEHDIQIKSCDIGLAKLHTK"
FT   sig_peptide     complement(137710..137796)
FT                   /locus_tag="HSM_0128"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.957 at
FT                   residue 29"
FT   gene            138256..139821
FT                   /locus_tag="HSM_0129"
FT   CDS_pept        138256..139821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0129"
FT                   /product="cytochrome bd ubiquinol oxidase subunit I"
FT                   /note="PFAM: cytochrome bd ubiquinol oxidase subunit I;
FT                   KEGG: hso:HS_0256 cytochrome d ubiquinol oxidase, subunit
FT                   I"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31020"
FT                   /db_xref="GOA:B0UVJ0"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVJ0"
FT                   /protein_id="ACA31020.1"
FT                   /translation="MLDVVELSRLQFALTALYHFLFVPLTLGLSFILVIMETLYVATGK
FT                   EVYKDMTKFWGKLFGINFALGVTTGITMEFQFGTNWSYYSHYVGDIFGAPLAIEALLAF
FT                   FLESTFVGLFFFGWDRLSKAKHLLTTYCVAFGSNFSAMWILVANGWMQNPVASEFNFET
FT                   MRMEMTSFMDLWLNPVAQSKFLHTLSAGYVTSACFVLAISSYYLLKRRDVGFAKRSFSI
FT                   ASVFGIIATVSVLIMGDESGYEIGQTQPVKLAAMEGEWHTQPAPASWNMIVVPNQAEQK
FT                   NDFALQIPYAAGIIVTRSLDKQFTGLVDLQALNEQRVRNGMVAYGLLQQLKAEKKANGQ
FT                   VNEETKAQFNAVKDDLGFGLLLKRYTDAVVDATDEQVKQAAADTIPNVGPTFWSFRIMM
FT                   LAGGLILVLMIAAFVQNMRKTVGRSPLLLKALLWGLPLPWIAMESGWFLAEYGRQPWAI
FT                   YDVLPVGVAASNLTTADLWLSIGLICALYTIFLVVEMYLMFKYGRLGPSSLKTGRYYFE
FT                   QLSK"
FT   gene            139836..140972
FT                   /locus_tag="HSM_0130"
FT   CDS_pept        139836..140972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0130"
FT                   /product="cytochrome d ubiquinol oxidase, subunit II"
FT                   /EC_number="3.1.3.1"
FT                   /note="TIGRFAM: cytochrome d ubiquinol oxidase, subunit II;
FT                   PFAM: cytochrome bd ubiquinol oxidase subunit II; KEGG:
FT                   hso:HS_0257 cytochrome d ubiquinol oxidase, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31032"
FT                   /db_xref="GOA:B0UVJ1"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVJ1"
FT                   /protein_id="ACA31032.1"
FT                   /translation="MIDYEFLRFIWWILVGVLLIGFAVTDGFDMGVLSLLPFAGKKEVE
FT                   KRIMINSIAPHWDGNQVWLLTAGGAMFAAWPIVYAASFSGFYVAMILVLAALFFRPVGL
FT                   EYRAKIDNPTWRKFWDWGLFAGGFVPSLVFGVAFGNLLQGVPFEFNDLMQVTYTGSFFE
FT                   LLNPFAILCGLISFSMLTTQGAAWLQMKTTSELRERARVITQVGAFVTLLTFILAGVWL
FT                   YFKEGFIVTSVLDHNAPSDPTVKTVAVEVGAWFKNYFDAPVLFILPALAVGGALLNILA
FT                   SKANRSGFAFFFSSITMAGIILTCGVAMFPFVMPSISHPNMSLLMWDSTSSELTLTLML
FT                   GFALFFVVILLSYTIWAYAKMFGRLDADFIEENKNSLY"
FT   gene            141347..141772
FT                   /locus_tag="HSM_0131"
FT   CDS_pept        141347..141772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0131"
FT                   /product="Pol-Pal system-associated acyl-CoA thioesterase"
FT                   /note="TIGRFAM: Pol-Pal system-associated acyl-CoA
FT                   thioesterase; PFAM: thioesterase superfamily protein; KEGG:
FT                   hso:HS_0258 possible thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31043"
FT                   /db_xref="GOA:B0UVJ2"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR008272"
FT                   /db_xref="InterPro:IPR014166"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVJ2"
FT                   /protein_id="ACA31043.1"
FT                   /translation="MPVFKLPVRVYYEDTDAGGVVYHARYLHFFERARTEYLRTLNFSQ
FT                   QNLLNERKVAFVVKSMQIDYCVPAKLDDLLIVETYVVAIKGASIVFSQILKRDDEIISQ
FT                   AVVKVASVDLVKMRPVAIPQEIKAEIKLNDNIFGVMS"
FT   gene            141769..142452
FT                   /locus_tag="HSM_0132"
FT   CDS_pept        141769..142452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0132"
FT                   /product="Tol-Pal system TolQ"
FT                   /note="TIGRFAM: Tol-Pal system TolQ; PFAM: MotA/TolQ/ExbB
FT                   proton channel; KEGG: hso:HS_0259 biopolymer transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31054"
FT                   /db_xref="GOA:B0UVJ3"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR014163"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVJ3"
FT                   /protein_id="ACA31054.1"
FT                   /translation="MTAELDFLELFLKASIVVQIVIVILISFSIISWAIIIQRSRILTR
FT                   ALKDSTLFEERFWSGEDLYKLYDGLSNRRNGLNSSERIFYVGFKEFNRLKQANPDAPEA
FT                   IIQGSSRAMNLTMNREVEDLETRVPFLATVASISPYIGLFGTVWGIMHAFMALSGAKQA
FT                   TLQMVAPGIAEALIATAIGLFAAIPAVMAYNRLSLRVNKLEQNYANFIDEFTTILHRQA
FT                   FGKNH"
FT   gene            142520..142942
FT                   /locus_tag="HSM_0133"
FT   CDS_pept        142520..142942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0133"
FT                   /product="Biopolymer transport protein ExbD/TolR"
FT                   /note="PFAM: Biopolymer transport protein ExbD/TolR; KEGG:
FT                   hso:HS_0260 biopolymer transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31065"
FT                   /db_xref="GOA:B0UVJ4"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="InterPro:IPR014168"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVJ4"
FT                   /protein_id="ACA31065.1"
FT                   /translation="MSYRRKRRDIKSEINIIPFLDVLLVLLLIFMATAPIISQSVQVEL
FT                   PEAVESQNVSKEDKTPVILEVSGIGQYALSIGGERTEGITEELVTQLSKQEFDKDNNTL
FT                   FLVGGAKDVPYEEVIKALNLLHVAGIKSVGLMTNPL"
FT   sig_peptide     142520..142651
FT                   /locus_tag="HSM_0133"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.955) with cleavage site probability 0.470 at
FT                   residue 44"
FT   gene            142961..144016
FT                   /locus_tag="HSM_0134"
FT   CDS_pept        142961..144016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0134"
FT                   /product="Tol-Pal system TolA"
FT                   /note="TIGRFAM: Tol-Pal system TolA; PFAM: TolA family
FT                   protein; KEGG: hso:HS_0261 TolA protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31076"
FT                   /db_xref="GOA:B0UVJ5"
FT                   /db_xref="InterPro:IPR014161"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVJ5"
FT                   /protein_id="ACA31076.1"
FT                   /translation="MCNHRQKNELGAILLSIFLHILLLSLLVLGSNYNNVEIMGGGEGD
FT                   GEVMSAVMVDTGTIAKEWGRLQEKKKSNPDKQETFVEATQEDELMENVDVFEEKIREDE
FT                   DVQKRLAEQKIKEEKIQQERLAKQLEEDNAKKETVAKLKAEAEEMRLQALAKKIEEEKK
FT                   VRDAEEKQKVEKLAKERAEKLAKEKADRLAKQKALKEAKIKAEKAAKAKAELAQRKAEQ
FT                   AALDDFFNGGDIAGSSKNGGNMTMKGSQGVGAGFENGKGGRTGEQYAAQIKREIQRRFL
FT                   KEPRFANKVCVIEVELARDGTITNFRKLSGSDDICTAGLSAVSRTKKVPEAPTDEIYRK
FT                   YKKFPLEFRLK"
FT   gene            144044..145348
FT                   /locus_tag="HSM_0135"
FT   CDS_pept        144044..145348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0135"
FT                   /product="Tol-Pal system beta propeller repeat TolB"
FT                   /note="TIGRFAM: Tol-Pal system beta propeller repeat TolB;
FT                   PFAM: TolB domain protein; WD40 domain protein beta
FT                   Propeller; KEGG: hso:HS_0262 biopolymer transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31085"
FT                   /db_xref="GOA:B0UVJ6"
FT                   /db_xref="InterPro:IPR007195"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR014167"
FT                   /db_xref="InterPro:IPR036752"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UVJ6"
FT                   /protein_id="ACA31085.1"
FT                   /translation="MKFSAYLTTLFIVLFSLFIQTVQAESEVRIVIDEGVDSARPIAII
FT                   PFKWNGSDSMPIDVADIISADLRNSGKFNPIAVSKMPQKPTSASEVISDVWSSLGIDAV
FT                   VVGQVTPNEKGYSIAYQLVDTIGASGNSGEVLSQNQYAVPKNAIRLGAHTISDEVFEKL
FT                   TAIRGAFRTKIAYVVQKNGGSKPYQVRIADYDGHNQFIVYSSSQPLMSPAWSPDGSKLA
FT                   YVSFENRKSQLIVHDLQSGARRVIAAFPGHNGAPAFSPDGSKIAFASSKDGVLNIYVMN
FT                   LGNGTISQLTSGAGNNTEPSWSPDGQSIIFTSDRAGGPQIYQMDVVGNGVSLVSAGRGY
FT                   SGKISADGSILVMIYGDNIVKKDLATGVTEMLSSTFLDESPSISPNGIMIIYSSTQGLG
FT                   KVLQLVSADGRFKARLPSSDGQIKFPAWSPYLNKN"
FT   sig_peptide     144044..144118
FT                   /locus_tag="HSM_0135"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.996 at
FT                   residue 25"
FT   gene            145358..145813
FT                   /locus_tag="HSM_0136"
FT   CDS_pept        145358..145813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0136"
FT                   /product="Peptidoglycan-associated lipoprotein"
FT                   /note="TIGRFAM: Peptidoglycan-associated lipoprotein; PFAM:
FT                   OmpA/MotB domain protein; KEGG: hso:HS_0263
FT                   peptidoglycan-associated outer membrane lipoprotein (outer
FT                   membrane protein P6)"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31096"
FT                   /db_xref="GOA:B0UVJ7"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR014169"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR039001"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVJ7"
FT                   /protein_id="ACA31096.1"
FT                   /translation="MKNFAKLLVVAGSVAVLAACSSSDNASKTNAQMFGGYSVTDLQQR
FT                   YNTVYFEFDSYDVQGEYAQILDAHSAYLKSTPASKVLVEGHADERGTPEYNMALGLRRA
FT                   DAVKNFLLNKGVQASQLSTLSYGEEKPAELGHNEAAYSKNRRAVFAY"
FT   sig_peptide     145358..145438
FT                   /locus_tag="HSM_0136"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.604 at
FT                   residue 27"
FT   gene            146001..146076
FT                   /locus_tag="HSM_R0005"
FT                   /note="tRNA-Lys1"
FT   tRNA            146001..146076
FT                   /locus_tag="HSM_R0005"
FT                   /product="tRNA-Lys"
FT   gene            146102..146177
FT                   /locus_tag="HSM_R0006"
FT                   /note="tRNA-Lys2"
FT   tRNA            146102..146177
FT                   /locus_tag="HSM_R0006"
FT                   /product="tRNA-Lys"
FT   gene            146203..146278
FT                   /locus_tag="HSM_R0007"
FT                   /note="tRNA-Lys3"
FT   tRNA            146203..146278
FT                   /locus_tag="HSM_R0007"
FT                   /product="tRNA-Lys"
FT   gene            146488..147015
FT                   /locus_tag="HSM_0137"
FT   CDS_pept        146488..147015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0137"
FT                   /product="type II secretory pathway, pseudopilin"
FT                   /note="KEGG: hso:HS_0264 type II secretory pathway,
FT                   pseudopilin"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31107"
FT                   /db_xref="GOA:B0UVJ8"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVJ8"
FT                   /protein_id="ACA31107.1"
FT                   /translation="MKALKGFTLLEILIVLLIISMTVTFSFPMWQTANTKMILEKEQNK
FT                   LYIFIRELQARVENSNDIWFLIANRDLVSKRWCLVAQPKNTDICDCLNPRSCNRNIPMK
FT                   FYYPYFADKTMLISKVYYPREMTRLNGTRNTSTTTCFVLQSDQQRTVFSFFNVGSLKLK
FT                   GYQSLSACVNDH"
FT   gene            147028..147741
FT                   /locus_tag="HSM_0138"
FT   CDS_pept        147028..147741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0138"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hso:HS_0265 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31118"
FT                   /db_xref="GOA:B0UVJ9"
FT                   /db_xref="InterPro:IPR016419"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVJ9"
FT                   /protein_id="ACA31118.1"
FT                   /translation="MIIYRGQTLLSVMIALSLSMMLLMSVSAFYSYSQQQNKQILLHLY
FT                   LQSELQRTIQLLGKDIRRSGFRAISDKLVRSNFDLFAQDKSGKSIVVAQADNEPPNSCV
FT                   LFIYDLDATGCVGTTYRNNVCVRNKQNTAREIERELFGYRLNKQMIETRLTYKNSISAN
FT                   CNQKQCQSYLQQPACNSGGWVDLLDENDIAITALKFNWIADYNGLEVYLKGHLKRNKQV
FT                   EYETSAIIPLLNQKR"
FT   sig_peptide     147028..147129
FT                   /locus_tag="HSM_0138"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.970 at
FT                   residue 34"
FT   gene            147744..148424
FT                   /locus_tag="HSM_0139"
FT   CDS_pept        147744..148424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0139"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hso:HS_0266 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31129"
FT                   /db_xref="GOA:B0UVK0"
FT                   /db_xref="InterPro:IPR022543"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVK0"
FT                   /protein_id="ACA31129.1"
FT                   /translation="MNIQKGVVTLTLLMLLSSVLLILLFFDGDLISLHSSIVSQRKIYL
FT                   EQSLILQRQSISQKEKLCENQPLNNNLKSLKIEFESRRKIDRTSQFIWCERKYLFKKRP
FT                   KKATYEAGLSQYINLELLDLFQHKLHSPPAILPRDKANYLYWVEEKSAELEIQGNINAV
FT                   VIAEGDLKLTGKGKISGTVITGGKLSIEPAVKIVYRSKTIIDLIRSYSYWQFAENSWYD
FT                   FQPL"
FT   gene            148405..148722
FT                   /locus_tag="HSM_0140"
FT   CDS_pept        148405..148722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0140"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hso:HS_0267 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31141"
FT                   /db_xref="GOA:B0UVK1"
FT                   /db_xref="InterPro:IPR020511"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVK1"
FT                   /protein_id="ACA31141.1"
FT                   /translation="MIFNHYKFPQRGTSLITLLVTMMIFSTLFLFVNQWVSYQRKSAVN
FT                   IYLRYQALQIAENQHQRLFLEPHFHCPHNIEQNGYKFKINCEGKNVRVSYANQQVNLLL
FT                   D"
FT   sig_peptide     148405..148503
FT                   /locus_tag="HSM_0140"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.826) with cleavage site probability 0.573 at
FT                   residue 33"
FT   gene            148775..152209
FT                   /locus_tag="HSM_0141"
FT   CDS_pept        148775..152209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0141"
FT                   /product="exodeoxyribonuclease V, gamma subunit"
FT                   /note="TIGRFAM: exodeoxyribonuclease V, gamma subunit;
FT                   PFAM: Exodeoxyribonuclease V RecC subunit; KEGG:
FT                   hso:HS_0268 exodeoxyribonuclease V, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31152"
FT                   /db_xref="GOA:B0UVK2"
FT                   /db_xref="InterPro:IPR006697"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041500"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVK2"
FT                   /protein_id="ACA31152.1"
FT                   /translation="MFTLYYSNQLETQKDILLHLMDQQPLSDPFQKEVILVQSGGMAQW
FT                   IQWQIAEKKGISANLSFPMPASFIWQLYVDNLSQVTASSQFSKENMTWRLMEIIPHYID
FT                   QPEFYILRQYLQQSYQSSQQRYYQLASKIAELFDQYLVYRPEWIISWEQNKGVEIIQQI
FT                   QYYQKNLSVSESCFSQVEQHIVWQGILWRALVCSVQKETQKNVLHRAHLHLLFLKHIAG
FT                   EKPKNLPTRIFVFGISALPKVHLDTLSALSQHCDVHLFFNNACREYWGDIIDQSHWQRL
FT                   KVRERISWQDFQQPQNTQAWLSDAQIHTFEQNGFEQIYDEKLQVGNPLLSSWGKLGRDY
FT                   LYLLTELEANEINAYVELSEKTLLSQVQARILDLVPSKHKFLNLAENDRSLTFHSCYSP
FT                   IREVQALQDYLLHLFNQAQDLTPKDVVVMVADIDKYAPYIQAVFSQGEHYIPYSIADSK
FT                   LSENDPLVSAFLQLLNLKESLFSAEEVLTFLDHPVIRQSFNITLEDLAQIRHWVEHSGI
FT                   RFGLEKYPQQSLQNYNAWQAGLERMLLGFAMREENGLWLDTLGFDDTYGLKGQLVGYLK
FT                   DFITRLYQWHQFLQVDHVIEKWEEHLIELMSSFFVVDGMDIPQQYKTTFNYLIDTIQQL
FT                   TELILDSSFQQEISAEVIYEVFVERLKDIPNSLKFLMGKVTFCTLLPMRSIPFKVVCLL
FT                   GMNDSDYPRQQTPNSFDLMQYHRKKGDRFRRDDDRYLFLEALISAQQYFYVSYIGRSII
FT                   DDSEREPSVLVTQLLDYIAENINAQGDLKGQDILKKSLIQQHAMTAFSRENFTKRDRSF
FT                   SKQWLVLANKKDSGNLANFLQPINDTEIVKELSLNDLIAFIQDPVRYFFEQKLRVFLRK
FT                   TEQNIADTENFTLDNLELYQIKEELIYLSEQEWEDFFARMKIKGIMPQGAFAKIYQQKT
FT                   KNEIITLKSLVTPYLDQISEQIPVDLSVETEYGKVCLTGSIDSLYHQKMRRVTWRASVV
FT                   KTKDIIQTWIYYLLQTLVGEPNSQVEHYALDSRLSFEKIEKSTALQQLQTYVEAYLLGQ
FT                   VSVLLMPMKNFDQYLQLLFTPKSNKWKEEKDIDLSACFELLSELGSGRKERNFYVKTDP
FT                   YWQRILAQTKLDDSHILEINQRVIQWFDLMLMLKRVE"
FT   gene            152288..152902
FT                   /locus_tag="HSM_0142"
FT   CDS_pept        152288..152902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0142"
FT                   /product="Holliday junction DNA helicase RuvA"
FT                   /note="TIGRFAM: Holliday junction DNA helicase RuvA; PFAM:
FT                   RuvA domain protein; DNA recombination protein RuvA domain
FT                   I; SMART: Helix-hairpin-helix DNA-binding class 1; KEGG:
FT                   hso:HS_0269 Holliday junction DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31163"
FT                   /db_xref="GOA:B0UVK3"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="InterPro:IPR036267"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UVK3"
FT                   /protein_id="ACA31163.1"
FT                   /translation="MIGRVTGILVEKQAPEILLDVQGVGYELLLPMTSFYNLPEVGQET
FT                   TLFTHFVVREDAHLLFGFSHKQDRSLFRELIKTNGVGPKLALAILSAMSVNEFVYAIEQ
FT                   EELSKLVKIPGVGKKTAERLLVELKGKFKGLQQTDFFIKSSHLPGIKCSKLDQSLQLDE
FT                   AVSALIALGYKPIEAEKMVKKVLKADLTSEQLIREALKAAL"
FT   gene            152913..153920
FT                   /locus_tag="HSM_0143"
FT   CDS_pept        152913..153920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0143"
FT                   /product="Holliday junction DNA helicase RuvB"
FT                   /note="TIGRFAM: Holliday junction DNA helicase RuvB; PFAM:
FT                   AAA ATPase central domain protein; Holliday junction DNA
FT                   helicase RuvB domain; ATPase associated with various
FT                   cellular activities AAA_5; SMART: AAA ATPase; KEGG:
FT                   hso:HS_0270 Holliday junction DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31174"
FT                   /db_xref="GOA:B0UVK4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UVK4"
FT                   /protein_id="ACA31174.1"
FT                   /translation="MIEVDRIVSANAKVDDEYIDRAIRPKLLSDYIGQPQVREQMEIFI
FT                   QAAKLRQDALDHLLIFGPPGLGKTTLANIVANEMGVNIRTTSGPVLEKAGDLAAMLTNL
FT                   EPHDVLFIDEIHRLSPAIEEVLYPAMEDYQLDIMIGEGPAARSIKLDLPPFTLIGATTR
FT                   AGSLTSPLRDRFGIVQRLEFYSVEDLASIVTRSAVCLQLEIDVEAGQEIACRSRGTPRI
FT                   ANRLLRRVRDYADVKNGGKITALIAQEALKMLDVDLAGFDFMDRKLLQAIIERFDGGPV
FT                   GLDNLAAAIGEERDTIEDVLEPYLIQQGFLQRTPRGRIATSRTYRHFGLEQIEK"
FT   gene            complement(154034..155242)
FT                   /locus_tag="HSM_0144"
FT   CDS_pept        complement(154034..155242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0144"
FT                   /product="HI0933 family protein"
FT                   /note="PFAM: HI0933 family protein; FAD dependent
FT                   oxidoreductase; KEGG: hso:HS_0271 conserved hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31185"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVK5"
FT                   /protein_id="ACA31185.1"
FT                   /translation="MMNYSQTIIIGAGAAGLFCAGQLGKAKHQVTILDNGKKVGRKILM
FT                   SGGGFCNFTNLNVTPQHYLSQNPHFVKSALARFTQWDFIALITDYGISYYEKESGQLFC
FT                   HNSAEDIVNMLRAECDKFQVNTQLRQQIEYIEKLDGNEKARFQLQSDGKIWQCENLVIA
FT                   TGGLSMPALSSTPFGYQVAEQFGLNVIAPRAGLVPFTWREIDKFYTALSGISLPVCVTA
FT                   KCGQSFSNNLLFTHRGISGPAILQISNYWQVNENIEIDLLPMENIQFFLNKLRQTSPKL
FT                   HLKTALSRLLPQKLVDLWLNHNIIQDEVIANLSKVQLKNLDDLIHHWQIQPNGTEGYRT
FT                   AEVTIGGVDTQEISSKTMESHKIKGLYFIGEVLDVTGRLGGYNFQWAWSSAYVCANGIL
FT                   SNK"
FT   gene            complement(155242..156207)
FT                   /locus_tag="HSM_0145"
FT   CDS_pept        complement(155242..156207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0145"
FT                   /product="putative methyltransferase"
FT                   /note="TIGRFAM: putative methyltransferase; PFAM:
FT                   methyltransferase putative; Methyltransferase type 11;
FT                   Methyltransferase type 12; KEGG: hso:HS_0272 possible
FT                   S-adenosylmethionine-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31196"
FT                   /db_xref="GOA:B0UVK6"
FT                   /db_xref="InterPro:IPR010017"
FT                   /db_xref="InterPro:IPR027555"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UVK6"
FT                   /protein_id="ACA31196.1"
FT                   /translation="MFDFRPFYQQIATSTLSAWLETLPLQLKQWEKQTHGDYIKWSKII
FT                   DFLPHLTADHIDLKSAVKAETKTPLSSGERQRIIHHLKQLMPWRKGPYHLYGIHIDCEW
FT                   RSDFKWERVLPHLAPLQNRLVLDVGCGSGYHMWRMVGEGAKMVVGIDPTELFLCQFEAV
FT                   RKLLNNDRRANLIPLGIEEMQPLAAFDTVFSMGVLYHRKSPLDHLTQLKNQLVKDGELV
FT                   LETLVVEGDINTILVPTDRYAKMKNVYFIPSVLALINWLEKCGFHNIRCVDVETTGLEE
FT                   QRKTDWLENESLIDFLNPQDHSKTIEGYPAPKRAVILANK"
FT   gene            complement(156210..157724)
FT                   /locus_tag="HSM_0146"
FT   CDS_pept        complement(156210..157724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0146"
FT                   /product="sodium/proline symporter"
FT                   /note="TIGRFAM: SSS sodium solute transporter superfamily;
FT                   sodium/proline symporter; PFAM: Na?? symporter; KEGG:
FT                   hso:HS_0273 sodium/proline symporter"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31207"
FT                   /db_xref="GOA:B0UVK7"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR011851"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVK7"
FT                   /protein_id="ACA31207.1"
FT                   /translation="MFSFDPTIITFIVYILGMLLIGALAYYYTNNLSDYILGGRRLGSF
FT                   VTAMSAGASDMSAWLLMGLPGTIYLSGLIEGWIAIGLTIGAYFNWLFVAGRLRIYTEFN
FT                   NNALTLPEYFHNRFGSRYNLLKFVSASIILVFFTIYCASGIVAGAKLFQNLFNIPYSTA
FT                   LWYGALATIAYTFIGGFLAVSWTDTIQATLMIFALILTPIMIILNLDGIDNFHFYLKQA
FT                   ESAAGKNLTDIFTGTTTIGLLSLASWGLGYFGQPHILARFMAAHTVKSLNNARRISITW
FT                   MILCLVGAIGIGFFGIAYFTANPQLAGVVNKESEQIFIELSKLLFNPWIAGILLSAILA
FT                   AVMSTLSAQLLISSSAVTEDFYKGFIRPKASDKELMWLGRLMVLAIATIAIWIAQDEKS
FT                   QVLKLVEFAWAGFGSAFGPVVLFSLFWKRMTSSAAMAGMLTGTIIVFSWKTIVPTTSEF
FT                   SKLYEMIPGFALASIVIIVVSLLSVKPEKSILETFEQAKNAYKASK"
FT   gene            157852..159330
FT                   /locus_tag="HSM_0147"
FT   CDS_pept        157852..159330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0147"
FT                   /product="ribonuclease, Rne/Rng family"
FT                   /note="TIGRFAM: ribonuclease, Rne/Rng family; PFAM: RNA
FT                   binding S1 domain protein; KEGG: hso:HS_0274 ribonuclease
FT                   G"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31218"
FT                   /db_xref="GOA:B0UVK8"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVK8"
FT                   /protein_id="ACA31218.1"
FT                   /translation="MMESVELLANITPSETRIALVDNGILKEVHIERQAKRGSVGNIYK
FT                   GRVTRVLPGMQSAFVDIGLEKAAFLHASDIVSHTECVDVDEQKQFVVKDIAQLVHEGQD
FT                   IVVQVVKDPLGTKGARLTTDITLPSRYLVFMPENSHVGVSQRIESEEERARLKELVLPL
FT                   CDELGGFIIRTAAEGATETELVQDAEFLKRLWRKVLERRAKYTTRSMLYGELALTQRIL
FT                   RDFIGANFSKIHIDSKLCFSEVKQFTEEFMPELTDKLVLYSGSQPLFDVYSVENAIQTA
FT                   LNSRVNLKSGGYLIIEQTESMTTIDINTGAFVGHRNLEETIFNTNIEATKAIAQQLQLR
FT                   NLGGIIIIDFIDMQTEEHRDRVLESLRLALSKDRVKTNVNGFTQLGLVEMTRKRTRESL
FT                   EHILCDECPTCSGRGSVKTVETVCYEIMREIIRVNHLFASEKFVVYASRAVADYLINEE
FT                   SHGLLAELEVFIGKQIQIKTEVYYSQEQFDVVVM"
FT   gene            159385..160167
FT                   /locus_tag="HSM_0148"
FT   CDS_pept        159385..160167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0148"
FT                   /product="putative glycosyltransferase"
FT                   /note="KEGG: hso:HS_0275 possible glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31229"
FT                   /db_xref="GOA:B0UVK9"
FT                   /db_xref="InterPro:IPR005076"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVK9"
FT                   /protein_id="ACA31229.1"
FT                   /translation="MVKNIGILYIATGRYHVLWEDFYKSAEKHFLPELPKKYFLFSDYE
FT                   GSFLGEESGNVHRIYQKKLGWPYDTLMRFDMFLKEKERFKELDYLFFVNANMIFIKDIH
FT                   QNEVLASDKELIMILQPWFIGLDIDKTTYDRNPLSTSYIPYGEGEHYVMGSFNGGKTSA
FT                   FLEMCQQLNDNIYLDLKKDIIALWHDESHLNHYCWRNKEKIFILPDSYLLDEGQQYFPS
FT                   KKSHYINPLYLKNHDVRLVMRNKNHYRFGGGELHERDY"
FT   gene            160305..161753
FT                   /locus_tag="HSM_0149"
FT   CDS_pept        160305..161753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0149"
FT                   /product="peptidase U62 modulator of DNA gyrase"
FT                   /note="PFAM: peptidase U62 modulator of DNA gyrase; KEGG:
FT                   hso:HS_0276 modulator of DNA gyrase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31240"
FT                   /db_xref="GOA:B0UVL0"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVL0"
FT                   /protein_id="ACA31240.1"
FT                   /translation="MLNKVQESILAPNNLELDNLKNTFDMLSHRQIDYADLYFQLSQDE
FT                   NWVLEDSIIKEGGFHIDRGVGVRAVTGEKTGFAYSDQIDLVSLQQCANAVKGIALPNQG
FT                   NIIKPIGFNAVNAITRYPAVNPLNSLNKEQKIELLHLVDRTARAYSPYVTKVVANLTAL
FT                   YEEILVVATDGTLAADVRPLIRLSIFVMAEKAGKREQGSAGVGARVGLDWFFEPYKGEQ
FT                   RAIYFAKEAARQALVNLDAIEAPAGLMPVVLGAGWPGVLLHEAVGHGLEGDFNRKGSSL
FT                   FTGKIGELVTSPLCTIVDDGTLPNRRGSLTIDDEGVPSQCNVLIKDGVLQGYMQDKMNA
FT                   RLMGVKPTGNGRRESYAHLPMPRMTNTYMLAGQSKFEDLIASVDYGIFAPHFGGGQVDI
FT                   VSGKFTFSMSEAYLIEKGRITKPIKGATMIGQGIEVMQQVSMVADNMEIDHGIGVCGKD
FT                   GQSVPVGVGQPACKIEQITVGGTA"
FT   gene            161967..163415
FT                   /locus_tag="HSM_0150"
FT   CDS_pept        161967..163415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0150"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: hso:HS_0277 possible SAM-dependent
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31252"
FT                   /db_xref="GOA:B0UVL1"
FT                   /db_xref="InterPro:IPR018773"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVL1"
FT                   /protein_id="ACA31252.1"
FT                   /translation="MLEIGCSFGGNLLPFAIRHPNSQLVGIDLSEYQINIGQQMMEQVG
FT                   VKNVELVAADISQVSFNIKFDYIICHGVFSWVPEAVRHAILKTIQEYLSPNGIAHISYN
FT                   TYPGWKIRDVAKELMCFGSNPNLSSLERIDQSFELLKFTSSILQRKNADLYKVLSHSFQ
FT                   EIPDKDKFYVAHEYFEDFNQPFYFREFISQLEAYHLAYLTDSSFPAIYSDVHFEHDEYE
FT                   KVCAYFDYRLEAVEQFIDFLNNRSFRHSIITHQQNLADKGITNNISQYNHCHHFYDIYF
FT                   RTDVRYSPATDDKEAHWQLLDIGAEISDTPLNNLLCTYLQEHNNPCKIGDICEYAKKFP
FT                   EYDETELYKLILSIIYSNHVYLCFEPETSTGYDSKPKLFEPYRRLIDLVRHNPNITCLS
FT                   NRYYQVLNLDFLPQYIAQFLDGTRTVKDLIKQLREDIENNTIVLHDENGNELSNKKIKD
FT                   KDIKEVIVRQLDALKEYGYFTEYK"
FT   gene            complement(163496..164302)
FT                   /locus_tag="HSM_0151"
FT   CDS_pept        complement(163496..164302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0151"
FT                   /product="Inositol-phosphate phosphatase"
FT                   /EC_number="3.1.3.25"
FT                   /note="PFAM: inositol monophosphatase; KEGG: hso:HS_0278
FT                   inositol-1(or 4)-monophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31263"
FT                   /db_xref="GOA:B0UVL2"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="InterPro:IPR022337"
FT                   /db_xref="InterPro:IPR033942"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVL2"
FT                   /protein_id="ACA31263.1"
FT                   /translation="MNPMLNIAIRAARKAGNIIVKGYERRDEIQTMQKGINDFVTNIDK
FT                   ASEAAIIEVVRKSYPEHTIITEESGAHEGQNNDIQWVIDPLDGTTNFVKGLPHFAVSIA
FT                   VRVKGRTEIGVVYDPIRNELFTAVRGEGAKINELRLRVDSSKRDLQGAILATGFPFKKP
FT                   SLMPTQFAMMSNLTENVADFRRAGSAALDLCYVAANRVDGYFEMGVKPWDITAGDLILR
FT                   EAGGLVCDFYGGHKYFTDSHIVAATPRLVKEILNKIQPCLAPDFKV"
FT   gene            164474..165214
FT                   /locus_tag="HSM_0152"
FT   CDS_pept        164474..165214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0152"
FT                   /product="RNA methyltransferase, TrmH family, group 1"
FT                   /note="TIGRFAM: RNA methyltransferase, TrmH family, group
FT                   1; PFAM: tRNA/rRNA methyltransferase (SpoU); KEGG:
FT                   hso:HS_0279 possible tRNA/rRNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31274"
FT                   /db_xref="GOA:B0UVL3"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004384"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVL3"
FT                   /protein_id="ACA31274.1"
FT                   /translation="MLENIKIVLVETSHSGNIGSAARAMKTMGLNQLCLVAPKQGIDEQ
FT                   AVALAAGAEDVVKSAVVADSFSQAVADCSLIIGTSARLRHLQSTLIEPRECAEKVIQSL
FT                   SSQKVAIVFGRERVGLTNDELLKCHYHLTIPANPEYSSLNLAMAVQLISYELRLAWLAS
FT                   LKELKQPFSVIANNYPTFQELEHFFAHTEQLYQQLGFIQNQGVMKKLRRLYQRVQLEKN
FT                   ELNILRGMLSAVEKRINCKKLEVD"
FT   gene            165268..165675
FT                   /locus_tag="HSM_0153"
FT   CDS_pept        165268..165675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0153"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="TIGRFAM: putative transcriptional regulator, Rrf2
FT                   family; iron-sulfur cluster assembly transcription factor
FT                   IscR; PFAM: protein of unknown function UPF0074; KEGG:
FT                   hso:HS_0280 possible transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31285"
FT                   /db_xref="GOA:B0UVL4"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR010242"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVL4"
FT                   /protein_id="ACA31285.1"
FT                   /translation="MKLTSKGRYAVTAILDIALNAELGPVSLADISERQHISLSYLEQL
FT                   FAKLRRGGLVKSVRGPGGGYQLGLSTDQISIGMVINAVNENINVTKCLGNGDCQGGVKC
FT                   LTHSLWEELSVRIENFLNEITIAELVAKQAK"
FT   gene            165754..166968
FT                   /locus_tag="HSM_0154"
FT   CDS_pept        165754..166968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0154"
FT                   /product="cysteine desulfurase IscS"
FT                   /note="TIGRFAM: cysteine desulfurase IscS; PFAM:
FT                   aminotransferase class V; aromatic amino acid
FT                   beta-eliminating lyase/threonine aldolase; KEGG:
FT                   hso:HS_0281 cysteine desulfurase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31296"
FT                   /db_xref="GOA:B0UVL5"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010240"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UVL5"
FT                   /protein_id="ACA31296.1"
FT                   /translation="MKLPIYLDYAATCPVDERVVKKMMEFLSIDGNFGNPASRSHKFGW
FT                   QAEEAVDVARNHIADLIGADSREIVFTSGATEADNLALKGVMRFYQTKGKHLITCKTEH
FT                   KAILDTCRQLEREGFEVTYLDPKSDGLIDLEELKSVIRDDTVLVSIMHANNEIGVVQDI
FT                   AKIGEICRERKVLFHTDATQSVGKLPINLSELKVDLLSMSSHKLYGPKGIGALYVCRKP
FT                   RVRLEAIIHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMATEMPRLTALRDRLYNGL
FT                   KDIEETYVNGSMEQRLGNNLNISFNYVEGESLMMALRDIAVSSGSACTSASLEPSYVLR
FT                   ALGLNDELAHSSIRFTVGRYTTEEEIDYSIGLVKSAVKKLRDLSPLWDMFKEGIDLNSI
FT                   EWTHH"
FT   gene            167045..167428
FT                   /locus_tag="HSM_0155"
FT   CDS_pept        167045..167428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0155"
FT                   /product="FeS cluster assembly scaffold IscU"
FT                   /note="TIGRFAM: FeS cluster assembly scaffold IscU; PFAM:
FT                   nitrogen-fixing NifU domain protein; KEGG: hso:HS_0282
FT                   iron-sulfur cofactor synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31307"
FT                   /db_xref="GOA:B0UVL6"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="InterPro:IPR011339"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVL6"
FT                   /protein_id="ACA31307.1"
FT                   /translation="MAYSEKLLDHYENPRNVGSFDKKDPTVGSGMVGAPACGDVMQLQI
FT                   KVNDEGIIEDAKFKTYGCGSAIASSSLITEWVKGKSLDEAQAIKNSQIAEELELPPVKV
FT                   HCSILAEDAIKAAIADYKAKKAE"
FT   gene            167594..167917
FT                   /locus_tag="HSM_0156"
FT   CDS_pept        167594..167917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0156"
FT                   /product="iron-sulfur cluster assembly protein IscA"
FT                   /note="TIGRFAM: iron-sulfur cluster assembly accessory
FT                   protein; iron-sulfur cluster assembly protein IscA; PFAM:
FT                   HesB/YadR/YfhF-family protein; KEGG: hso:HS_0283
FT                   HesB-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31318"
FT                   /db_xref="GOA:B0UVL7"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR011302"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVL7"
FT                   /protein_id="ACA31318.1"
FT                   /translation="MSITLTQAAANRVRTFLEKRGKGIGLRLGIKTSGCSGLAYVLEFV
FT                   DVLNEDDEVFEQDGVKVIVDHKSLVYLDGTQLDFVKEGLNEGFKFSNPNVKDECGCGES
FT                   FNV"
FT   gene            167930..168448
FT                   /locus_tag="HSM_0157"
FT   CDS_pept        167930..168448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0157"
FT                   /product="co-chaperone Hsc20"
FT                   /note="TIGRFAM: co-chaperone Hsc20; PFAM: heat shock
FT                   protein DnaJ domain protein; HSCB oligomerisation domain
FT                   protein; KEGG: hso:HS_0284 co-chaperone protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31329"
FT                   /db_xref="GOA:B0UVL8"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR004640"
FT                   /db_xref="InterPro:IPR009073"
FT                   /db_xref="InterPro:IPR036386"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVL8"
FT                   /protein_id="ACA31329.1"
FT                   /translation="MINPFALFDLEIDFNLDQQILSQRYLTLQKSLHPDNFAHRSAQEQ
FT                   RLALQKSAEINDALQILKDPISRADSIINLHLGEQNIEQKTNQDMMFLMQQMAWRERLE
FT                   QVEQQQNMDKLLHFSQEVECVQRDILAELQEFLAQQNWQQAQLLNDRLRFIKKLFVEIE
FT                   RVEEQLAGF"
FT   gene            168490..170340
FT                   /locus_tag="HSM_0158"
FT   CDS_pept        168490..170340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0158"
FT                   /product="Fe-S protein assembly chaperone HscA"
FT                   /EC_number="1.3.1.74"
FT                   /note="TIGRFAM: Fe-S protein assembly chaperone HscA; PFAM:
FT                   Heat shock protein 70; KEGG: hso:HS_0285 chaperone protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31340"
FT                   /db_xref="GOA:B0UVL9"
FT                   /db_xref="InterPro:IPR010236"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="InterPro:IPR042039"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UVL9"
FT                   /protein_id="ACA31340.1"
FT                   /translation="MALLQIAEPGQSAAPHQHKLAVGIDLGTTNSLVAAVRSGSSEVLR
FT                   DEQDRLLIPSIVHLTEDQAIVGYEAGQLASQDPQNTIISVKRLIGRSCTDVQQRYPNLP
FT                   YQFNATENGLPLLKTRRGLLSPVEISAEILKKLTALAEQRLGGELTGAVITVPAYFDDA
FT                   QRQSTKDAAKLAGLKVLRLLNEPTAAAIAYGLDSGQEGVIAVYDLGGGTFDVSILRLSK
FT                   GVFEVLATGGDTALGGDDFDHLLAEWIVKKSTVAPQNDREKRQLIEVANQVKVALTTND
FT                   KIRISYAEQNLEIMRDEFNFLISGLVKRSLLACRRTLKDANLTPSDILEVVMVGGSTRI
FT                   PYVREQVGEFFQCTPLTSIDPDKVVALGAAIQADILVGNKPDSEMLLLDVIPLSLGIET
FT                   MGGLVEKIIPRNTTIPVARAQEFTTFKDGQTAMSVHVLQGEREMVTDCRSLARFTLRGI
FT                   PAMVAGAARIRVTYQVDADGLLSVTAVEKSTGVQASTQVKPSYGLTDDEIANMLKSSME
FT                   HAKEDIQTRLLTEQRVDATRVIESVYSALQQDEDLLDDNELSAVKNALVSLQKLIQEED
FT                   SLAIKQGIKMLDQATQEFASRRMDKSIRRALSGQHIEHIK"
FT   gene            170352..170693
FT                   /locus_tag="HSM_0159"
FT   CDS_pept        170352..170693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0159"
FT                   /product="ferredoxin, 2Fe-2S type, ISC system"
FT                   /note="TIGRFAM: ferredoxin, 2Fe-2S type, ISC system; PFAM:
FT                   ferredoxin; KEGG: hso:HS_0286 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31351"
FT                   /db_xref="GOA:B0UVM0"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001055"
FT                   /db_xref="InterPro:IPR011536"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR018298"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVM0"
FT                   /protein_id="ACA31351.1"
FT                   /translation="MPKIVFLPHQDFCPEGMVVDAAPGENLLDVAHNAGVEIHHACDGS
FT                   CACTTCHVVIREGFDSLNETTEQEEDMLDKAWGLEMDSRLSCQCVVGEEDLVVEIPRYN
FT                   LNHANEAAH"
FT   gene            170828..173101
FT                   /locus_tag="HSM_0160"
FT   CDS_pept        170828..173101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0160"
FT                   /product="glutamate--cysteine ligase, putative/amino acid
FT                   ligase, putative"
FT                   /EC_number="6.3.2.3"
FT                   /note="TIGRFAM: glutamate--cysteine ligase, putative/amino
FT                   acid ligase, putative; PFAM: phosphoribosylglycinamide
FT                   synthetase; glutamate--cysteine ligase; KEGG: hso:HS_0287
FT                   glutamate--cysteine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31363"
FT                   /db_xref="GOA:B0UVM1"
FT                   /db_xref="InterPro:IPR006334"
FT                   /db_xref="InterPro:IPR006335"
FT                   /db_xref="InterPro:IPR007370"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR040657"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVM1"
FT                   /protein_id="ACA31363.1"
FT                   /translation="MKIQHLIKQHQLGLLFQQGSFGLEKESQRVYQDGSVVTTEHPKCF
FT                   GNRSYHPYIQTDFAESQLELITPPNKNLEDSLRWLSAIHEVVLRSLPEDEFIFPLSMPA
FT                   GLPSDELIKVAQLDNPEDVAYREHLVQSYGKNKQMVSGIHYNFQLAPELIQTLFDLQQE
FT                   QKSAVDFQNNLYLKMAKNFLRYQWVLLYLLSATPTVESNYFKGSSPLGKGEYVRSLRSS
FT                   KYGYVNDPEVIVSFDSLEQYAESLEHWVKSGKLIAEKEFYSNVRLRGAKKARDLIQNGI
FT                   KYLEFRLFDLNPFEQYGMSLADARFIHHFVLLMIWLDEMPDQQGVELGRSRLAEVALEN
FT                   PLAQTAYREEGEWLLNQLISMLQSIGADQSAVSFVREKLAQFADPGLTLCGRLVQEIEQ
FT                   KGGYQKLGAELAKQYKENAFERFYALTAFDNMELSTQALMFDLIQQGISFEILDERDQF
FT                   LRLQFGEHVEYVKNGNMTSKDSYISPLIMENKVVTKKVLEKAGFNVPQSQEFTSVKQAI
FT                   VGYSLFEKRAVVIKPKSTNYGLGITIFQQGVNNREDFAKAVEIAFREDKEIMVEDYLVG
FT                   TEYRFFVLGEETLAVLLRVPANVVGDGIHTVAELVAQKNAHSLRGDGSRTPLKKIALGD
FT                   IEQLQLKEQGLTVESIPAKDQIVQLRANSNISTGGDSIDITDEMHLSYKQLAVGIAKAM
FT                   GAAVCGVDLIISDLKEPAQPDLSSWGVIEANFNPMMMMHIFPYAGQSRRLTRNVINMLF
FT                   PEVK"
FT   gene            complement(173270..173986)
FT                   /locus_tag="HSM_0161"
FT   CDS_pept        complement(173270..173986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0161"
FT                   /product="purine nucleoside phosphorylase"
FT                   /note="TIGRFAM: purine nucleoside phosphorylase; PFAM:
FT                   purine or other phosphorylase family 1; KEGG: hso:HS_0288
FT                   purine-nucleoside phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31374"
FT                   /db_xref="GOA:B0UVM2"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR004402"
FT                   /db_xref="InterPro:IPR018016"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UVM2"
FT                   /protein_id="ACA31374.1"
FT                   /translation="MTPHINAPAGAFADVVLMPGDPLRAKYIAETFLENAQEVTNVRNM
FT                   LGYTGTYKGRKISVMGHGMGIPSCSIYAKELITEYGVKKIIRVGSCGAVNMDVKIRDVI
FT                   IGLGACTDSKVNRIRFKDNDFAAIADFGMARAAVQAAKNKGIDVKVGNLFSADLFYTPD
FT                   LEMFDVMEKYGILGVEMEAAGIYGVAAEFKAKALTICTVSDHIRTHEQTSAEERQLTFN
FT                   EMIEIALESVLLEDSL"
FT   gene            complement(174119..175378)
FT                   /locus_tag="HSM_0162"
FT   CDS_pept        complement(174119..175378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0162"
FT                   /product="nucleoside transporter"
FT                   /note="TIGRFAM: nucleoside transporter; PFAM: Na dependent
FT                   nucleoside transporter; nucleoside recognition domain
FT                   protein; Na dependent nucleoside transporter domain
FT                   protein; KEGG: hso:HS_0289 transport system permease"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31385"
FT                   /db_xref="GOA:B0UVM3"
FT                   /db_xref="InterPro:IPR002668"
FT                   /db_xref="InterPro:IPR008276"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR011657"
FT                   /db_xref="InterPro:IPR018270"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVM3"
FT                   /protein_id="ACA31385.1"
FT                   /translation="MSSLISIIGIFALLLIAFLLSNNRKAINYRTVLGALLIQFLFGAF
FT                   ILYVPVGRQALQSVAGAVQSVINYGNEGIRFLFNGLAPQADGSMGSAGFVFVINVLPNI
FT                   VFFSALISLLYYIGVMQWLIKIIGGALQKALGTSKSESMSAAANIFVGQTEAPLVIKPY
FT                   ISKMTESELFAVMCGGLASIAGSVMAGYAGMGVPLTYLIAASFMAAPAGLLFAKILIPQ
FT                   TEKFNDNFEQIQQEKPTNILDAAAGGASSGMQLALNVGAMLIAFVALIALLNGILGTIG
FT                   NWIGQEGLSLGMIFGWVFKPLAFIIGVPWEEAEIAGRMIGTKLAINEFVGYLDFVPYLA
FT                   ADAAVQLSDKTKAIITFALCGFANFSSIAILIGGLGAMAPNRRGDIARLGIKAVIAGSL
FT                   ANLMSATIAGLFIGLSGAAL"
FT   sig_peptide     complement(175298..175378)
FT                   /locus_tag="HSM_0162"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.861) with cleavage site probability 0.519 at
FT                   residue 27"
FT   gene            175554..176198
FT                   /locus_tag="HSM_0163"
FT   CDS_pept        175554..176198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0163"
FT                   /product="protein of unknown function DUF161"
FT                   /note="PFAM: protein of unknown function DUF161; KEGG:
FT                   hso:HS_0290 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31396"
FT                   /db_xref="GOA:B0UVM4"
FT                   /db_xref="InterPro:IPR038750"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVM4"
FT                   /protein_id="ACA31396.1"
FT                   /translation="MKKFNELPQTPWAAKSLWEIETKSLLVLCFSLSLLGIGDGLLVLS
FT                   NLGSAPWTVLSQGIALQAQFSVGWASFIVSILVMLMWIPLRLKVGFGTILNVVLIALFL
FT                   GLSIFYISPPSSLLARFCYLITGIIFFGIGTAFYLTCHQGAGPRDGLMVGLCHRFKLRI
FT                   GIVRTLMEVSVCFLGFLLGGTVGIGTLLFATSIGWIIQLGVYFIMKLNKSV"
FT   gene            176275..177843
FT                   /locus_tag="HSM_0164"
FT   CDS_pept        176275..177843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0164"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   hhe:HH0773 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31407"
FT                   /db_xref="GOA:B0UVM5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR027791"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVM5"
FT                   /protein_id="ACA31407.1"
FT                   /translation="MMRLPISVTMLVKNAEKYLAKSLSSLKDFPEIIVLDNGSTDRSIE
FT                   IAKQFTNVKIYHSPFIGFGPMKNLVATYASYDWILNIDSDEILQPQLIQEISQLNFDEP
FT                   RKVYALLRINHYRGKPIKTCGWYPDFVKRLYNKKLVKFDDKRVHEALEIADDIQVVRLK
FT                   HEFNHYSFDSSEMLINKMQHYTALFAEQQKYRKKSSVLSAIAHGIVAFFKSYILKRGIL
FT                   SGGDGFIISFANASGSYYKYIKLMEANQSLTTALIITTYNRPDALEAVLVSVLAQSLLP
FT                   NEVIIADDGSTEDTKELIQKYQAIFPIPLKHVWQPDTGFRLAESRNKALSLVESEYVIT
FT                   IDGDMVLHPQFISDHRKAAEKNVFVGGGRILLTKDKTTALLQSSEQYSSFKWYEKGLET
FT                   RFEKRLMALHIPFLSEFIQRTKRVHYYNGIRGCNMAFFLSDALEINGFNNDFVGWGRED
FT                   SEFVARFFNNGGKRKNIKFAAIAYHLWHPEEDRKALPVNDELLKRAIEDKLVFCSNGLN
FT                   QIKLD"
FT   gene            178024..178272
FT                   /locus_tag="HSM_0165"
FT   CDS_pept        178024..178272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0165"
FT                   /product="ribosomal protein S16"
FT                   /note="PFAM: ribosomal protein S16; KEGG: hso:HS_0293 30S
FT                   ribosomal protein S16"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31418"
FT                   /db_xref="GOA:B0UVM6"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UVM6"
FT                   /protein_id="ACA31418.1"
FT                   /translation="MVTIRLSRGGSKKRPFYQIVVADSRSPRDGRFIERVGFFNPLASG
FT                   NVERVRINLDRVNHWIGHGASLSDRVASLVKEAQKAA"
FT   gene            178299..178826
FT                   /locus_tag="HSM_0166"
FT   CDS_pept        178299..178826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0166"
FT                   /product="16S rRNA processing protein RimM"
FT                   /note="TIGRFAM: 16S rRNA processing protein RimM; PFAM:
FT                   RimM protein; PRC-barrel domain protein; KEGG: hso:HS_0294
FT                   16S rRNA processing protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31429"
FT                   /db_xref="GOA:B0UVM7"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UVM7"
FT                   /protein_id="ACA31429.1"
FT                   /translation="MEQQRIEVVGKLGSTYGIRGWLRLYSSTEQAESIFDYQPWFLKIK
FT                   GQWQPIELESWKFHNHELIVKLKGINEREVAQTLANVEIGVNLSIFPLLDEGDFYWHDL
FT                   IGCQVVNLQGYAMGVVSEMMETGANDVLVVRASTKDAFGKKERLIPFLYEQVVKRVDLS
FT                   SKTIEVDWDAGF"
FT   gene            178880..179617
FT                   /locus_tag="HSM_0167"
FT   CDS_pept        178880..179617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0167"
FT                   /product="tRNA (guanine-N1)-methyltransferase"
FT                   /note="TIGRFAM: tRNA (guanine-N1)-methyltransferase; PFAM:
FT                   tRNA (guanine-N1-)-methyltransferase; KEGG: hso:HS_0295
FT                   tRNA (guanine-N(1)-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31440"
FT                   /db_xref="GOA:B0UVM8"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UVM8"
FT                   /protein_id="ACA31440.1"
FT                   /translation="MWIGIISLFPEMFKAITEYGVTGRAVRQNLLEIQYWNPRDFTFDK
FT                   HKTVDDRPYGGGPGMLMMVQPLRDAIHCAKSVAGDGVKVIYLSPQGRKLDQNGVQELAR
FT                   NQKMIFVCGRYEGIDERLIETEIDEEWSIGDYVLTGGELPAMTLIDAVARFVPCVLGKQ
FT                   ASAQEDSFAEGLLDCPHYTRPEQLNGLTVPPVLMSGNHEEIRKWRLKQSLQRTWLRRPE
FT                   LLESLALTDEQSKLLSQIKQENS"
FT   gene            179653..180003
FT                   /locus_tag="HSM_0168"
FT   CDS_pept        179653..180003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0168"
FT                   /product="ribosomal protein L19"
FT                   /note="PFAM: ribosomal protein L19; KEGG: hso:HS_0296 50S
FT                   ribosomal protein L19"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31451"
FT                   /db_xref="GOA:B0UVM9"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UVM9"
FT                   /protein_id="ACA31451.1"
FT                   /translation="MSNIIKQIEQEQLKQNVPSFRPGDTLEVKVWVVEGSKRRLQAFEG
FT                   VVIAIRHRGLHSAFTLRKISNGVGVERVFQTHSPIIDSITVKRKGAVRKAKLYYLRERS
FT                   GKSARIKERLGN"
FT   gene            complement(180138..180956)
FT                   /locus_tag="HSM_0169"
FT   CDS_pept        complement(180138..180956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0169"
FT                   /product="putative esterase"
FT                   /note="PFAM: putative esterase; KEGG: hso:HS_0297 possible
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31462"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVN0"
FT                   /protein_id="ACA31462.1"
FT                   /translation="MKNTNYYLKMEEHFLYVPYYNRTRRIRVLLPKDYYTDTWDSYAVL
FT                   YMHDGQNIFYSKESYSGYSWKIIPTIKHHKEFPKIIIVGIDNSGVDRLDEYGPWRTDVG
FT                   SSPEIKKCGGKGMEYGKWVVEIVKPFIDQHYRTKPQKEHTLLAGSSMGGIITAYMGSAY
FT                   PQIFGHLGVFSLASWFSEKDFLHFIHHNPIDKNSKVFIQVGTKEGDDVDSLFISNMNQA
FT                   YIDCTLHYYQALLRTGHPLDNIRLRMMANEIHHEKHWADHFVEFLHFALL"
FT   gene            complement(180993..181994)
FT                   /locus_tag="HSM_0170"
FT   CDS_pept        complement(180993..181994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0170"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: hso:HS_0298
FT                   gluconate utilization operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31474"
FT                   /db_xref="GOA:B0UVN1"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVN1"
FT                   /protein_id="ACA31474.1"
FT                   /translation="MPDKRKRPTLQDIASHLGITKMTISRYLRDPRLVAPKTGVRIAEA
FT                   IEHFGYIPNRAPEILSNAKSKAIGVLVPSLTNHVFADVIKGIENITDQAGYQTMLAHYG
FT                   YCQEKEEKRIESLLSYNIDGLILSETEHSARTLKMLDVANIPVVEIMDTSEFGLQQVVG
FT                   FNNIAAAQSMVETMIKRGYKNIVYFSARMDKRTRLKMQGYEQAMKKHQLTPHSLLTEEP
FT                   SSFTLGAEQLKLALKKHPQIDGIFCTNDDLAIGALFECQRQGIDVPKEIGIAGFHGLNV
FT                   GLSLTTQIATVRTPRLNIGEVAAKELLNRIEGIVPENYMINLGYNIHLGESI"
FT   gene            complement(182003..183055)
FT                   /locus_tag="HSM_0171"
FT   CDS_pept        complement(182003..183055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0171"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="PFAM: tRNA/rRNA methyltransferase (SpoU); RNA 2-O
FT                   ribose methyltransferase substrate binding; KEGG:
FT                   hso:HS_0299 tRNA/rRNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31485"
FT                   /db_xref="GOA:B0UVN2"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR016479"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVN2"
FT                   /protein_id="ACA31485.1"
FT                   /translation="MKTKKPIFQQANNEKRFTERFVSNKRYEKSTSKSPHVDNNSKRAL
FT                   SNRHSRPQNTQNTASHTHIINTTMEKPNGTGQVQVVLKRSSLVAKTEKKTGPLSPRAPE
FT                   KIKKNRAEEMKVYGENACLSLFAQRPESIVRVWTTVEMAHKVGDLFSYLASNKKVYHVV
FT                   DNSELALVSGTEHHGGICMLVKKRRPFTLHGYLDIPQQKNCLLVLNGVRNPHNIGGIIR
FT                   TCVCYGISAVVIDDVELLHSAVAMRVAEGGMEYIHPLEIDRTETALVKLRQAGYQIVHL
FT                   SSNKHAKTIKQLQLDDKVAFVLSEADTESLADKADELINLSLVNPLKHGLNVSVATGIL
FT                   LAKWTEVKLC"
FT   gene            183221..184588
FT                   /locus_tag="HSM_0172"
FT   CDS_pept        183221..184588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0172"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /note="PFAM: phospholipase D/Transphosphatidylase; KEGG:
FT                   hso:HS_0300 CDP-diacylglycerol--serine
FT                   O-phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31496"
FT                   /db_xref="GOA:B0UVN3"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR016270"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVN3"
FT                   /protein_id="ACA31496.1"
FT                   /translation="MLINKTKRAKQNLERLPCIPLQAEQVEFIYHSSDFKQQIIQCIRQ
FT                   AKSRIYFTALYWQNDEAGQQILDEIYRAKQANPELEVKILVDWHRAQRNLLGAEKSATN
FT                   ADWYCDERSKYQLADDPNIFFGVPINTREVFGVLHIKGFVFDDTVLYSGASINNVYLHQ
FT                   QTKYRYDRYHKIENKRLADILVSFVKNYLFDPNVVYPLDSSDRPKTKEIRQYIRNFRKY
FT                   LAGEGQYYVESSVTLNDSLTICPLFGLGANHNLLNQTIEDLFQVVEDKLTICTPYFNFP
FT                   RLLQQKVRRLLAKGKQVEIIVGDKTASDFYIPPSEPFKMAGALPYLYEKNLRHFSKKFT
FT                   KQIEQGQLVVRIWKDGENSYHLKGIWVDDCYMLLTGNNLNPRAWRLDAENGLFIHDPKQ
FT                   QLQAQIQQELTYIRRNTTVLKHYTELSDLTQYPKPVQKILKKFARIKADKLVKMIL"
FT   gene            complement(184618..185328)
FT                   /locus_tag="HSM_0173"
FT   CDS_pept        complement(184618..185328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0173"
FT                   /product="Exonuclease RNase T and DNA polymerase III"
FT                   /note="PFAM: Exonuclease RNase T and DNA polymerase III;
FT                   SMART: Exonuclease; KEGG: hso:HS_0301 DNA polymerase III,
FT                   epsilon subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31507"
FT                   /db_xref="GOA:B0UVN4"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVN4"
FT                   /protein_id="ACA31507.1"
FT                   /translation="MIKNFLNKFHPLNKLEKQRKIFINQDNLPVQWKRLFEKPYPKSST
FT                   DLTALSYLVIDFETTGLNSMMDNILSVATVPIDNLTLDISKAWHQFVAEQQEIKEDTVI
FT                   INHILPQMLNGAETLDDTMNKLFELMQGRILIAHGSTIEKRFILHYLNVRYNLSQFPLF
FT                   WLDTLKIERSLCQDNENNYQLSHIRNKYNLPEYIGHNALIDAISAGELFLAQLEKVFGK
FT                   SSKEIGEIYRRSIG"
FT   gene            complement(185325..187205)
FT                   /locus_tag="HSM_0174"
FT   CDS_pept        complement(185325..187205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0174"
FT                   /product="putative CBS domain and cyclic
FT                   nucleotide-regulated nucleotidyltransferase"
FT                   /note="PFAM: cyclic nucleotide-binding; CBS domain
FT                   containing protein; protein of unknown function DUF294
FT                   nucleotidyltransferase putative; KEGG: hso:HS_0302 possible
FT                   signal-transduction protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31518"
FT                   /db_xref="GOA:B0UVN5"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005105"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR018821"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVN5"
FT                   /protein_id="ACA31518.1"
FT                   /translation="MDSSLIPNIELFIAQVPPFTHLPHDLIRLTAQNIEIRYIPKGELI
FT                   TNDEIDSLNNNENLYIVRMGSVEQVNKSGQLRARLESGDCFGFSIFNHHEQDKYQAYAL
FT                   ENTLIYQIPFQRLNELLKKFPEYASYFSSDAGKRLNSLAKNNFLKNQNDIFMKKVIDIA
FT                   NPKIALVDTNTTLQQAAIRMCEQRRSSALVMQQNKLIGIIHDRDMTKKVVAQGLDVNTL
FT                   VTEIMNINPPVIRGDELVLQAISMMMQHNIRSLPVIVDDKVQGILTATDLVKQNSMQSV
FT                   FIINRIFQANTLPLLVEIAKQQRDLFRALLERGVAYNNIMHVMTLIADAFARKLLMMAE
FT                   HKLGTPPCRYAWVVAGSQARYEMHPLSDQDNAIILERKLTALEQEYFVQLTKFVNNGLH
FT                   ECGYPYCTGNYMAINARWCVSLQEWKENFRSWIIAPELEGLLNASVFMDMRGIYGDLNL
FT                   ADQLQQYFVDLVAHNKRFLAFLVANSIRVKPPLSIFRNFVLIKEGEHKNKLNLKKRAIS
FT                   LLVDLARIYALAAGLAQTMSTEQRFRHCYKQGILNKETLNNALEVYQFVCNMRFKYQSD
FT                   ALQQQQELTNHIDPSELSALERNHLKDAFRLIAQFQEAAEIRFSQRGIMR"
FT   gene            complement(187307..189217)
FT                   /locus_tag="HSM_0175"
FT   CDS_pept        complement(187307..189217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0175"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: hso:HS_0303
FT                   myo-inositol catabolism protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31529"
FT                   /db_xref="GOA:B0UVN6"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018659"
FT                   /db_xref="InterPro:IPR023314"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030830"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVN6"
FT                   /protein_id="ACA31529.1"
FT                   /translation="MKKEKTLDLICLGRVAVDLYAQQIGSRLEDVSSFAKYLGGSSGNV
FT                   AYGTAVQGVKSSMLARVGDEHMGRFLREELQRLGVDTSHLITDKERLTALVILGIKDQD
FT                   TFPLIFYRDNCADMAITADDFDEEYIASAKALAITGTHLSHPKTRHAVLTALEYAGRNG
FT                   TKRLLDIDYRPVLWGLTSLGDGETRFIDSEAVTQSLQEVLHHFDVLVGTEEEFHIAGGS
FT                   TDTLTALKNVRKVSNATLVCKRGALGCSVFEGDIPNHIDGGINVYGVRVEVLNVLGAGD
FT                   AFMSGLLRGYINGESWEQCCRYANACGALVVSRHGCAPAMPTKEELDNYLSRAESVPRP
FT                   DLDEQLNHLHRVTTRKQQWHDLCIFAFDHRKQLVDMAEKCGADLKRIPTLKTLLLKAAE
FT                   QTAQKEGIYNGNAGVLADTTFGQEALNEITGKKWWIGRPIEMPSSRPLRLEHGDLGSQL
FT                   ISWPAEHVVKCLAFYHPADKAELKADQDATLKEVYRACCRTGHELLLEIILPADMEQKE
FT                   SYYTDMIAHFYSLGIKPDWWKLPGVSAKTWADISQVIEKNDKHCRGILILGLDAPEAVF
FT                   ENVFKASANAPLVKGFAVGRTIFGQPSADWLAGKIDDEQLIKETSERYRRLIKLWKNRK
FT                   N"
FT   gene            189460..190302
FT                   /locus_tag="HSM_0176"
FT   CDS_pept        189460..190302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0176"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="PFAM: helix-turn-helix protein RpiR; sugar isomerase
FT                   (SIS); KEGG: hso:HS_0304 possible transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31540"
FT                   /db_xref="GOA:B0UVN7"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVN7"
FT                   /protein_id="ACA31540.1"
FT                   /translation="MQEHSQLVTLQNEIRSRYSTLSKRLKQVAQYVLDNHNSVIFDTVA
FT                   TISERAGVPPSTLIRFANAFGFSGFNEMKQIFRENLIEETANYTERLQVFRQLEPEKSE
FT                   QHNLQDILNIFAQANNQALKQLSSQTTTKQLKSAVEILKNAQNIFIIGLKRSFSIACYL
FT                   DYVLHHLDCRSFLINGLGGMFDEQLMQVKKGDVIVAVSFSPYAKETLEIVSATSQKGVK
FT                   HIAITDSQISPLIASSDVAFVVKEAQVSGFRSQCATMTLVQTLAILLGLEKEKETQNS"
FT   gene            complement(190339..191103)
FT                   /locus_tag="HSM_0177"
FT   CDS_pept        complement(190339..191103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0177"
FT                   /product="protein of unknown function DUF548"
FT                   /note="PFAM: protein of unknown function DUF548; KEGG:
FT                   hso:HS_0305 possible SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31551"
FT                   /db_xref="GOA:B0UVN8"
FT                   /db_xref="InterPro:IPR007536"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UVN8"
FT                   /protein_id="ACA31551.1"
FT                   /translation="MVNQKIQLICETESAVQFTALCQQKGLIHDPNSYLALVQTKVEGQ
FT                   VRLELRKLDEPKLGAVYVDFVTGTMAHRRKFGGGRAEAVAKAVGIKGNYLPTVIDATAG
FT                   LGRDAFVLAALGCKVRLVERHPVVHLLLQDGLKRAYADAEIGTMMQANMQLLDIAHIQE
FT                   LNSSEEGADVVYLDPMYPHKQKSALVKKEMRIFQHLIGADLDADMLLEPALLLAQKRAV
FT                   VKRPDYADFLAKKTPHFSHQTKNHRFDIYLKT"
FT   gene            complement(191079..192179)
FT                   /locus_tag="HSM_0178"
FT   CDS_pept        complement(191079..192179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0178"
FT                   /product="tRNA (uracil-5-)-methyltransferase"
FT                   /EC_number="2.1.1.35"
FT                   /note="TIGRFAM: tRNA (uracil-5-)-methyltransferase; PFAM:
FT                   (Uracil-5)-methyltransferase; KEGG: hso:HS_0306 tRNA
FT                   (uracil-5-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31562"
FT                   /db_xref="GOA:B0UVN9"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR011869"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UVN9"
FT                   /protein_id="ACA31562.1"
FT                   /translation="MQRLPIEQYSALLAEKQQKLTALLAPFNSPPLDVFASETSHFRMR
FT                   AEFRIWHEQDDFYHIMFDQKTKQRFRIDQFPIASQLINQMMLALLPLLKQHNILTHRLF
FT                   QIDYLSTLSNKIIVSLLYHKTLNEEWLQAATQLKQQLIKQGFDVQIIGRANKQKICLQQ
FT                   DFVDEILPVKNQQYIYRQVENSFTQPNATVNCKMLEWAINCTKNSQGDLLELYCGNGNF
FT                   SIALAQNFRKVLATEIAKPSVSAAQFNIAANKIDNLHIIRMSAEDFTQAMNGVRAFNRL
FT                   KGINLQDYQCNTIFVDPPRSGLDMATVKLVQNYERILYISCNPYTLCENLQELTKTHRI
FT                   EKAALFDQFPYTEHMESGVWLIKKSN"
FT   gene            complement(192245..192574)
FT                   /locus_tag="HSM_0179"
FT   CDS_pept        complement(192245..192574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0179"
FT                   /product="protein of unknown function DUF413"
FT                   /note="PFAM: protein of unknown function DUF413; KEGG:
FT                   hso:HS_0307 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31573"
FT                   /db_xref="InterPro:IPR007335"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVP0"
FT                   /protein_id="ACA31573.1"
FT                   /translation="MAESFSVTRRFFDDKNYPRGFARHGDYTIRESQTLEQYGQAFKAL
FT                   DLGERVPVTEEEKAFVAFCRGERPAETYFEKTWNKYRTRISASKRVYTLSGVVGADNPD
FT                   DFSAE"
FT   gene            complement(192628..193236)
FT                   /locus_tag="HSM_0180"
FT   CDS_pept        complement(192628..193236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0180"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: hso:HS_0308 protein
FT                   disulfide-isomerase (thiol:disulfide interchange protein)"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31585"
FT                   /db_xref="GOA:B0UVP1"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVP1"
FT                   /protein_id="ACA31585.1"
FT                   /translation="MKKFLWALASFFFLNSTQALALQEGKQYIELEQPRSVQPEVIEFF
FT                   SFGCIHCFNFEKTYQIPQQIKADLPKDVTFKQYHVDWMGEDIVRAWSLAILLGIEEKVK
FT                   MPLFELIIEKRKAPTLDNIREVFLANGITAAQFDGGINSFAVTAQTNKQIALAKKLGVR
FT                   ATPEFYINGKYKVNAEGLSRTTDGFIKDYVETVKGLLQK"
FT   sig_peptide     complement(193171..193236)
FT                   /locus_tag="HSM_0180"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.977 at
FT                   residue 22"
FT   gene            complement(193246..193512)
FT                   /locus_tag="HSM_0181"
FT   CDS_pept        complement(193246..193512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0181"
FT                   /product="protein of unknown function DUF1040"
FT                   /note="PFAM: protein of unknown function DUF1040; KEGG:
FT                   hso:HS_0309 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31596"
FT                   /db_xref="InterPro:IPR009383"
FT                   /db_xref="InterPro:IPR038134"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVP2"
FT                   /protein_id="ACA31596.1"
FT                   /translation="MKCHRLNEVLELLQPYWSNNPDLHLIQVLQKIAEETGFDKPIAEL
FT                   TDEVIIYHLKMYGTGKNEPIPGIKKDYEDDFKTALLKARGIID"
FT   gene            193579..194166
FT                   /locus_tag="HSM_0182"
FT   CDS_pept        193579..194166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0182"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein A"
FT                   /note="TIGRFAM: molybdopterin-guanine dinucleotide
FT                   biosynthesis protein A; KEGG: hso:HS_0310
FT                   molybdopterin-guanine dinucleotide biosynthesis protein A"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31607"
FT                   /db_xref="GOA:B0UVP3"
FT                   /db_xref="InterPro:IPR013482"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UVP3"
FT                   /protein_id="ACA31607.1"
FT                   /translation="MATTISAVILAGGQAKRMAGLDKGLQLLQGKPLYQHCLQRLTNQV
FT                   SSISINANRHQAIYQQSGVEVFGDELEDFQGPLSGILTALERANTDFVLFVPCDSPFLP
FT                   LNLCEKLQSAVENSKSLLAYANDGEREHPAFSLLSTQLKLPLRVYLQSGHRQMLQFFRQ
FT                   HKAISVDFSLQKQAFVNMNTLQDIEKYQNIYA"
FT   gene            194285..196291
FT                   /locus_tag="HSM_0183"
FT   CDS_pept        194285..196291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0183"
FT                   /product="oligopeptide transporter, OPT family"
FT                   /note="TIGRFAM: oligopeptide transporters, OPT superfamily;
FT                   oligopeptide transporter, OPT family; PFAM: Oligopeptide
FT                   transporter OPT superfamily protein; KEGG: hso:HS_0311
FT                   integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31616"
FT                   /db_xref="GOA:B0UVP4"
FT                   /db_xref="InterPro:IPR004813"
FT                   /db_xref="InterPro:IPR004814"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVP4"
FT                   /protein_id="ACA31616.1"
FT                   /translation="MLSKQQSLKELTFRGMLLGALITVVFTASNVYLGLKVGLTFASSV
FT                   PAAVISMAVLKFFKGSNILENNMVQTQASSAGTLSSVIFVIPAMLMLGYWQGFPFWQTL
FT                   LICISGGMLGVIFTVPLRNVMVVKSDLPYPEGVAAAEVLKAGNDEIGGRGVKELTIGGL
FT                   IAAVAGFLTNGLRVIADSASLWFKGGNAIFQVPMGFSLALLGAGYLVGMIGGLAILLGI
FT                   FVAWGVAVPYFTSVAPMPSDADMIGYAFSIWKNKVRFIGVGTIGIAAIWTLLVLMKPMI
FT                   QGMIESFRALKDPNAKNTDRTSQDLSPTTLIFTTLVSVVLIVLALYSFINPVGIEAGTA
FT                   IILILVCTLLAVVIGFLVAAACGYMAGLVGSSSSPISGIGIISVVTTSLVLMLVGSATG
FT                   LLDTAEGQKFLTALTLFTGSIVVCIAAISNDNLQDLKTGQLVEATPWRQQFALIIGVIV
FT                   GALVIAPVLEILYHAYGFAGAMPRETMDPSQALFAPQATLMMTIANGIFSHNLEWNYIF
FT                   FGIGFGAVLIFIDSVLKKASNKRLALPALAVGMGIYLPPSVNAPIVVGALLAWLINRHL
FT                   ENFAKRTGKDLADVKKKAERFGTLFAAGLIVGESLIGILLAFIVAGSVTSGGSDAPLAL
FT                   HLENWESLAQVLGLMMFATGITIFALRVLKAKQ"
FT   sig_peptide     194285..194386
FT                   /locus_tag="HSM_0183"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.781) with cleavage site probability 0.372 at
FT                   residue 34"
FT   gene            complement(196413..197171)
FT                   /locus_tag="HSM_0184"
FT   CDS_pept        complement(196413..197171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0184"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="PFAM: Sel1 domain protein repeat-containing protein;
FT                   KEGG: hso:HS_0313 conserved hypothetical protein, with TPR
FT                   repeat (tetratrico peptide repeat)"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31627"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVP5"
FT                   /protein_id="ACA31627.1"
FT                   /translation="MNLKKSLLIALLSFGVAQSALAETNSEKLDRATQLYKQQNYSAAF
FT                   PLLKQLGEKGNAKAQAVLGTMYMFGQGITQNSQQAVYWYTKAAEQGDAKAQSMLGFMYT
FT                   NGLGVTQNSQQAVYWWTKAAEQGAAEVQLYLGVMYANGQGVAQNYQQAVYWFTKAAEQG
FT                   IAEAQLYLGVMYANGQGVAQNYQQAVYWFTKAAEQGIAEAQLYLGDMYEKGRGAQKNVS
FT                   TAKAFYGQACDNGNAQGCKDFARLDKQGVR"
FT   sig_peptide     complement(197103..197171)
FT                   /locus_tag="HSM_0184"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 23"
FT   gene            complement(197193..197456)
FT                   /locus_tag="HSM_0185"
FT   CDS_pept        complement(197193..197456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0185"
FT                   /product="Haemophilus-specific protein, uncharacterized"
FT                   /note="KEGG: hso:HS_0314 Haemophilus-specific protein,
FT                   uncharacterized"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31638"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVP6"
FT                   /protein_id="ACA31638.1"
FT                   /translation="MSNRIEITVDIYKNFFGDTSDSPYVYDNIKAINPNEQKEVDEIVN
FT                   KMIANGSSQLFDSNLNILNPITPLETGRKCFLNPQTLCIEFK"
FT   gene            complement(197940..198902)
FT                   /locus_tag="HSM_0186"
FT   CDS_pept        complement(197940..198902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0186"
FT                   /product="lipoic acid synthetase"
FT                   /note="TIGRFAM: lipoic acid synthetase; PFAM: Radical SAM
FT                   domain protein; SMART: Elongator protein 3/MiaB/NifB; KEGG:
FT                   hso:HS_0315 lipoate biosynthesis protein A (lipoate
FT                   synthase)"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31649"
FT                   /db_xref="GOA:B0UVP7"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031691"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UVP7"
FT                   /protein_id="ACA31649.1"
FT                   /translation="MTTPFKMERGVKYRDAAKTSIIPVKNIDPNQELLKKPEWMKIKLP
FT                   ANSAKINSIKNGMRRHGLHSVCEEASCPNLHECFNHGTATFMILGAICTRRCPFCDVAH
FT                   GKPLPPDPDEPKKLAETIQDMKLRYVVITSVDRDDLPDRGAGHFAECVKEIRKLNPGIK
FT                   IEILVPDFRGRIEQALEKLKDNPPDVFNHNLENVPRLYREIRPGADYNWSLKLLKEFKT
FT                   IFPHIPTKSGIMVGLGETNEEILQVMQDLRDNGVTMLTLGQYLQPSRHHLPVARYVPPE
FT                   EFDDFRDKAEKMGFEHAACGPFVRSSYHADLQASGGLVK"
FT   gene            complement(198920..199576)
FT                   /locus_tag="HSM_0187"
FT   CDS_pept        complement(198920..199576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0187"
FT                   /product="lipoate-protein ligase B"
FT                   /note="TIGRFAM: lipoate-protein ligase B; PFAM:
FT                   biotin/lipoate A/B protein ligase; KEGG: hso:HS_0316
FT                   lipoate biosynthesis protein B (lipoyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31660"
FT                   /db_xref="GOA:B0UVP8"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UVP8"
FT                   /protein_id="ACA31660.1"
FT                   /translation="MTDTTLIIRQLGIQDYQQVWQQMREFTDTRNVLTADEIWLVQHPA
FT                   VFTQGQAGKPEHLLNPTDIPVVQSDRGGQITYHGLGQQIMYVLIDIKRHKANGSELNVR
FT                   QLVTALEQSVVSTLADYGIKSYPKADAPGVYVNEQKICSLGLRIRKGCSFHGLALNINM
FT                   DLSPFRQINPCGYIGLEMCQMADFIPTEQAQCDKVAPKLVTHFTQLLGYNDVTTY"
FT   gene            complement(199585..199881)
FT                   /locus_tag="HSM_0188"
FT   CDS_pept        complement(199585..199881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0188"
FT                   /product="protein of unknown function DUF493"
FT                   /note="PFAM: protein of unknown function DUF493; KEGG:
FT                   hso:HS_0317 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31669"
FT                   /db_xref="InterPro:IPR007454"
FT                   /db_xref="InterPro:IPR027471"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVP9"
FT                   /protein_id="ACA31669.1"
FT                   /translation="MTDKTVKLNDIPQKQLKDLLEFPCSFTFKVVGKNRADLIDDVVMV
FT                   TQKYAKGDYNPRQNISSKGTYNSISVDIIAENIEQVEILYTELAKIDGVRMVL"
FT   gene            complement(199936..201116)
FT                   /pseudo
FT                   /locus_tag="HSM_0189"
FT                   /note="Serine-type D-Ala-D-Ala carboxypeptidase"
FT   gene            complement(201211..201771)
FT                   /locus_tag="HSM_0191"
FT   CDS_pept        complement(201211..201771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0191"
FT                   /product="rare lipoprotein A"
FT                   /note="TIGRFAM: rare lipoprotein A; PFAM: Rare lipoprotein
FT                   A; KEGG: hso:HS_0319 possible rare lipoprotein A"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31699"
FT                   /db_xref="GOA:B0UVQ0"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVQ0"
FT                   /protein_id="ACA31699.1"
FT                   /translation="MKSNKIFKLCTALFMALVSLSIQADTKKLYGIEGAKPVYQKLSKK
FT                   PYTYVVKGVRYTTLPYEKAKNYSQKGMASFYHKKFHGRKTANGEIFNNNAYTAAHKTLP
FT                   LNSYVVVTNLRNNRKVIVRINDRGPFSKARIIDLSEAAAKELGMIHAGIAKVKVESLYV
FT                   DAYGKISGPGTKTLAKTRKNIKS"
FT   sig_peptide     complement(201697..201771)
FT                   /locus_tag="HSM_0191"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 25"
FT   gene            complement(201814..202929)
FT                   /locus_tag="HSM_0192"
FT   CDS_pept        complement(201814..202929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0192"
FT                   /product="rod shape-determining protein RodA"
FT                   /note="TIGRFAM: rod shape-determining protein RodA; PFAM:
FT                   cell cycle protein; KEGG: hso:HS_0320 rod shape-determining
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31710"
FT                   /db_xref="GOA:B0UVQ1"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVQ1"
FT                   /protein_id="ACA31710.1"
FT                   /translation="MEKKNIWLILWRRLHIDFWLFLGLVTISSYGLLVLYSAVGGSEKM
FT                   FRNRIIQVALGFTVMFVMAQFSPRFYQRIAPYGFVIGVILLLLVDLFGTTSKGAQRWLD
FT                   LGIFRFQPSEIVKLSVPLMVATYLGKRPLPPKLSEIFIALLLIIVPTLLVAIQPDLGTS
FT                   ILVSASGIFVVFLAGINWWFILIAIVGLAAFTPIVWLYLMHDYQRTRVLTLLDPEKDPL
FT                   GAGYHIMQSKIAIGSGGIWGKGWMQGTQSQLEFLPEPHTDFIFAVLSEEYGMTGFTILM
FT                   LIYLFIVARGLIIGVNAQNSFGRILSGALTLIFFVYVFVNIGMVSGILPVVGVPLPLMS
FT                   YGGTSFVTLMAGFGLIMSIHTHKNNFFKGTK"
FT   gene            complement(202952..204856)
FT                   /locus_tag="HSM_0193"
FT   CDS_pept        complement(202952..204856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0193"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: penicillin-binding protein transpeptidase;
FT                   Penicillin-binding protein dimerisation domain; KEGG:
FT                   hso:HS_0321 cell elongation-specific transpeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31721"
FT                   /db_xref="GOA:B0UVQ2"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVQ2"
FT                   /protein_id="ACA31721.1"
FT                   /translation="MNLKKLLSQPLQTPIRDKKAERNLFARRALIAFLGVLGLSALLFT
FT                   NLYYLQIVNYETYQTRSNGNRIKLLPLPPTRGLIYDRYGKLLAENITFLGLYIVPEKVE
FT                   DLNRTFEELRYIVGLNDDDIENFKKERRRSSRYMPILLKGDLSEEQIARFAVNQYHYPS
FT                   LDIRPYFKRHYLYGEPLTHILGYVAKINEKDVERLKKNEKYANYAGTHDIGKLGIERYY
FT                   EDDLHGKVGFEEVEVNNRGKVIRKLREQPAIAGKSIHLTIDLELQRYIANLLGNLRAAV
FT                   VVLDPKDSGILAMVSTPSYDNNLFVGGISSADYKQLLTDPNRPLYSRVTQGAYPPASTI
FT                   KPFVAIAGLQENLITTNTTIFDPGYWILPNTTKRFRDWKKSGHGYTDLNKAIVESSDTY
FT                   FYQLAYDMGISRLSQWMKRFGFGVPTGIDIQEETAALMPSREWKQKRYKRPWVQGDTIS
FT                   VGIGQGYWTATPLQVAKATAVLVNNGKVNTPHLMKAIEGSEMQPYQDPRLYEDITEPQA
FT                   VFWETIKQSMYNVIHAPNGTGRKSFIDVSYPVAGKSGTAQVFSLKENQTYNANELDNKL
FT                   HDHAWFIGYAPYDNPKMVVVVILENAGGGSSKAGPVVRKIMDYYLNIRLPQVQSQNEK"
FT   sig_peptide     complement(204725..204856)
FT                   /locus_tag="HSM_0193"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.803) with cleavage site probability 0.354 at
FT                   residue 44"
FT   gene            complement(204873..205340)
FT                   /locus_tag="HSM_0194"
FT   CDS_pept        complement(204873..205340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0194"
FT                   /product="protein of unknown function DUF163"
FT                   /note="PFAM: protein of unknown function DUF163; KEGG:
FT                   hso:HS_0322 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31732"
FT                   /db_xref="GOA:B0UVQ3"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UVQ3"
FT                   /protein_id="ACA31732.1"
FT                   /translation="MKIQLIAVGTKMPDWVTKGFEEYQRRFPKDMPFELIEIPAGKRGK
FT                   NADIKRILEQEGKAMLSACQKSRIITLDIPGKPWTTEQLAQQLEAWKHDGRNVALLIGG
FT                   PEGLSPECKAATEQSWSLSPLTLPHPLVRIVVAESLYRAWSLSTNHPYHRE"
FT   gene            complement(205360..205668)
FT                   /locus_tag="HSM_0195"
FT   CDS_pept        complement(205360..205668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0195"
FT                   /product="iojap-like protein"
FT                   /note="TIGRFAM: iojap-like protein; PFAM: Iojap-related
FT                   protein; KEGG: hso:HS_0323 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31743"
FT                   /db_xref="GOA:B0UVQ4"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVQ4"
FT                   /protein_id="ACA31743.1"
FT                   /translation="MNLVDFLVSKLDDLKGTDILALDVRGKSSITDHMILCTGTSSRHV
FT                   ISLAQKLIDESKQAGIDTFGEEGKSTADWIAIDFGQAIVHIMQADSREMYQLEKLWG"
FT   gene            complement(206021..206863)
FT                   /locus_tag="HSM_0196"
FT   CDS_pept        complement(206021..206863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0196"
FT                   /product="ABC-3 protein"
FT                   /note="PFAM: ABC-3 protein; KEGG: hso:HS_0325 chelated iron
FT                   ABC transporter, permease"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31754"
FT                   /db_xref="GOA:B0UVQ5"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVQ5"
FT                   /protein_id="ACA31754.1"
FT                   /translation="MFNTIVAWFTEPLVYPFMQQAIIIAPIIGAVCAILSCYLVLKGWS
FT                   LMGDAISHAVLPGIILAYVLAIPIAIGAFWAGIFCAVSVGYLRDNSRIKEDTVMGIVFS
FT                   GMFAFGLVLFSKVETDQHLMHILFGNILGIIKQEFWQSIGIALLAFILIALKRKDLLLY
FT                   CFDPSHTRVAGLNTKFLHYGLLVILALVIISAMQVVGVILVVAMLITPGITGYILAKRF
FT                   DYMMLIAVCTAVFSGIFGVLLSFHFNVATGPCIILLQASLFLCALGYSKYIAMRVVNI"
FT   gene            complement(206856..207746)
FT                   /locus_tag="HSM_0197"
FT   CDS_pept        complement(206856..207746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0197"
FT                   /product="ABC-3 protein"
FT                   /note="PFAM: transport system permease protein; ABC-3
FT                   protein; KEGG: hso:HS_0326 chelated iron ABC transporter,
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31765"
FT                   /db_xref="GOA:B0UVQ6"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVQ6"
FT                   /protein_id="ACA31765.1"
FT                   /translation="MLELLLEPFSYDFMFKAIVVSGAIGAVCAFLSAYLMLKGWSLIGD
FT                   ALSHAVVPGVAIAYALALPYAVGAFFSGLLATIAILAVKYVTKLKEDAVIGFIFTSFFA
FT                   LGLLIISINPTSVNVQSIVLGNILGIADEDMIQVAIILGISFVLLLLFWKDLMLVFFDE
FT                   IQAKAVGLSPLKFKILFFTLLSACIVTALQGVGAILVIAMVITPGATAYLLTDRFDRLL
FT                   IISILLGGTTSSLGAYLSYFADSATGGFIVSLQTFIFLLAFFFAPKYGLIPRKRSTQKA
FT                   VTSSPNLANQEKPNV"
FT   gene            complement(207751..208509)
FT                   /locus_tag="HSM_0198"
FT   CDS_pept        complement(207751..208509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0198"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: hso:HS_0327 iron ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31776"
FT                   /db_xref="GOA:B0UVQ7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVQ7"
FT                   /protein_id="ACA31776.1"
FT                   /translation="MKTHISSLSVRDITVRYSNGHTALHDVSFHLEGGTICALLGINGS
FT                   GKSTLFKSIMGLVKPQGSIEICNMPANQALKQNLVAYVPQSEEVDWQFPVSVYDVVMMG
FT                   RYGYMNCFRMPKAQDKKKVLDAMERVNIAHLRDRQIGELSGGQKKRVFLARALAQESQI
FT                   ILLDEPFTGVDVGTENAIIALLKQLRQEGHLVLVSTHNLSTVPSFCDQAVMINRTLLAA
FT                   GSIESTFTQENLTRVFGGVLRYQHFIQDAE"
FT   gene            complement(208519..209400)
FT                   /locus_tag="HSM_0199"
FT   CDS_pept        complement(208519..209400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0199"
FT                   /product="periplasmic solute binding protein"
FT                   /note="PFAM: periplasmic solute binding protein; KEGG:
FT                   hso:HS_0328 chelated iron ABC transporter,
FT                   periplasmic-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31787"
FT                   /db_xref="GOA:B0UVQ8"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVQ8"
FT                   /protein_id="ACA31787.1"
FT                   /translation="MSRLLIVMGVILGSVFSLPSYAKFKVVTTFTVIQDIAQNVAGDAA
FT                   VVESITEPGAEIHDYEPTPQDIVKAQSADLVLWNGMNLERWFERFFTQVKDKPAVVVTK
FT                   GIDPISIYEGPYKGMPNPHAWMSTKNALVYIENIREALVKYDPKNADTYNANAKAYADK
FT                   IVALDAPLRAELEKVPASQRWLVTSEGAFSYLAHDYGFKELYLWPINAEEQGTPKQIKN
FT                   VIKKVREHKIPVVFSESTISDKPAKQVAKETNAKYGGVLYVDSLSTKDGKVPTYIDLLN
FT                   VTVSTIVNGFKK"
FT   sig_peptide     complement(209332..209400)
FT                   /locus_tag="HSM_0199"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.997 at
FT                   residue 23"
FT   gene            complement(209506..209835)
FT                   /locus_tag="HSM_0200"
FT   CDS_pept        complement(209506..209835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0200"
FT                   /product="DsrC family protein"
FT                   /note="PFAM: DsrC family protein; KEGG: hso:HS_0329 sulfite
FT                   reductase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31800"
FT                   /db_xref="GOA:B0UVQ9"
FT                   /db_xref="InterPro:IPR007453"
FT                   /db_xref="InterPro:IPR025526"
FT                   /db_xref="InterPro:IPR042072"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVQ9"
FT                   /protein_id="ACA31800.1"
FT                   /translation="MLSVNQVQIETDVEGYLLDMNQWNKDVAIAIAKSENIELTEAHWE
FT                   IINFVRDFYQEYKTSPAMRMLVKALGQKLGADKGNSRYIQRLFPEGPAKQASKLAGLPK
FT                   PIKCL"
FT   gene            complement(209913..210575)
FT                   /locus_tag="HSM_0201"
FT   CDS_pept        complement(209913..210575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0201"
FT                   /product="protein of unknown function UPF0005"
FT                   /note="PFAM: protein of unknown function UPF0005; KEGG:
FT                   hso:HS_0330 conserved integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31811"
FT                   /db_xref="GOA:B0UVR0"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVR0"
FT                   /protein_id="ACA31811.1"
FT                   /translation="MQSRFIVDTKEESVLATNKVLRNTYFLLALTLAFSSVVAFSAMQL
FT                   NLPPLHFGVMLIGFYGLLFLNNMLANSAWGLLSTFALTGLLGYSLGPILSYYVGSGLGD
FT                   LVVLALAGTASVFFTCSAYVLTTKKDMSFLSGMMLALFIVLVIGMIASFFFNMSGFHIV
FT                   FSSLFIVFSTMAILYETSNIIHGGETNYIRATVSLYVSLYNLFVSLLNLLGIFNRDE"
FT   sig_peptide     complement(210450..210575)
FT                   /locus_tag="HSM_0201"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.953) with cleavage site probability 0.816 at
FT                   residue 42"
FT   gene            210791..210880
FT                   /locus_tag="HSM_R0008"
FT                   /note="tRNA-Ser1"
FT   tRNA            210791..210880
FT                   /locus_tag="HSM_R0008"
FT                   /product="tRNA-Ser"
FT   gene            complement(210983..212512)
FT                   /locus_tag="HSM_0202"
FT   CDS_pept        complement(210983..212512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0202"
FT                   /product="Mg chelatase, subunit ChlI"
FT                   /note="TIGRFAM: Mg chelatase, subunit ChlI; PFAM: magnesium
FT                   chelatase ChlI subunit; ATPase associated with various
FT                   cellular activities AAA_5; SMART: AAA ATPase; KEGG:
FT                   hso:HS_0331 competence-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31822"
FT                   /db_xref="GOA:B0UVR1"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVR1"
FT                   /protein_id="ACA31822.1"
FT                   /translation="MSLAVVYSRASMGVQAPLVTIEVHLSNGKPAFTLVGLPEKTVTEA
FT                   QGRVRSALLNAQFKYPAKRITVNLAPADLPKEGGRFDLPIALGILAASEQINAKKLQQF
FT                   EFVAELALTGELRGVHGVIPAILAGQKSKRQLIVAQQNANEASLVSQHETFFARNLLEV
FT                   VQFLNDDSSLPSSTTLCMQSAVDFSPQSNKDLTDIIGQQHAKRALMIAAAGQHNLLFLG
FT                   PPGTGKTMLASRLTGLLPDMTDQEAIETASVTSLVQNELNFQNWKQRPFRAPHHSASSP
FT                   ALVGGGTIPKPGEISLAHNGVLFLDELPEFERRVLDALRQPLESGEIIISRANAKIQFP
FT                   ARFQLVAAMNPSPTGHYTGIHNRTSPQQVLRYLNRLSGPFLDRFDLSIEVPLLPQGALQ
FT                   NTEDRGETTAQVKEKVLRVREIQLARAGKVNAYLTGKEIERDCKLTEQDALFLENTLTR
FT                   LGLSVRAYHRILKVARTIADLNGDSDIKQNHLAEALSYRAMDRLLRKLSDQ"
FT   gene            complement(212614..213309)
FT                   /locus_tag="HSM_0203"
FT   CDS_pept        complement(212614..213309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0203"
FT                   /product="GTP-binding protein HSR1-related"
FT                   /note="PFAM: GTP-binding protein HSR1-related; KEGG:
FT                   hso:HS_0332 GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31825"
FT                   /db_xref="GOA:B0UW08"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW08"
FT                   /protein_id="ACA31825.1"
FT                   /translation="MYKKMSWLLLVFHNAIFPIGNDLSENKMTNIKLNYHKTHFLMSAP
FT                   NIQVLPEDSGIEIAFAGRSNAGKSTALNALTQQKNLARTSKTPGRTQLINLFQVEPNCK
FT                   LVDLPGYGYAAVPEQMKLQWQKSLGEYLQKRECLGGLVILMDIRHPLKDLDQQMIEWAV
FT                   SADLPVLLLLTKADKLSQSARSKQVKMVRESILPFQGDVQVEAFSAQNKIGIERLSEKL
FT                   DQWFSPLFS"
FT   gene            complement(213230..214612)
FT                   /locus_tag="HSM_0204"
FT   CDS_pept        complement(213230..214612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0204"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /EC_number="2.3.1.157"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine pyrophosphorylase;
FT                   PFAM: transferase hexapeptide repeat containing protein;
FT                   Nucleotidyl transferase; KEGG: hso:HS_0333
FT                   UDP-N-acetylglucosamine diphosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31826"
FT                   /db_xref="GOA:B0UW09"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UW09"
FT                   /protein_id="ACA31826.1"
FT                   /translation="MTKRKFIMNKLSVVILAAGKGTRMYSDLPKVLHKIAGKPMVKHVI
FT                   DTAKKLSAAQIHLIYGHGADLLKQHLADEPVNWVFQSEQLGTGHAMQQAVPFFQDDENI
FT                   VMLYGDVPLISKETLECLISQKPENGIALLTVNLDNPTGYGRVIRENGTVTAIVEQKDA
FT                   NPEQLKITEVNTGVMVSDGASFRKWLARLDNNNAQGEYYMTDVIGLANQDGFKVVAVQA
FT                   KDLMEVEGVNNRLQLANLERHYQRKQVEKLLLAGVTFADPARFDLRGELTHGKDVEIDI
FT                   NVIIEGTVRLGNNVFIGAGCVLKNCTIADNVEIKPYSVIEDAIVGNNAKIGPFSRLRPG
FT                   AELSENTHVGNFVEIKKAQIGKGSKVNHLTYIGDAEVGHHCNIGAGVITCNYDGANKFK
FT                   TLIGDNVFVGSDSQLVAPLTIASGATIGAGTTVTKDVQENELVITRVPQRHISNWQRPK
FT                   RK"
FT   gene            214658..215815
FT                   /locus_tag="HSM_0205"
FT   CDS_pept        214658..215815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0205"
FT                   /product="protein of unknown function UPF0075"
FT                   /note="PFAM: protein of unknown function UPF0075; KEGG:
FT                   hso:HS_0334 possible molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31827"
FT                   /db_xref="GOA:B0UW10"
FT                   /db_xref="InterPro:IPR005338"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW10"
FT                   /protein_id="ACA31827.1"
FT                   /translation="MLLCLANIRSSFMQKNNHYYIGIMSGTSLDGVDIALMDFNQRPPK
FT                   LLASHCFSMPENLRQQLTALLKNGEIGLQQLGELDHQLGLLYANSVQRFLAQNQMTADS
FT                   IQAIGCHGQTIWHSPQGQYPFTMQIGDANLISVLTGITTIADFRRKDMAHGGQGAPLSP
FT                   AFHQALFAQPDRITVVLNIGGISNISCLIPEQEVIGYDTGVGNALMDSWIEQHLGVPFD
FT                   QDGEWAKSGSVHQDLLKDLLDEPFFQQLPPKSTGRELFNLAWLNKKLKKHTALSAQDVQ
FT                   ATLLEFTVQCTVQELVKLTNPNHLPCLLLVCGGGAKNRQLMARLQACLPQWHVATTTEH
FT                   GLSVDYVEAAAFAWLAYQRINHLPSNLPSVTGAKSAVSLGVIYPK"
FT   gene            215818..216729
FT                   /locus_tag="HSM_0206"
FT   CDS_pept        215818..216729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0206"
FT                   /product="glucokinase regulatory-like protein"
FT                   /note="TIGRFAM: glucokinase regulatory-like protein; PFAM:
FT                   sugar isomerase (SIS); KEGG: hso:HS_0335 glucokinase
FT                   regulator-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31828"
FT                   /db_xref="GOA:B0UW11"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005486"
FT                   /db_xref="InterPro:IPR005488"
FT                   /db_xref="InterPro:IPR040190"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UW11"
FT                   /protein_id="ACA31828.1"
FT                   /translation="MNKQNLINQFAQLITEQPNPLSVNLDQMSALEIVQLMNKEDQQVP
FT                   LVIAKALPEIAVVVEKIVAAFRQGGRLVYLGAGTSGRLGVLDASECPPTFGVNHEMVKG
FT                   IIAGGEQAIRYPVEGAEDNQQAAIVDLQAIQLCSKDILVGIAASGRTPYVISGLKYAKE
FT                   IGSFTVAIASNPQSAMAKIADIGIETIVGPEILTGSSRLKSGTAQKLVLNMLTTASMVL
FT                   LGKCYQNLMVDVQASNEKLVDRATRIIMQATGCERAKAEQTLTQADNNAKLAILMILMD
FT                   LDKQSAVDLLAKNQDKLRQTLD"
FT   gene            217017..217568
FT                   /locus_tag="HSM_0207"
FT   CDS_pept        217017..217568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0207"
FT                   /product="NAD(P)H dehydrogenase (quinone)"
FT                   /note="PFAM: NAD(P)H dehydrogenase (quinone); KEGG:
FT                   hso:HS_0336 NAD(P)H dehydrogenase (quinone)"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31829"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW12"
FT                   /protein_id="ACA31829.1"
FT                   /translation="MPNILVISGHSNLQQSTANSAILGELANNLPNAEIRKLDELYPDF
FT                   NINIEAEQAALLKADIIIWQFPVNWYHFPAIMQKWLSDVFTYGFAYGSEQKLTGKKLYI
FT                   SCTTASPEEAYQHDGAQKHTIEEFSYAYQQTAALCGLEFCGIIHSGNMLYIPGMNTEED
FT                   KENVIAKAKQHAERLVSAVK"
FT   gene            217835..218533
FT                   /locus_tag="HSM_0208"
FT   CDS_pept        217835..218533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0208"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hso:HS_0337 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31830"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW13"
FT                   /protein_id="ACA31830.1"
FT                   /translation="MRGGGGNFNFYGKAGIDLTSRFETMKITENHDSDRGFKLSIPASS
FT                   RQNTFSPSIFFETTYNILPQTEIGLGLGYIKRKGFDHIAIWPVEGSSLYNPQGQFHLKE
FT                   TYRVNRYASLPIYFILKQNYALNANTKFYLKGDLGYSINKIRKTVYTLYEDLSLGSSTG
FT                   YKKDRDFISNNKSRSGLYLGLGLGIEYKSFLVDIGYYHTHSKITYKEQGSYVSTPYNND
FT                   AIRLTLGFKF"
FT   gene            complement(218615..220303)
FT                   /locus_tag="HSM_0209"
FT   CDS_pept        complement(218615..220303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0209"
FT                   /product="SSS sodium solute transporter superfamily"
FT                   /note="TIGRFAM: SSS sodium solute transporter superfamily;
FT                   PFAM: Na?? symporter; KEGG: hso:HS_0338 sodium/glucose
FT                   cotransporter (symporter)"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31831"
FT                   /db_xref="GOA:B0UW14"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW14"
FT                   /protein_id="ACA31831.1"
FT                   /translation="MLSLISFIGFTALVAVLAWWYTRKDDLSNSEGYYLAGRSLTATFI
FT                   AGSMLLTNLSTEHLVGLNGLAYREGFIVMAWEVLAAITIAMFALYFLPKYLKLGIATIP
FT                   EFLEKRFDKGTLLITSLLFLGCYVISLLPIVLYTGALALESLFDVSTVFNIDKTTAIWI
FT                   MVWGIGILGSVYAIFGGLKAVAVSDTINGIGLLVGGILVAVLGLAYVGDGNAWHGLKTI
FT                   YETNPDKFNSIGDDNSVVPFSTLFTGMIISNLFFWCTNQSIIQRALGAKSLKEGQKGVL
FT                   LCAFLKLLGPLLIILPGIIAYHIYQGKLDIPDQAYPNLVHLVLPDALVGFFAAVVVGAV
FT                   LSTFNSALNSSVTLFSRNVYKTQINPHASDMKLVSVGKWVGTGLAIMAMIVAPLVANAP
FT                   DGLFFLIQELQGIFNAPILSVVVVGLLTKRVPAIAAKFGLVFGMVAYILCKFVIKVEIH
FT                   FFHLIAILFVVNVVVMLIIGRIMPMETPYNEEYTKQVDIQPWAYAKAVSLVITFISISL
FT                   YIFMAKDVLPAVWIGYYCFGAATVLYFIYSFVQHRNQQFRLKENN"
FT   sig_peptide     complement(220247..220303)
FT                   /locus_tag="HSM_0209"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.842) with cleavage site probability 0.817 at
FT                   residue 19"
FT   gene            220629..222389
FT                   /locus_tag="HSM_0210"
FT   CDS_pept        220629..222389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0210"
FT                   /product="surface antigen (D15)"
FT                   /note="PFAM: surface antigen (D15); surface antigen
FT                   variable number repeat protein; KEGG: hso:HS_0339 conserved
FT                   outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31833"
FT                   /db_xref="GOA:B0UW15"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR035243"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW15"
FT                   /protein_id="ACA31833.1"
FT                   /translation="MKLLSKYFVRSILNTSIFCIYLASSFSFAEHLVDLKVVGVTGVQK
FT                   TTNVDAYINTIDEEERDGSERYQQLVRTAIDKALRAYGYYSSTVNFTLQPAKSSNKPVL
FT                   VANVDMGRPSIIQRADVTILGEAKDDEVFQDLLRRTAQKGEHVSHPVYEDYKSRLQKQL
FT                   LARGYFDAKFEVSRFEIKPSTYQGWWKMVLNSGTRYKFGQFNFKHSQIREDYLRNMMPI
FT                   KTGDKYLINDLSSLTNDYTSSNWFRSVLLEPKVDEKRKVVDINVLLYPRKKNAIDVGIG
FT                   YSSDVGTRFKLSWIKPWINNRGHSFNSNLYISAPKQTLEANYKIPLLKNPQRYYYELSG
FT                   GFEKENTKDTQTIAASFAALRYWNRVTGWQHSFGLRVRYDSFTQANVSDRTLFIYPTIS
FT                   ANRTRLRGELFPTWGDSQRITVDFGSKRWKSDVNFFRIKASTVWIRTFKENHRFLTRGE
FT                   IGWLHTKDINKIPPALRFFAGGERSVRGYGYKKISPTSSDGKPIGAPYLLTVNTEYQYQ
FT                   VLEDWWLAAFADTGLAANKFNVKELRYGAGFGVRWVSPVGAIKLDIATPIRDREKNKNI
FT                   QFYIGLGSEL"
FT   sig_peptide     220629..220718
FT                   /locus_tag="HSM_0210"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.981 at
FT                   residue 30"
FT   gene            222400..225927
FT                   /locus_tag="HSM_0211"
FT   CDS_pept        222400..225927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0211"
FT                   /product="protein of unknown function DUF490"
FT                   /note="PFAM: protein of unknown function DUF490; KEGG:
FT                   hso:HS_0340 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31834"
FT                   /db_xref="GOA:B0UW16"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW16"
FT                   /protein_id="ACA31834.1"
FT                   /translation="MTQIPNENTTTERQETRSVKPKRKVLRWILCTISAVILLLILFLV
FT                   TALATNSGQRLLIQLADHFIDNLHIAQIDGGLQDGLQLKQIAFHTQGIKADIEQANIKL
FT                   DLHCLLSGKICLKDLTLNQPKIQIDTAQLPKSETKTSQPIQQIKLPVEVDINGIEINQL
FT                   DLTIDQQQVKLAKFRTALTLNNEQGLTLLPTEINGLTIVHRHLTEKTTKKKKSEKTVRS
FT                   PVDWEKLTQQLNQPLLPDMPEIELPFDLHIQGIQGKNWLYQQIGNSNIPQSDLHQIEIS
FT                   TIYLHADSIDNSIQLQTFQLESNLGQLRGEGTLRLKQEFPIELQVQATLNELKHDGKLL
FT                   LPHSNINFTLSGNLKKQTALFLQTQGTLESILQGKIELYSQKTPFDIELKVINGQYPFE
FT                   KNSTDPLKIQDMFFTAKGDLLNYQATLQGKLIGMGMPETNVDLVLQGGLTQFTLQQLRV
FT                   NALNMKANANANVSWKDKLKLKSNIDLKGHNVRLNNMRINKIDLLANISLQDIVQGQVD
FT                   LDIDGFSLNNIKLNSTKLQIKGTEQQHYLILKSKGEPASATLNLQGKFDRTLQQWQGIL
FT                   SQVNIHSLIGNLTNSENILLSYDNKKTIAQVSAHCWRSSDIHLCFQQEFIVGKTGEIPF
FT                   DFKTINLALVNKLISQEIFKGHLSGQGKFAWFTESSPYLTLQLKGDNLNVAKKLDYRTF
FT                   RLAIPTLNITTELQNNNLTLNSNFNIQNRGDVNMELKLADLTNQKRLSGHLKISDMNLN
FT                   IVNQLIASSEKVDGQVNAKLSFAGDLSNPLLNGEFAVSQVRAKLKSVPFGITNGNIILS
FT                   FYGDRSILKGNIQTHESHLNIEGQANWRKLDDWQAGLHINADKFKVDIPSIAKLQVSPN
FT                   IEIHATPKLLALSGNVDIPWARIEIERLPDNIVAPSKDEVILDGPQKTKVVKLMKGEIE
FT                   TTTKSGIQIHSDLKIKLGDHVRLEAYGLKTELNGLLSVKQEKGNLGLFGQINLHNGHYE
FT                   SFGQDLLIRKGIISFSGLPSQPMLNIEAIRNPTSMENTNMTVGAKIVGIADSPEITIFS
FT                   EPSTSQDQALSYLLTGRSLENSGNNGSGGSLGAALLGIGLAKSGKLVGGIGKVFGIQNL
FT                   NLDTSGVGDSSKVVVSGNITPTLQIKYGIGLFDGLAELTLRYRLLPKLYLQSVSGINQA
FT                   VDLLYQFEF"
FT   sig_peptide     222400..222549
FT                   /locus_tag="HSM_0211"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.920 at
FT                   residue 50"
FT   gene            225930..227480
FT                   /locus_tag="HSM_0212"
FT   CDS_pept        225930..227480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0212"
FT                   /product="Ppx/GppA phosphatase"
FT                   /EC_number="3.6.1.40"
FT                   /note="PFAM: Ppx/GppA phosphatase; KEGG: hso:HS_0341
FT                   exopolyphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31835"
FT                   /db_xref="GOA:B0UW17"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="InterPro:IPR030673"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW17"
FT                   /protein_id="ACA31835.1"
FT                   /translation="MNNENLLQKVTALVQHRGEAKEIAAIDLGSNSFHMVIARIINGSI
FT                   QVLSRLKQKVQLAEGLDENNMLSQAAITRGVNCLALFAERLQGFDPQNINVVGTYTLRS
FT                   AVNKIEFLQQAAEVFPYPINIISGETEAKTIYSGVSHTQPEIGRKFVIDIGGGSTEMII
FT                   GDDFIPLIANSRNMGCVSFAKKFFPCGKISRDNFQRAKKTAKQCIEDLAKPYLDLNWDC
FT                   VLGSSGTIKTVHQVISTNYNQHAIITLSHLNKLITQVLKAHHFNKLHINGLNEDRVDVF
FT                   VPGLAILTALFETFAIKEMRYSDGALREGIIYSLEKDFQVKNIRQRTALGIMQQFNVDL
FT                   AQAERTYQSTLLLSEQYQRWQAVELKTEMQDILLWAARLHEVGVVINHKNLQKHSAYIL
FT                   QNMELPGFDKEQQRLLTTIIHHQFNHFKMPDIGKFARYPRADVIALVRLLRLAILLNKS
FT                   RQATSKTNNITLKIDRTLKKWSLYFDAEYLEHNPLVKNELMEEQKRLSEFNLALDFYS"
FT   gene            227653..229488
FT                   /locus_tag="HSM_0213"
FT   CDS_pept        227653..229488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0213"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="TIGRFAM: dihydroxy-acid dehydratase; PFAM:
FT                   dihydroxy-acid and 6-phosphogluconate dehydratase; KEGG:
FT                   hso:HS_0342 dihydroxy-acid dehydratase (DAD)"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31836"
FT                   /db_xref="GOA:B0UW18"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UW18"
FT                   /protein_id="ACA31836.1"
FT                   /translation="MPKLRSATSTQGRNMAGARALWRATGMKENDFGKPIIAVVNSFTQ
FT                   FVPGHVHLKDMGQLVAAEIEKFGGVAKEFNTIAVDDGIAMGHGGMLYSLPSRDLIADSV
FT                   EYMVNAHCADAMVCISNCDKITPGMLMAALRLNIPTVFVSGGPMEAGKTKLSDQIIKLD
FT                   LVDAMIQGANPNVSDDVSEQIERSACPTCGSCSGMFTANSMNCLTEALGLSLPGNGSCL
FT                   ATHADRKQLFLAAGKQIVELCKRYYEQDDTSVLPRSIATKEAFDNAMSLDIAMGGSTNT
FT                   VLHLLAAAQEAEVNFTMADIDRLSRVVPCLSKVAPNTQKYHMEDVHRAGGIMAILGELD
FT                   RAGLLNSQTRTILGMSIGEQIAKYDIKLTQDKAIHKFFRAGPAGIRTTQAFSQDCRWDT
FT                   VDDDRENGCIRSKEFAYSQDGGLAMLSGNIALDGCIVKTAGVDESILKFSGKAIVFESQ
FT                   EDAVSGILGGKVQAGHVVVIRYEGPKGGPGMQEMLYPTSYLKSMGLGKACALLTDGRFS
FT                   GGTSGLSIGHCSPEAAAGGLIGVVKDGDIIEIDIPNRRIELMVSEEELAERRAEQDKLG
FT                   WKPANRQREVSFALKVYGYFATSADKGAVRDKTKI"
FT   gene            complement(229886..231130)
FT                   /locus_tag="HSM_0214"
FT   CDS_pept        complement(229886..231130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0214"
FT                   /product="ATP-dependent Clp protease, ATP-binding subunit
FT                   ClpX"
FT                   /note="TIGRFAM: ATP-dependent Clp protease, ATP-binding
FT                   subunit ClpX; PFAM: AAA ATPase central domain protein; zinc
FT                   finger C4 domain protein; ATPase AAA-2 domain protein;
FT                   SMART: AAA ATPase; KEGG: hso:HS_1433 ATP-dependent Clp
FT                   protease, ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31837"
FT                   /db_xref="GOA:B0UW19"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UW19"
FT                   /protein_id="ACA31837.1"
FT                   /translation="MTKEKELHCSFCGKEQKEVDKLIAGTSGYICNECIELCHDMLANA
FT                   DDIEEIDEEFQEEEPKLPTPHEIRAHLDDYVIGQDYAKKVLAVAVYNHYKRLRSEKNTS
FT                   EVELGKSNILLIGPTGSGKTLLAQTLARMLNVPFAMADATTLTEAGYVGEDVENVLQKL
FT                   LQNCDYDIEKAQQGIIYIDEIDKITRKSENPSITRDVSGEGVQQALLKLVEGTVASIPP
FT                   QGGRKHPQQEMLRVDTSKILFICGGAFAGLDKIIEKRTNTSGKGIGFGADVRIDEEKVS
FT                   LTELFKQVEPDDLMKFGLIPEFIGRLPVIAPLSELDEEALVKILTEPKNALTKQYQVLF
FT                   SLENIELEFTQEALIAMAKKALARKTGARGLRSIVETLLLDTMYDLPSIENLQKVIVEE
FT                   ETVTENKVPVLKFNS"
FT   gene            complement(231146..231727)
FT                   /locus_tag="HSM_0215"
FT   CDS_pept        complement(231146..231727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0215"
FT                   /product="ATP-dependent Clp protease, proteolytic subunit
FT                   ClpP"
FT                   /EC_number="3.4.21.92"
FT                   /note="TIGRFAM: ATP-dependent Clp protease, proteolytic
FT                   subunit ClpP; PFAM: peptidase S14 ClpP; KEGG: hso:HS_1432
FT                   ATP-dependent Clp protease, proteolytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31838"
FT                   /db_xref="GOA:B0UW20"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UW20"
FT                   /protein_id="ACA31838.1"
FT                   /translation="MSVIPMVVEQTSRGERSYDIYSRLLKERVIFLTGEVEDRMANLIV
FT                   AQLLFLEAEDPAKDINIYINSPGGSVTAGMAIYDTMQFIKPNVRTLCIGQACSMGAFLL
FT                   AGGTAGKRAALPHARVMIHQPLGGFRGQASDIQIHAQEILKIKQTLNERLAFHTGQSIE
FT                   QIEQDTDRDNFMSAEQAKLYGLVDDVLIKR"
FT   gene            complement(231813..233111)
FT                   /locus_tag="HSM_0216"
FT   CDS_pept        complement(231813..233111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0216"
FT                   /product="trigger factor"
FT                   /note="TIGRFAM: trigger factor; PFAM: peptidylprolyl
FT                   isomerase FKBP-type; trigger factor domain protein; trigger
FT                   factor domain; KEGG: hso:HS_1431 FKBP-type peptidyl-prolyl
FT                   cis-trans isomerase, trigger factor"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31839"
FT                   /db_xref="GOA:B0UW21"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UW21"
FT                   /protein_id="ACA31839.1"
FT                   /translation="MSFNIETTQGLERRVNITVPSEAVEQAVREELKRVAKNARIDGFR
FT                   KGKVPAQMIEKRFGASVRQDVLGDLLQKHFFNVMLENKVNLAGRPEFTVEQFEAGKELK
FT                   FTATFEVYPEVQLQGLDKIKVEKPVVEISDADIDKMLDILRKQQATWIETQDVAKADDR
FT                   VTIDFVGSVDGEEFEGGKSTDFVLAMGQGRMIPGFEEGIIGHKAGEQFEINVTFPETYH
FT                   AENLKGKAAKFSITLKKVEVMQLPELTDEFVAKFGPNTKNVADLRNEIAKNMQRELKNA
FT                   LVSRIKTQVIDGLLEQNPIEVPTAAVEQEIEVLRNQAAQRFGGNAQQAAQLPRELFEEQ
FT                   AKRRVQVGLLFSEVISSNELKADEERVKAMIADIASAYEQPAEVIEYYSKNKELMNNIR
FT                   NVVLEQQAVDAVLTKAQVTEKASSFDEVMNPQA"
FT   gene            233470..234885
FT                   /locus_tag="HSM_0217"
FT   CDS_pept        233470..234885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0217"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; General
FT                   secretory system II protein E domain protein; KEGG:
FT                   hso:HS_1430 pilin/fimbriae biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31840"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW22"
FT                   /protein_id="ACA31840.1"
FT                   /translation="MIIPQSEDMSPIVMSIDGDTYEITPHLWQRNQQQSQILLRYFAIP
FT                   LQENEQTLWLGVDSLNNISACETFAFLYGKIVEPVLLNNQLLKQLLQNLSPQQNNMFVE
FT                   EQPINQYVAEHRIEVTEKSDEPVIQLLDHIFENALKQHVSDIHIEPQMNCLQIRFRIDG
FT                   ILQCQSPLPLSLSKRILSRLKLLAKLDISETRLPQDGRFHFKTTFSDILDFRLSTLPTN
FT                   MGEKAVLRLQQNKPVQLSFAELGMTENQQKSFKQALSQPQGLILVTGPTGSGKSISLYT
FT                   ALQWLNDKHKHIMTAEDPIEIELNGIIQCQINPQIGLDFSRLLRTFLRQDPDIIMLGEI
FT                   RDNESAIMALRAAQTGHLVLSTLHTNDAPSAVSRLLQLGVKQHEIDNSLLLVIAQRLVR
FT                   KKCPHTENENCTCHQKYQGRIGVYQFLQPHLIDNHICYQTDYAHLRESAMEKVRLEITD
FT                   LAEVDRVIGQSSE"
FT   gene            complement(234919..236178)
FT                   /locus_tag="HSM_0218"
FT   CDS_pept        complement(234919..236178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0218"
FT                   /product="protein of unknown function DUF21"
FT                   /note="PFAM: CBS domain containing protein; protein of
FT                   unknown function DUF21; transporter-associated region;
FT                   KEGG: hso:HS_1429 possible transporter"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31841"
FT                   /db_xref="GOA:B0UW23"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW23"
FT                   /protein_id="ACA31841.1"
FT                   /translation="MDSIPLSTLFITLIILLILSAYFSGSETGVLSVNRYRMRFLAEKG
FT                   HKGAQKTEKLLKRTDVFLSLILICNNLVNISASAIATIIGMRIYGDVGVAVATGLLTFV
FT                   MLIFSEIFPKTIAALYPEKVAFVSSHIISILLKIFSPLVFIINLFISGLMKLFRLKNEV
FT                   KAHSLNSEELRAIVNQSGQYIPSAHQEMLLSILDLEKVTVDDIMVPRNDIAGIDVDDDW
FT                   KAIMRQLNHAAHGRVVLYKGSIDENVLGILRVREAYRLMLDKNEFSKETLIRAVDETYF
FT                   IPEGTELNTQLLNFRNNKERIGLVVDEYGDIKGLVTLEDILEEIVGEFTTSTAPSIDEE
FT                   VTQQSDGTIIIEGSANLRDLNKLFNWNLDTEDARTFNGLILEHLEEIPNEGTECEINGL
FT                   KITVLEVADNMIKQVKVEKV"
FT   sig_peptide     complement(236104..236178)
FT                   /locus_tag="HSM_0218"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.703) with cleavage site probability 0.376 at
FT                   residue 25"
FT   gene            complement(236248..237045)
FT                   /locus_tag="HSM_0219"
FT   CDS_pept        complement(236248..237045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0219"
FT                   /product="cytochrome c assembly protein"
FT                   /note="PFAM: cytochrome c assembly protein; KEGG:
FT                   hso:HS_1428 possible permease"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31842"
FT                   /db_xref="GOA:B0UW24"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW24"
FT                   /protein_id="ACA31842.1"
FT                   /translation="MWFAVISAFFYLISILLIMPMLLGQGGQEVKLNKMAFLVTALIAI
FT                   ISHFIALNKLFIHLFIGNNFTLIEICSLVSAMIAAIATVAILARVKTLWFLLPIVYCFS
FT                   IINLILQALLPEIWVYHLSQNTSLLFHIALSLFAYSVCFIAMLYAIQLRWIDNSLKSKK
FT                   LTFSPVVPPLMTVEKHFFRSLFSGQILLTLTLISGSIQLIDFFSAHNIPKAIFSFLAWF
FT                   VFGIALFGHWKLYWRGKRMIIYTISGMILLTVAYFGSRVILEL"
FT   sig_peptide     complement(236971..237045)
FT                   /locus_tag="HSM_0219"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.780) with cleavage site probability 0.724 at
FT                   residue 25"
FT   gene            237195..238571
FT                   /locus_tag="HSM_0220"
FT   CDS_pept        237195..238571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0220"
FT                   /product="signal recognition particle protein"
FT                   /note="TIGRFAM: signal recognition particle protein; PFAM:
FT                   GTP-binding signal recognition particle SRP54 G- domain;
FT                   Signal peptide binding (SRP54) M- domain protein;
FT                   GTP-binding signal recognition particle SRP54 helical
FT                   bundle; SMART: AAA ATPase; KEGG: hso:HS_1427 signal
FT                   recognition particle protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31844"
FT                   /db_xref="GOA:B0UW25"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW25"
FT                   /protein_id="ACA31844.1"
FT                   /translation="MFENLSDRLSKTLRNITGKGRLTEDNIKDTLREVRMALLEADVAL
FT                   PVVREFIHQVKERAIGEEVNKSLTPGQEFLKIVQTELEKAMGVANEKLNLATQPPAVIL
FT                   MAGLQGAGKTTSVGKLAKFLKENYKKKIMVVSVDVYRPAAIKQLETLAQSIGVDFYPSN
FT                   VSQKPVEIARTALAEAKLKFYDVLIVDTAGRLHVDDTMMEEIQQIHTALNPIETLFTVD
FT                   AMTGQDAANTAKAFNEALPLTGIILTKVDGDARGGAALSIRHITGKPIKFLGVGEKTEA
FT                   LEPFHPDRIASRILGMGDVLSLIEDLQRSVDQEKAEKMAKKFKKGDSFTLEDFREQLIE
FT                   MKKMGGMMSMLEKLPGARNLPDHVKSQVDDKMFNKMEAIINSMTLKERANPDIIKGSRR
FT                   RRIALGSGTQVQDVNNLLRQFNEMQRMMKKMRKGGMARMMRGMQGMMGGLGGLGNMFRR
FT                   "
FT   gene            complement(238614..240353)
FT                   /locus_tag="HSM_0221"
FT   CDS_pept        complement(238614..240353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0221"
FT                   /product="sulfate transporter"
FT                   /note="TIGRFAM: sulfate transporter; PFAM: Sulfate
FT                   transporter/antisigma-factor antagonist STAS;
FT                   Xanthine/uracil/vitamin C permease; sulphate transporter;
FT                   KEGG: hso:HS_1426 sulfate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31845"
FT                   /db_xref="GOA:B0UW26"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW26"
FT                   /protein_id="ACA31845.1"
FT                   /translation="MLKKWFLTKNIFLAVRPFSALQDSFKIGYGKSHLIKDIIAGLTVG
FT                   VIAIPLSMALAIASGVPPQHGLYTAIVAGIVIALSGGSRFNISGPTAAFVVILYPVTQQ
FT                   FGLSGLLMATLLSGIILILMAFFRLGRLIEYIPLSVTLGFTCGIGIVIATLQIKDFLGL
FT                   NVATMPVHYLGKLQAIFTALPTINWADAAVGTVTLILLTKWHKFRLPIPGHLPAVIIGT
FT                   LLSIALIHFGFDVATIGSSFSYSLSDGSTGYGIPNVIPEIILPWNFPNADGEVINWDFN
FT                   TLQALLPAAFSMAVLGAIESLLCAVILDNMTSTKHHSNNELLAQGLGNIVAPFLGGITA
FT                   TAAIARSAANVKSGAVSPISSVIHALLVLFSLLFFAKALSYLPLASMSALLLVVAWNMA
FT                   NVGQIVQLIRRSGLNEIAVLLTCLTLTVIFDMVIAITVGVLLASLLFIRTIAEMTRSFE
FT                   IAHPEDLCDTVVFRISGPLFFAAADNLFADLHEKTTHTGKEIKHIVLQCDAVTVLDAGG
FT                   IHALTRFIQHMLPSQELHMCNMQFQPLRTIVKSKTVKEIHKIHFSTNLDVVYRKIRDLT
FT                   KTE"
FT   gene            240492..240581
FT                   /locus_tag="HSM_R0009"
FT                   /note="tRNA-Ser2"
FT   tRNA            240492..240581
FT                   /locus_tag="HSM_R0009"
FT                   /product="tRNA-Ser"
FT   gene            240845..241798
FT                   /locus_tag="HSM_0222"
FT   CDS_pept        240845..241798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0222"
FT                   /product="prophage CP4-57-like integrase"
FT                   /note="KEGG: hit:NTHI0419 prophage CP4-57-like integrase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31846"
FT                   /db_xref="GOA:B0UW27"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW27"
FT                   /protein_id="ACA31846.1"
FT                   /translation="MAKINQSFVDKLKTTGKQEQISLGYKLFLVMSPKGTKSYRYIFRH
FT                   PVTKAIKKKNLGNADVMSLESALSLAISFNSLLEQGVDPVENFKAQFKPVERVVFTLSM
FT                   VVEDWHVTKGMRLSKKHLRDRLARFKRYLLPHFGEREVLDISLFEAREVIKAIFERAPH
FT                   MGEKVARDLRELGDHAVDMGVWSANLLAPIKRSFPRPKAVNNPCIRADELPEFLCVLAR
FT                   SRLDFQTRLLIEFQLLTMVRANEVVTARWVDVDFVNAVWRIPAENMKMNKAHDVPLSSQ
FT                   AVALLFELRKFNADKPFIFPHRSIDILPRLKAGDSY"
FT   gene            complement(241901..243037)
FT                   /locus_tag="HSM_0223"
FT   CDS_pept        complement(241901..243037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0223"
FT                   /product="transposase, IS605 OrfB family"
FT                   /EC_number="2.1.1.37"
FT                   /note="TIGRFAM: transposase, IS605 OrfB family; PFAM:
FT                   putative transposase IS891/IS1136/IS1341 family;
FT                   transposase IS605 OrfB; KEGG: hso:HS_0583 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31847"
FT                   /db_xref="GOA:B0UW28"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW28"
FT                   /protein_id="ACA31847.1"
FT                   /translation="MLLRKAFKFEISPNGEQIRKIKQFCGCSRFVFNKALAWQNEQYEL
FT                   DNNHKFRYSKIANLLPQWKKELVWLKECHSQVLQQSLKDLESAFKNFFQQRADFPKFKK
FT                   KGIKESFRFPQGCKIEQENDRLYLPKIGWVRYRNSREIVGEVKNVTVSQKCGRFFVSIQ
FT                   TEFEHEIPMHKGGEIGIDMGIARFATLSNGEFFEPINAFKTYKGKLAKLQKQLKNKVKF
FT                   SKNWQKLKEKIGKLHHKIANCRKDFLHKISTQISKNHAMIYVEDLQVANMSKSAKGTVE
FT                   AHGKNVKQKSGLNRSIRDQSWFEFRRQLDYKTQWLGGFLVAVPAQNTSRTCPCCGHIAK
FT                   ENRETQAHFECVECGYTENADVVGAMNVFTRGQAIVQA"
FT   gene            243084..243500
FT                   /locus_tag="HSM_0224"
FT   CDS_pept        243084..243500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0224"
FT                   /product="transposase IS200-family protein"
FT                   /note="PFAM: transposase IS200-family protein; KEGG:
FT                   hso:HS_0666 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31848"
FT                   /db_xref="GOA:B0UW29"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW29"
FT                   /protein_id="ACA31848.1"
FT                   /translation="MKKETEIRRGRHVVFNLHVHLVFVTKYRGEVFTQAILNDLHTIFE
FT                   AVCADFEAKLVEFDGEDDHVHLLVEYPPKVAISNLVNSLKGVSSRMIRKKNYPSIRKKL
FT                   WGNQLWSPSYFAGSCGGAPISIIRQYIEQQQTPD"
FT   gene            complement(243787..244248)
FT                   /locus_tag="HSM_0225"
FT   CDS_pept        complement(243787..244248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0225"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31849"
FT                   /db_xref="InterPro:IPR009678"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW30"
FT                   /protein_id="ACA31849.1"
FT                   /translation="MRLKYQDLTDHLVAKLPPRYQANFYSWMDDGEMIDEGKIVTDKGE
FT                   ILFYLEYSAELFFHELPFKQINPLQIMAAINLWLAENDLERYMQDEYKTPFDLTLLDDE
FT                   LADLSFTLKFREPIYLNQMTETEKDLDTETEIWTAETVQEIDVLAEIEK"
FT   gene            complement(244245..244697)
FT                   /locus_tag="HSM_0226"
FT   CDS_pept        complement(244245..244697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0226"
FT                   /product="phage head completion"
FT                   /note="PFAM: phage head completion; KEGG: spt:SPA2617
FT                   putative phage gene"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31850"
FT                   /db_xref="GOA:B0UW31"
FT                   /db_xref="InterPro:IPR009225"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW31"
FT                   /protein_id="ACA31850.1"
FT                   /translation="MLNGRENPIADKQIENTGFFGAINIGDFQKQRAIPLQIPLELIES
FT                   VLVYAIQSVEFDLNIVSQRYQKQGIKSVDDIQSPTINGKNFEKILFEKAVFARAKQELL
FT                   PEFATLSAREIHEQRDIVTEQKQLQAEAVQAIRQLKGKGRGTVDLI"
FT   gene            complement(244690..245571)
FT                   /locus_tag="HSM_0227"
FT   CDS_pept        complement(244690..245571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0227"
FT                   /product="phage small terminase subunit"
FT                   /note="PFAM: phage small terminase subunit; KEGG:
FT                   yps:YPTB3143 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31851"
FT                   /db_xref="GOA:B0UW32"
FT                   /db_xref="InterPro:IPR010270"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW32"
FT                   /protein_id="ACA31851.1"
FT                   /translation="MGLREQQARMQELAKLEQAQLNAQANASAEMPSVTQSAVLIALNQ
FT                   DVEKIRQFSAFADRNEYKRTQFLPKWMPFVEQHFNDGRADQNDVIGYCLVYLLDIGHFE
FT                   QAFNLAEKAITNGQRLPERFKSTIPTFMAKHMLDWTIHTTAMGSPVEPYFSQTFEKVAT
FT                   TWQLNEVLVSAWFKQAAIQLLKNATGKAHAASVSDPMRLISAIKLLKKSLYLNPKSGVN
FT                   SLISRCFMRLNALIIGLNDEGINVSDLIDPAQQAALAENNPEIDIKAVIALLNRPPCSF
FT                   DEVVKEMRGKHA"
FT   gene            complement(245600..246631)
FT                   /locus_tag="HSM_0228"
FT   CDS_pept        complement(245600..246631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0228"
FT                   /product="phage major capsid protein, P2 family"
FT                   /note="TIGRFAM: phage major capsid protein, P2 family;
FT                   PFAM: phage major capsid protein P2; KEGG: pat:Patl_0697
FT                   phage major capsid protein, P2 family"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31852"
FT                   /db_xref="InterPro:IPR006441"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW33"
FT                   /protein_id="ACA31852.1"
FT                   /translation="MNRKQIYNAFIQAIAQHYNVPFAEVRLGEEFSLEAPKAALLGSNI
FT                   QQSSDFLKEINMVQVTDLKGLKLWGATEKGITGRKPTERHIATLNHTQTGYELARTDSG
FT                   ILVPWDMFDQFARFGDKLPALYAEFFNKQVALDMLQVGWHGKSVAPTTSQSDLSDVNKG
FT                   WLALLKEQKSANVYTGNSSHKINLYGTDAEFANLDELALDLKQGLDLRHQNRTDLVFLV
FT                   GADLVNVESKYISKASKLTATERAALGSHNLVNTFAGMRAIIPPNFPAKGAAVTTLNNL
FT                   SIYTQSSSVRRRFESNQDKMGIITSYYRNEGYVVEDTGLMTAIEAENVVIGKPDKPMAQ
FT                   ASD"
FT   gene            complement(246641..247066)
FT                   /locus_tag="HSM_0229"
FT   CDS_pept        complement(246641..247066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0229"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31853"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW34"
FT                   /protein_id="ACA31853.1"
FT                   /translation="MKSPNKKKNHFFSKFFNWLFSGEQPEIKENQENTANTGNPTAIEI
FT                   DNMDKQEFSTLIATAVAGAVAQAFSEQAEQQQEKEQAADKPTEQPAETVSKQEFNELKT
FT                   KYDVLEAKFNQLLQPVTQTPSELGNADNMFNLENSGF"
FT   gene            complement(247017..247538)
FT                   /locus_tag="HSM_0230"
FT   CDS_pept        complement(247017..247538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0230"
FT                   /product="phage capsid scaffolding"
FT                   /note="PFAM: phage capsid scaffolding; KEGG: hch:HCH_00395
FT                   flagellar biosynthesis/type III secretory pathway protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31855"
FT                   /db_xref="GOA:B0UW35"
FT                   /db_xref="InterPro:IPR009228"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW35"
FT                   /protein_id="ACA31855.1"
FT                   /translation="MKTELFTNFVCIATAGATVDGRHIDAQDLKDMAESYNPEVYTALI
FT                   WLEHYRNFGNYGRVVELKTEDEEGKTKLYARLAPNAQLLELNQSGQKIFTSIEITPNFA
FT                   QTGKAYLSGLAITDSPASTGTNALMFNRIGSKDVIISDHLEFNINFPQEVHNMNEITEQ
FT                   EKKSLFQQVF"
FT   gene            247701..249488
FT                   /locus_tag="HSM_0231"
FT   CDS_pept        247701..249488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0231"
FT                   /product="protein of unknown function DUF264"
FT                   /note="PFAM: protein of unknown function DUF264; putative
FT                   terminase ATPase subunit; KEGG: yps:YPTB3140 possible
FT                   [Haemophilus phage HP1] orf16-like phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31856"
FT                   /db_xref="GOA:B0UW36"
FT                   /db_xref="InterPro:IPR004921"
FT                   /db_xref="InterPro:IPR010332"
FT                   /db_xref="InterPro:IPR035421"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW36"
FT                   /protein_id="ACA31856.1"
FT                   /translation="MPISKLRKRKSKYDDEVIYQARYLYLKKYSPQEIVKELGLNSPRP
FT                   VYYWAEKYNWRNLINEQGIEELIALRIVALIEREGKTDQEIKELESLIEKDLQYKHQRA
FT                   KQAQKTKENSTALFAEETPGRKSKKKAAVKNDISHITDDMFEPFLSSLFDYQLRAREQK
FT                   ALHKVRMILKSRQIGATYYFAFEALEDAIKTGDNQIFLSASKKQAEIFKTYITKMARQY
FT                   FNVELKGNPIILSNGAELHFLSTNKSTAQGYHGHVYGDEFAWLRNFKEFYTVASAMATH
FT                   KKWRETYFSTPSSKLHESYAFWSGDMWKESDKKRRDIVFPSLEQMCNGGVVCPDGAWRY
FT                   VITIHDALKGGAGVLFDLDQLKQKYSALAFKQLFECHWIDDEDSIFTISKLLKCAVNIN
FT                   KWADFQPDTPRPFGDREVWGGYDPAHSSDGASFVIVAPPINEGEKFRVLARYQWFGLSY
FT                   RWQAEQIKKLYQQYNFSYIGIDANGVGQGVFEMIQEFARREARPILYSLETKSGLVLKV
FT                   HDLVERGLIEWSEEEKDIAASFLMIKQTSTQSGAKITFTADRTSQLQHADVFWAIAHAI
FT                   NKKSLIDDRPRRRSVWRIN"
FT   gene            249499..250527
FT                   /locus_tag="HSM_0232"
FT   CDS_pept        249499..250527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0232"
FT                   /product="phage portal protein, PBSX family"
FT                   /note="TIGRFAM: phage portal protein, PBSX family; PFAM:
FT                   phage portal protein; KEGG: sgl:SG0244 putative phage
FT                   capsid portal protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31857"
FT                   /db_xref="InterPro:IPR006430"
FT                   /db_xref="InterPro:IPR006944"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW37"
FT                   /protein_id="ACA31857.1"
FT                   /translation="MKKQKNTNKPIMFSFQPQGDWELSMPPALDYTGIYFNDFYQCYEP
FT                   PIKRWSLARLPSQNAQHCGILHSRANMIAADYDQGGLSKMDMRAACLNLIQFGDVGLLK
FT                   VRNGFGQVVKLITLSSLYLRKTKEGNYRYLVRRSLTDTEQSDILTYPAQDIIFIKLYDP
FT                   MQQVYGVPDYMGGIQSALLNSDATTFRRRYFANGSHLGFILYTTDPNVTEEMEENINKS
FT                   LNGSQGVGNFKSMFVNSPDGHPDGLKVIPIGDTGKKDEFGTIKNVSAQDVLTAHRYPPG
FT                   LSGVIPQTGSFGDPLKMRLAYRQDEVLPMQDLISSSINGDIEIARNKALQISFKQRQIL
FT                   QK"
FT   gene            250583..250861
FT                   /locus_tag="HSM_0233"
FT   CDS_pept        250583..250861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0233"
FT                   /product="phage transcriptional activator Ogr/delta"
FT                   /note="PFAM: phage transcriptional activator Ogr/delta;
FT                   KEGG: yps:YPTB3138 possible (AB008550) orf34 [bacteriophage
FT                   phi CTX]"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31858"
FT                   /db_xref="InterPro:IPR007684"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW38"
FT                   /protein_id="ACA31858.1"
FT                   /translation="MARIFKIYCRECKSPAIIQRTDRLHPDLYDLYCVCKNPECGHTWK
FT                   AQYNFSHSLRPTQLDRDELVKYLISKMPKTELEQLGRDIEQQLKLAI"
FT   gene            complement(250962..251357)
FT                   /locus_tag="HSM_0234"
FT   CDS_pept        complement(250962..251357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0234"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31859"
FT                   /db_xref="GOA:B0UW39"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW39"
FT                   /protein_id="ACA31859.1"
FT                   /translation="MKIKMRFLTEVAEIEPRPSKDKIYPIGTIIIQISATRGEVLYLRK
FT                   ESKIEDRYAVISPKEQIQSFYLFSIIEKYFPKFFLQYKQGLNFKAEDLKRFKLPVHEEQ
FT                   KQRNIIAKMMMLCGCEPKKFYENIPTI"
FT   gene            complement(251354..252739)
FT                   /locus_tag="HSM_0235"
FT   CDS_pept        complement(251354..252739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0235"
FT                   /product="N-6 DNA methylase"
FT                   /note="PFAM: N-6 DNA methylase; KEGG: ldb:Ldb1052 type I
FT                   restriction-modification system, modification subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31860"
FT                   /db_xref="GOA:B0UW40"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW40"
FT                   /protein_id="ACA31860.1"
FT                   /translation="MKITELLNLKWDYQITEHLINLLFDKQKRNEVFARYLSQKPDLSQ
FT                   DCFLQEFQENFADRKSLKQDFTPSAICQLVSRLTPEVDSVLDVCAGTGALTIAKWKVNP
FT                   NATFYCQEYSKEAIAFLLFNLCVRGITAEVKHCDVLTGETFAEYRLTRNGQYSDIENTK
FT                   LDWRGLKVDCVVSNPPYSAKWNPVSDERFEYFGLAPKNAADYAFVLHGLHHLKEEGTAH
FT                   FILPHGVLFRGNSEGKIRQKLIEQGYFSSVIGLPDNLFISAKIPTAILTFKKQSSDIYV
FT                   IDAADLFEKAKSNNIMRPEHVNQVLTAYQLRHNIDKLAHLANYTEIQQNDFNLNIPRYV
FT                   DKSEPDPEIDLLKEAQELLDLTNDIEKSGQAFVAMLAELEMTHGSAEDKAEFEQVKQIL
FT                   AQVFAPRTKEKKAIQQLISSKQGSLFITEQEVEQFTGFIEHELKIISQLETIKKYFLSK
FT                   MFI"
FT   gene            complement(252756..253286)
FT                   /locus_tag="HSM_0236"
FT   CDS_pept        complement(252756..253286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0236"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31861"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW41"
FT                   /protein_id="ACA31861.1"
FT                   /translation="MIVNNKWIPEVPRPTLEDDAFAAFIKAWIEEEYPDHCEDIPAEET
FT                   GLYETLLRNWAGFDDLMAEEFIKFHGWSYAQAKEFEEKSLSFAIDKKESEMIQQWVAEN
FT                   GYTLPFPVGSRVKIDTWRGAVYGVIAQNQDQYFSKKGQAIVQIDREHAIEIEGGEVLDK
FT                   RSFPWEMLELVKS"
FT   gene            complement(253301..255490)
FT                   /locus_tag="HSM_0237"
FT   CDS_pept        complement(253301..255490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0237"
FT                   /product="unknown protein"
FT                   /note="KEGG: pmu:PM1782 unknown"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31862"
FT                   /db_xref="InterPro:IPR009270"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW42"
FT                   /protein_id="ACA31862.1"
FT                   /translation="MIVKKKNLKNAPNVKDFKKQAINTTDIAFIIVGEDAWSYAGKKGK
FT                   YILSHYGTLKDKFGVFLPEKPIVLGPKQIEQISSLRIIPENHKKVRIMEAGEFSPIKKT
FT                   ALLLNLAQNSKANDVVFVDLLGEPLEDVSDYLEKLRTDSEDLAFAEQVVGYEPDIETHK
FT                   EPYVDEREEGKLNGLFYVVPKVDRDTGAVINEKLSWICSPLTLVGNGRNDIGDYYYLFK
FT                   WKHFSQKESHIEAVSLADFGTEAGWRQLKRKGLLMTAKNLTNHLVEHFHVLSRQAPFWK
FT                   VTASTGWQDSAYLLPSGEIIGEPSKPIYFNGESGSASGYRTKGTLNDWQREIAQNLKGN
FT                   PSMMLGVAVALAAPLLAILGRDSFGVHLYAESSKGKTTILNIANSLYGDPDKIKLSWSA
FT                   TAVGVKNEAAARNDGLITLDEIGQAKDAKNLEAIAYDLFNETGKLQGKKEGGNKDINRW
FT                   KVTALSTGEKDLETQLALQGVKVHAGQLVRLINIPLEEAKNLHYFTNNKSHADHLNESV
FT                   REYYGTAGREWIAFLAKNAELAKESYKIIRKKWADLADNMSGQVQRVATDRFAVLETAL
FT                   HLASHITQWSIEENQQVILKNFLNWKEEYGENSREETKLIANLMDWITMNEGAFVEYPT
FT                   DQNAKTPNKIYGIKILEDEFRGEGGYFYVIPQAFKEATQGYPRNMALKILANAKILQSP
FT                   TTPEKGYEYQFKVPKKMLGRQIRAYKITPILEETH"
FT   gene            complement(255487..255756)
FT                   /locus_tag="HSM_0238"
FT   CDS_pept        complement(255487..255756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0238"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31863"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW43"
FT                   /protein_id="ACA31863.1"
FT                   /translation="MSKSSVVRFAMEAQLKETISTLNAYVDYLFEIQHIGASSDSPEFN
FT                   HKKSDRYFIAMDNLCYTLDMHLKSWREIAQNEQLGRYSTSREEI"
FT   gene            complement(255749..256237)
FT                   /locus_tag="HSM_0239"
FT   CDS_pept        complement(255749..256237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0239"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hso:HS_0528 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31864"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW44"
FT                   /protein_id="ACA31864.1"
FT                   /translation="MSLKRYRNMTKIKFSVLPKNQSAVSIGDTTTKNGYRTRKTCGIFL
FT                   PQIPIINGLSLLSSICLSEFVARSIRRDKAEFIRTNKASRFFAVVETLLHPLGNSNSHL
FT                   LNKETIKMLFKFILFLGKNRLKIAIRAKSIQQARQQLNLTQHQAVFVARINTKGGLYV"
FT   gene            complement(256389..256667)
FT                   /locus_tag="HSM_0240"
FT   CDS_pept        complement(256389..256667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0240"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hso:HS_0527 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31866"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW45"
FT                   /protein_id="ACA31866.1"
FT                   /translation="MMSNTNYQANQENAFKPDLEGIKNTLETSRDLIIQLKEKKPVMAF
FT                   NDEGQEVQLSQEKILDIVLTQLFCSIDDIDEIQSKRLEPIAKTIEEP"
FT   gene            complement(256736..257500)
FT                   /locus_tag="HSM_0241"
FT   CDS_pept        complement(256736..257500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0241"
FT                   /product="DNA methylase N-4/N-6 domain protein"
FT                   /note="PFAM: DNA methylase N-4/N-6 domain protein; KEGG:
FT                   hit:NTHI1495 modification methylase DpnIIB-like"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31867"
FT                   /db_xref="GOA:B0UW46"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW46"
FT                   /protein_id="ACA31867.1"
FT                   /translation="MEHIKRTQKCELFNDHFQNYKRYHIPKAQLVIADIPYNVGNNAYA
FT                   SSPEWYKDGDNKNGESDKANKAFFDTDENFRIAEFMHFCSKMLVKEPKERNQAPCMIVF
FT                   CAFQQIQMVLEYAEKYGFKKHIPLVFIKSSSPQVLKANMKVVGATEYALILYREKLPKF
FT                   RNNGKMIKNWMEWTRDDRKKYPKLHPTQKPIDVLKRLIEIFTDEGDVVIDPVAGSGSTL
FT                   RAARELGRNSYGFEIKKDVYQNAKENMLKEGD"
FT   gene            complement(257511..257972)
FT                   /locus_tag="HSM_0242"
FT   CDS_pept        complement(257511..257972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0242"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pmu:PM1778 unknown"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31868"
FT                   /db_xref="InterPro:IPR018880"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW47"
FT                   /protein_id="ACA31868.1"
FT                   /translation="MNMHLKKTSAEPQNSNVRQTANSSTPLNRAFFIRTLRTSQINPFA
FT                   YGAKCLISMVAYHGKGFALCCVPFDAVSELMIRCRQYQSLRTLRAVTPKNTNGVTLMIY
FT                   KFILLGKNRLHLSIFANNEQQARNRVNLSNAICYARINPKQYRTLSGNA"
FT   gene            complement(258443..258724)
FT                   /locus_tag="HSM_0243"
FT   CDS_pept        complement(258443..258724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0243"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31869"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW48"
FT                   /protein_id="ACA31869.1"
FT                   /translation="MSYTNKKNRTNRIAGANGKPPSPRIAQHQINFIKTLLYLHYNIKT
FT                   PQQARNALRNGKLGQDLERLRNQHGDILANLNMAIPSDVTLENWYNQA"
FT   gene            complement(258693..258962)
FT                   /locus_tag="HSM_0244"
FT   CDS_pept        complement(258693..258962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0244"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31870"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW49"
FT                   /protein_id="ACA31870.1"
FT                   /translation="MAPILNNPLKKIKEKTMANSNTEHSKKLRAQTAKERNQRLKAEGK
FT                   VRQISMLINSELADQFDVIAKEQGKSRPEVLKMLIELYQQKKQN"
FT   gene            259257..259694
FT                   /locus_tag="HSM_0245"
FT   CDS_pept        259257..259694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0245"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vei:Veis_1323 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31871"
FT                   /db_xref="InterPro:IPR025272"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW50"
FT                   /protein_id="ACA31871.1"
FT                   /translation="MAYSAMQVANAFIQKAQEGKVPALTPMKLQKLMFFAQSWYLKKYH
FT                   VRLIDDHFVRWQYGPVIPSVYYEFSSFGSCDINQPATNPFGIIAPNLTIADDAFIDEVI
FT                   ATYGSFDGWKLSVMTHQPKTAWSMGKIGSVITPIEMFEGKV"
FT   gene            complement(261096..261314)
FT                   /locus_tag="HSM_0246"
FT   CDS_pept        complement(261096..261314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0246"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31872"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW51"
FT                   /protein_id="ACA31872.1"
FT                   /translation="MAYAKTEHSRKLRIKTANEWNKKRLEAGIVKRITMQFATEDANEL
FT                   DAIAQELGLSRPQAIKKLCEMYRESNK"
FT   gene            complement(262158..262610)
FT                   /locus_tag="HSM_0247"
FT   CDS_pept        complement(262158..262610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0247"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nma:NMA1837 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31873"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW52"
FT                   /protein_id="ACA31873.1"
FT                   /translation="MQEVEVISTALNFCHEFGLTKKSRKKCEKVFQQIEERSNFIINLS
FT                   IKSDEEWKETTGNLTRGHFDPSTFTITIPESIYELACRGDRTSLFIIFHEFGHLFLGHR
FT                   AVLHNAKVPPTKNEDAEWQADTFAEIVLERLGFYTSPQLELDFGGM"
FT   gene            complement(262646..263011)
FT                   /locus_tag="HSM_0248"
FT   CDS_pept        complement(262646..263011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0248"
FT                   /product="conserved hypothetical DNA-binding protein"
FT                   /note="KEGG: nma:NMA1838 hypothetical DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31874"
FT                   /db_xref="GOA:B0UW53"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW53"
FT                   /protein_id="ACA31874.1"
FT                   /translation="MALTEFGKIVRKARIDANETLLTMSKALGTTPAYLSGLETGSKKI
FT                   SKKWVVAITHFFKEKGIEVKELQKLADVSNENVPIDGLSEHHKMLVAGFANSRYTAKEL
FT                   AQISELLTRINHEKDSK"
FT   gene            263373..263696
FT                   /locus_tag="HSM_0249"
FT   CDS_pept        263373..263696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0249"
FT                   /product="Addiction module killer protein HI1419"
FT                   /note="TIGRFAM: Addiction module killer protein HI1419;
FT                   PFAM: protein of unknown function DUF891; KEGG:
FT                   bxe:Bxe_B0862 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31875"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="InterPro:IPR014056"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW54"
FT                   /protein_id="ACA31875.1"
FT                   /translation="MYSIKQTSIFKQWLKNIKDPIARIMVIKRIERAKNGNFGDHKLLA
FT                   NTGGIYEMRIDTGKGYRIYYAKIEDIIYLLTNGGDKKTQQQDISDAQVILEKFKQLGDD
FT                   ENE"
FT   gene            263689..263988
FT                   /locus_tag="HSM_0250"
FT   CDS_pept        263689..263988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0250"
FT                   /product="putative transcriptional regulator"
FT                   /note="TIGRFAM: Addiction module antidote protein HI1420;
FT                   KEGG: pfo:Pfl_2007 predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31877"
FT                   /db_xref="GOA:B0UW55"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR014057"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW55"
FT                   /protein_id="ACA31877.1"
FT                   /translation="MSEQNNIEVTDFDAAEFLENDELIALYLAETLKNGNDEEFIQALN
FT                   TVARAKGMNDIAKKAGIARESLYQTLSSNKPRFETVRKILNALNIDLIPTVKTA"
FT   gene            264628..265488
FT                   /locus_tag="HSM_0251"
FT   CDS_pept        264628..265488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0251"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /note="TIGRFAM:
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase;
FT                   PFAM: SAICAR synthetase; KEGG: hso:HS_1364
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase
FT                   (SAICAR synthetase)"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31878"
FT                   /db_xref="GOA:B0UW56"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UW56"
FT                   /protein_id="ACA31878.1"
FT                   /translation="MTQLSLKKIYSGKVRDLYEIDDKRMLMVATDRLSAFDVILDDPID
FT                   RKGEILTQISNFWFKKLAHIMPNHFTGETVYDVLPQAEADLVKDRAVVCKRLTPIKIES
FT                   IVRGYLTGSGLKDYKATGTICGLKLPEGLVEASKLPEPIFTPSSKAKVGDHDINISYEE
FT                   CEQLIGVELAKQVREKAISLYKEAAEYALTKGIIICDTKFEFGLDENGVLTLMDEVLTP
FT                   DSSRFWSVETYQEGTNPPSFDKQFVRDWLEKSGWNKQAPAPKVPADVIQKTVDKYKEVL
FT                   DLLTK"
FT   gene            265555..266385
FT                   /locus_tag="HSM_0252"
FT   CDS_pept        265555..266385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0252"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   dTDP-4-dehydrorhamnose reductase; KEGG: hso:HS_1363
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31879"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW57"
FT                   /protein_id="ACA31879.1"
FT                   /translation="MRAVSIVGLGWLGLTLARHLKNLGWKVKGTKRTHEGVEQMRLIRL
FT                   EAYHLELTPDINADPDDLTALLSVDALVINIPPSQYFFHLQHYVQGVKNLVNEALLNGL
FT                   QHIIFISSTSVFPDVSGEFDEQSQIVPQSEMSKALLEIEQWLFELKDVDCDIIRFGGLV
FT                   GEDRHPVYSLAGKDELSAGNMPINLVHVDDCARAIQLLLETPSSQRLYHLVAPQHPTRA
FT                   EYYSQIAEKLALEAPHFICSEQDPRRVILANKICRELSFVYQCPDPYLMLFERK"
FT   gene            266479..267813
FT                   /locus_tag="HSM_0253"
FT   CDS_pept        266479..267813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0253"
FT                   /product="Argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="PFAM: argininosuccinate synthase; KEGG: hso:HS_1362
FT                   argininosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31880"
FT                   /db_xref="GOA:B0UW58"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023437"
FT                   /db_xref="InterPro:IPR024073"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UW58"
FT                   /protein_id="ACA31880.1"
FT                   /translation="MSNTILQHLPIGQKVGIAFSGGLDTSAALLWMRQKGAVPYAYTAN
FT                   LGQPDEEDYNAIPRKAMEYGAEKARLIDCRNQLAHEGIAAIQCGAFHISTGGVTYFNTT
FT                   PLGRAVTGTMLVSAMKEDDVNIWGDGSTFKGNDIERFYRYGLLTNPSLRIYKPWLDNQF
FT                   IDELGGRQEMSEFLIANGFDYKMSAEKAYSTDSNMLGATHEAKDLEYLNSGIRIVKPIM
FT                   GVAFWRDDVTVKAEEVTVGFEDGVPVTLNGQSFSSAVELFLEANRIGGRHGLGMSDQIE
FT                   NRIIEAKSRGIYEAPGMALLHIAYERLVTAIHNEDTIEQYRINGLRLGRLLYQGRWFDP
FT                   QALMLRETAQRWVARAVTGEVTLELRRGNDYSILNTVSPNMTYHPERLSMEKVENAPFD
FT                   PSDRIGQLTMRNLDITDTRDKLGIYTHTGLLTVGKDSMLPQLDKK"
FT   gene            267923..268810
FT                   /locus_tag="HSM_0254"
FT   CDS_pept        267923..268810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0254"
FT                   /product="protein of unknown function DUF535"
FT                   /note="PFAM: protein of unknown function DUF535; KEGG:
FT                   hso:HS_1361 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31881"
FT                   /db_xref="InterPro:IPR007488"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW59"
FT                   /protein_id="ACA31881.1"
FT                   /translation="MKNLFSFPSFYQFSNERRFLKRLRTRIRYYFYRLTCFKECQIFVT
FT                   YLNHNPLWIDIFTKSYYRCDAVLRKYCDNRFNKKQRVQAIMDNFSVAEQVFGRSFSQLL
FT                   VEKDKVLLAELTDELDLYLAINQIDPFEGFFAVNIRNKQGQRIYDASFSFLAGNKLLIT
FT                   SVQGPSDDNSQELIKSTTKQLHGVRPMFMLVNVYKLLAKELNCELLGIAHKNQGKYRWN
FT                   DNARLLFNYDDFWQENNALLNPQGYWQLPVVIERKTLEDIQSKKRSMYRKRYEMFDFIE
FT                   KNITEIFGKENLNK"
FT   gene            268893..269348
FT                   /locus_tag="HSM_0255"
FT   CDS_pept        268893..269348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0255"
FT                   /product="beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabZ"
FT                   /note="TIGRFAM: beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabZ; PFAM:
FT                   Beta-hydroxyacyl-(acyl-carrier-protein) dehydratase
FT                   FabA/FabZ; KEGG: hso:HS_1360 3-hydroxymyristoyl-(acyl
FT                   carrier protein) dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31882"
FT                   /db_xref="GOA:B0UW60"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UW60"
FT                   /protein_id="ACA31882.1"
FT                   /translation="MTVTTERIARIIESKEIMTLLPHRYPFLLVDRVTDYEEGKWLTAI
FT                   KNVSVNEPCFTGHFPDQPILPGVLILEALAQAMGILAFKTHELSNKELFYFAGVDEARF
FT                   KRPILPGDQMMLKVEVIRERRGITAFTGVASVNGEVACEAKLMCARR"
FT   gene            269362..270150
FT                   /locus_tag="HSM_0256"
FT   CDS_pept        269362..270150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0256"
FT                   /product="acyl-(acyl-carrier-protein)--UDP-N-acetylglucosamine
FT                   O-acyltransferase"
FT                   /EC_number="2.3.1.129"
FT                   /note="TIGRFAM:
FT                   acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine
FT                   O-acyltransferase; KEGG: hso:HS_1359
FT                   UDP-N-acetylglucosamine acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31883"
FT                   /db_xref="GOA:B0UW61"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR010137"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029098"
FT                   /db_xref="InterPro:IPR037157"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UW61"
FT                   /protein_id="ACA31883.1"
FT                   /translation="MIHSTAKIHPSSIIEEGAKIGENVVIGPFCIVGSDVQIGKGTTLH
FT                   SHVVVKGVTTIGEDNQIFQFASIGEVNQDLKYQGEPTKTIIGHRNRIRESVTIHRGTVQ
FT                   GGGVTRIGDDNLLMINAHIAHDCQIGNRCILANNATLAGHVELGDFVIVGGMSAIHQFV
FT                   IVGAHVMLGGGSMVSQDVPPYVMAQGNHARPFGVNIEGLKRRGFDKPTLHAIRNVYKLI
FT                   YRSGKTLEEVIPEIENYAQTESAVSFFLDFFTRSTRGIIR"
FT   gene            270232..271401
FT                   /locus_tag="HSM_0257"
FT   CDS_pept        270232..271401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0257"
FT                   /product="lipid-A-disaccharide synthase"
FT                   /EC_number="2.4.1.182"
FT                   /note="TIGRFAM: lipid-A-disaccharide synthase; PFAM:
FT                   glycosyl transferase family 19; KEGG: hso:HS_1358
FT                   lipid-A-disaccharide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31884"
FT                   /db_xref="GOA:B0UW62"
FT                   /db_xref="InterPro:IPR003835"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UW62"
FT                   /protein_id="ACA31884.1"
FT                   /translation="MIDKKNITIGIVAGEVSGDILGAGLIRALKIQYPQARFIGIAGKN
FT                   MLAEGCKTLVDMEDIAVMGLVEVIKYLPRLLKIRRLVIDTMLAEKPDIFIGIDAPDFNL
FT                   DIELKLKKQGIKTLHYVSPSVWAWRQKRIFKIAQATNLVLAFLPFEKAFYDRFNVPCRF
FT                   VGHTMADIIDLQPDRQDACFQLNLEPKHRYVAILVGSREAEVQFLTPPFLQTAQLIKQR
FT                   FPDVQFLVPLVNEKRRKQFEQIKAQIAPHLEVIFLDGQARQAMIVAEASLLASGTASLE
FT                   CMLCKSPMVVGYKMKPFTYFLAKRLVKTKYISLPNLLADDMLVPEMIQEDCTAEKLAEK
FT                   LSVYLEQTESGIKNRQHLIQQFTQLHQLIRCDADKQAAQAVIDLLNDEV"
FT   gene            271402..272037
FT                   /locus_tag="HSM_0258"
FT   CDS_pept        271402..272037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0258"
FT                   /product="Ribonuclease H"
FT                   /EC_number="3.1.26.4"
FT                   /note="PFAM: ribonuclease HII/HIII; KEGG: hso:HS_1357
FT                   ribonuclease HII"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31885"
FT                   /db_xref="GOA:B0UW63"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UW63"
FT                   /protein_id="ACA31885.1"
FT                   /translation="MTNVFIYPNVEFIAGVDEVGRGPLVGAVVTAAVILDPHNPIEGLK
FT                   DSKKLSEKKRLLLAEEIKQKALAWSLGRAEPAEIDKLNILHATMLAMQRAVENLKIQPH
FT                   FVLVDGNRIPQLPMSAQAVIKGDSLVAEISAASILAKVARDQEMIELDRRYPEYAFAQH
FT                   KGYPTKLHLERLAQFGVLPEYRRSFAPVKKLLSTLLSKNHEYVFKIQK"
FT   gene            272098..272682
FT                   /locus_tag="HSM_0259"
FT   CDS_pept        272098..272682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0259"
FT                   /product="molybdenum cofactor synthesis domain"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain; PFAM:
FT                   molybdopterin binding domain; KEGG: hso:HS_1356
FT                   molybdopterin biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31886"
FT                   /db_xref="GOA:B0UW64"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW64"
FT                   /protein_id="ACA31886.1"
FT                   /translation="MATLLKIGLVSVSDRASQGVYQDQGIPELLEWLKSALCDPFEVES
FT                   RLIPDEQTLIEKTLCELVDDCHCHLVLTTGGTGPVKRDVTPDATLAVADREMPGFGEQM
FT                   RQVSLHFVPTAILSRQVGVIRRNSLILNLPGQPKAIKETLEGVKDEHGNVIVKGIFSAV
FT                   PYCLQLIDGIYIDTDPNVIESFRPKSARRTL"
FT   gene            272725..273063
FT                   /locus_tag="HSM_0260"
FT   CDS_pept        272725..273063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0260"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   hso:HS_1355 nitrogen regulatory protein p-II"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31888"
FT                   /db_xref="GOA:B0UW65"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW65"
FT                   /protein_id="ACA31888.1"
FT                   /translation="MKKIEAIIKPFKLDDVRESLADIGITGMTVTEVRGFGRQKGHTEL
FT                   YRGAEYMVDFLPKVKMEIIVPDEIVEQCIEAIIETAQTGKIGDGKIFVYDVNRVIRIRT
FT                   REENEEAL"
FT   gene            273063..274115
FT                   /locus_tag="HSM_0261"
FT   CDS_pept        273063..274115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0261"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   hso:HS_1354 possible permease"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31889"
FT                   /db_xref="GOA:B0UW66"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW66"
FT                   /protein_id="ACA31889.1"
FT                   /translation="MSERNSSLTQVLVACAAIIVILGGIKLASEIVVPFLLSLFIAIIC
FT                   SPVVNFMTKRKIPHWLAITLLFVLIVVLFYFLASLISNTVQEFTQSIPQYKVLLSQRLN
FT                   DLLAFAHHFNIPLFFSTDSINDDFDPSIIMKFVSRFLLSFSNVVTNIFVLFLIVVFMLA
FT                   EAPTVKQKFTKLIVTENTVTQQNYIERILQGVIGYLGVKTITSVMTGLCIYFVLSVLDI
FT                   QYAILWATLVFLLNYIPNIGSIIAAVPVIVQSFLLNGFITGLVVSIAFILINTVVGNVL
FT                   EPKMMGRKLGLSTLIVFLSLLFWGWLLGTVGMLLSVPLTMGLKIALEANPNTIKYAELL
FT                   GDVSDVQNVK"
FT   gene            complement(274430..275383)
FT                   /locus_tag="HSM_0262"
FT   CDS_pept        complement(274430..275383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0262"
FT                   /product="modification methylase, HemK family"
FT                   /EC_number="2.1.1.72"
FT                   /note="TIGRFAM: modification methylase, HemK family; PFAM:
FT                   putative RNA methylase; methyltransferase small; KEGG:
FT                   hso:HS_1353 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31890"
FT                   /db_xref="GOA:B0UW67"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR017127"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW67"
FT                   /protein_id="ACA31890.1"
FT                   /translation="MSTINQFNQELVDCILTDQVQNSLHTIQDFLRWTYSIFNRSDIYY
FT                   GHGYDNAWDESLQLILTGLHLPLDFPEKLYNSALTTSEKNSLIQLVIARIEQRLPIAYL
FT                   TNSAWFCGLEFYVDERVIIPRSPISALITNKFKGLLQQDPIRILDLCTGSGCIAIACAE
FT                   QFTHAEVDAVDLSIDALNVAEINIERHNLTHRVFPIQSDLFKNLPLDQYDLIITNPPYV
FT                   DEEDLQDMPIEFHHEPEMALGSGIDGLTITKEILANSADYLTDNGILICEVGNSMVHLI
FT                   EQFPEVPFQWLELRNGGIGVFALHKKDLVKYKKKFL"
FT   gene            275468..275974
FT                   /locus_tag="HSM_0263"
FT   CDS_pept        275468..275974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0263"
FT                   /product="Smr protein/MutS2"
FT                   /note="PFAM: Smr protein/MutS2; KEGG: hso:HS_1352
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31891"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR022990"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW68"
FT                   /protein_id="ACA31891.1"
FT                   /translation="MLNDEDIELFHREIQGAKKIEQNIFIAPRHRNLKNKVEIRNVREK
FT                   EDTLFFFSDEYEPLLNEDGTVKYLRPHEDRYLLKQLRRGDFSPELFLDLHGLTRKEAKI
FT                   ELASLIHACEKEHVYCACIMTGYGTYTLKQQIPRWLVQHPRVRALHQAPREWGGDAAIL
FT                   VLLDV"
FT   gene            complement(275976..278141)
FT                   /locus_tag="HSM_0264"
FT   CDS_pept        complement(275976..278141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0264"
FT                   /product="hypothetical membrane protein"
FT                   /note="TIGRFAM: hypothetical membrane protein; integral
FT                   membrane protein, YccS/YhfK family; PFAM: protein of
FT                   unknown function DUF893 YccS/YhfK; KEGG: hso:HS_1351
FT                   possible membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31892"
FT                   /db_xref="GOA:B0UW69"
FT                   /db_xref="InterPro:IPR010019"
FT                   /db_xref="InterPro:IPR010020"
FT                   /db_xref="InterPro:IPR032692"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW69"
FT                   /protein_id="ACA31892.1"
FT                   /translation="MTPWINTKIILSIPVFLAVNIVTFSIWKLNISEQSMPLILGIIAG
FT                   GLVDLDNRLTGRLKYVFYTLIAFSISSLSVQLTLGHGIEYLLLMTALTFLFTMVGAIGQ
FT                   SYSTIAFGTLVVALYTTLTYTPNVSWYINPILILCGTLLYSLCTVFVHLMFQNRPVQEN
FT                   MTKAFLALSEYLDTKSLFFDPDDIEQLENKRVILAMKNGNLITAFNACRTALFHRIRGQ
FT                   HKHRRTTKMIKYYFAAQDIHERINSSHFNYQQLSEQLKNTDLIFRIQRLLELQAQSCRE
FT                   IAHSLQYNKSYSYNPRLEQAILGINQSFEIHYQNSHLNQLQRLAIKTLIDNLQAVNWQL
FT                   HHMDQYSENTNERSEGTQIYTEQIIGLKNMWRTICSHFTFESQLFRHAIRLSIIVFVSC
FT                   SLVEIFNLQLGYWILLTAVFVCQPNYSATKLRLKQRIIGTILGVVIGSLLPYIHPTLEL
FT                   QLGLVVVTSTLFFFFRSNNYSYSTFFITLQVLISFNIMGFDLNNALLSRLTDTLIGSFI
FT                   AWSAVSYLWPDWKYLQLNKVIKQAIKANAKYFLYIISQLLFGKGDPLKYRIARRQAHEY
FT                   ATALSTTLSNMNSEPKKYQAYLQEGFELVKINYSLLSYISALGAYRKNMQKIQQSAVFL
FT                   GEFYPIAKKLLHVLEHIETLERDNFEKLLLNIEFSLKQFSDEHADQFNRNEVAIPLQQL
FT                   NLINQILPALYTAFRQNQRTSKLDANK"
FT   gene            complement(278166..278624)
FT                   /locus_tag="HSM_0265"
FT   CDS_pept        complement(278166..278624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0265"
FT                   /product="methylglyoxal synthase"
FT                   /EC_number="4.2.3.3"
FT                   /note="TIGRFAM: methylglyoxal synthase; PFAM: MGS domain
FT                   protein; KEGG: hso:HS_1350 methylglyoxal synthase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31893"
FT                   /db_xref="GOA:B0UW70"
FT                   /db_xref="InterPro:IPR004363"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR018148"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UW70"
FT                   /protein_id="ACA31893.1"
FT                   /translation="MQTTYRKLAKNKKIALVAHDHCKQDLIQWCQTNRTLLQPHILYAT
FT                   GTTGNLIHQETNLEIKNLLSGPMGGDQQLGGLIAEGKIDLLIFFWDPMNAVPHDPDVKA
FT                   LMRIATVWNIPVAMNIATADFLISSPAFQQETEIRIPDYQGYLKERLK"
FT   gene            complement(278689..279342)
FT                   /locus_tag="HSM_0266"
FT   CDS_pept        complement(278689..279342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0266"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hso:HS_1349 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31894"
FT                   /db_xref="InterPro:IPR018635"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UW71"
FT                   /protein_id="ACA31894.1"
FT                   /translation="MKFSFAALASAMLLTSTAAFAGIVTSSSNIDFLAIDGQKANKDLL
FT                   KSTKSFNINESQTHQVVVRVSEIVRHGSDRSLYESDPIVVTFQGTNEDVVISAPKLENE
FT                   RDIKNFKDSPSVIVKTNSGKIIATKQEILKQEGFLPGANLIDTLSEYNASGSVASVSNF
FT                   ATAMPAVALGFAKAQKGKVVVQGENIAEQQLQFWFQQADKETQARFINWAKNQK"
FT   sig_peptide     complement(279277..279342)
FT                   /locus_tag="HSM_0266"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            279733..281478
FT                   /locus_tag="HSM_0267"
FT   CDS_pept        279733..281478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0267"
FT                   /product="Polypeptide-transport-associated domain protein
FT                   ShlB-type"
FT                   /note="PFAM: Hemolysin activator HlyB domain protein;
FT                   Polypeptide-transport-associated domain protein ShlB-type;
FT                   KEGG: msu:MS1169 FhaC protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31895"
FT                   /db_xref="GOA:B0UW72"
FT                   /db_xref="InterPro:IPR005565"
FT                   /db_xref="InterPro:IPR013686"
FT                   /db_xref="InterPro:IPR027282"
FT                   /db_xref="InterPro:IPR035251"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW72"
FT                   /protein_id="ACA31895.1"
FT                   /translation="MKKMSVLIWLCGFSSLLSAVERPLLQLNRIDAQQQQRQKEQIQQQ
FT                   SERLRSDPDVRMEISSEKPTALPFNESPCYPIQHLSIVDYSSDNKTKPSQFQWALNKAV
FT                   TQLNLQLPHCFGTQGLGILMKQVQNNVIERGYITTRVVAGEQNLTQGVFSLTVIPGQVR
FT                   HTIIADVSSLPWFSKLTAKTALAFKQGDLVNIRDIEQSLENLKRVPTADANIDILPADN
FT                   SSAFGESDIKITYQQRFPFRFSLNLDDSGSTSTGKWQGSATLSWDNLFSANDLFYTTFT
FT                   HSLKRHSDNSGRRATRNYGFYYSVPLGYWALSASLYKTDYHQDVFGAFDNTYLYAGRSE
FT                   TTNLNLAYRLYRDAVRKTTISGGFWSRHSKNYIDDAEIDVQRRRMAGWQLNLSHIEYIK
FT                   AVTLKLSLGFKWGTGVGRTIAAPEEYWGNGTSRPKIITASVDINYPFYMGKQPLAFNTT
FT                   WSTQWNKTPLIQQDRLSIGGRYTVRGFDGELTLSGERGWLWRNELSWNIANKGHWVYLA
FT                   LDGGRVMGRSDGIRLGHHLMGTVLGLRGSWTHFYYDVFIGRPLSKPSGFRTSHTVTGFN
FT                   IGLTF"
FT   sig_peptide     279733..279792
FT                   /locus_tag="HSM_0267"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.983 at
FT                   residue 20"
FT   gene            281512..288630
FT                   /locus_tag="HSM_0268"
FT   CDS_pept        281512..288630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0268"
FT                   /product="filamentous haemagglutinin family outer membrane
FT                   protein"
FT                   /note="TIGRFAM: filamentous haemagglutinin family outer
FT                   membrane protein; adhesin HecA family; PFAM: Haemagluttinin
FT                   repeat-containing protein; filamentous haemagglutinin
FT                   domain protein; KEGG: nme:NMB1768
FT                   hemagglutinin/hemolysin-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31896"
FT                   /db_xref="GOA:B0UW73"
FT                   /db_xref="InterPro:IPR008619"
FT                   /db_xref="InterPro:IPR008638"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR025157"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW73"
FT                   /protein_id="ACA31896.1"
FT                   /translation="MNKRQFRVIFSKTLQPIVVVSEPVKTEGKTKSEMPQMQSAVNFLP
FT                   IFAALTPLVFRLFCALSFVFSSSVFAETLIIKADPNAPKNQQPIVLQTANGLPQVNIQT
FT                   PNDKGLSHNKYQDFNVDKKGAILNNSHKDTQTQQAGWVQSNPYLARGEAKVILNEVTST
FT                   HPTQLKGYVEVAGRKAEVIIANPNGLHCDGCGTINATRSTMTTGKPQIIDGQVESINIE
FT                   RGKITISGKGLDNSRVNYTDILAREAEINAGVWAGKKLNVVTGKNTIKQADMEHGGNDL
FT                   QITHIDSQNLSENAPHFALDVSELGGMYAGKIHLVGTEQGLGVRNAGHIGASADNLVID
FT                   SQGKIVNQGMISAKGNLHVSTKKEIQNQGQLLTEAQLSTKSSHLDNRGGKIEGRTAQIN
FT                   ATETVNNDRIGSTGSLIQTAEKLDIHSKLVTNKNTKASQSKPPEQGIIAGVLTINGDAL
FT                   ANQNGAIYGMQNVQLNLSVHLDNQQGEILSLGELQIQGDKLNMNNEHGEIASRSNLAIY
FT                   ANKLESEGEIESSHNASIHLKQDLTLNNAFKVGGNLDFQTQGNFINNSVLRVGEKLSIQ
FT                   AHNINNNRESELSGKNTQILSNEIINRGLIDGEKTLLKSTALSNLGTGRIYGNHLAIAT
FT                   PNLINGKEDNASPTIAARERLDLAVGSLINRDHALIFSAGEMGIGGHLNEQHHAEGKAS
FT                   FIDNGSATIEALGNAYVNTARLQNHDLHLRLGENHTDERRVEYAPKNTSRRYVLIDKDG
FT                   NHGRFDSRNNSRSDRNSYLRLNDGTTIAANSWMHWDYNRHTITTTIEKRDPAKILIGGD
FT                   LHLSGNDLENNASTLSVGKRLLLGDEVFIKNDKNETLHSTTGTSLNNIDIAGTINVTDK
FT                   GHWDSFHKKKRRYGIRGRKRWAVYGTGRGDLNDIHPTSHFFFNKVDNTIGQPVDSTNTQ
FT                   ITAQAEAIVPNQMNGVIINLPEQSLYQINPDAPNGYLVETDPHFTNRKQWLSSDYMLNA
FT                   LRYNHENVQKRLGDGFYEQRLINEQIHQLTGRRFLDNHQTDDEQYKALMDSGIYYAKKF
FT                   NLHLGVGLTAEQMAELTADMVWFVNKEITLPSGKKLTVLTPQVYLVARNLDVTSQGALI
FT                   SAREIMGNINGKLTNTGTIAGRNLTALSAKNINNQGLVLGDSVNLLAKQKLVNLGGRIE
FT                   ALDSVTLVGKEGVDIASTTTRLAYQDDFGNKFDRTHVDNLAGIHVKDKNGKLIVHSPKD
FT                   VTIKGAELNSAGGILVQANHIDIGTLNTKNKTDYNADMDNYYRLEQHQEVGSQLNGKGN
FT                   ITLAGEQGVVIRQGEIHSENGDVHIASNGNIRIEEGRNKERLSSASKVKHSGFLQSTTD
FT                   ITKHDHHYDLAQGSTLDGKNVVLQSNANLTVQGSNIVAENQLNARAKNIAIKEAENRVF
FT                   EQDVEKTTKSGLMSSGGFGFSIGEKKTTTETNQTKYYATGSQVGSLKGDTALIAGKHYQ
FT                   QTGSTLSSLEGDVTIGAKKVDILAADDRYESRYKQTMEQKGFTIAVNIPVVQAVQNALA
FT                   VAKQAEQVGESKHSRINAMAAANTAWSAYRAGQGLMQASQSLSQMANGNMAQGANVSVS
FT                   ITYGEQKNVQTTDIQGNTAANSAINAGGKVTVTATGAGKESDIHVVGSDVSGQQGTLLQ
FT                   AEDEINVLAAKQTHQERSQNKSAGFNAGVAVSYGSNGLAFGFTVGGNYGKGYGNGDETT
FT                   YRHSHIGDKHSQTHIMSGGDTTLRGAQVRGKGVQVHAQNLSIESLQDTMTYKGKQMNVS
FT                   GQVTVGYGFSASANFNQSKINADYASVQEQSGIYAGDEGYQINIAQHTDLKGGLITSTA
FT                   QAENQGKNQFSTGTLSYSDIQNHADYNGSAVGVGVQADINGGWDGRQVRDGSPVSRVNQ
FT                   GIGFGYDKDSQSSLTKSGINTQNLIIRDEQGQLAKTGKTIETTRGEISTNITTDSAEQH
FT                   TGKLAPNFDKERLQKELDLQREVTQKFDQTRQEVKAELYDIVDEKREKATQIRKINGGY
FT                   DTELSAQLDREATDLDEKVRWLDMGLGLLQGSAGNSKTMLGVFAGTQADRAVRSATAPK
FT                   EMWYHKKVINEKTGKVKLESRQIWSLNDLSREELASIQDTNGKVITVSNPGIFNNREDS
FT                   LSNAEKQNLNSTNSSGVIVVMNPPTGNYKGWWILSSMVSELMYVGYDQLNNKVFQGYLP
FT                   KTNSEKLNQDIYREVQNMGNGWSVDTDNHSRGGITASVALKDWVNNKEQNGIAPIRKAR
FT                   FYGTATNVQNDYADVLQKNGYTYTSADGKTYNSGAYSIVHDKDFVGNKWIPFLLGNNET
FT                   TKGDCGIFCYSHSSYFAEVPEQYQRDEDGNIKMENGKPVETENWKDYTKKWGTPKTGAD
FT                   GDINHAIPKLVNPNNPNGEKYETNPF"
FT   gene            288599..288940
FT                   /locus_tag="HSM_0269"
FT   CDS_pept        288599..288940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0269"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nme:NMB1764 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31897"
FT                   /db_xref="GOA:B0UW74"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW74"
FT                   /protein_id="ACA31897.1"
FT                   /translation="MEKNMKQILFKYFMLITCVLGLSGCGYLLSLGQLMLDGRCADWNC
FT                   SKPTPRWRKAVDDCYSRNFGVVKQQLGYKDHGEVQDSDIGQHISYQCVRHDGRYDIRKD
FT                   KQYGHLFVK"
FT   sig_peptide     288599..288691
FT                   /locus_tag="HSM_0269"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.873) with cleavage site probability 0.701 at
FT                   residue 31"
FT   gene            289047..292526
FT                   /locus_tag="HSM_0270"
FT   CDS_pept        289047..292526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0270"
FT                   /product="hemagglutinin/hemolysin-related protein"
FT                   /note="KEGG: nme:NMB1768 hemagglutinin/hemolysin-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31899"
FT                   /db_xref="InterPro:IPR006914"
FT                   /db_xref="InterPro:IPR025157"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW75"
FT                   /protein_id="ACA31899.1"
FT                   /translation="MDNYYRLEQHQEVGSQLNGKGNITLAGEQGVVIRQGEIHSENGDV
FT                   HIASNGNIRIEEGRNKERLSSASKVKHSGFLQSTTDITKHDHHYDLAQGSTLDGKNVVL
FT                   QSNANLTVQGSNIVAENQLNARAKNIAIKEAENRVFEQDVEKTTKSGLMGSGGFGFSIG
FT                   EKKTTTETNQTKYYATGSQAGSLKGNTTLLAQEHYHQQGSTLSSLEGDVTIGAKKVDIL
FT                   AADDRYESHYKQTMEQKGFTIAVNIPVVQAVQNTLAVAKQAEQVGESKHSRINAMAAAN
FT                   TAWSAYRAGQGLMQASQSLSQMASGNMAQGANVSVSITYGEQKNVQTTDIQGNRAANSA
FT                   INAGGKVTVIATGAGKESDIHVVGSDVSGKQGTFLQAEDDINLRAAKQTHQERSQNKSA
FT                   GFNAGVAVSYGSNGLAFGFTAGGNYGKGYGNGDETTWRNSHIGDKHSQTHIMSGGDTAI
FT                   KGAQVRGKGVQVQAQNLNIESLQDTMTYKGKQMNVSGQVTVGYGFSASANFNQSKINAD
FT                   YASVQEQSGIYAGNEGYQINIAQHTDLKGGLITSTEQAEKQGKNQFSTGTLSYSDIQNH
FT                   ADYKGSRIGLSGSMAINFDTPLGKYGQAQSQKQAVNDKGEKLYIDSQGKQTTASRDSAG
FT                   NANQAKLAKGLDSLTGTTSFGFGSDRDHQRSETKSGINTTNIAIRDEQGQLKKTTKTVE
FT                   QIAAEVKTNMTTDNAESRSGKLENRFDKDELQKELDLQRTVSQDFSKNVQAANAKINQH
FT                   LDQLKTQREKGEISQSDYDTRVRSWQRGQVLLNSVASGLIAPTQSTIGIVAATASPALS
FT                   YEIGQHFKGLAKANQLTGKTEREELTVEQKAAHILAHAVLGAAAAAAGDNHALAGAISA
FT                   GGAEAATPVIGKWLYGKDKGSDLTAKEKETVTSIIGLLGAAIGTTVGNSSTNAVQGSLN
FT                   AQSAVENNSLHVDKNGVVIRNISNDDYNIYQYDYACSPVAGNNCPNLKDFDELYNSPKK
FT                   VVGQVMWQDSFTSPESGKSFGIIHFGENIEPYIYQLNDKAWGQWDITVAIKSLPGGEYD
FT                   IKSNYPSAGSYHGFLFQGKYISLRDGGNILAGMNAAVNRKTFDEFQQASGALQQGGKIG
FT                   VLLNVFTGKTYGSAPMYGELPYQYNKSKYGYDLGLERIWIKDDMKNMIPNNK"
FT   gene            292546..293073
FT                   /locus_tag="HSM_0271"
FT   CDS_pept        292546..293073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0271"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nme:NMB1502 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31900"
FT                   /db_xref="GOA:B0UW76"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW76"
FT                   /protein_id="ACA31900.1"
FT                   /translation="MEFVNNFNILSLLLLIFIPIFLTIYVIYHAIHYHKTYILKMSFVL
FT                   LGLIFFSMYYIHCRYIDPQKIAHYCIDGKCISIVHLCKGCGINSPTYAKIYDGKILFRF
FT                   QTKTRNHAEFLMEDDILISKIILGNKFIIYGSLPLMYGNVDTIKVKEAAGYINEERIDY
FT                   IASRKLKFRYLY"
FT   gene            293222..294907
FT                   /locus_tag="HSM_0272"
FT   CDS_pept        293222..294907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0272"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: msu:MS1162 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31901"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW77"
FT                   /protein_id="ACA31901.1"
FT                   /translation="MRQDTMTYKGKQMNVKGQVTVGYGFSASADFNQSKINADYASVQE
FT                   QSGIYAGDEGYQINIAQHTDLKGGLITSTAQAEKQGKNQFSTGTLSYSDIQNYSHHSAR
FT                   GFGLSGGVTVSGGEAPKEIGGMNLQHIGQNAQDGSSKVEYSGIAGVSSQGNWGITKGIT
FT                   TALLGQVKYKGSESGITTGSINTAHITIRHRDAQQKLTGKTVEESLQNLPKINLHQGVE
FT                   KADVETIRSDLARDLNTATEFVNNLNNQGDEIHYKMEKNEDSLFSIQKTRSDCDHISCL
FT                   DFDKDNSQELKRIIYSEELLTEEQAKLFSKVATAGMLNLTREAKVSSAVLYDKDLSSIE
FT                   DTALILNRGSAGILNEIIFTGFERFRAWVNMPAIFGASNATRAHAQIAKKLDEYNAYAE
FT                   SRGTKTYTFKNSAHSLGVSGNKNMLNWSEHIGQKYEHTDVEYLHLGGSYPSSEIDQQSR
FT                   RLFKSVKTQYHGVKGDFVYEGTPVLRNLGLGMIGNNPNATPNKANVSFLDTHTKANQNI
FT                   NNLKFVYKSEENGTKTKEWLTIEDMLKKTYTEGIRKFNEINGGR"
FT   gene            294885..295271
FT                   /locus_tag="HSM_0273"
FT   CDS_pept        294885..295271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0273"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31902"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW78"
FT                   /protein_id="ACA31902.1"
FT                   /translation="MKLMGVDNMKKFVFLVFFLLSGCSAIISLYPGYDKDVMHGERFWV
FT                   KKGTNEQVSEKTYVACFHKGLQFDLNQKGFTSYSPDWDEYNVALYQSKCLHDLGYAFKE
FT                   DIFSKYCYHYQNELNCKAYRKFKY"
FT   gene            295335..296903
FT                   /locus_tag="HSM_0274"
FT   CDS_pept        295335..296903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0274"
FT                   /product="adhesin HecA 20-residue repeat X2"
FT                   /note="KEGG: mfa:Mfla_0483 adhesin HecA 20-residue repeat
FT                   X2"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31903"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW79"
FT                   /protein_id="ACA31903.1"
FT                   /translation="MQSYFLNISGQMTVGYGFSASANFNQSKINADYASVQEQSGIYAG
FT                   DEGYQINIAQHTDLKGGLITSTENAETENRNQFSTGTFTYSDIQNHADYKGSSIGLSGS
FT                   MAINFDTPLGKYGQVQSNKQAVNDKGEKLYIDSQGRQTTTSRDSAGNANQAKLAKGLDS
FT                   LTGTTSFGFGYDKESQSSVTKSGINTQNLIIRDEQGQVEKTGKTVEQVKAEVKTNITTD
FT                   NAESRSGKLENKFDKEKVLKELNIQVKVTQEFRKNAFSTIDAYVLPKQAELREKIKAAQ
FT                   TEEEKDELYKEIYKLQYQKRLLETTVGIIAGTPEIAITQGTLQLAATKMREETLKNSRL
FT                   FKGIKDKKTGQILRNDSYSSGYFDGVKLGGVRIDVDVICNSGMGACSKNNDGSITFNGT
FT                   NDYTLKDAIDPTQNNKAKKLYGETGGFQAVEGGWYFNGEPIFKYKLGSISDLSVESFAG
FT                   THDMSGSQIWGWYDKLGNTAPKTPMQDTSSKATTIIAIPISAPFAVADLMSADFFEVLM
FT                   KIGGQ"
FT   gene            296905..297255
FT                   /locus_tag="HSM_0275"
FT   CDS_pept        296905..297255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0275"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31904"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW80"
FT                   /protein_id="ACA31904.1"
FT                   /translation="MKKAVLIFILFLLAGCSYHDGCFYSPQLVSCVDKGEVFPSISRYQ
FT                   KPYSLGRTDSNQRWKDVISCGGKYLDYDQRSVPFEKQEEFYYCMLGKGYIHLSPAKCGY
FT                   QNPKWDKGVCNF"
FT   gene            297372..297707
FT                   /locus_tag="HSM_0276"
FT   CDS_pept        297372..297707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0276"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31905"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW81"
FT                   /protein_id="ACA31905.1"
FT                   /translation="MKVFSIISVVFLIGCSFGGFKPPKLHYKWRFEDKNFETSYEYAVF
FT                   RGKEMRSCGMDPVLGESVKLKVNLCMEKKGWYLEQGPVCEEKYVWNEPECIKWRAKHSK
FT                   PDAKPWE"
FT   gene            complement(297852..297938)
FT                   /locus_tag="HSM_R0010"
FT                   /note="tRNA-Leu4"
FT   tRNA            complement(297852..297938)
FT                   /locus_tag="HSM_R0010"
FT                   /product="tRNA-Leu"
FT   gene            complement(297963..298036)
FT                   /locus_tag="HSM_R0011"
FT                   /note="tRNA-Cys1"
FT   tRNA            complement(297963..298036)
FT                   /locus_tag="HSM_R0011"
FT                   /product="tRNA-Cys"
FT   gene            complement(298048..298123)
FT                   /locus_tag="HSM_R0012"
FT                   /note="tRNA-Gly2"
FT   tRNA            complement(298048..298123)
FT                   /locus_tag="HSM_R0012"
FT                   /product="tRNA-Gly"
FT   gene            298438..299547
FT                   /locus_tag="HSM_0277"
FT   CDS_pept        298438..299547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0277"
FT                   /product="Cystathionine gamma-synthase"
FT                   /EC_number="2.5.1.48"
FT                   /note="PFAM: Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent protein; aromatic amino acid
FT                   beta-eliminating lyase/threonine aldolase; KEGG:
FT                   hso:HS_1345 cystathionine gamma-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31906"
FT                   /db_xref="GOA:B0UW82"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW82"
FT                   /protein_id="ACA31906.1"
FT                   /translation="MTQQYALDTLLAQAGNRTDERTGAVSTPIFLSTAYAHHGIGESTG
FT                   FDYTRTKNPTRTVLEETIAKLEGGDRGFACSSGMAAIQLLMNLFASPDEWIVSSDVYGG
FT                   TYRLLDFAHKNIHGVKPVYVNTASSEEIEKAITENTKAIFVETPSNPLMEECDVAEIAK
FT                   IAKKYNLLLIVDNTFLTPVLFRPMEHGADIVIHSGTKYIAGHNDTLVGLIVAKGQEICD
FT                   RLYYIQNGAGPVLSPFDSWLTIRGMKTLALRMERHQKNAQELANFLREQPQVKDVLYPN
FT                   KGGMLSFRLQNENWVNPFLKAMKLITFAESLGGTESFITYPATQTHMDIPEVERVARGV
FT                   CNRLLRFSVGLENVEDIKADLLQAFSQLK"
FT   gene            299712..300035
FT                   /locus_tag="HSM_0278"
FT   CDS_pept        299712..300035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0278"
FT                   /product="thioredoxin"
FT                   /note="TIGRFAM: thioredoxin; PFAM: Thioredoxin domain;
FT                   KEGG: hso:HS_1344 thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31907"
FT                   /db_xref="GOA:B0UW83"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW83"
FT                   /protein_id="ACA31907.1"
FT                   /translation="MSEVLHTTDATFDTDVLKSDIPVLLDFWAPWCGPCRMIGPILEEL
FT                   SAELGDKVKIVKINIDENQATPAQFGVRSIPTLIFFKEGKAVATQVGALPKNQLVNFIN
FT                   QNS"
FT   gene            complement(300153..300848)
FT                   /locus_tag="HSM_0279"
FT   CDS_pept        complement(300153..300848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0279"
FT                   /product="Chromosomal replication initiator DnaA"
FT                   /note="PFAM: Chromosomal replication initiator DnaA; KEGG:
FT                   hso:HS_1343 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31908"
FT                   /db_xref="GOA:B0UW84"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR017788"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW84"
FT                   /protein_id="ACA31908.1"
FT                   /translation="MSQQLPLPIHQIDDDTLENFCSDNNLLLLGSLRKNFIQLYQPFFY
FT                   IFGGKSTGKTHLLKACSNYFLASQRNAIYIPLSKAQYFSPEVLENLEQQELVCLDDFHA
FT                   IIGNHEWELAIFDLMNRIKESGSTLLLISANQSPVNLNISLPDLASRLSWGEIYQLNPL
FT                   NEQQKVEVIKRNAHQRGIELPDDTANFLLKRLDRDIKSLFDTLTLLDKASLQAQRKLTI
FT                   PFVKEILNL"
FT   gene            complement(300935..302176)
FT                   /locus_tag="HSM_0280"
FT   CDS_pept        complement(300935..302176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0280"
FT                   /product="uracil-xanthine permease"
FT                   /note="TIGRFAM: uracil-xanthine permease; PFAM:
FT                   Xanthine/uracil/vitamin C permease; KEGG: hso:HS_1342
FT                   uracil permease"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31910"
FT                   /db_xref="GOA:B0UW85"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR029935"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW85"
FT                   /protein_id="ACA31910.1"
FT                   /translation="MTNQNIPVEISGKIKQAFIGLQMLFVAFGALVLVPLITGLDANTA
FT                   LLTAGIGTLLFQLCTGKKVPIFLASSFAFIAPIQYGVASWGIPATMGGLACAGLVYVAL
FT                   SLLVKLRGAGALQKIFPPVVVGPVIIIIGLGLAPVAVDMATGKGSNYEYGDAVLVSMIT
FT                   LLTTLIVAVFAKGMMKLIPIMFGIAVGYILSLFMGLIDFSPIAKASWFSLPNLTTPEFK
FT                   LEAILYLLPIAIAPAVEHVGGIMAISSVTGKDFLKNPGLHRTLLGDGLATSAASLLGGP
FT                   PNTTYAEVTGAVMLTRNFNPTIMTWAAVWAIAISFCGKVGAFLSTIPTFVMGGIMMLVF
FT                   GSIAVVGMSTLIRGKVDVTEARNLCIISVVMTFGIGGMFVNLGELSLKGISLCAVVAII
FT                   LNLILPSAKNQIED"
FT   gene            complement(302278..302904)
FT                   /locus_tag="HSM_0281"
FT   CDS_pept        complement(302278..302904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0281"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /note="TIGRFAM: uracil phosphoribosyltransferase; PFAM:
FT                   phosphoribosyltransferase; KEGG: hso:HS_1341 uracil
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31911"
FT                   /db_xref="GOA:B0UW86"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UW86"
FT                   /protein_id="ACA31911.1"
FT                   /translation="MKIVEVKHPLVKHKLGLMRVADITTKDFRELATEVGSLLTYEATS
FT                   DLETEKVIIDGWCGAVEIDRIKGKKVTVVPILRAGLGMMDGVLEHVPSARISVVGMYRD
FT                   EETLEPVPYFQKLASDLDERLAIVVDPMLATGGSMIATINLLKAKGCQHIKVLVLVAAP
FT                   EGIKALEAVHPDVELYTASIDSHLNEHGYIIPGLGDAGDKIFGTK"
FT   gene            complement(303044..303871)
FT                   /locus_tag="HSM_0282"
FT   CDS_pept        complement(303044..303871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0282"
FT                   /product="glutamine amidotransferase class-II"
FT                   /note="PFAM: glutamine amidotransferase class-II; KEGG:
FT                   hso:HS_1340 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31912"
FT                   /db_xref="GOA:B0UW87"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR026869"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW87"
FT                   /protein_id="ACA31912.1"
FT                   /translation="MCQLLGMNCNTPTDIVFSFEGFRRRAGLTNCHSDGFGIAFFEGKG
FT                   IRVFRDNRPGHSSPIADCIKQYNIKSLNVVAHIRKATQGEVNIENTHPFIRELWGENWV
FT                   FAHNGNLNSLPDMTESLFQPIGSTDSETAFCYMLSQLKKRFPKKPNEQDMFSAIQKLTQ
FT                   ELTRRGTFNFILSNGEWMMAHCSTNLHYLTRKAPFGKAQRIDDDNIIDFRDYAKETDKV
FT                   TIITTFPLTKDEHWNKMESGGFVMFKEGDKVAEILGIESEIIDDGTLGMQQFA"
FT   gene            complement(304065..305414)
FT                   /locus_tag="HSM_0283"
FT   CDS_pept        complement(304065..305414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0283"
FT                   /product="Glutamate dehydrogenase (NADP(+))"
FT                   /EC_number="1.4.1.4"
FT                   /note="PFAM: Glu/Leu/Phe/Val dehydrogenase ;
FT                   Glu/Leu/Phe/Val dehydrogenase dimerisation region; KEGG:
FT                   hso:HS_1339 NADP-specific glutamate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31913"
FT                   /db_xref="GOA:B0UW88"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW88"
FT                   /protein_id="ACA31913.1"
FT                   /translation="MSAIVSLEDFLAKVEQRDGHQPEFLQAVREVFTSIWPFLEKNPKY
FT                   RSEALLERLVEPERAFQFRVAWTDDKGQVQVNRAFRVQFNSAIGPFKGGMRFHPSVNLS
FT                   ILKFLGFEQIFKNALTTLPMGGGKGGSDFDPKGKSDAEVMRFCQALMSELYRHVGADTD
FT                   VPAGDIGVGGREVGYLAGYMKKLSNQAACVFTGRGLSFGGSLIRPEATGYGLVYFAQAM
FT                   LAEKGQSFAGKTVVVSGSGNVAQYAIEKALQLGAKVVTCSDSSGYVYDPEGFTQEKLTA
FT                   LLDIKNVKRGRVKDYAEQFGLQYVEGARPWGVKADIALPCATQNELELSDAQQLIANGV
FT                   QLVAEGANMPTTIEATDAFLEAGVLFGPGKAANAGGVATSGLEMAQSSQRLYWTAEEVD
FT                   EKLHRIMLDIHANCKKYGTVEGQKNINYVVGANVAGFVKVADAMLAQGVY"
FT   gene            305820..306425
FT                   /locus_tag="HSM_0284"
FT   CDS_pept        305820..306425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0284"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hso:HS_1338 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31914"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW89"
FT                   /protein_id="ACA31914.1"
FT                   /translation="MKKALLTALVLGTSLTVTGCFDKDNNVSQQAESTKESVSTAIAET
FT                   KEAMSKQVTEVKETAAEKVEAAKEAMSEQVTEIKETAAEKVEAAKEAMSEQVTEIKEIA
FT                   AEKVEAAKEAMSEQVTEVKEMAAEKVEVAKEAMSEQVTEVKEMATEKVEAAKEAMSEQV
FT                   TEVKAMAAEKVEAAKEAMSEKVMEVKEMATEIKSAVEK"
FT   sig_peptide     305820..305879
FT                   /locus_tag="HSM_0284"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.940) with cleavage site probability 0.909 at
FT                   residue 20"
FT   gene            complement(307235..309025)
FT                   /locus_tag="HSM_0285"
FT   CDS_pept        complement(307235..309025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0285"
FT                   /product="Beta-glucuronidase"
FT                   /EC_number="3.2.1.31"
FT                   /note="PFAM: glycoside hydrolase family 2 immunoglobulin
FT                   domain protein beta-sandwich; glycoside hydrolase family 2
FT                   TIM barrel; glycoside hydrolase family 2 sugar binding;
FT                   KEGG: hso:HS_1330 beta-glucuronidase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31915"
FT                   /db_xref="GOA:B0UW90"
FT                   /db_xref="InterPro:IPR006101"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR023230"
FT                   /db_xref="InterPro:IPR023232"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW90"
FT                   /protein_id="ACA31915.1"
FT                   /translation="MLYPTLTKTRSLYDLSGLWQFKLGEHNPEKDLSPEEVMVVPTSFN
FT                   DVVVDKDKRNYIGDFWYERWVDIPKLAENDELVLRFGSVTHNAKIYVNGRELASHKGGF
FT                   TPFEVIIPEELYQENQIKISVCANNILDYTTLPVGNYIEETQEDGSIKKVVKENFDFFN
FT                   YAGIHRPVKLMVRPKIHISDVTIVSELSDDLKTAKLSIAVETSKAVDTIQVTILDEDRQ
FT                   VVAQSSNGHITLEQVRLWEVLDAYLYTAHIELLVDGKVVDTYDEPFGVRSVHVADGQFF
FT                   VNQKPVYFKGFGKHEDTFINGRGLNEAANLMDMNLLKEIGANSFRTSHYPYSEEMMRLA
FT                   DRMGVLVIDEIPAVGLFQNFTASLDLNPKDNGTWSAMKTREAHEQAIQELVKRDKNHPS
FT                   VVMWVVANEPASHEAGAHDYFKPLVALYKELDPQKRPVTLVNILLATPERDEVMDLVDV
FT                   ISLNRYYAWYVDHGDLAKGEAGLRQELLKWQSKFPDKPILMTEYGADTLPGLHSMWDIP
FT                   YTEEFQCDFYAMSHSVFDSIPNLVGEQVWNFADFETNLMIYRIQGNHKGLFSRNRQPKQ
FT                   VVKEFKKRWTAIPNYNYKKK"
FT   gene            complement(309047..310075)
FT                   /locus_tag="HSM_0286"
FT   CDS_pept        complement(309047..310075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0286"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: hso:HS_1329
FT                   2-keto-3-deoxygluconate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31916"
FT                   /db_xref="GOA:B0UW91"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW91"
FT                   /protein_id="ACA31916.1"
FT                   /translation="MKTVVSLGEILLRLSPPQYQTLTLTTSLECQFGGSELNVLSTLAQ
FT                   LGHNVSLISAIPDNDLGRMTKNFLFSRQINQDYILEKGQRLGIYYYQKGFSLRASRVTY
FT                   DRKHSAFWESQLSDYDLESVFKGADWFHVSGITPALNDNLYSLTHYLMTKAKAEGLTVS
FT                   FDLNFRASLWNSFQEARELLSPLAALADVCIGIEPLSLSGDGQGDLKDQLGLTRPYEDQ
FT                   ELLKSILDKLAKTYSVKSFAFTQREMGHTNEYLLKGYLYQDGHLYQTDKSGIQVLDRVG
FT                   TGDAFTAGIIHGMLKKESPEKSLAIAMASFKFKHTIEGDINVISQADIDQLLDETSHEI
FT                   KR"
FT   gene            310576..311874
FT                   /locus_tag="HSM_0287"
FT   CDS_pept        310576..311874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0287"
FT                   /product="Adenylosuccinate synthase"
FT                   /EC_number="6.3.4.4"
FT                   /note="PFAM: adenylosuccinate synthetase; KEGG: hso:HS_1328
FT                   adenylosuccinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31917"
FT                   /db_xref="GOA:B0UW92"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UW92"
FT                   /protein_id="ACA31917.1"
FT                   /translation="MGKSVVVLGAQWGDEGKGKIVDLLTDRVKYVVRYQGGHNAGHTLI
FT                   INGEKTVLRLIPSGILRENVTCLIGNGVVLSPTALMQEMGELESRGINVRERLLISEAC
FT                   PLILPYHVAMDKARESALGNKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKQSFAEKLK
FT                   NILDYYNFQLVNYYKVEAVDYQKTLDEVLAVADIITAMVADVTTILDVARKNGDNILFE
FT                   GAQGTMLDIDQGTYPYVTSSNTTAGGVSTGAGFGPRHIDYVLGIIKAYCTRVGGGPFTT
FT                   ELFDEVGAEIARKGNEFGAVTGRPRRCGWFDAVAIKRAIQTNSISGFCMTKLDVLDGFR
FT                   EVKICVGYKMPNGEIAEYAPLAAKDWEGVEPIYETLPGWQENTFGITDVNQLPENTRNY
FT                   IKRIEEVTGVPIAILSTGPDRVETMILNDPFAV"
FT   gene            complement(311940..313292)
FT                   /locus_tag="HSM_0288"
FT   CDS_pept        complement(311940..313292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0288"
FT                   /product="peptidase U62 modulator of DNA gyrase"
FT                   /note="PFAM: peptidase U62 modulator of DNA gyrase; KEGG:
FT                   hso:HS_1327 antibiotic maturation factor"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31918"
FT                   /db_xref="GOA:B0UW93"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW93"
FT                   /protein_id="ACA31918.1"
FT                   /translation="MITQQNSTALLKQQEQMLQDAVSYAIKTATQAGATAEVAVTKVNG
FT                   LSVSTRLQEIENVEFNNDGALGISVYLGNQKGNASTSDLSHTAIKSAVDSALAIAKYTS
FT                   PDDCAGLADKELMAFDAPDLALYHEFDIDVDHAVSLALQTEKAALDYDKRIVNSEGATF
FT                   NSHTGVRVYGNSHGMLQSYLSSRYSLSCSVIASSNEQLERDYEYTVARNIQELESAVWV
FT                   GENSAKKALSHLQPRKIPTQEVPVIFMNSVATGLIGHLATAISGGSLYRDSSFLLDHLG
FT                   KKILPDWFHISERPHLIGKLASTPFDSEGVRTKNLEIIEQGILQTYLLTSYSGRKLGMQ
FT                   STGHAGGIHNWLVKPNSQNLTALLQEMGTGLLVTDLMGQGVNIITGDYSRGAFGFWVEN
FT                   GEIQYPVSEITIAGQLKDMFANIIAVGNDIEYRSNIQTGSILLEKMKISGS"
FT   gene            313439..313972
FT                   /locus_tag="HSM_0289"
FT   CDS_pept        313439..313972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0289"
FT                   /product="protein of unknown function DUF615"
FT                   /note="PFAM: protein of unknown function DUF615; KEGG:
FT                   hso:HS_1326 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31919"
FT                   /db_xref="InterPro:IPR006839"
FT                   /db_xref="InterPro:IPR023153"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UW94"
FT                   /protein_id="ACA31919.1"
FT                   /translation="MAKCKEEVFNWEDEEQEEIIWVSKSEIKRDAEALKKLGEKLVNLT
FT                   KTNLDKIPLDTGLRDAVELAQRLQKEALRRQIQYIGKLLRAIDPEPIQEALNKIENKHQ
FT                   QQQAKLHKLELLRDELVQKGNSAFTELLIQYPHADRQHLHNLIRSAQKEREQNKPPKSY
FT                   REIFQYLKDLILED"
FT   gene            314103..315638
FT                   /locus_tag="HSM_0290"
FT   CDS_pept        314103..315638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0290"
FT                   /product="small GTP-binding protein"
FT                   /note="TIGRFAM: small GTP-binding protein; PFAM:
FT                   GTP-binding protein HSR1-related; Miro domain protein;
FT                   SMART: AAA ATPase; KEGG: hso:HS_1325 GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31921"
FT                   /db_xref="GOA:B0UW95"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW95"
FT                   /protein_id="ACA31921.1"
FT                   /translation="MTTPVVALVGRPNVGKSTLFNRLTRTRDALVADFPGLTRDRKYGQ
FT                   AHFNGYDFIVIDTGGIDGTEEGVEEKMAEQSLLAIEEADIVLFLVDARAGLTSADVGIA
FT                   QYLRKRQNKTTVLVANKTDGIDADSHCAEFYQLGLGEIEKIAASQGRGISALMEKVLPP
FT                   VADKLSLANAEEHSESAVENSDESAEEWEKDFNFNSEEDIQLLDEALVEEQEESEDKNI
FT                   KIAIVGRPNVGKSTLTNRILGEDRVVVYDLPGTTRDSIYIPMERDGQQYTLIDTAGVRK
FT                   RGKVHLTVEKFSVIKTLQAIQDANVILLTIDARQGISDQDLSLLGFILNTGRSLVIVVN
FT                   KWDGLNQDIKDQVKSELDRRLDFIDFARVHFISALHGSGVGNLFDSIKEAYACATKKMT
FT                   TSLLTRILQMATDEHQPPMIGGRRIKLKYAHPGGYNPPIIVVHGNQIEGLPDSYKRYLS
FT                   NYYRRSLKIIGSPIRLLFQEGNNPFAGRRNKLTPNQLRKRKRLMKFIKKSKQR"
FT   gene            315806..316615
FT                   /locus_tag="HSM_0291"
FT   CDS_pept        315806..316615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0291"
FT                   /product="ATP dependent DNA ligase"
FT                   /note="PFAM: ATP dependent DNA ligase; KEGG: hso:HS_1324
FT                   NAD-dependent DNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31922"
FT                   /db_xref="GOA:B0UW96"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016059"
FT                   /db_xref="InterPro:IPR029319"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW96"
FT                   /protein_id="ACA31922.1"
FT                   /translation="MRVSALFFMLFIIKVQATLPDFMLLENYKNQDVSGWVMSEKLDGI
FT                   RGYWDGKQLFTRQNKVIQPPHYFIRDFPPFAIDGELFTERNQFEKISSIVRSKKDKGWE
FT                   KMKLYVFDVPNAQGNLFERLAVLQDYLDKHPTPYIQIIEQIPIKTKQQVKNFLQQIEKQ
FT                   QGEGVVLRNPHATYERKRSTQILKLKTALDEECTVIAHHQGKGQFENMLGSISCQNHRG
FT                   IFKIGSGFNLIERRNPPPIGSIITYKYRGLTKNGLPRFATYWRSKKE"
FT   gene            316757..318133
FT                   /locus_tag="HSM_0292"
FT   CDS_pept        316757..318133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0292"
FT                   /product="peptidase U32"
FT                   /note="PFAM: peptidase U32; KEGG: hso:HS_1323 collagenase
FT                   PrtC"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31923"
FT                   /db_xref="GOA:B0UW97"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="InterPro:IPR032525"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW97"
FT                   /protein_id="ACA31923.1"
FT                   /translation="MTTQFKPELLSPAGSLKNMRYAFAYGADAVYAGQPRYSLRVRNNE
FT                   FNHANLKIGIDEAHALGKKFYVVVNIAPHNSKLRTFIKDLQPVIDMQPDALIMSDPGLI
FT                   MLVREHFPNIDIHLSVQANAVNWATVKFWKQLGLTRVILSRELSLEEIAEIRQQVPDIE
FT                   VEIFVHGALCMAYSGRCLLSGYINKRDPNQGTCTNACRWEYSVVEGKTDEVGNIVNVGE
FT                   EIPVKNVAPTLGEGNTTNKVFLLAENQRPEEQMSAFEDEHGTYIMNSKDLRAVQHVEKL
FT                   SQIGVHSLKIEGRTKSFYYCARTAQVYRKAIDDAVAGRPFDESLMDTLESLAHRGYTEG
FT                   FLRRHTHDEYQNYDYGYSISERQQFVGEFTGKRNEQGMAEVAVKNKFLLGDEVELMTPK
FT                   GNVVFTIERMLNRKNEHIDAALGDGHFVFLDVPQDIQLDYALLMRNLVNANTRNPHNKK
FT                   "
FT   gene            complement(318444..318632)
FT                   /locus_tag="HSM_0293"
FT   CDS_pept        complement(318444..318632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0293"
FT                   /product="Haemophilus-specific protein, uncharacterized"
FT                   /note="KEGG: hso:HS_1322 Haemophilus-specific protein,
FT                   uncharacterized"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31924"
FT                   /db_xref="InterPro:IPR041535"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW98"
FT                   /protein_id="ACA31924.1"
FT                   /translation="MQDDEKLTPEILTRREFHIKNALASFALEGEYPSKECEVLLKKYV
FT                   SGEIKTLDELRIRLFEK"
FT   gene            complement(318641..318913)
FT                   /locus_tag="HSM_0294"
FT   CDS_pept        complement(318641..318913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0294"
FT                   /product="Haemophilus-specific protein, uncharacterized"
FT                   /note="KEGG: hso:HS_1321 Haemophilus-specific protein,
FT                   uncharacterized"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31925"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW99"
FT                   /protein_id="ACA31925.1"
FT                   /translation="MVLWQIKVVIFKGFSNKTRGRIMATLMEKDSLINGISQTLGLIVA
FT                   QTGGRNEDSELLAGLRNKLYALKPEEIDYEELSKLVRKKFHKYKF"
FT   gene            318940..319335
FT                   /locus_tag="HSM_0295"
FT   CDS_pept        318940..319335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0295"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31926"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWA0"
FT                   /protein_id="ACA31926.1"
FT                   /translation="MIFCQEKIAFDHVKSGTINDSNYFVYYGKVASLEQHFQLQGKNYT
FT                   CYAFSNPPYPFVRPAIFDDELNFLEQALSNKNKIDKKKAFVFFKRYANQPICVGNFLQK
FT                   LSYLLYFRWGSHNIIGNFDFFCTGMAH"
FT   gene            319678..319806
FT                   /locus_tag="HSM_0296"
FT   CDS_pept        319678..319806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0296"
FT                   /product="Haemophilus-specific protein, uncharacterized"
FT                   /note="KEGG: hso:HS_1320 Haemophilus-specific protein,
FT                   uncharacterized"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31927"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWA1"
FT                   /protein_id="ACA31927.1"
FT                   /translation="MDGKFGTKTRNAAVSYLATKGISVTNDIALDRLFEYFEPNLQ"
FT   gene            320118..320258
FT                   /locus_tag="HSM_0297"
FT   CDS_pept        320118..320258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0297"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hso:HS_1319 C4-dicarboxylate transport system,
FT                   C4-dicarboxylate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31928"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWA2"
FT                   /protein_id="ACA31928.1"
FT                   /translation="MLKLIGKFYENCKKLQKTAKNCKKLQKTAKNCKKLQKTAKNCIAF
FT                   F"
FT   gene            320321..321193
FT                   /locus_tag="HSM_0298"
FT   CDS_pept        320321..321193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0298"
FT                   /product="TRAP dicarboxylate transporter-DctP subunit"
FT                   /note="PFAM: TRAP dicarboxylate transporter- DctP subunit;
FT                   KEGG: hso:HS_1319 C4-dicarboxylate transport system,
FT                   C4-dicarboxylate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31929"
FT                   /db_xref="GOA:B0UWA3"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWA3"
FT                   /protein_id="ACA31929.1"
FT                   /translation="MANDNVNHTLVIDFSDKLKEISNGKLTVDVYSNGILGDQVELFEG
FT                   MKLGTVDMSISDTSIIASYYSPIGILDMPYFFKDMEHIKKLLNTAKMAEIKKQVEAKSG
FT                   VKILSIQPVAYRNIILKKELADNNKFDGLKIRVPNSPVLVNTITSLGATPSPIPSGEAY
FT                   TAIQTGVVDGMEGNPEFLSSIKISEVAKNWYETQHAMTFTALNISAKKFNSLTESEQQW
FT                   IKEAVTFAIDQFYIKTVNTDEKWRSYLKQQGVEFHNVDIPTLREKAKPMVDKFVQANGL
FT                   EELYKEAQK"
FT   gene            321190..321642
FT                   /locus_tag="HSM_0299"
FT   CDS_pept        321190..321642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0299"
FT                   /product="Tripartite ATP-independent periplasmic
FT                   transporter DctQ component"
FT                   /note="PFAM: Tripartite ATP-independent periplasmic
FT                   transporter DctQ component; KEGG: hso:HS_1318
FT                   C4-dicarboxylate transport system, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31930"
FT                   /db_xref="GOA:B0UWA4"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWA4"
FT                   /protein_id="ACA31930.1"
FT                   /translation="MKLDGYISSFRNTLTIILFSALVIVVSIGVFSRFLTSHPFAWTEE
FT                   LSRFIFIWLAWIASSLTIAKGINITFDIVLDKLEQTVGSIAHIIVNVISVIYILAVIIL
FT                   GYILCINNTNSYSPLLGVPMWTLNLAIPVGGVLMVYEQIKNLIKKR"
FT   sig_peptide     321190..321303
FT                   /locus_tag="HSM_0299"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.703) with cleavage site probability 0.487 at
FT                   residue 38"
FT   gene            321660..322928
FT                   /locus_tag="HSM_0300"
FT   CDS_pept        321660..322928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0300"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctM
FT                   subunit; PFAM: Citrate transporter; TRAP C4-dicarboxylate
FT                   transport system permease DctM subunit; KEGG: hso:HS_1317
FT                   C4-dicarboxylate transport system, large subunit
FT                   (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31933"
FT                   /db_xref="GOA:B0UWA5"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWA5"
FT                   /protein_id="ACA31933.1"
FT                   /translation="MLLLAFLCFFILVLLGVPIAFSMGLGAIISILSNDLPLALISQRL
FT                   FSGINSFSLLAIPFFMLAGELMENGGISRRLIHLSKCLVGHFRGGLGMIDISTSVIFAG
FT                   VSGSAAADTAAVGSIMIPTMKKNGYPAGLTAVLQSVAGSLGPIIPPSLTAIIFASLTGL
FT                   SIKDLFLAGILPGIAIAIGLVLVTYFYAKKYNLGRDQKASRAILCKAFKEASSALFMPV
FT                   IIVGGILVGFFTPTEAGAVAVLYAIAVGIYYKELTFKKFKHSILNAAAMTAMCTLIISG
FT                   ATILSWIIAFTRLPDLIIGFLTSITDNPYMILLLLVAFLLFIGMFIETIAATIIVAPIL
FT                   MPVAYQYGIDPIQFAIIMIVVLVYAGVTPPVGGVLFITMGIANVKLQETLKYLVPYLGV
FT                   IFIVVLLMILFPSISLMIPNMFR"
FT   sig_peptide     321660..321728
FT                   /locus_tag="HSM_0300"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.840 at
FT                   residue 23"
FT   gene            323060..324130
FT                   /locus_tag="HSM_0301"
FT   CDS_pept        323060..324130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0301"
FT                   /product="S-adenosylmethionine--tRNA-ribosyltransferase-isomerase"
FT                   /note="TIGRFAM:
FT                   S-adenosylmethionine--tRNA-ribosyltransferase-isomerase;
FT                   PFAM: Queuosine biosynthesis protein; KEGG: hso:HS_1316
FT                   S-adenosylmethionine:tRNA ribosyltransferase-isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31934"
FT                   /db_xref="GOA:B0UWJ9"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UWJ9"
FT                   /protein_id="ACA31934.1"
FT                   /translation="MYLSDFYFDLPDELIARYPKRERSSSRMLQLNGQNGELFHRTFSD
FT                   VADLINEGDLLIFNNTRVIPARMFGRKASGGKIEVLVERVLNEHHFLAHIRSSKSPKEN
FT                   TVLFLGEDKLGEGKGVEMLMKARHENLFELELSDKSTALLDILQKIGHMPLPPYIDRPD
FT                   EDADKERYQTVYNKVPGAVAAPTAGLHFDDELLTQLKNKGVNFAFVTLHVGAGTFQPVR
FT                   VENIEDHKMHAEYVEVPQEVVDAVLATKAKGKRVIAVGTTSVRSIESAALFAEENNSTH
FT                   LLEPYFSDTSIFIYPGKKFRVIDCLITNFHLPESTLIMLVSAFAGYQHTMNAYKSAVEN
FT                   RYRFFSYGDAMFITKA"
FT   gene            324175..325311
FT                   /locus_tag="HSM_0302"
FT   CDS_pept        324175..325311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0302"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /EC_number="2.4.2.29"
FT                   /note="TIGRFAM: tRNA-guanine transglycosylase, various
FT                   specificities; queuine tRNA-ribosyltransferase; PFAM:
FT                   Queuine/other tRNA-ribosyltransferase; KEGG: hso:HS_1315
FT                   queuine tRNA-ribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31935"
FT                   /db_xref="GOA:B0UWK0"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWK0"
FT                   /protein_id="ACA31935.1"
FT                   /translation="MTMKFTLHKTNGMARRGTMTFNRPQGEFTVETPAFMPVGTYGTVK
FT                   GMTPEEVRATGAEILLGNTFHLWLRPGQEIMRQHGDLHDFMQWHRPILTDSGGFQVFSL
FT                   GKLRKITEEGVKFQNPINGERIFLSPEKSMEIQYDLGSDIVMIFDECTPYPATFDYAKK
FT                   SMEMSLRWAKRSRERFDELGNKNALFGIVQGSTFEDLRKLSIEGLINIGFDGYAVGGLA
FT                   VGEPKEDMHRILAYVCPQLPADKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNG
FT                   HLFVSNGIVKIRNAKYRNDTTSLDPECDCYTCKHYTKAYLYHLDKCGEILGARLNTIHN
FT                   LRYYQRLMAQIRQAIEEDRFEDFVVEFYKKIGKSVPAR"
FT   gene            325467..325766
FT                   /locus_tag="HSM_0303"
FT   CDS_pept        325467..325766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0303"
FT                   /product="preprotein translocase, YajC subunit"
FT                   /note="TIGRFAM: preprotein translocase, YajC subunit; PFAM:
FT                   YajC family protein; KEGG: hso:HS_1314 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31936"
FT                   /db_xref="GOA:B0UWK1"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWK1"
FT                   /protein_id="ACA31936.1"
FT                   /translation="MEAQQSSPLSMLFIFAIFGLIFYFMIYRPQAKRNKAHKQLMSELA
FT                   KGTEVLTSGGIIGKISKISAENDYVVIALNDTTEITIKRDFIVAVLPKGSLKSI"
FT   gene            325798..327648
FT                   /locus_tag="HSM_0304"
FT   CDS_pept        325798..327648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0304"
FT                   /product="protein-export membrane protein SecD"
FT                   /note="TIGRFAM: protein-export membrane protein, SecD/SecF
FT                   family; protein-export membrane protein SecD; PFAM:
FT                   SecD/SecF/SecDF export membrane protein; KEGG: hso:HS_1313
FT                   protein-export membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31937"
FT                   /db_xref="GOA:B0UWK2"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="InterPro:IPR027398"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWK2"
FT                   /protein_id="ACA31937.1"
FT                   /translation="MLNRYPLWKNLMVILVIAIGVLYSLPNLYGEDPAVQISGTRGQTA
FT                   DINVLTNVQTLLEQNNLPIKSIILENGSILARFNNTDDQLLAKDKIIEQLGNNYSVALN
FT                   LAPATPKWLTNIGGRPMKWGLDLRGGVRFLMEVDMHTALDKRQEQLQDSLRTELRKEKY
FT                   QYTSIRNGENFTTLITLAKPEQLSDVQRFLRKQHQNLNVNAISENTLSLELSENALREI
FT                   RDHAIEQNLSILRRRVEELGVAEPVIQRQGAERIVVELPGVQDTARAKEILGATATLEF
FT                   RLVNQNANLDVALKGMVPSDSEVKYDRNGSPIVLYRRAVLGGEHITNASSGIDQNTGSP
FT                   QVSVTLDSEGGEIMSQTTKLNLKKPMATLYVEYKDSGKKDEHGKTILAKHEEVINVATI
FT                   QGRFGSQFQITGINSPAEAQNLSVLLRSGALTAPIQIIEERTVGPSLGAQNVEQGLKAG
FT                   LWGLAITIIFILFYYKLFGLFAGIALIANMILLVGIMSLLPGATLTMPGIAGIVLSVGM
FT                   SVDANVLIFERIKEEINNGRTIQQAINEGYSGAFTSIFDANLTTILTSVVLYAVGTGPV
FT                   KGFAITLSLGVAISMFTAITGTRFLVNLIYGGKRVEKLSI"
FT   sig_peptide     325798..325890
FT                   /locus_tag="HSM_0304"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.814) with cleavage site probability 0.786 at
FT                   residue 31"
FT   gene            327661..328629
FT                   /locus_tag="HSM_0305"
FT   CDS_pept        327661..328629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0305"
FT                   /product="protein-export membrane protein SecF"
FT                   /note="TIGRFAM: protein-export membrane protein, SecD/SecF
FT                   family; protein-export membrane protein SecF; PFAM:
FT                   SecD/SecF/SecDF export membrane protein; KEGG: hso:HS_1312
FT                   protein-export membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31938"
FT                   /db_xref="GOA:B0UWK3"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWK3"
FT                   /protein_id="ACA31938.1"
FT                   /translation="MSLFTRNKKVHEYKGVILPFKLTPFMKYRYWGYAFSIIVTAVCFF
FT                   FIFTKGFNWGLDFTGGTVIDTHFSQPADLNKVRSTLKENGIESALVQTTGGVRDVMIRL
FT                   PVVESSAEVGNKIKTILNSLDEGLEIHSIEFVGPNVGEELTQGAIYATLATLLMLLGYI
FT                   AFRFEWRLGTGAVIALAHDVIVTLGVFSYFQIEMDLTFVAAILSVVGYSLNDSIVVFDR
FT                   VRENFRKIRRIDTVEIIDISLTQTLARTLMTSITTLFVVIALFAFGGPTIHSFSLALLI
FT                   GIAFGTYSTIYIAITLALDLGLKREHMLIQIVEKEEFEEGF"
FT   gene            complement(329100..329185)
FT                   /locus_tag="HSM_R0013"
FT                   /note="tRNA-Leu3"
FT   tRNA            complement(329100..329185)
FT                   /locus_tag="HSM_R0013"
FT                   /product="tRNA-Leu"
FT   gene            complement(329205..329549)
FT                   /locus_tag="HSM_0306"
FT   CDS_pept        complement(329205..329549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0306"
FT                   /product="preprotein translocase, SecG subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecG subunit; PFAM:
FT                   Preprotein translocase SecG subunit; KEGG: hso:HS_1311
FT                   protein-export membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31939"
FT                   /db_xref="GOA:B0UWK4"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWK4"
FT                   /protein_id="ACA31939.1"
FT                   /translation="MYQVLLIAYLVIAIVLIGFILIQQGKGANAGASFGGGASGTVFGS
FT                   AGAGNFLSRTTAILATAFFAISLLIGNINSHSNNVKSGKFDDLSKVAEQVQEKQQSIPT
FT                   PDTKNSDIPQ"
FT   gene            complement(329687..331585)
FT                   /locus_tag="HSM_0307"
FT   CDS_pept        complement(329687..331585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0307"
FT                   /product="DNA topoisomerase III"
FT                   /EC_number="5.99.1.2"
FT                   /note="KEGG: hso:HS_1310 DNA topoisomerase III; TIGRFAM:
FT                   DNA topoisomerase III; PFAM: TOPRIM domain protein; DNA
FT                   topoisomerase type IA central domain protein; SMART: DNA
FT                   topoisomerase I ATP-binding; DNA topoisomerase I
FT                   DNA-binding; Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31940"
FT                   /db_xref="GOA:B0UWK5"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005738"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR034144"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWK5"
FT                   /protein_id="ACA31940.1"
FT                   /translation="MRLFIAEKPSLARAIADVLPKPHQRGQGFVKCGEQDYVTWCVGHL
FT                   LEQAAPDVYNPMFKQWRLEHLPIIPQKWLLLPRQEVKSQLDIVLKLIHQADIIINAGDP
FT                   DREGQLLVDEVFSYAKLPATKLAEIQRCLINDLNPSAVEKAIKKLQPNKNFIPLATSAL
FT                   ARSRADWLYGINMTRAYTIRGRQSGYNGVLSVGRVQTPVLGLIVRRDLEIEHFQPKDFF
FT                   EVQAFIATKEKMPSTFTALWQPSKACEDYQDEEGRVLSNALAKNVVKRITAQPATVTEY
FT                   IDKREKETAPLPYSLSALQIDAAKRYAMSAQEVLDVCQKLYETHKLITYPRSDCRYLPE
FT                   EHFSARHTILRAISTHSILYKEIPDIVNTELKNRCWNDKKVEAHHAIIPTAKNKTVSLS
FT                   QNEQQIYDLIARQYLMQFCQEAEYRKSKITLDIAGGTFIAQARNLQIAGWKQLWGKEDE
FT                   DEQQEPLLPIVKKGDELFCEKGDVISKKTQPPKPFTDATLLSAMTGIARFVQNKELKKI
FT                   LRETDGLGTEATRAGIIELLFKRGFIYKKGRNIHSTETGRTLIQALPEIATQPDMTAHW
FT                   EAQLDSISRRQGSYQQFMQTLSELLPELLGYFNFSALRKLGLQTKENKKADLKKNE"
FT   gene            331711..332040
FT                   /locus_tag="HSM_0308"
FT   CDS_pept        331711..332040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0308"
FT                   /product="conserved hypothetical protein 103"
FT                   /note="PFAM: conserved hypothetical protein 103; KEGG:
FT                   hso:HS_1309 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31941"
FT                   /db_xref="GOA:B0UWK6"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UWK6"
FT                   /protein_id="ACA31941.1"
FT                   /translation="MFGKGGLGNLMKQAQQMQERMQKMQEEIAQLEVTGEAGAGLIKVT
FT                   INGAHNCRRIDIDPSLMEDDKEMLEDLIAAAFNDAVRRAEEMQKEKMASVTAGMSLPPG
FT                   FKMPF"
FT   gene            332103..332708
FT                   /locus_tag="HSM_0309"
FT   CDS_pept        332103..332708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0309"
FT                   /product="recombination protein RecR"
FT                   /note="TIGRFAM: recombination protein RecR; PFAM: RecR
FT                   protein; TOPRIM domain protein; SMART: Toprim sub domain
FT                   protein; KEGG: hso:HS_1308 recombination protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31942"
FT                   /db_xref="GOA:B0UWK7"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UWK7"
FT                   /protein_id="ACA31942.1"
FT                   /translation="MQSSPLLENLIEHLRCLPGVGPKSAQRMAYHLLQRDRSGGMNLAG
FT                   ALTEAMSKIGHCTHCRTFTEEESCAICNNPRRQNSGFLCVVEQPSDIPAIEQTGQFSGR
FT                   YFVLMGHLSPLDGIGPKEIGLDLLQKRLQHESFYEVILATNPTVEGEATANYIAEMCFQ
FT                   HNIKVSRIAHGIPVGGELETVDGTTLSHSLIGRREIQL"
FT   gene            complement(332756..333943)
FT                   /locus_tag="HSM_0310"
FT   CDS_pept        complement(332756..333943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0310"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /note="TIGRFAM: tyrosyl-tRNA synthetase; PFAM:
FT                   aminoacyl-tRNA synthetase class Ib; RNA-binding S4 domain
FT                   protein; KEGG: hso:HS_1307 tyrosyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31944"
FT                   /db_xref="GOA:B0UWK8"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024108"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWK8"
FT                   /protein_id="ACA31944.1"
FT                   /translation="MTNINTVIAELKRGVDHVFSEQDFIEKLKENRPLRIKLGADPTAP
FT                   DIHLGHTVVLNKLRQFQNFGHEVIFLIGDFTATVGDPSGKNTTRPPLSREDVLRNAETY
FT                   KTQIFKILDPQKTQVVFNSDWLGKLGTIGMIRLASNYTVARMLERDDFKKRFNNNQPIA
FT                   IHEFIYPLLQGHDSVHLEADVELGGTDQTFNLLMGRELQKSCGQKPQVAITMPLLVGLD
FT                   GEKKMSKSLGNYIGVTETPSNMFGKIMSISDELMWDWYNLLSFRPLTEITQLKKDVENG
FT                   RNPRDVKILLAKEIITRFHSADDADTAEQEFIDRFQKGAIPDDMPEFTFTGEIGLANLL
FT                   KDAGLVGSTSEAIRMVQQGGVKINGEKVDNAKLIVSPSTAVYQVGKRKFARVTIK"
FT   gene            complement(334135..336211)
FT                   /locus_tag="HSM_0311"
FT                   /note="iron-regulated outer membrane protein; contains
FT                   frameshift induced by phase variation"
FT   gene            complement(336349..338064)
FT                   /locus_tag="HSM_0313"
FT   CDS_pept        complement(336349..338064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0313"
FT                   /product="prolyl-tRNA synthetase"
FT                   /note="TIGRFAM: prolyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (G H P and S); Anticodon-binding domain
FT                   protein; YbaK/prolyl-tRNA synthetase associated region;
FT                   KEGG: hso:HS_1305 prolyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31945"
FT                   /db_xref="GOA:B0UWK9"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UWK9"
FT                   /protein_id="ACA31945.1"
FT                   /translation="MRTSKYLLSTLKETPNDAQVVSHQLMLRAGMIRPLASGLYNWLPT
FT                   GLRVLKKVENIVREEMNKSGAIEVEMPVVQPAELWQESQRWEQYGPELLRFVDRGNRDF
FT                   VLGPTHEEVITDLVHREVSSYKQLPLNLYQIQTKFRDEVRPRFGVMRGREFLMKDAYSF
FT                   HTSKECLQNTYDVMYRTYNNIFTRLGLDFRAVQADTGSIGGSASHEFQVLAKSGEDDIV
FT                   FSSNSDYAANIELAEAVAIGQRQAPSATMELVDTPNAKTINDLVEQFNLSVEKTVKTLI
FT                   VKGANEDQPLIALIVRGDHELNEVKAQKLPEVADPLEFANEDEIKTKIGAGIGSLGPVN
FT                   LPIPAIIDRSVALMSDFSTGANIDGKHYFNVNWDRDVALPKVADLRNVVEGDPSPDGKG
FT                   TLQIKRGIEVGHIFQLGTKYSEAMKATVQGEDGRPQTMIMGCYGIGVSRVVAATIEQCH
FT                   DEKGIIWSSDEIAPFTVAIIPMNMYKSKNVQIFAEELYQSLLNKNVDVIFDDRKERPGV
FT                   MFADIELIGVPHMIVIGEKNLEKGEIEYKNRRTGEKQIIAKEQVLDFLAQRVNA"
FT   gene            complement(338166..338630)
FT                   /locus_tag="HSM_0314"
FT   CDS_pept        complement(338166..338630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0314"
FT                   /product="regulatory protein RecX"
FT                   /note="PFAM: regulatory protein RecX; KEGG: hso:HS_1304
FT                   regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31946"
FT                   /db_xref="GOA:B0UWL0"
FT                   /db_xref="InterPro:IPR003783"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWL0"
FT                   /protein_id="ACA31946.1"
FT                   /translation="MSSLALSYVIGLLARREYSEFELRCKMQEKRFTEQEITQTLTHCQ
FT                   QKNWQNDKRFAENYLYYRAKRGYGLQRIRQELYQLKGIPAELINEIEQESEIDWNEIVL
FT                   QVLNKKFPYYRDKLDSRAKQKIWRYMLSHGFSHNDFANYVATGKDNYSLD"
FT   gene            complement(338739..339806)
FT                   /locus_tag="HSM_0315"
FT   CDS_pept        complement(338739..339806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0315"
FT                   /product="recA protein"
FT                   /EC_number="3.6.3.8"
FT                   /note="KEGG: hso:HS_1303 recombination protein; TIGRFAM:
FT                   recA protein; PFAM: RecA domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31947"
FT                   /db_xref="GOA:B0UWL1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UWL1"
FT                   /protein_id="ACA31947.1"
FT                   /translation="MATPEEKAKALEAALGQIEKQFGKGAIMKLGETQKLDIEAISTGS
FT                   LSLDVALGIGGLPMGRIVEIFGPESSGKTTLTLSVIAQAQKAGKTCAFIDAEHALDPIY
FT                   AAKLGVDVKELLISQPDNGEQALEICDALVRSGAVDVVIVDSVAALTPKAEIEGEMGDT
FT                   HVGLQARLMSQALRKLTGQIKNSNCLVVFINQIRMKIGVVFGNPETTTGGNALKFYASV
FT                   RLDIRRVGSIKNGDEVIGNETRVKVVKNKVAPPFRQVDFQILYGEGISRNGELIELGVK
FT                   HKLVNKSGAWFSYEGEKIGQGKTNAMKWLAEHPEQAAILEQKLRSELLANPEKALLADL
FT                   EAESESNISEVESDF"
FT   gene            complement(339930..341849)
FT                   /locus_tag="HSM_0316"
FT   CDS_pept        complement(339930..341849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0316"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: hso:HS_1302 ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31948"
FT                   /db_xref="GOA:B0UWL2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWL2"
FT                   /protein_id="ACA31948.1"
FT                   /translation="MILFTNLTLKRGNTLLLENTCATINPGQKVGLVGKNGCGKSSLFA
FT                   LLKKEMSAEEGDITFPNHWAMAWVNQETPALEISALDYVIKGDREYCKLQKALATATEN
FT                   NHGNDIARIHAQLDTIDAWTIQARAASLLHGLGFSQEDLTRTVKSFSGGWRMRLNLAQA
FT                   LLCRSDLLLLDEPTNHLDLDAVIWLERWLIQYQGTLILISHDRDFLDPIVNKIIHIEQH
FT                   KLHEYSVNYSSFEVQRATKLAQQTALYRQQQQKINHLQKYIDRFKAKATKAKQAQSRVK
FT                   ALERMELIAPAYVDNPFTFKFREPLALPNPLVSIEKASAGYDNGESTVEILQKIKLNLV
FT                   PGSRIGLLGKNGAGKSTLIKLLAGELTALSGHVQLAKGVKLGYFAQHQLDTLRSEENAL
FT                   WHMQKIAPQQTEQQLRDYLGSFAFHGDKVTQAVSSFSGGEKARLVLAIIVWQRPNLLLL
FT                   DEPTNHLDLDMRQALTEALIDYQGSLVVVSHDRHLLRNTVEEFYLVHDKQVEEFTGDLE
FT                   DYQKWLNEINSTPKHNEKIINNNENTGNHRKEQKRKEAELRQRSAPLRKEIADIERKMQ
FT                   IYQQKLQEIELLLSDTVLYQTENKAKLTALLNEQVQLKKALEDIEISWFTMQEALENLI
FT                   NNIE"
FT   gene            complement(342092..342724)
FT                   /locus_tag="HSM_0317"
FT   CDS_pept        complement(342092..342724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0317"
FT                   /product="peptidylprolyl isomerase FKBP-type"
FT                   /note="PFAM: FKBP-type peptidyl-prolyl isomerase domain
FT                   protein; peptidylprolyl isomerase FKBP-type; KEGG:
FT                   hso:HS_1301 FKBP-type peptidyl-prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31949"
FT                   /db_xref="GOA:B0UWL3"
FT                   /db_xref="InterPro:IPR000774"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR036944"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWL3"
FT                   /protein_id="ACA31949.1"
FT                   /translation="MTKQFFAQVALDDVSAQGSYGIGLQIGQQLVDSKLAVKAEAVAKG
FT                   IYDALNQNPPALELNEVAKALQELQQQASEIAQAQFKQIEEEGKKYLEENAKKDSVKVT
FT                   DSGLQYEVLVEGSGAIPTRQDQVRVHYTGTLIDGTVFDSSVKRGQPAEFPVSGVIAGWI
FT                   EALSMMPLGSKWKLTIPHHLAYGERGAGASIPPFSTLVFEVELLDIL"
FT   gene            complement(342751..343635)
FT                   /locus_tag="HSM_0318"
FT   CDS_pept        complement(342751..343635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0318"
FT                   /product="phosphatidylserine decarboxylase"
FT                   /EC_number="4.1.1.65"
FT                   /note="TIGRFAM: phosphatidylserine decarboxylase; PFAM:
FT                   phosphatidylserine decarboxylase-related; KEGG: hso:HS_1300
FT                   phosphatidylserine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31950"
FT                   /db_xref="GOA:B0UWL4"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033177"
FT                   /db_xref="InterPro:IPR033178"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UWL4"
FT                   /protein_id="ACA31950.1"
FT                   /translation="MYNAEKKQPTYWQRLKIAFQYVMPQLYLTLAAGWLAKQKWGSVTH
FT                   FIIKLFAKKYHVNMQEAEKTEFKDYASFNEFFIRPLKSEARKIDENPTALCLPADGRIS
FT                   QCGHIEQQTLLQAKGHSFSLVDLLAGDTELAKEFEHGEFATIYLSPRDYHRVHMPCDAT
FT                   LRKMIYVPGDLFSVNPFLNEHIPNLLARNERVICVFDTEFGTMVQILVGATITASMSTV
FT                   WAGIINPPRSTEVKEWTYSDESAVQLRKGQEMGAFQLGSTVINLFQADKVELANHLDVG
FT                   VPVRVGEVLAYKK"
FT   gene            343932..344819
FT                   /locus_tag="HSM_0319"
FT   CDS_pept        343932..344819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0319"
FT                   /product="tyrosine recombinase XerC"
FT                   /note="TIGRFAM: tyrosine recombinase XerC; PFAM: phage
FT                   integrase family protein; phage integrase domain protein
FT                   SAM domain protein; KEGG: hso:HS_1299 tyrosine recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31951"
FT                   /db_xref="GOA:B0UWL5"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011931"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UWL5"
FT                   /protein_id="ACA31951.1"
FT                   /translation="MHILLQKYYNYLRIERQLSPYTLINYQRQLEKIVVILQQNDIHSW
FT                   QQVTPSVVRFVLAQSRKEGLHERSLALRLSALRQFLNYLVVQGELKVNSAVGISAPKQS
FT                   KYLPKNMDMEQVQQLLTNESKEPIDLRDKAMMELMYSSGLRLSELQSLNLNSINIRSRE
FT                   VRVIGKGNKERILPFGRYASQAIQQWLKVRLLFNPKDEALFVSQLGNRISHRSIQKRME
FT                   TWGIRQGLNGHLNPHKLRHSFATHMLENSSDLRAVQELLGHSNLSTTQIYTHLDFQHLA
FT                   QVYDKAHPRAKRKK"
FT   gene            complement(344868..345236)
FT                   /locus_tag="HSM_0320"
FT   CDS_pept        complement(344868..345236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0320"
FT                   /product="dihydroneopterin aldolase"
FT                   /note="TIGRFAM: dihydroneopterin aldolase; KEGG:
FT                   hso:HS_1298 dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31953"
FT                   /db_xref="GOA:B0UWL6"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWL6"
FT                   /protein_id="ACA31953.1"
FT                   /translation="MTDKIFIEGLTALAQIGVYDWEQQIKQKLIFDIEMAWDCRRAAQT
FT                   DDVKYCLNYAEVSEFILNYVQSRPFLLIERVAYEVAEQLRVKFNISWVKIKLSKPKAIA
FT                   QANNVGIVVEQGNLSNCA"
FT   gene            345332..345913
FT                   /locus_tag="HSM_0321"
FT   CDS_pept        345332..345913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0321"
FT                   /product="protein of unknown function DUF205"
FT                   /note="PFAM: protein of unknown function DUF205; KEGG:
FT                   hso:HS_1297 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31954"
FT                   /db_xref="GOA:B0UWL7"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWL7"
FT                   /protein_id="ACA31954.1"
FT                   /translation="MMSLFAIIYMLFTYLLGSISSDVVICRFTERNDARVTNSNVLQKG
FT                   GYRLVLAVFLCDVLKGMLPVWVGYYLGLTYFELGMVALAACLGHIFPIFFKFSGGKGVA
FT                   TAFGAIAPIAWGVAGSMLGTWLLIFLFSGYVALSTVVTALILPFYVWWFKPEFTFPVAL
FT                   VCCLLVYRHHENIQRLWRGQEDKIWSKFKK"
FT   gene            complement(345930..346640)
FT                   /locus_tag="HSM_0322"
FT   CDS_pept        complement(345930..346640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0322"
FT                   /product="methyltransferase small"
FT                   /note="PFAM: methyltransferase small; KEGG: hso:HS_1296
FT                   possible SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31955"
FT                   /db_xref="GOA:B0UWL8"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR022882"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UWL8"
FT                   /protein_id="ACA31955.1"
FT                   /translation="MAKKQEFTFKQFHINQDQCAMKVGTDGILLGAWANINQANTLLDL
FT                   GTGTGLIALMLAQRSPEHCQISAVELDQLAYLQAKDNIQQSPWANKIKIFQQDIIVFAQ
FT                   DCEHKFDVITANPPYFKQGVDCASKQRNLARYTLTQSHLDWLNAAEKLLNLTGEIHLIL
FT                   PFEEGKSLQKKCGLFCIRECKIITKAGKTPQRLLLSFSREERKCEESQLVIYDRNNQYS
FT                   TEFKTLTQDFYLNF"
FT   gene            346723..348057
FT                   /locus_tag="HSM_0323"
FT   CDS_pept        346723..348057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0323"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; SMART: DEAD-like helicases; KEGG:
FT                   hso:HS_1295 ATP-dependent RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31956"
FT                   /db_xref="GOA:B0UWL9"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028621"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWL9"
FT                   /protein_id="ACA31956.1"
FT                   /translation="MWINMTSTQFEDFDLAPQLLKALAQKGYSRPTVIQLDAIPAIMEA
FT                   RDVLGSAPTGTGKTAAFLLPALQHLLDYPRRKPGPPRILVLTPTRELAMQVAEQAEELA
FT                   QFTHLSIATITGGVAYQNHGEVFNKNQDIVVATPGRLLQYIKEENFDCRAVEILIFDEA
FT                   DRMLQMGFGQYAEEIAAETRWRRQTLLFSATLEGELLMDFASRLLKDPVQFNAEPSRRE
FT                   RKKINQWYYHADSNEHKIKLLARFIENEQVSRGIVFVRRRENVRELSEILRKRGIRSTY
FT                   LEGEMAQTQRTKAIDKLKNDVVTVLVATDVAARGIDIDDVSHVMNFDLPYNADTYLHRV
FT                   GRTARAGKKGTAVSFVEAHDYKLLGKIKRYTGELLKPRIIEGLEPRTNPPKDGEIKTVS
FT                   KKQKNRAKTKLEENKKAVQKKKQKLRHKDIKNIGKRRKPSAKVAE"
FT   gene            complement(348094..348927)
FT                   /locus_tag="HSM_0324"
FT   CDS_pept        complement(348094..348927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0324"
FT                   /product="glycine cleavage T protein (aminomethyl
FT                   transferase)"
FT                   /note="PFAM: glycine cleavage T protein (aminomethyl
FT                   transferase); KEGG: hso:HS_1294 conserved hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31957"
FT                   /db_xref="GOA:B0UWM0"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWM0"
FT                   /protein_id="ACA31957.1"
FT                   /translation="MLINLKQYGLIYVEGVDAEKFLQGQLTCDVTKLAIGQSTLTAHCD
FT                   PKGKVNSLFRLIRHAEQQFYLLIRQDLLNHGLAQLKKYAVFSQVTFSEKNWTIVGMLDQ
FT                   DLKECGAISPQIRIDLGNRQILCWEQKMSLEYTQDTQYWDYLDMQQGFPILTIIGQGEF
FT                   IPQALNLQEIEQAISFQKGCYIGQETIARAKYRGINKRAMYLLQAKTAALVEIGTEIEM
FT                   QLEHAWRKTGCILSAVNLNGILYLQVVMSNQLEENQRFRLPVDESELEILPLSYQ"
FT   gene            complement(348936..349799)
FT                   /locus_tag="HSM_0325"
FT   CDS_pept        complement(348936..349799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0325"
FT                   /product="YicC domain protein"
FT                   /note="PFAM: YicC domain protein; domain of unknown
FT                   function DUF1732; KEGG: hso:HS_1293 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31958"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWM1"
FT                   /protein_id="ACA31958.1"
FT                   /translation="MIYSMTAFARVEIKKEWGDAVWEIRSVNQRYLETFFRLPEQFRGL
FT                   ENTLREKLRQKLARGKIECSLRIDTKKQTALNLNLNQKFAKQVIQSLQYIKAQAGEGEI
FT                   NLMDILRYPGVVETPEQDLDSIIEDLLQAFDDLLVEFIATRAREGEKVQKLIEQRLMAI
FT                   SVEAQKVRSFMPEILQWQRDRLQQRFDEIQLQADTQRIEQEMVLLAQRIDIAEELDRLQ
FT                   LHVKETYAILHKGGAVGRKLDFMMQELNRESNTLASKSINADITSSAVELKVLIEQMRE
FT                   QIQNLE"
FT   gene            349920..350636
FT                   /locus_tag="HSM_0326"
FT   CDS_pept        349920..350636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0326"
FT                   /product="ribonuclease PH"
FT                   /EC_number="2.7.7.56"
FT                   /note="TIGRFAM: ribonuclease PH; PFAM: 3' exoribonuclease;
FT                   KEGG: hso:HS_1292 ribonuclease PH"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31959"
FT                   /db_xref="GOA:B0UWM2"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UWM2"
FT                   /protein_id="ACA31959.1"
FT                   /translation="MRPNARAINQPRPIKITRHYTKHAEGSVLVEFGETKVICTATVED
FT                   SVPRFLKGQGKGWVTAEYGMLPRSTHSRMQREAAKGKQGGRTMEIQRLIARSLRAMVDL
FT                   EALGERAITLDCDVIQADGGTRTASITGACVALIDAINFLLQNGTLTTNPIKGLVAAIS
FT                   VGIVNGETVCDLEYVEDSIAETDMNVVMMEDGRMIEVQGTAEGEPFSHAELLTLLDLAK
FT                   QGCEQLFVAQRVALAE"
FT   gene            350729..351598
FT                   /locus_tag="HSM_0327"
FT   CDS_pept        350729..351598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0327"
FT                   /product="heat shock protein DnaJ domain protein"
FT                   /note="PFAM: heat shock protein DnaJ domain protein; KEGG:
FT                   hso:HS_1291 DnaJ-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31960"
FT                   /db_xref="GOA:B0UWM3"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR023749"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWM3"
FT                   /protein_id="ACA31960.1"
FT                   /translation="MNFLGKIIGFIFGWRFGGFFGAVVGLILGHLADKKLYELGSVNSS
FT                   FFKNKLTRQSLFMQTTFAVLGHLTKAKGRVTEDDIALATSLMQQLNLDDAGRRLAQEAF
FT                   NRGKQTDFPLRQVIREFRLGCGQRADLLRIFLSIQVKAAFMDNELQGAEKSVLQIVAEE
FT                   LGLSRFQFEQILAMELAARHFSRGGFYQQSRTYQQGSYHQYQEQGQYQNSYHQSGPTLD
FT                   DAYKVLGVSGNDNQQTVKRAYRRLMNENHPDKLVSKGLPPEMLEMAKEKAQQIQAAYDL
FT                   ICKSKGWK"
FT   gene            351603..352532
FT                   /locus_tag="HSM_0328"
FT   CDS_pept        351603..352532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0328"
FT                   /product="dihydrouridine synthase DuS"
FT                   /note="PFAM: dihydrouridine synthase DuS; KEGG: hso:HS_1290
FT                   tRNA-dihydrouridine synthase C"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31961"
FT                   /db_xref="GOA:B0UWM4"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR032886"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="InterPro:IPR042270"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWM4"
FT                   /protein_id="ACA31961.1"
FT                   /translation="MRVFLAPMQGVLDPFVRQLLTEVNQYDLCISEFVRVVDQRLPNKV
FT                   FYRLCPELHHQGFTLSGTPVRVQLLGQYPQWLAENAQRAVELGSQGIDLNCGCPSKAVN
FT                   GSNGGASLLKQPELIYQATKAIRQAVPMEQPVSVKVRLGWDNVDQVFEIADAVQQGGAT
FT                   EITIHGRTKSDGYRADRINWYKIAEVRKKLRIPVIANGEIWHWQDGQNCLAITGCQDLM
FT                   IGRGALNIPNLSYVIKFNAEKLDWQQGVMPMLHKYAHVENEFDKGFYHIARIKQWLQYL
FT                   KKEYPQAGTLFERIKSCQSAAELRHKIQ"
FT   gene            complement(352579..353145)
FT                   /locus_tag="HSM_0329"
FT   CDS_pept        complement(352579..353145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0329"
FT                   /product="translation elongation factor P"
FT                   /note="TIGRFAM: translation elongation factor P; PFAM:
FT                   Elongation factor P/YeiP protein; Elongation factor KOW
FT                   domain protein; Elongation factor P; KEGG: hso:HS_1289
FT                   elongation factor P"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31962"
FT                   /db_xref="GOA:B0UWM5"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UWM5"
FT                   /protein_id="ACA31962.1"
FT                   /translation="MATYTTSDFKPGLKFMQDGEPCVIIENEFVKPGKGQAFTRTRIRK
FT                   LISGKVLDVNFKSGTSVEAADVMDLNLTYSYKDEAFWYFMHPETFEQYSADAKAVGDAE
FT                   KWLLDQADCIVTLWNGAPITITPPNFVELEVVETDPGLKGDTAGTGGKPATLSTGAVVK
FT                   VPLFVQIGEVIKVDTRSGEYVSRVK"
FT   gene            353181..354194
FT                   /locus_tag="HSM_0330"
FT   CDS_pept        353181..354194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0330"
FT                   /product="lysine 2,3-aminomutase YodO family protein"
FT                   /EC_number="5.4.3.2"
FT                   /note="TIGRFAM: lysine 2,3-aminomutase YodO family protein;
FT                   PFAM: Radical SAM domain protein; KEGG: hso:HS_1288
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31964"
FT                   /db_xref="GOA:B0UWM6"
FT                   /db_xref="InterPro:IPR003739"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022462"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWM6"
FT                   /protein_id="ACA31964.1"
FT                   /translation="MRILTQNSINREEENWTDYLAKAISDPIELLNCLELPIESFQYDI
FT                   AARQLFPLRVPFPFVKKMEKGNPNDPLFLQVMASQHEFLPMAGFTKDPLEEQHNSVPNI
FT                   LHKYHNRLLLIVKNSCAVNCRYCFRRHFPYAENKGNKQSWVKSLDYIAAHAEIEEVIFS
FT                   GGDPLMAKDHELAWLIKELENIPHLHTLRIHTRLPVVIPQRITDELCRILSESRFQKVI
FT                   VTHINHPNEIDEILACAMKKLKHANVTLLNQSVVLKNINDNAHILKKLSDKLFSIGILP
FT                   YYLHLLDKVEGASHFYLDDESAAAIYKELQRISSGYLVPKLAREIAHEPNKTLYSA"
FT   gene            354288..355451
FT                   /locus_tag="HSM_0331"
FT   CDS_pept        354288..355451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0331"
FT                   /product="Opacity-associated protein A"
FT                   /note="PFAM: Opacity-associated protein A; KEGG:
FT                   hso:HS_1287 opacity associated protein A"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31965"
FT                   /db_xref="GOA:B0UWM7"
FT                   /db_xref="InterPro:IPR007340"
FT                   /db_xref="InterPro:IPR013731"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWM7"
FT                   /protein_id="ACA31965.1"
FT                   /translation="MTAEQNKIDTSGQASIQKELELDLDPMEPILPKKNLAPKQTLLEK
FT                   AKRIFKRADKQNRVDKAEVSTHKEVISASDDEQRPIITETQEQQISQAIDPTISEVPVK
FT                   TQKELKKPENWTMLGVLPPKYRRIFIALLVVVIILLIISWLKPDDNIEQYFEQSTGNSI
FT                   PTQFQPLDHSQPVEPSILEQLKNPQPKSENITQNDQEKNIPVQALQVENEPQNIAIPIN
FT                   STPSKADSPVVETSKRPSIKVEEATSQPIAPMEEVKIVEKNEPNKKAEKQVKAEQKGVP
FT                   VVDAKPANVNKVTNSQKTALQKNAQTKTLVIPQGTSLMQVFRNNNLNIADVNAMTKARG
FT                   VGNTLSSFKAGDKVQVSLNKQGRVNELRLSNGARFIRQADGSYQFKK"
FT   gene            complement(355519..356424)
FT                   /locus_tag="HSM_0332"
FT   CDS_pept        complement(355519..356424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0332"
FT                   /product="putative exonuclease RdgC"
FT                   /note="PFAM: putative exonuclease RdgC; KEGG: hso:HS_1286
FT                   recombination associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31966"
FT                   /db_xref="GOA:B0UWM8"
FT                   /db_xref="InterPro:IPR007476"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWM8"
FT                   /protein_id="ACA31966.1"
FT                   /translation="MFWFKNALIYRLTKSLDWSVENLQSQLQQCAYSPCQQSDMSRFGW
FT                   HNPLRESESLYFCVGKQLLLVAHKEEKILPAQVIKRELEERIEQLEQKENRKLKKIEKQ
FT                   ALKDDIVATLLPRAFSKNQHTALWIDTENNLIYIDTASTKRAEDCLALLRKSLGSLPVV
FT                   PLAFANEPSLVMTNWVKENSPQWLTVLEEAELKGSQDQAVIRCKQQVLDSEEMIGLLNS
FT                   GKYITNLSLNWEEHLSFTLNEDASLKRLKFADQIREQNDDISKEDFAQRFDADFVLMTG
FT                   ILAKLTENLLDEFGGEKERL"
FT   gene            356487..357302
FT                   /locus_tag="HSM_0333"
FT   CDS_pept        356487..357302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0333"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="TIGRFAM: pyrroline-5-carboxylate reductase; PFAM:
FT                   NADP oxidoreductase coenzyme F420-dependent; NAD-dependent
FT                   glycerol-3-phosphate dehydrogenase domain protein; KEGG:
FT                   hso:HS_1285 pyrroline-5-carboxylate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31967"
FT                   /db_xref="GOA:B0UWM9"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWM9"
FT                   /protein_id="ACA31967.1"
FT                   /translation="MQHKLISFIGGGNMAQAIVLGLLKQGYPAHYIRVCDPNQSRRDLF
FT                   IAQGTQVSSNNVEAIQDADVVLLAVKPQIMAEVCVPLSAVDFSDKLVISIAAGISTVRL
FT                   TALLPSAKNIIRVMPNTPALVSAGMAGLFATPQVSVNLKQFAQDLLSAMGEICWLEQEQ
FT                   DMHAVTAGSGSSPAYFFLFMEAMQQALIEMNLDPKTARLLVQQSALGAAKMVIENPQIA
FT                   LSELREDVTSKGGTTASALAVFNEQNVTQIIKQAMLACVKRSQEMESLF"
FT   gene            357303..358502
FT                   /locus_tag="HSM_0334"
FT   CDS_pept        357303..358502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0334"
FT                   /product="Chloramphenicol O-acetyltransferase"
FT                   /EC_number="2.3.1.28"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   hso:HS_1284 3-phenylpropionic acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31968"
FT                   /db_xref="GOA:B0UWN0"
FT                   /db_xref="InterPro:IPR024989"
FT                   /db_xref="InterPro:IPR026032"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWN0"
FT                   /protein_id="ACA31968.1"
FT                   /translation="MRVSPFSWIAICLFGYFFAYGVFVPYFPVWLKSQSYNETTIGLIL
FT                   AGAYFFRALGGIWVSSLVKRPSQLISGLRYLAWATCVLMFVAGFMAPHFWLLCILIGLF
FT                   SMASSGGLPLMDTLSTTWQQQQGLDYGKARMIGSIAFAAGVVIFGYVIEMINATNIVWM
FT                   LTALLFVYAIGQMAIPTYPPLDHIESTQQENNETEKTDFSFIQLLKNKVTLRLLIAISL
FT                   IHGSHAAYYSYSVLYWQEELHIPLQVIGGLWALSIVAEIVLFFFSSKWFRHWKVSTLFY
FT                   LSALGAVVRWGGLSFADNLGIVIFIQLLHSITFATSHYAIIRYISTQPHQAMAKLQGLY
FT                   NSFSACIAVGLLAGLSSLIYPISPFYTFLTMMLIAALAIPIIPRNINAFRQSIITRVKS
FT                   "
FT   gene            358499..359392
FT                   /locus_tag="HSM_0335"
FT   CDS_pept        358499..359392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0335"
FT                   /product="tyrosine recombinase XerD"
FT                   /note="TIGRFAM: tyrosine recombinase XerD; PFAM: phage
FT                   integrase family protein; phage integrase domain protein
FT                   SAM domain protein; KEGG: hso:HS_1283 tyrosine recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31969"
FT                   /db_xref="GOA:B0UWN1"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011932"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWN1"
FT                   /protein_id="ACA31969.1"
FT                   /translation="MKDNALIDLFLNELWLEKGLSENTVQSYRLDLTALSQWLEPQGLS
FT                   LETLDVVDLQTFLGERLTQGYKATSTARMLSALRKLFQYLYREKYRSDDPSAVLSSPKL
FT                   PSRLPKYLTEQQVTDLLNTPNTEIPLELRDKAMLEMLYATGLRVTELVSLSLDSININQ
FT                   GVVRVIGKGKKERIVPMGEEANYWLRQFILYGRSFLLAGQSSDVVFPSRRGTQMTRQTF
FT                   WHRVKYYAILAEIDTSALSPHVLRHAFATHLVNHGADLRVVQMLLGHSDLSTTQIYTHV
FT                   AKERLKILHERFHPRG"
FT   gene            359502..360248
FT                   /locus_tag="HSM_0336"
FT   CDS_pept        359502..360248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0336"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hso:HS_0337 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31970"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWN2"
FT                   /protein_id="ACA31970.1"
FT                   /translation="MKYKLSLAILSILPALSHAGGGNFNFYGKAGIDLTSRFETMVLRT
FT                   EQNNYVPSIPASSRQNTFSPSIFFETTYTILPQTEIGLGLGYIKRKGFDHSASWHFNKD
FT                   IQKKTWAQTSGFTDIEQYRIYRYSSLPIYLILKQNYAFNANSKFYLKGNIGYSINKMPN
FT                   TKYAHYSNETSLKIQQTQIGDPIYKMKAKNGLYLGLGIGIEYKSFLAEIGYYHTHATVS
FT                   YKNKNTQYPQYSYNNDAIRLTLGVKF"
FT   sig_peptide     359502..359561
FT                   /locus_tag="HSM_0336"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 20"
FT   gene            360404..361150
FT                   /locus_tag="HSM_0337"
FT   CDS_pept        360404..361150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0337"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hso:HS_0337 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31971"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWN3"
FT                   /protein_id="ACA31971.1"
FT                   /translation="MKYKLSLVLLSILPALSHAGGGNFNFYGKAGIDLTSRFETMQLRT
FT                   YLNNDVPSIPASSRQNTFSPSIFFETTYTILPQTEIGLGLGYIKRKGFDHSASWHVHTD
FT                   GEWVIRADNTAVEYYKINRYSSLPIYFTLKQNYAFNANSKFYLKGDIGYSINKIADTKY
FT                   KKYTDITNKFELQGENLRKMKARNGLYLGLAIGLEYKSFLAEIGYYHTHAAVNYKTKPY
FT                   KSKAEGYYAWHSYNNDAIRLTLGFKF"
FT   sig_peptide     360404..360463
FT                   /locus_tag="HSM_0337"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 20"
FT   gene            complement(361328..368587)
FT                   /locus_tag="HSM_0338"
FT   CDS_pept        complement(361328..368587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0338"
FT                   /product="YadA domain protein"
FT                   /note="PFAM: YadA domain protein; Hep_Hag repeat-containing
FT                   protein; KEGG: hso:HS_0790 possible large adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31972"
FT                   /db_xref="GOA:B0UWN4"
FT                   /db_xref="InterPro:IPR005594"
FT                   /db_xref="InterPro:IPR008640"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR024973"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWN4"
FT                   /protein_id="ACA31972.1"
FT                   /translation="MNKIFKTKYDVTTGQCKAVSELASNRQIASSSGEKPKCGGFFGGV
FT                   LGAFKVLPLALAMSGVSSVAYGADVWIDNNTSSEYGKSNYNTSIWYDGADKNIKEKHQE
FT                   LILLADKSNKAGAESSIENQHAKYAVIIGSRAVGGGIGATSIGYKAIVGENTKDKNIDN
FT                   ANAQGTAVGYRTFARGAGATSLGNDTVAWGDSSIAIGSDGIGNADAKQKKLPKDIFRLF
FT                   LDNAQNFNYTEEYPAVDFRFLLGINGVGKNEYVNGKGELVGKDGNALVLNGDYFVRDDG
FT                   KTWSSYYLIKNDNGEEVFYKKNGHLYDKVTERDEIEKIKKKDDYLRKQEYDSKVNVAYE
FT                   KYLDKDSRNKIEKEKNLNGVKYDNRKTHTWARGKNAIAVGARSIAYGDYTTAIGTFAIA
FT                   FKDYSTAIGSDTIAFGKESLVLGNKSYVYADRTVGVGTNVQAINDGAMVYGSDSYAGGR
FT                   GSLAIGNYALANIEMDDNFNNDGLQNNNGFTLTDKKNSYGTKFDFEELYEKGNTADIQT
FT                   YSRLIKPKTTKQEGTEELKAKQSRDSLGYNQGGIAIGSYSVALGDNTLTIGRYAYAKED
FT                   SAIAIGRFSFAKGKDAFAIGSFTRAIGQASIALGNNTYSGKQYSVAIGYKAQSQAEKGI
FT                   ALGIEAGVGRDATGALALGNEAEANLSNSVALGYKSTTNYFYDNKADASDKFTPKLSGE
FT                   PASKLDAYKAAGSTYEIKNDASYGVISVGGWKVSEGTNTEAVGLRRIINVAPGALDSDV
FT                   ATVGQLKTLEYVKKEGLVVYYTVDNNNKIVKLMKASDDGEFYRVDTRNGEPLKKLGKID
FT                   KNKVFVGAKGFDEKTQTFADGKTTADIGETIKFGHLADGEISATSDQAITGAQLNSAKE
FT                   ALGLEYQKDSQTKFKKHDFTAVNYVEAGDKGSQDTFKAALTETIAAINSGYKFSDGTPD
FT                   HPNKDTPFYLGSTIEIVNGDIESNSKTKYVGKNLETKFEQGKTNNSVAKFTIGLKDDPE
FT                   FKSVTITEAPTNDNHAVNFLQLKNFATNVLGAEVDNGKFTFKKSQFNKFKNGTEQNGQI
FT                   LKEEKTFKAAIEANIDKINKGFIFGSGDGDTEKGTHYLGDKLIIKAGAVDKPTTTQEGG
FT                   YVPDNIKTAYLKDSKQLLIGIKESPTFKNVLIENDIPEDEPANPKKNTYDNYAVNKKYL
FT                   DKRLEKVAANFTVKGDNSKDNKEVYTLDKEHNELTIAGDSKNIDTKVDKNKQTVSITLK
FT                   DALTGIKSVANGDDVKISLNNGTNGSGKSIVFTAGNSGKTVTLTEDKFSGVSEISSKDS
FT                   QSKLTLNADKATVELAHGKSKLELKENEATITAGTDAGSLKITSNGKKQIELSPESGAT
FT                   LTFTKSNSDKVKISGVASGLGDTTANNVATNIENVLTGSSIDTIQSNAINVKDLSDVAK
FT                   AIIGKGLTFAGNSGTANVALGETITIKGDGTDVDIMATASATEKALTLTLNKETTFNPD
FT                   SDKVVTSKAVAEELKKYTQRDTLVGDLEEYYLEIDGANVKDKAIFGSNIGIDKINLKED
FT                   ETEGTSELVQAKALVDYLKGTGDKSVKLSDSAKTQAIGTGSISIGHNAVSQNEGAIALG
FT                   YNSSAKNKGAISIGQDSDVLGRSSISVGRENKVNGSFSFVFGDENQIGFDSSETYVIGS
FT                   NNEVNGRKNILLGSHIKADEEINNAIVLGDRSIAVNNALSVGNATNRRRIVFVGDPKHD
FT                   FDAANKKYVDERGYKYVADSIPTNDDKDKIIKLGSTISIVKLAGTSNGATTPPQPSTST
FT                   INIGDYKGDNLITQYSYESGNAKIEIGFKDSPIFKSVSLSENQNYDRNTLTEDSKKELI
FT                   TKGYLEQALSSFKFNVANGDGKTYQIGRDDTLKFTNGQNITLALEKKEGATQPSANNGG
FT                   NSVGGGSDASNTASSATASSMATASTASSTSEPSNTTAVITIGTKEDLENIKSIKGLKD
FT                   LDDKSTGDMATNKNYVDEQVKALNNNRPFDFYLNGQKVVKDASGKFKKLKDGKPDQELS
FT                   GDEAKQVVIKAEPTSTPIGISNIASGLGIDADKAKEQAENVKKAGEAVKTEAQAVAKKV
FT                   DDMLTLQTAKEAKQDAIDALETALSFMPETTPEEKAAKEKAKAKIEGEKSTLADINSKL
FT                   DKAKKEVESAQGILKAKQDAYQTALATKDDAVNKFLSDDSSIDVKRAANLQDVKALGQA
FT                   GLNFEGNDGVLVHKNLGEKLTIKGEGEFNSATTAAGNIKVDASETGLEVKLSDKLKNMT
FT                   SFETKETAEGNKSRLDGNGLRVTHKDGKSAQYGVDGVRLTVGKHSATLTPSGLTLTNPQ
FT                   GQRIEIDGVKGEIRVPDLTPNSSPNAVVNKGYVDALQTHTDKKFNQLENRFDAFSKESR
FT                   AGIAGSNAAAALPTISIPGKSVLSVSAGTYKGQSAVALGYSRVSDNGKVLLKLHGNSNS
FT                   VGDFGGGVGIGWAW"
FT   gene            complement(369103..369891)
FT                   /locus_tag="HSM_0339"
FT   CDS_pept        complement(369103..369891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0339"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hso:HS_1184 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31973"
FT                   /db_xref="InterPro:IPR021729"
FT                   /db_xref="InterPro:IPR037126"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWN5"
FT                   /protein_id="ACA31973.1"
FT                   /translation="MKKIFLFFSLMTTVLLAACQEQDVPTLQVKKNVIFDQVKTVNYPH
FT                   SDEYTTDNAQIEVRGELSETGIKWLDQLLLKHAYTLVGGEDSMKKDTPTKQDLVQKFQQ
FT                   IHDEFVQSAKEDRVLGASFHLTSNYLGQRNNIITFSNDIDTYTGGAHGINVTLFQNIDS
FT                   HKKKILELNDIVKQDQQSKLKEVLWNFYTNLMEEANDDYIGMITKEDFNISEQFYFNNE
FT                   GINFVYPPYALRAYAYGNVVLTAYWHEIEDIINPEYNWKK"
FT   sig_peptide     complement(369826..369891)
FT                   /locus_tag="HSM_0339"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.615 at
FT                   residue 22"
FT   gene            370048..370764
FT                   /locus_tag="HSM_0340"
FT   CDS_pept        370048..370764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0340"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: Abortive infection protein; KEGG: hso:HS_1183
FT                   possible permease"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31975"
FT                   /db_xref="GOA:B0UWN6"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWN6"
FT                   /protein_id="ACA31975.1"
FT                   /translation="MKQTTQSMNIVDMLIVTVIFFGMPIYISLSQFFLLQEGAVAITDT
FT                   LTFTDQDNIWAILIELISLAIAAVYLKLRRFDFTQLTFSFNAKAIVLTAGIILIAGSLS
FT                   ELYFYLAAPFQDAGAYLTSAEVAPTDTTSTLSFYLVLFSLLNGFFEEVFFLGLIFAVNK
FT                   KALPYAIVFSLVIRFLFHTYQGMFYAVNVLLFGIVLLILRSKIKNLLPFTLAHAFFDVF
FT                   GLGLLPIIDIVEKIIK"
FT   gene            complement(370807..372219)
FT                   /locus_tag="HSM_0341"
FT   CDS_pept        complement(370807..372219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0341"
FT                   /product="membrane protein involved in aromatic hydrocarbon
FT                   degradation"
FT                   /note="PFAM: membrane protein involved in aromatic
FT                   hydrocarbon degradation; KEGG: hso:HS_1548 outer membrane
FT                   protein P1"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31976"
FT                   /db_xref="InterPro:IPR005017"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWN7"
FT                   /protein_id="ACA31976.1"
FT                   /translation="MNSNKQSLFTKSFIASALALSASYVNAAAFQIAEVSSSGLGRAYA
FT                   GEAAIADNAAVVATNPALMSLFKTKQFSMGGVYVQSRININGEVKVNAGLFHGIETGKG
FT                   DQKNIVPSAVIPNMYFVAPINDKFAVGAGMNVNFGLQSKYKKDYDAGVLGGTTALNSIN
FT                   LNLSGSYRISKGLSIGAGLNAVYAKAKIERHAGILKEALGTVKQISTPGGQPGGFIIRL
FT                   DPSSQQLLAALAQIKVNSDTSIIQLQDNNAWGFGWNIGAVYEFNQGNRIGIAYHSKVDI
FT                   NFKDDDALSYQLKPRRISPVKEKGGLTLHLPDYFEISGFHQLTEKFAMHYSYKYTKWSR
FT                   LQSLHATYDNGKVAFHKDEKFHDSSRVALGATYNVNDKLTLRAGIAYDESADHPSASIP
FT                   DTDRTWYSLGATYNFTPNLSVDVGFAHLRGKKQQFSETQNIGKEIKLVNISADYQSTAR
FT                   ANLYGLNLNYRF"
FT   sig_peptide     complement(372136..372219)
FT                   /locus_tag="HSM_0341"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 28"
FT   gene            372565..373293
FT                   /locus_tag="HSM_0342"
FT   CDS_pept        372565..373293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0342"
FT                   /product="molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein"
FT                   /note="TIGRFAM: molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein; PFAM: extracellular
FT                   solute-binding protein family 1; KEGG: hso:HS_1182
FT                   molybdenum ABC transporter, periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31977"
FT                   /db_xref="GOA:B0UWN8"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWN8"
FT                   /protein_id="ACA31977.1"
FT                   /translation="MICFSVSLVAQAKITVFAAASMVNVLEEIKSEYIKVNPQQEIDFS
FT                   FASSSVLARQISQGAPAQLFISADQKWMDFLAEKGAIVTESRRDLVGNRLVMIAPQNSL
FT                   ITSVDLPNAQWHSHLNNTYLAVGDPEHVPAGKYAKAAFIFLGQWNDLETKLARANNVRA
FT                   ALALVERGESPLGVVYATDAAASKKVKIVAIFPENTHPAIEYPIAIVNGQDNEESRKFL
FT                   AYLRSESAVKIFQQFGFSVK"
FT   gene            373299..374009
FT                   /locus_tag="HSM_0343"
FT   CDS_pept        373299..374009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0343"
FT                   /product="molybdate ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: molybdate ABC transporter, inner membrane
FT                   subunit; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: hso:HS_1181 molybdenum ABC
FT                   transporter, permease"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31978"
FT                   /db_xref="GOA:B0UWN9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWN9"
FT                   /protein_id="ACA31978.1"
FT                   /translation="MLDVMIDYLRLSQSEINAISLSVRVALVSISVSLPFAIAVAWLLA
FT                   RKDFWGKSIINGLIHLPLVLPPVVIGYLLLIAMGRNGIIGRYLLQWFDFSFGFSWYGAA
FT                   LASGIVAFPLQVRAIRLAIENIDFRLEQAAQTLGASSLRIFFTITLPLSLPGILSGMIL
FT                   GFARSLGEFGATITFVSNIPQVTQTIPLAMFSFIETPGAEYSAFRLCVIAIIIALISLS
FT                   ISEWLAKRMQQKLG"
FT   gene            374110..377070
FT                   /locus_tag="HSM_0344"
FT   CDS_pept        374110..377070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0344"
FT                   /product="(Glutamate--ammonia-ligase) adenylyltransferase"
FT                   /EC_number="2.7.7.42"
FT                   /note="PFAM: glutamate-ammonia ligase adenylyltransferase;
FT                   KEGG: hso:HS_1218 glutamate-ammonia-ligase
FT                   adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31979"
FT                   /db_xref="GOA:B0UWP0"
FT                   /db_xref="InterPro:IPR005190"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="InterPro:IPR023057"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWP0"
FT                   /protein_id="ACA31979.1"
FT                   /translation="MSLFLCAEERLVQCATSLIEQFPEQYNTTLFQQIQKDKHNQKTQL
FT                   GQLGYGLCLSDFVFETLQKQPHFLKQCWHQLPTLADCDRYFVRLQEILINTETEEQLYR
FT                   KLRLFRHREMAKLSLCQSLNLATVDEIFIRLSQLAESLIIAARDWLYEKICTELGTPTD
FT                   TQGNPQQLYILGMGKLGGCELNFSSDVDLIFTYPTNQGETRGGRRSIENGVFFTRLGQR
FT                   LIRALDEYTVDGFVYRTDMRLRPFGESGALALSFNAMEQYYQDQGRDWERYAMIKARIL
FT                   GANMQDPNVKILQQLLRSFVYRRYIDFSVIQSLRDMKNKIAGEVRRRGLLDNIKLGAGG
FT                   IREIEFIVQVFQLIRGGREIILQQPSLLHLLPALEKLGLIDTEQSTNLYHAYLFLRRVE
FT                   NILQAIDDKQTQTLPSADIDRERLLLATKNFTYFPISTENAGKETALAQYPIENWQQFL
FT                   QVLHEHQQKVRFVFRNLIGEDDDEEEKNIADDLWHDFLNADINEQEIKVILQENQIDEQ
FT                   YFDEIIEKLTQFKLDLSRRSVGERGRRVLTQLMPMLFRQVFRYKNSQQLLPRVLKILDK
FT                   IITRTTYLELLVENPQALTQLLKLCAQSKMIAEQVAKYPILLDELLDPNALLNPTDFHQ
FT                   YSSELRRYLLRLPADDEEQIINGLRQFKQTALLRVAAADILGALPVMNVSDHLTYLAEA
FT                   IIENVVNLAWQQVSLRFGTPEYLKENQKGFLVIGYGKLGGIELGYKSDLDLVFLYDGSQ
FT                   TGQTIGGKKSIDSNQFYLKLVQKIISIFSMNTSAGILYDIDIRLRPAGDSGLLGCSLNA
FT                   FENYQLNEAWTWEKQALVRCRAVYGDIDLCERFEKIRCNVLSAPRNVEQLKQDIREMRQ
FT                   KMYHHLSKHKTDEFNIKTDLGGITDIEFIAQYLVLAYAPQHSALTRWSDNVRIFDCMAE
FT                   SAVISQEVSTKLKKCYVNLRNQIHHLNLLGQEPIINAQLFSKERTFILNTWKSLLE"
FT   gene            377185..377850
FT                   /locus_tag="HSM_0345"
FT   CDS_pept        377185..377850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0345"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hso:HS_1217 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31980"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWP1"
FT                   /protein_id="ACA31980.1"
FT                   /translation="MKLNKSLLVGTLVASTVLLAACNEKNKAETTPTEPVTVAETQAQP
FT                   DVQGKTETTSSESTAVENTQPESQEKVVSEKSETAEQEILNQFNNTVTIQLVGYQSEKI
FT                   EGEDTLSFVYNVKNKGDKAIKELQWYNLIFFDSTLVEPLSIAYSFEDTLAPEGEGEIKL
FT                   TKLAKTYAEEIRADILKPEANLQFSPIIAGRIIFEDGTQLVVTTDEELTQSLQQILTQ"
FT   sig_peptide     377185..377247
FT                   /locus_tag="HSM_0345"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.719 at
FT                   residue 21"
FT   gene            complement(378185..382837)
FT                   /locus_tag="HSM_0346"
FT   CDS_pept        complement(378185..382837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0346"
FT                   /product="YadA domain protein"
FT                   /note="PFAM: YadA domain protein; Haemagluttinin domain
FT                   protein; Hep_Hag repeat-containing protein; KEGG:
FT                   hso:HS_0209 possible large adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31981"
FT                   /db_xref="GOA:B0UWP2"
FT                   /db_xref="InterPro:IPR005594"
FT                   /db_xref="InterPro:IPR008635"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR024973"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWP2"
FT                   /protein_id="ACA31981.1"
FT                   /translation="MNKIFKTKYDVTTGQTKVVSELAKNCQVASRSENKPKCGGISGNF
FT                   LGLFKLLPLAFLLTGSFVYGQDINIVLSGFTADEAKIGPDTILNDKGGNNKVPFISKVG
FT                   DKSIILAPGSKSLIFKRKRDWKNAGGQITIDTDNWMRIRETVIIGHRARSNGNKAVAIG
FT                   EQAFANKEAVSLGSEAIAYGSHTVALGMQSYAEQTDDISLGHRAYAKGSQSTALGAHSS
FT                   VESQKAVAIGYNARVDSQHSDAIALGAESEADSPSGNGTFMITKDDKTEAKEKTWISEK
FT                   FANQFKDKLGGALSIGKKDTKYRQIVNVAPGTEDTHAVNLGQLREAMKNAGGGGVSYFS
FT                   VNKLKAETNKNNDGAKAEHSLAIGVAETEMSKGMYSIVIGTANDDGTNTGSGNSQFTKS
FT                   SGKAAVAIGSIATVEADYGIALGKMAKIHTSATAAIALGKGAEAKVAGAVAIGEGAKVE
FT                   TAAGDSIALGKNSVAATKKLAPTGTTQNVGKDDVKISWNNAGAGQMKSVVSMGNKNAER
FT                   LITHVAAGEVTDRSTDAINGGQLYNVIHTFGHLGISILGAKKADSDGDGFKMPTFAKLK
FT                   DASGSDSNSKTPSTFKDAIDKNIAKLNEGLKFKGDTNGSGGSNSEQQLYLGSTLNIKGA
FT                   KGDASSPATSAGQNGAPNTHQNIFTKTSKDTLEIALNKDLKGISTISGSNGSAVAKIEF
FT                   TNGSGSPTSPTVKITADSGTFTFGKDGLDLGNKQITKLGSGLGVNSNGGSSGTSNIENV
FT                   LNGNLGSNGSNIFNNAVNVKDLSDIAKALVEKGLKFAVEDGSTTQPSAQNGKTPVTRKL
FT                   GETLTFKGDSYLTLATENGSGGSNVGKITFKLNVANSIDTNGQSMGGSGSTTDPNGDKL
FT                   VTVSAVKNYLKTQLDSLTLKIEADNSNTAQAQPQPQPPQPTGTPSASGNPQGAVKLRSQ
FT                   ALQVLGTKDEIETKVEQGKQNVTLKLAKKVTDKLGIIQLSDKDDDSSFALGKNSKLETK
FT                   KNALESAEFGVGKNSLKFSWKDAGTSKNGQWNSVVSVGNTGAERIITHVAAGSVMPGST
FT                   DAINGGQLYGVIEVFGKLGTDILGAEVDDKTKTFKQSTFAKLKDKDGKDDTVKAATTFK
FT                   EAIDKNIETINKGLIFEVDAGSTTTSTDQAGSTTANKMTRQLGATIKLKGDDYIKPSID
FT                   ANTGTISFKIEATEDIKEDADTEDKKLTTAGAVKKFVKNKIQTIADKQAEADKVAVKYD
FT                   SEAKNTITLGGKDTNGSTSHPPVAINNLKSGLGLDNGTQDQPMGQDKTLELVKKLVAEG
FT                   MNGQQGQQMTKDELHKAANLADLKAVAQAGLSFAGNESGKDKTVHRKLSDTLIIKGEEE
FT                   TQNGQTTSSFSSAAGNIKVETNKTNDGLEIKLSDTLKNMKAFETKEESGKKSTLNSDGL
FT                   TVTDKIGTATATYGAKGLTVKGVGGEIKIDGKQGIITVPDIKPTTTGSAVVNKNYVDGR
FT                   NNELRTQLNNTDRNLRAGIAGANAAAGLTSVSMPGKSMLAISAAGYGGENAMAIGYSRM
FT                   SDNGKIMLKFQGNRNSQGKMAGSVSIGYQW"
FT   gene            383421..384755
FT                   /locus_tag="HSM_0347"
FT   CDS_pept        383421..384755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0347"
FT                   /product="exodeoxyribonuclease VII, large subunit"
FT                   /EC_number="3.1.11.6"
FT                   /note="TIGRFAM: exodeoxyribonuclease VII, large subunit;
FT                   PFAM: Exonuclease VII large subunit; nucleic acid binding
FT                   OB-fold tRNA/helicase-type; KEGG: hso:HS_1216
FT                   exodeoxyribonuclease VII, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31982"
FT                   /db_xref="GOA:B0UWP3"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWP3"
FT                   /protein_id="ACA31982.1"
FT                   /translation="MTQAKIYSVSQLNQSVRQMLEGQLGSVWLTGEISNFTQPVSGHWY
FT                   FSLKDENAQVRCAMFRMKNMRVGFKAQNGMQVLVRASVSLYEPRGDYQLIIESMNLAGD
FT                   GLLQRQFEALKLTLAAEGLFAQHYKKNLPHFAKSVGIITSPTGAALQDILHILQRRDPS
FT                   LHVVIYPTAVQGKEATAEIVQMIELANQRREVDVLIVGRGGGSLEDLWCFNEERVARAI
FT                   FHSELPIISAVGHEIDVTIADFVADVRAPTPSAAAELVSRHQQELLDQLFYRKQRLEMA
FT                   LDRFFQQKVKLLQRLQFRLQQQHPQSQLNIQQKMMQQLLHRLHLALSTFVDKKQQKMTA
FT                   LCRRLDNSPLPYYVQKQHQILVQLELRLNSGLQKKFKNADYQLSRLCGKLDSLSPLKVL
FT                   ARGYSITKNQQGQALKNSLQIEVGQLISTQLERGIIVSRVEAMEE"
FT   gene            complement(384808..385542)
FT                   /locus_tag="HSM_0348"
FT   CDS_pept        complement(384808..385542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0348"
FT                   /product="alanine racemase domain protein"
FT                   /note="PFAM: alanine racemase domain protein; KEGG:
FT                   hso:HS_1215 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31983"
FT                   /db_xref="GOA:B0UWP4"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWP4"
FT                   /protein_id="ACA31983.1"
FT                   /translation="MPISNQLQQVLLIMMQIKNNLAKINRQISQYCEQAKRHSSTVSLL
FT                   AVSKTKPVEDILIAYQAGQTAFGENYVQEGVEKIQYFIEQHIQLEWHFIGPLQSNKTKL
FT                   VAENFDWMQTLDREKIATRLNEQRPHYKQPLNVLIQINISAENSKSGIQPQEMLILAKH
FT                   IQNLPHLRLRGLMAIPEPTDNITAQEQAFNQMKYLFTQLQLAFPDEKIDTLSMGMSDDM
FT                   ASAIKCGSTMVRIGTAIFGKRN"
FT   gene            385832..388282
FT                   /locus_tag="HSM_0349"
FT   CDS_pept        385832..388282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0349"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /EC_number="1.1.1.3"
FT                   /note="TIGRFAM: aspartate kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase; homoserine
FT                   dehydrogenase; amino acid-binding ACT domain protein;
FT                   homoserine dehydrogenase NAD-binding; KEGG: hso:HS_1214
FT                   aspartate kinase/homoserine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31984"
FT                   /db_xref="GOA:B0UWP5"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR011147"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWP5"
FT                   /protein_id="ACA31984.1"
FT                   /translation="MRVLKFGGTSLANPQRFLQAAALIEKAHLEEQAAGVLSAPAKITN
FT                   HLVALSEKAALNQPTDGHFDEAIEIFYNIINGLYAENTHFDLVGTKALIESEFAQIKGL
FT                   LENIRQAGKVEDAVKATIDCRGEKLSIAMMNAWFEAKGYTVTVINPVEKLLAYGSYLES
FT                   SVDIAESTKRVDAKSIPAKNIVLMAGFTAGNDKGELVLLGRNGSDYSAACLAACLGASV
FT                   CEIWTDVDGVYTCDPRLVPDARLLSSLSYREAMELSYFGAKVIHPRTIGPLVEPQIPCL
FT                   IKNTGNPEGAGSIIDNRENISEGLQVKGITNLDNVAMFNVSGPGMQGMVGMAARVFSAM
FT                   SKASVSVILITQSSSEYSISFCVPTKAIEKAKAALNAEFEQELVAKDLDPVEVIHDLSI
FT                   ISVVGDGMERSKGIAASFFSALASANISIVAIAQGSSERSISAVVPLNKAIEAVKATHQ
FT                   ALFNNRKVVDMFLVGVGGVGGELIEQIKRQSEYLAKKDIEIRVCALANSNKMLLNENGL
FT                   NLGNWREDLANATQPSDFDVLLSFIKLHHVVNPVFVDCTTAESVAGLYERALKEGFHVI
FT                   TPNKKANTRELDYYNQVRENARKNHRKFLYDTNVGAGLPVIDNLQNLLAAGDDVVSFNG
FT                   ILSGSLSFIFGKLEEGLSLSEATALAREKGFTEPDPRDDLSGQDVARKLLILAREIGLE
FT                   LELSDIEVEGVLPQGFSEGKSADEFMAMLPSLDEEFAERVAKAKSEGKVLRYVGQIEEG
FT                   KCKVSIVAVDGDAPLYKVKNGENALAFYTRYYQPIPLLLRGYGAGNAVTAAGIFADILR
FT                   TLKH"
FT   gene            388295..389239
FT                   /locus_tag="HSM_0350"
FT   CDS_pept        388295..389239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0350"
FT                   /product="homoserine kinase"
FT                   /note="TIGRFAM: homoserine kinase; PFAM: GHMP kinase; GHMP
FT                   kinase domain protein; KEGG: hso:HS_1213 homoserine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31986"
FT                   /db_xref="GOA:B0UWP6"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UWP6"
FT                   /protein_id="ACA31986.1"
FT                   /translation="MLRIYAPASSANISVGFDTLGVAVSPIDGSLLGDVVQIEEIEQGF
FT                   ELESTGYFVRKLPKEPQKNIVYQAYVLFSERLKLRNLKIKPLRLTLEKNMPIGSGLGSS
FT                   ACSIVATLVALNQFYQQPFSKMELLEMMGELEGRISGSIHYDNVAPCYLGGVQLMVQSL
FT                   GNICQQLPFFDNWYWVLAYPGIEVSTAEARAILPKSYTRQDVISHGRHLGSFVHACHTR
FT                   QEALAAYMMRDVIAEPYREALLPNFAEVKQAVKDLGVLASGISGSGPTMFAIAPDLAIA
FT                   TKSATYLENNYLQNNEGFVHICKVDNVGARALV"
FT   gene            389252..390529
FT                   /locus_tag="HSM_0351"
FT   CDS_pept        389252..390529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0351"
FT                   /product="threonine synthase"
FT                   /EC_number="4.2.3.1"
FT                   /note="TIGRFAM: threonine synthase; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   KEGG: hso:HS_1212 threonine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31987"
FT                   /db_xref="GOA:B0UWP7"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR029144"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR037158"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWP7"
FT                   /protein_id="ACA31987.1"
FT                   /translation="MNLYNIKHPEQQVSFSQAVRQGLGKDQGLFFPEKLPHFDDIDSLL
FT                   SLPLVERSQKILTALIGAELSQETISAMVKNAFTFPAPMVKVEDNIYALELFHGPTLAF
FT                   KDFGGRFMAQALAVVRGDSKITILTATSGDTGAAVAHAFYGLENIEVVILYPKGKISPL
FT                   QEKLFCTLGGNIRTVAINGDFDACQALVKQAFDDEELRQAVGLNSANSINISRLLAQVC
FT                   YYFEAVAQLPKEIRQDIVISVPSGNFGNLTAGLIAKTLGLPIKRFIAATNANDTVPRYL
FT                   NSGKWQPHTTVATLSNAMDVSQPNNWPRVEELFKYNGWSLSELGSGALSDEETEKTLRA
FT                   QYAKGYLCEPHGAIAYQVLKDQLQVNETGIFLCTAHPAKFKENVERILSLELVLPETLD
FT                   RYNKLPLLSDEMENDFAQLRAYLLKK"
FT   gene            complement(390701..391147)
FT                   /locus_tag="HSM_0352"
FT   CDS_pept        complement(390701..391147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0352"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG: hso:HS_1211
FT                   ferric uptake regulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31988"
FT                   /db_xref="GOA:B0UWP8"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWP8"
FT                   /protein_id="ACA31988.1"
FT                   /translation="MSEENIKLLKKAGLKITEPRLTILSLMQESRGTMQHFSAEDVYKM
FT                   LLEQGKDIGLATVYRVLNQFDEANILIRHNFEGNKSVFELAPEEHHDHIICVDCGKVFE
FT                   FNDEVIEKRQREISAEHGIKLKTHNLYLYGKCSNVQNCDESGKK"
FT   gene            complement(391164..391688)
FT                   /locus_tag="HSM_0353"
FT   CDS_pept        complement(391164..391688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0353"
FT                   /product="flavodoxin"
FT                   /note="TIGRFAM: flavodoxin; PFAM: flavodoxin/nitric oxide
FT                   synthase; KEGG: hso:HS_1210 flavodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31989"
FT                   /db_xref="GOA:B0UWP9"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010086"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWP9"
FT                   /protein_id="ACA31989.1"
FT                   /translation="MAIVGLFYGSDTGNTENIAKMIQKQLGSELIDIRDIAKSSKEDIE
FT                   SYDFLMIGIPTWYYGEAQCDWDDFFPTLEEIDFTDKLVAIFGCGDQEDYAEYFCDAMGT
FT                   VRNIIEPKGAIIVGHWPTEGYTFEVSQALVDDNTFVGLCIDEDRQPELTAERVEKWVKQ
FT                   VYDEMCLAELA"
FT   gene            complement(392110..392889)
FT                   /locus_tag="HSM_0354"
FT   CDS_pept        complement(392110..392889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0354"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; PGAP1 family
FT                   protein; KEGG: hso:HS_1209 esterase/lipase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31990"
FT                   /db_xref="GOA:B0UWQ0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWQ0"
FT                   /protein_id="ACA31990.1"
FT                   /translation="MPTTKLLNYQFHAINNSQISPTLVFIHGLFGDMNNLGVIARAFSE
FT                   KYPILRLDLRNHGQSFHSEEMNYQLMAEDVLQVIDHLNLTNVILIGHSMGGKTAMKCAM
FT                   LRPHLIEKLIVIDIAPVNYSNNEHDSVFAGLFAVSKAQSETRQQAKQLLANYIPQESVQ
FT                   QFMLKSFDAQAKEKFRFNLTALKQNYAEIMDWKKGFFNKPTLFIRGGLSNYILPEYSEQ
FT                   ILAQFPQATSFTINGSGHWVHAEKADFVIRSIQRFLS"
FT   gene            392995..393609
FT                   /locus_tag="HSM_0355"
FT   CDS_pept        392995..393609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0355"
FT                   /product="SeqA family protein"
FT                   /note="PFAM: SeqA family protein; KEGG: hso:HS_1208 SeqA
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31991"
FT                   /db_xref="GOA:B0UWQ1"
FT                   /db_xref="InterPro:IPR005621"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR026577"
FT                   /db_xref="InterPro:IPR033761"
FT                   /db_xref="InterPro:IPR036835"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWQ1"
FT                   /protein_id="ACA31991.1"
FT                   /translation="MKIIEVDEELYQYIAGQTKSIGESASDILRRLLNLPYSKVASAVQ
FT                   NSENVSTEAILPNTCIESEQEVQTNELINIPVKKQSDEAIQKIVDKVRNLLYSEEFQQE
FT                   TKAVVRFLSLLRTLYRTNPESFALATESLQGRTRVYFARDEATLLVAGNHTKPKQIPDT
FT                   PFWVITNTNSGRKMLMLESAMESMHLPQELIEEVRSFFVTN"
FT   gene            393612..395018
FT                   /locus_tag="HSM_0356"
FT   CDS_pept        393612..395018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0356"
FT                   /product="O-succinylbenzoate-CoA ligase"
FT                   /note="TIGRFAM: O-succinylbenzoate-CoA ligase; PFAM:
FT                   AMP-dependent synthetase and ligase; KEGG: hso:HS_1207
FT                   O-succinylbenzoic acid--CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31992"
FT                   /db_xref="GOA:B0UWQ2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR010192"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWQ2"
FT                   /protein_id="ACA31992.1"
FT                   /translation="MFLWHKYALTPLFQSKIALRNSQGEVFTWQQLCSLINRQSLLFQQ
FT                   QGVKAGSGVLLCGKNDFSLLLAYLATIQLGARVLGVNPSFPADKIQHIAECYQCDFIFN
FT                   RTAFLFKNMQNLTALSVSDCTQYVDVLPETEVKMDLQAVATLTLTSGSSGLPKAVVHSL
FT                   QGHLDNAIGVCELTQFSAKNSWLLSLPLFHVSGQGIIWRWLVSGAELHLPQEDFYFSVS
FT                   QASHCSLVPTQLQRLFDYWQQNPTLPRYTQHILLGGTQIPTQLTEKLAQYSIKSYTGYG
FT                   MTEMASTVCAKLSDGKRGVGLPLAGREVRLVCDEIWVRGAGLALGYWQQGKICSLLNEQ
FT                   GWFATKDKGIWQDNELHILGRLDNMFISGGENIQPEEIEQIIGQNETVAQVFVLPIDDV
FT                   EFGQRPVAMIKFHDVFSEQAVHELHIWLADKLEKFKQPIQYFPLLLQSQGNIKISRHQL
FT                   KSELTRLLGK"
FT   gene            395021..398317
FT                   /locus_tag="HSM_0357"
FT   CDS_pept        395021..398317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0357"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   hso:HS_1206 possible small-conductance mechanosensitive
FT                   channel"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31993"
FT                   /db_xref="GOA:B0UWQ3"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR006686"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="InterPro:IPR024393"
FT                   /db_xref="InterPro:IPR025692"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWQ3"
FT                   /protein_id="ACA31993.1"
FT                   /translation="MKKIKNKFKQVAMIGLFSLAQFALAGAILTENDVKMRLDEIKKIE
FT                   QPQQEDKSAVQNLEETLFLLGKIAKQKEDNLKLQKLIQDAPNEQKNIREEITTLKEAFV
FT                   VRDFDNLSIGQLEDNLAKIQSELQQVQADLVQANAQLVNQHSATERAQSALSANIVRTQ
FT                   EIDKLSFSVDIAPEEQNKLATESALIELQNDYNQTVLQGNNELTALYTLQLELKNLVQQ
FT                   HLQATQTALQTEINRRKLVQTEQQVEQLKQTQKEAEGNPLLVQQQQINIQIGQDLVEQT
FT                   TKLNVLSQDNLRIKSVLDNFQQTERNINEQISALQGTLVLSRIINKQKQLLPHDRMITG
FT                   LSNQIADLRVKIFDLTELRDSLYDIDGYISNIERKQGVTFGIAEHAQLTKILRERQKGI
FT                   SDLVSILNDQLNLSINIELNQKQVNLISDTLQEKLQQQSFWVKSNTPIDLDWVKRFPSL
FT                   LKIELEDIRTQFNFNNWQDNIISATALIVFLLSIAFFISWRKEKIKQRLNYINSKINTL
FT                   QEDRQLYTPEAVFWTIILCLPMTLVVLVGLIVITFICFNDPEKFWLWSVRMSGYWWLFA
FT                   FMLAMLRPNGLAYRHFSMPKYNVELFSNVMKRSVWITVLWLNASMFTYLDGGIANDVIG
FT                   QLMTIAVLVISLFIIGPRMRYAVQAYEKNSEKKPFLKVFRIVLLLSPIILIVLVVLGYY
FT                   YTTLNLMDHLMSSYFALMIWIVIRNIVYRGFTISARRLAYRRLQEKQKKTQVQSQDVVD
FT                   KEEFNLNTQEEVLAISAVKDQVLRVMDLVLLVGLIGMFYWVWSDLITVAYYLEGVTLWN
FT                   QTAITEVGTVIETITLWNLLLALIILGITYALVRNIGGVLEVLIFSRVNFSQGTPYTIT
FT                   TLLIYFIIAIGSAMAFSTLGMSWSKLQWLFAALSVGLGFGLQEIFANFVSGIIILFERP
FT                   VRIGDFVTIDNFSGTVSKIRIRSTTIIDSDKKEVIVPNKAFVTERIVNWALTNSMTRVV
FT                   IGVGVAYGSDLELVRKLLLQAAYETPTVLKEPEPSAYFIAFGASTLDHELRVYVGKLSD
FT                   RMTTQDFLNRRINELFAQHNIEIAFNQLDVFIKNQTTNEEVKVLSENLQR"
FT   sig_peptide     395021..395098
FT                   /locus_tag="HSM_0357"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.977 at
FT                   residue 26"
FT   gene            398333..399415
FT                   /locus_tag="HSM_0358"
FT   CDS_pept        398333..399415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0358"
FT                   /product="Chorismate synthase"
FT                   /EC_number="4.2.3.5"
FT                   /note="PFAM: chorismate synthase; KEGG: hso:HS_1205
FT                   chorismate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31994"
FT                   /db_xref="GOA:B0UWQ4"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UWQ4"
FT                   /protein_id="ACA31994.1"
FT                   /translation="MAGNSIGQLFRVTTFGESHGIALGCIVDGMPPGLALSEDDIQPDL
FT                   DRRKPGTSKYTTPRREEDKVQILSGVFDGKTTGTSIGMIIKNTDQRSQDYGEIKDRFRP
FT                   GHADFTYQQKYGLRDYRGGGRSSARETVMRVAAGAIAKKYLREYFGIEVRGYLSQIGEI
FT                   KIDPQVVADVSKIDWAKVNSNPFFCPDESAVEKFDELIRELKKAGNSIGAKLTIVAEHV
FT                   PVGLGEPVFDRLDADLAHALMGINAVKAVEIGDGFAVVEQKGTEHRDEMTPEGFCSNHA
FT                   GGILGGISSGQPIIATIALKPTSSITVVGRSVNLNNEPVDVITKGRHDPCVGIRAVPIA
FT                   EAMMAIVLLDHLLRFKAQCK"
FT   gene            399448..400287
FT                   /locus_tag="HSM_0359"
FT   CDS_pept        399448..400287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0359"
FT                   /product="peptidase U6 penicillin-insensitive murein
FT                   endopeptidase"
FT                   /note="PFAM: peptidase U6 penicillin-insensitive murein
FT                   endopeptidase; KEGG: hso:HS_1204 penicillin-insensitive
FT                   murein endopeptidase A"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31995"
FT                   /db_xref="GOA:B0UWQ5"
FT                   /db_xref="InterPro:IPR005073"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWQ5"
FT                   /protein_id="ACA31995.1"
FT                   /translation="MLKTAVFFTALFFTQILSANPQYWQSVKRPIHGEAMPIGSYNNGC
FT                   LIGAEALPFNGEGYQVIRTNKNRYYGHPDMIAYLQRLGKKAKQAGLPTILIGDIAMPGG
FT                   GRFLTGHASHQMGLDADIWLRLGKLSAKDAQDPSGMGLLVVDRKKQRVIDKLWSKDHEN
FT                   LIRLATQDPQVSRIFVNPAIKLKLCQTVKGDRNWLQKIRPWFGHDSHFHVRLTCPKDAK
FT                   YCENQLPIPAGEGCGEELYSWFKPAKPSEFKPKKVVPEAPFLCQQLISAPNRHEWLE"
FT   sig_peptide     399448..399507
FT                   /locus_tag="HSM_0359"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.953 at
FT                   residue 20"
FT   gene            400298..401068
FT                   /locus_tag="HSM_0360"
FT   CDS_pept        400298..401068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0360"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   hso:HS_1203 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31997"
FT                   /db_xref="GOA:B0UWQ6"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWQ6"
FT                   /protein_id="ACA31997.1"
FT                   /translation="MVEMSIQLMLILFFVAMIAGFIDAMAGGGGLITIPALLMTGMSPA
FT                   LALGTNKLQACGGSFSASLYFLRKRAVDLRAFLLIIVMTFLGAALGTLSIQSVDAILIK
FT                   KVLPFLVLIIGLYFLLTPSLGNKDRQPRISYSLFAFSIGLTVGFYDGFFGPGTGSLLTL
FT                   ACVSLLGFNLAKATAHAKVLNFTSNIASLLFFLLGDQIFWKLGLVMMLGQFIGANLGAK
FT                   MVLTKGKTLIRPMVVLMSFIMTVKMAYEQAWFSW"
FT   sig_peptide     400298..400378
FT                   /locus_tag="HSM_0360"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.847) with cleavage site probability 0.623 at
FT                   residue 27"
FT   gene            401092..402045
FT                   /locus_tag="HSM_0361"
FT   CDS_pept        401092..402045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0361"
FT                   /product="lipid A biosynthesis (KDO)2-(lauroyl)-lipid IVA
FT                   acyltransferase"
FT                   /note="TIGRFAM: lipid A biosynthesis (KDO)2-(lauroyl)-lipid
FT                   IVA acyltransferase; PFAM: lipid A biosynthesis
FT                   acyltransferase; KEGG: hso:HS_1202 lipid A biosynthesis
FT                   (kdo)2-(lauroyl)-lipid IVA acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31998"
FT                   /db_xref="GOA:B0UWQ7"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="InterPro:IPR011921"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWQ7"
FT                   /protein_id="ACA31998.1"
FT                   /translation="MTENNDLRLTARVGYQPHYSWSYLLPKYWGIWLGIFALVILAFVP
FT                   FRWRDKLATKLGRIIARKAKKQRHRADVNLRYCFPHWSEKQRNEVIENMFITVTQVMLG
FT                   IGEIALRSKKHLKKRSEFKGLEHVQQAREVGKNIILMVPHGWAIDASGIILHAQGIAMT
FT                   SMYNPHQNPLVDWLWTMTRQRFGGKMHARQNGIKPFLNHVKKGEMGYYLPDEDYGEELS
FT                   VYADFFATYKATLPGLNKMARLAKAVVIPMFPRYNAQRGKYEIEICAPLELTEDPEQSA
FT                   RMMNQAIEYFVTPTPEQYVWILRLLKTRKDNEDIYR"
FT   gene            402116..402655
FT                   /locus_tag="HSM_0362"
FT   CDS_pept        402116..402655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0362"
FT                   /product="adenine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.7"
FT                   /note="TIGRFAM: adenine phosphoribosyltransferase; PFAM:
FT                   phosphoribosyltransferase; KEGG: hso:HS_1201 adenine
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31999"
FT                   /db_xref="GOA:B0UWQ8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005764"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UWQ8"
FT                   /protein_id="ACA31999.1"
FT                   /translation="MNKLELIKSSIKSIPNHPKEGIIFRDITSLTEVPEAFQATIDLII
FT                   ERYKSKGITKVIGTESRGFIFGAPVALALNVPFILVRKPGKLPRETIAQSYQLEYGQDT
FT                   LEMHVSSIQAGDNVLVIDDLLATGGTIEATVKLVERLQGQVKHAAFVISLPDLGGEVRL
FT                   RELGVEPFTLVEFSGH"
FT   gene            402686..404689
FT                   /locus_tag="HSM_0363"
FT   CDS_pept        402686..404689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0363"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: hso:HS_1200 DNA polymerase III, subunits gamma
FT                   and tau; TIGRFAM: DNA polymerase III, subunits gamma and
FT                   tau; PFAM: AAA ATPase central domain protein; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32000"
FT                   /db_xref="GOA:B0UWQ9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR021029"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038249"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWQ9"
FT                   /protein_id="ACA32000.1"
FT                   /translation="MSYQVLARKWRPKTFSEVVGQEHILTALSNGLCENRLHHAYLFSG
FT                   TRGVGKTSIARLFAKGLNCIRGVTAEPCGECEHCKAIEEGRFIDLIEIDAASRTKVEDT
FT                   RELLDNVQYKPTQGRYKVYLIDEVHMLSRHSFNALLKTLEEPPEYVKFLLATTDPQKLP
FT                   ITILSRCMQFHLKALSEKQIAQHLEFILQQENIPFEYPALEKLATAAQGSIRDSLSLTD
FT                   QAIAMGNANVSLDTVSIMLGLLDDNQPIDILYALQQGNGEMLMKAIQAVAEKGADWDKL
FT                   LVTLAEKLHQIAMLQLLPQQINEENSLGFLAKHITPEDVQFFYQVIVSGRKELASAPNH
FT                   RIGAEMILLRSLAFHPKFISPSSAAPIEQSAVQKSQNIVQPPLVEMPVVSVAEQLPSQN
FT                   LIRKPTIADKVDTKLSTTALSALEALEQLSQPSDHSDSEKKNSPIDNIYDISLRENTEN
FT                   ISALPVLNVVPKDVDNALKTVTVIDKSDHRSDEIQEDSAENYRWEWRNPEMAVEEKAIR
FT                   PSEIKQAILEQASPELIQRIIATAQERDDWTRIIEQLPLRGMTKDMALNTVLLNQSGDQ
FT                   IVLSLMSDKQHLLDRCHKELKQALSDFYQRDIQLLITPTDDKNLATPLYYQNLVYQEFN
FT                   EQAKKALQEDNSLKLLEKEFAATLDLDSVRPI"
FT   gene            404942..406060
FT                   /locus_tag="HSM_0364"
FT   CDS_pept        404942..406060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0364"
FT                   /product="radical SAM enzyme, Cfr family"
FT                   /note="TIGRFAM: radical SAM enzyme, Cfr family; PFAM:
FT                   Radical SAM domain protein; KEGG: hso:HS_1198 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32001"
FT                   /db_xref="GOA:B0UWR0"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027492"
FT                   /db_xref="InterPro:IPR040072"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UWR0"
FT                   /protein_id="ACA32001.1"
FT                   /translation="MSDKINLMNLTRQQMRAFFQELGEKPFRADQLVKWIYHFGEDNFD
FT                   HMTNINKKLREKLKTVAEIKAPEIAVEQRSADGTIKWAMQVGDQQVETVYIPETDRATL
FT                   CVSSQVGCALACTFCSTAQQGFNRNLTVSEIIGQVWRASKIIGNFGVTGVRPITNVVMM
FT                   GMGEPLLNVANVVPAMEIMLDDFAYGLSKRRVTLSTSGVVPALDKLSEMIDVALAISLH
FT                   APNDELRNEIVPINKKYNIKMLMESVNRYLNVSNANHGKVTIEYVMLDHINDGTEHAHQ
FT                   LAEVLKNTPCKINLIPWNPFPDAPYAKSSNTRIDRFQKTLMEYGFTVILRKTRGDDIDA
FT                   ACGQLAGDVIDRTKRTAQKKRFGKEIGTHQIY"
FT   gene            406091..406630
FT                   /locus_tag="HSM_0365"
FT   CDS_pept        406091..406630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0365"
FT                   /product="type IV pilus biogenesis/stability protein PilW"
FT                   /note="TIGRFAM: type IV pilus biogenesis/stability protein
FT                   PilW; PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: hso:HS_1197
FT                   fimbrial biogenesis and twitching motility protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32002"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013360"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWR1"
FT                   /protein_id="ACA32002.1"
FT                   /translation="MRYRTIFTFIIFSLFLSACVSQPTTGRFNKQQAAKARIELGLGYL
FT                   KLRNFSQAKLNFDKALFYQPDYYLVHSAFAYLYQLQGDISQAKSSYEKAISLDKSQGDV
FT                   KNNYGAFLCSQGEFARAYELFEQALTTPNYYQQADTYANIIICAEAEHNIPRYQKFLQL
FT                   LKNIDPKRAEEIKKVS"
FT   sig_peptide     406091..406156
FT                   /locus_tag="HSM_0365"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.773 at
FT                   residue 22"
FT   gene            complement(406713..408983)
FT                   /locus_tag="HSM_0366"
FT   CDS_pept        complement(406713..408983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0366"
FT                   /product="ribonucleoside-diphosphate reductase, alpha
FT                   subunit"
FT                   /EC_number="1.17.4.1"
FT                   /note="TIGRFAM: ribonucleoside-diphosphate reductase, alpha
FT                   subunit; PFAM: ribonucleotide reductase large subunit;
FT                   ATP-cone domain protein; Ribonucleotide reductase large
FT                   subunit domain protein; KEGG: hso:HS_1196 ribonucleoside
FT                   diphosphate reductase, alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32003"
FT                   /db_xref="GOA:B0UWR2"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWR2"
FT                   /protein_id="ACA32003.1"
FT                   /translation="MNKALMVTKRDGNKEPIDLDKIHRVITWAAEGLENVSVSLVELKS
FT                   HIQFYEGIRTSDIHETIIKAAADLISKDSPDYQYLAARLAVFHLRKKAYGHFEPPKLYD
FT                   HVKKLVRMGKYDQALLTDYTREEWDEMDGFLDHWRDMTFSYAAVKQLEGKYLVQNRVTG
FT                   EIYESAQFLYLLVAASLFSRYPKETRLDYIHRFYDATSTFKISLPTPIMAGVRTPTRQF
FT                   SSCVLIECGDSLDSINATASAIVKYVSQRAGIGVNAGAIRALGSPIRNGEAFHTGCIPF
FT                   YKHFQTAVKSCSQGGVRGGAATVYYPIWHLEVESLLVLKNNRGVEDNRVRHMDYGVQLN
FT                   KLMYQRLIKGGEITLFSPSDVPGLYEAFFADQNKFETLYLKYEQDPAVRKRSVKAVELF
FT                   SLLMQERASTGRIYIQNVDHCNTHSPFDPTVAPIRQSNLCLEIALPTKPLQHFHDENGE
FT                   IALCTLSAFNLGALENLDELEELADLAVRALDALLDYQDYPVAAAKRSSLARRSLGIGV
FT                   INYAYYLAKNNVRYSDGSANDLTHRTFEAIQYYLLKASMNLAKEIGACEYFHETTYAQG
FT                   ILPIDTYKKDIDNLTKEPLHYDWEALRKEIQEFGLRNSTLTALMPSETSSQISNATNGI
FT                   EPPRGHVSIKASKDGILKQVVPDYENLGENYELLWDIPSNDGYLHLVGIMQKFIDQAIS
FT                   ANTNYDPKRFEDGKVPMKVLLKDLLTAYKYGLKTLYYQNTRDGAEDMQEDLDDACAGGA
FT                   CKI"
FT   gene            complement(409267..410388)
FT                   /locus_tag="HSM_0367"
FT   CDS_pept        complement(409267..410388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0367"
FT                   /product="chaperone protein DnaJ"
FT                   /note="TIGRFAM: chaperone protein DnaJ; PFAM: DnaJ central
FT                   domain protein; heat shock protein DnaJ domain protein;
FT                   chaperone DnaJ domain protein; KEGG: hso:HS_1195 chaperone
FT                   protein DnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32004"
FT                   /db_xref="GOA:B0UWR3"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UWR3"
FT                   /protein_id="ACA32004.1"
FT                   /translation="MAKRDYYEILGVQKGADDKEIKRAYKRLAMKYHPDRTKGDKESEE
FT                   KFKEINEAYEVLADKEKRAMYDQYGHAAFEQGGGAGGFGGFSGADFGDIFGDMFGDIFG
FT                   GGRSRQRVVRGEDLRYDIEISLEEAVKSCKKDIQINTLVHCGTCHGSGAEAGSKIESCP
FT                   TCHGAGRVRRQQSFFVTEQTCPHCHGTGKKIEKPCHTCHGEGRVHKTQNLTVTIPMGVD
FT                   TGNQLRLAGKGAAGENGAPAGDLYVVIHVKKHHIFERDGNNLYCEVPISFTMAALGGEV
FT                   EIPTLDGRLKVKIPAETQTGKLLRLRGKGITSRGYAGDLICEIVIETPIKLNEEQKELL
FT                   RKLEESLEGKTLQRPKSSGFLDGVKKFFDNLGK"
FT   gene            complement(410486..412393)
FT                   /locus_tag="HSM_0368"
FT   CDS_pept        complement(410486..412393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0368"
FT                   /product="chaperone protein DnaK"
FT                   /EC_number="1.3.1.74"
FT                   /note="TIGRFAM: chaperone protein DnaK; PFAM: Heat shock
FT                   protein 70; KEGG: hso:HS_1194 chaperone protein DnaK, heat
FT                   shock protein 70"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32005"
FT                   /db_xref="GOA:B0UWR4"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UWR4"
FT                   /protein_id="ACA32005.1"
FT                   /translation="MGKIIGIDLGTTNSCVAVMDGDKPRVIENAEGERTTPSIIAYTND
FT                   NETLVGQPAKRQAVTNPKNTLFAIKRLIGRRFEDQEVQRDVAIMPFEITKADNGDAWVS
FT                   VKGEKMAPPQISAEVLKKMKKTAEDFLGETVTEAVITVPAYFNDAQRQATKDAGRIAGL
FT                   EVKRIINEPTAAALAYGLDKGKGNQTIAVYDLGGGTFDLSIIEIDEVGGEKTFEVLATN
FT                   GDTHLGGEDFDNRVINYLVDEFKKEQGVDLRNDPLAMQRLKEAGEKAKIELSSAQQTDV
FT                   NLPYITADATGPKHLNIKLTRAKLEALVEDLVARSMEPVKVALSDAGLSVSEINDVILV
FT                   GGQTRMPLVQQKVAEFFGKEPRRDVNPDEAVAIGAAVQGGVLAGDVKDVLLLDVTPLSL
FT                   GIETMGGVMTTLIEKNTTIPTKKSQVFSTAEDNQSAVTIHVLQGERKQASANKSLGQFN
FT                   LEGINPAPRGMPQIEVTFDIDADGIIHVSAKDKGTGKEQKITIKASSGLSDEEIQQMVR
FT                   DAEANAEADRKFEELVQARNQADHLVHSTRKQLAEVGEKLSAEDKAPIESAVNELETAA
FT                   KGEDKTEIDAKVQALIQVSEKLLQASQQQAQADAGAQQSQSTKGGEDVVDAEFEEVKDK
FT                   "
FT   gene            complement(412572..413825)
FT                   /locus_tag="HSM_0369"
FT   CDS_pept        complement(412572..413825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0369"
FT                   /product="polynucleotide adenylyltransferase/metal
FT                   dependent phosphohydrolase"
FT                   /note="PFAM: Polynucleotide adenylyltransferase region;
FT                   metal-dependent phosphohydrolase HD sub domain; KEGG:
FT                   hso:HS_1193 tRNA nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32006"
FT                   /db_xref="GOA:B0UWR5"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR012006"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWR5"
FT                   /protein_id="ACA32006.1"
FT                   /translation="MMQIYLVGGAVRDQLLGLPIKDRDWLVVGSTAEELLSQGYQQVGK
FT                   DFPVFLNPKTREEYALARTERKSGTGYTGFICDFNPNITLEQDLMRRDLTINAIAQDMA
FT                   GQYHDPYNGIADLKKGILRHISPAFAEDPLRVLRVARFAARYHQLGFKIAPDTLALMKK
FT                   IANNGELRQLSPERVWQETEKALHEQDPQVYFAILQKIDALKVLCPEISVFNSDSIQYR
FT                   SDMTDFVHAMPILKQTTLLTEKTDYHKSAVRFAALCHDVGKALSTANIPPYSHDNKITS
FT                   IAYLRNVCQRFKVPNYVQELAELTCQYHSHIHHALALHTKTILTLFNKLDVWRKPKRFE
FT                   ELMLVCLADSLTQTEMNYTDCPQYKFLLCLYQAALAVNVQQIISEGFQHKAIRVELDRR
FT                   REIAIQIKKQQFIEQNLT"
FT   gene            complement(413830..414441)
FT                   /locus_tag="HSM_0370"
FT   CDS_pept        complement(413830..414441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0370"
FT                   /product="SH3 domain protein"
FT                   /note="SMART: SH3 domain protein; KEGG: hso:HS_1192
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32008"
FT                   /db_xref="GOA:B0UWR6"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR016476"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWR6"
FT                   /protein_id="ACA32008.1"
FT                   /translation="MKKITSLLVSALLLGFSLSNAYAETKYVKENLTTFMRRGAGDQFK
FT                   ISGTIQAGESVTVLDKKDKYSLIRDKRNREAWILTSELTSTPSSREENPKLKAQIQELT
FT                   LKLNNIDNDWKQRTSEMQRRTKQAEEQSSKLLEQNSLLNRELEITKNKNRDLEAMLDVG
FT                   KREIAIQWFIYGGSVLGAGLLLGLILPLLIPKRRRQNRWS"
FT   sig_peptide     complement(414370..414441)
FT                   /locus_tag="HSM_0370"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.929 at
FT                   residue 24"
FT   gene            complement(414546..415808)
FT                   /locus_tag="HSM_0371"
FT   CDS_pept        complement(414546..415808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0371"
FT                   /product="phosphate transporter"
FT                   /note="PFAM: phosphate transporter; KEGG: hso:HS_1191
FT                   phosphate permease"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32009"
FT                   /db_xref="GOA:B0UWR7"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWR7"
FT                   /protein_id="ACA32009.1"
FT                   /translation="MEILQEYGTILVIITAVFGFLMAFGVGANDVANAMGTSVGSGTIT
FT                   AKQAIFIAMFFECAGAYLAGGEVTETIKSGVIDPMQFTDTPEILVFGMMAALFSSGIWL
FT                   LIASKMGWPVSTTHAIIGAIVGFACITVGAHAVDWGTVRNIVGSWFITPILAGIIAYAI
FT                   FFSTQKLIFDTPKPLANAQKYGPFYMGLTVLILAIVTMTKGLKHIGLHLTTIETLIISG
FT                   IISIIAGILGSFYFRSQRFIQNVTKGTFGAVEKVFSILMLLTACAMAFAHGSNDVANAV
FT                   GPLSAVVSIIEHGGEIAGKTTLAWWILPLGSVGIGVGLIVMGYKVMSTIGTGITDLTPS
FT                   RGFAAQFATAVTVVLASGTGLPISTTQTLVGAILGIGFARGIAAINLTVIRNIVASWIV
FT                   TLPAGTFFAIVIYYIIYAIFH"
FT   sig_peptide     complement(415722..415808)
FT                   /locus_tag="HSM_0371"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.684) with cleavage site probability 0.636 at
FT                   residue 29"
FT   gene            complement(415835..416515)
FT                   /locus_tag="HSM_0372"
FT   CDS_pept        complement(415835..416515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0372"
FT                   /product="protein of unknown function DUF47"
FT                   /note="PFAM: protein of unknown function DUF47; KEGG:
FT                   hso:HS_1190 possible phosphate transport regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32010"
FT                   /db_xref="InterPro:IPR002727"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWR8"
FT                   /protein_id="ACA32010.1"
FT                   /translation="MAMNNILGLFAHSPLTPLQRHSDKVTECCKLLIPFFESTFAGDWH
FT                   NATKIRAELSELERQADTLKREIRLKLPLGLFMPIDRTDLLELTTQQDKLANCAKDIAG
FT                   RMLGRQFTFPQEMQEDFMKYVYRSLDATVQANRVIEEMDALLETGFKGHELTLVNNLIH
FT                   ELDAIEDDTDHMQIKLRMMLRNIENQYSPIDVMFLYETLAWIGVLADQAQRVGSRIELM
FT                   LARS"
FT   gene            416658..417701
FT                   /locus_tag="HSM_0373"
FT   CDS_pept        416658..417701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0373"
FT                   /product="adenylate cyclase"
FT                   /note="PFAM: adenylate cyclase; KEGG: hso:HS_1189
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32011"
FT                   /db_xref="GOA:B0UWR9"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="InterPro:IPR039013"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWR9"
FT                   /protein_id="ACA32011.1"
FT                   /translation="MTKEIELKLSVSNAFAQFLSQEMTSFHVLKQEKVFLGNTYYDTAD
FT                   SYFARHKMGLRVRQYNNDFTLTLKTNGDVLGGLHSRPEYNVSQESAVPNLAKLTEIYDL
FT                   PNWHEFVLQPIFSTDFERCLWLVECGYDVEIEVALDQGWIIAGEKSVPICEVEFELKQG
FT                   KTEDLLNFVANLSLESDVRLSSASKAQRGYQLAFNIQPQVQDWIAKWREFIVLATHEKI
FT                   AYLVKFEQQLIEESVMLGKDYFAQEFLRTVERIGAFFNLYHFYSENVTLLENQVNLQLT
FT                   QGITHLDQNLLADLVERNAYLLLQIKDIIRCHSENKNNALAIEKLFALFHSGQYVKRML
FT                   DLTFLTL"
FT   gene            417711..419087
FT                   /locus_tag="HSM_0374"
FT   CDS_pept        417711..419087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0374"
FT                   /product="DNA repair protein RadA"
FT                   /EC_number="2.1.1.63"
FT                   /note="TIGRFAM: DNA repair protein RadA; SMART: AAA ATPase;
FT                   KEGG: hso:HS_1188 DNA repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32012"
FT                   /db_xref="GOA:B0UWS0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWS0"
FT                   /protein_id="ACA32012.1"
FT                   /translation="MAKSPKTAYVCNDCGAEFARWQGQCSACKAWNTISEVRLVSTAKV
FT                   KNDRFSGYAGETKAKIQTLAEISLQETPRFTSGFRELDRVLGGGIVPGSAILIGGHPGA
FT                   GKSTLLLQVMCGLAQSMTALYITGEESLQQVAMRANRLGLPTDRLQLLSETSIEQICHL
FT                   ADQLKPQIIVIDSIQVMHLSDIQSSPGSVAQVRECAAFLTRYAKTRQVAIIMVGHVTKD
FT                   GTLAGPKVLEHAIDASLLLEGESDSRYRTLRSHKNRFGAVNELGVFAMTEQGLREVKNP
FT                   SAIFLSRGDEQTSGSSVMVVWEGTRPLLVEIQALVDHSMLANPRRVAVGLEHNRLALLL
FT                   AVLHRHGGLQMSDQDIFVNVVGGVKVTETSADLALLLALISSFRNRPLPQDLVVFGEVG
FT                   LAGEIRPVPSGQERISEAAKHGFKRAIVPFANKPKSAVENMQVFTVKKLADALAILDNF
FT                   "
FT   gene            419189..419665
FT                   /locus_tag="HSM_0375"
FT   CDS_pept        419189..419665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0375"
FT                   /product="putative transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; KEGG:
FT                   hso:HS_1187 leucine-responsive regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32013"
FT                   /db_xref="GOA:B0UWS1"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWS1"
FT                   /protein_id="ACA32013.1"
FT                   /translation="MEKKIKSLDSIDIKILNELQRNGKISNIDLSKKVGLSPTPCLERV
FT                   KRLERQGIIMGYRALLNPELLDSPLLVIVEITLVRGRPDVFEEFNVAVQQLDEIQECHL
FT                   VSGDFDYLLKTRVADMAAYRKLLGTTLLRLPGVNDTRTYVVMEEVKQTNFLQLK"
FT   gene            419667..422378
FT                   /locus_tag="HSM_0376"
FT   CDS_pept        419667..422378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0376"
FT                   /product="cell divisionFtsK/SpoIIIE"
FT                   /note="PFAM: cell divisionFtsK/SpoIIIE; KEGG: hso:HS_1186
FT                   DNA translocase protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32014"
FT                   /db_xref="GOA:B0UWS2"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR018541"
FT                   /db_xref="InterPro:IPR025199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041027"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWS2"
FT                   /protein_id="ACA32014.1"
FT                   /translation="MIKRIKQFFLPKRDLVEFLLILTALWGFYLIVAWFSYSPFDNSWA
FT                   ISSFQTETINKAGALGAWMIDLFFTFFGVVGNIIPFVLFIAPIYFLHTKRTQGLTWGRF
FT                   FLRILGFVTLLVGLMILATLMLAKTEHHLSGGVLGAILIVKLYPLFSNQFPLIIIGSIA
FT                   SIIGFIFCSGASLFYLMMNCYDWLTMKDKESLLDTQSNGADSVEQELEEIIIQSPPIEQ
FT                   NIANEDTEKQGLELVNISSFINIQGLPDEQVEEQQNLAAPMLMKQNEVVDIAQTLGDLK
FT                   QQELPIPSVSLSTEKNEALALETANIAEPTALSAVEEADNHNINELAKQFAEFEQQRLL
FT                   KMEQQAREIGAEDALKVILAEEVTEDVPAVMEEVIEEKELSQSAVNYKTYGDSLIHPAL
FT                   QQKVTVQEKPTTPLPSLDLLERRTIQTYNITQEEILETSQRIMQQLRNFNVKAEVRDVL
FT                   VGPVVTRYELELQPGVKASKVTSIDTDLARALMFRSIRIAEVIPGKPYIGIETPNIQRQ
FT                   IVPLRDVLDTDEFRQSNYLLPMALGKDISGKPVIVDLAKMPHLLVAGSTGSGKSVGVNT
FT                   MILSLLFRVKPEEVKFIMIDPKVVELSVYNGIPHLLTEVVTDMKKAANALRWCVDEMER
FT                   RYQLLSALRVRNIEGYNEKITEYEALNMPIPNPLWRPGDTMDTLPPPLEKLSYIVLIVD
FT                   EFADLMMVAGKQVEELIARLAQKARAIGIHLILATQRPSVDVITGLIKANIPSRIAFTV
FT                   ASKIDSRTILDQGGAEALLGRGDMLYSAQGSSELLRVHGAFMSDDEVVRVADDWRARGK
FT                   PSYIEGILDSVNDESNDNETDYDSNGDLDDLFDEVVEFVINTGITSASSVQRRFRVGFN
FT                   RAARIMDQLEEQGIVSPLQNGKREVLARKGDY"
FT   gene            complement(422466..432413)
FT                   /locus_tag="HSM_0377"
FT   CDS_pept        complement(422466..432413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0377"
FT                   /product="YadA domain protein"
FT                   /note="PFAM: YadA domain protein; Haemagluttinin domain
FT                   protein; Hep_Hag repeat-containing protein; KEGG:
FT                   hso:HS_1616 possible large adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32015"
FT                   /db_xref="GOA:B0UWS3"
FT                   /db_xref="InterPro:IPR005594"
FT                   /db_xref="InterPro:IPR008635"
FT                   /db_xref="InterPro:IPR008640"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR024973"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWS3"
FT                   /protein_id="ACA32015.1"
FT                   /translation="MNKIFKTKYDITTGQCKAVSELASNRHVASSSEKPKCGGVLRTFK
FT                   VLPLVLVIAGFFGVSTISNAAWLAIDSSKGTVGIANWQNEYGEKNNNGNIVLGKENLHK
FT                   VNGQNTKLEKVVVIGAGDKTKATGEGLVAVGYGAQALRDGATAVGYESIVAGTNGTALG
FT                   AESKAQGAQATAIGNNVYAVAQGTALGADVMAAGGASIAIGGDDIFENGNKVNYGEPNL
FT                   KAGEGGFADRLPEATIKQIYGYSGSRASSNVTYNSILNWNDFYKKYVKADDGKDHRMYS
FT                   PTYAAGVGAIAIGSRSVGYGNASLAMGTLSFALADRSTAVGVRAFVGLGADGATAIGDS
FT                   SRVFAKNSYAIGNAAESTAEGSLSFGSGAKAVGMGSIAIGPNVSSNAKLTDMSAEKFRT
FT                   QIMQETKLGTVNENQDPHFKTVTTDINDLKVGDNNEIVKYGFPANHFNGNNKVSELITK
FT                   LEKANKFEYEKESKVEITTTEDIKKTRQQGNHAISLGYHISNNGDNTIAIGSASYVRGA
FT                   NSVVLGALNNVGKYATNTIAIGIGTNVHKENSVAIGTGTTILGAGSIGIGSGVGVKKDN
FT                   SIAIGYGSSAFSESSMALGNDSKINENAKNSVALGNNSSSSSENSVALGYRSTTNYFYT
FT                   GSDKTTASLNEKNAYNASSLEGYVPEGSSYRIETDTSAGVISVGGWDTTKDAKGGPGSS
FT                   KGNKNHVGLRRIVNVAPGALDSDVATVGQLRALYYVKKEGLVVYYTEENGKKVKLVKSA
FT                   GDNKFYKVDTRTGEPLANSPAISEDKVLVGAKGFDEKIGTKDLGNKIQFGNLKDGKIEP
FT                   NSDQAITGNQLNQLGGSILGLSVNTDKTKFTTPNFTAVEYISTPESKKGATHTFKDALD
FT                   ETIKAINQGYKFSDGTNQPTTPFYLGSTIVIKAGDIQSGNSKTHLGKNLKTEFKNDNSK
FT                   PTFTIGLKDDPEFKTVKLTGNPTDDKHAVNKKYVDDKFKNVATSFNVNGDNGTFKVTSK
FT                   LDIKGDNGNIKTNASGSAVTISLKDTLTGISSIAGKNGNSGNKIDFTNSDGLKLSSKSG
FT                   STITLKRDGLDLGNKKITQLAKGTADTDAANFGQLKELATTVLGATVNSGGFTKSTFNQ
FT                   LIGSNGATASTPATAKTFKQAIDDNIAKINKGFIFSDGTTEGTRYFGEKITIQSGVIDG
FT                   GDFASDNIKTNYGKDQGVFRIGIKKDPRFEKVTVTENVTDKSPEMTLTTKKYVDDQFKN
FT                   FSSDLKFETDSGGEKKISLKDGKLKVKGTANQIKTSVESNDTIKIGLDEKITQKINETA
FT                   TKADKNEQYIATIKTNIEGKITDQVIKYKANSSGDYTVKLSEGLNFKNGTNTTAVVESN
FT                   GVVKFNVNEALTNITSIAGKEVANGGSGNVKVKTEIKFNENGKGNNANTNVVILSNGAK
FT                   YTFDPKGFHVGNKQITALASGLGLTDTSGSGGSAGNNSTVIANVLAGDPDKGNNNGNKI
FT                   SNNAINVKDLSEVAKALVEKGLKFQGNDNQDVTRKLGETLKIVGETAISAAGTTATTQI
FT                   TTAPDNIIVAKKNGTNGKADTLEIKLSKNLTGIASIANGEKAKIALGGSNGSDNKITFK
FT                   AGSSEVTLADGKFSGVSEINKADGKGALKLEDGKATLESTKDGSSIVVDNAGASIKVGT
FT                   NKASYTFSDSGLDLNSKKLTNLASGLELNGAGGSSGNGNADIIDKVLAGTLDSTNSGGS
FT                   STTIANNAVNVKDLSEVAKAIVQKGLTFAGNTGTDVKASLGDKITIKGEGTYLTSKASS
FT                   NGSGKEITFSLTDKVTNKLAIINVGNGSTNGDNSFALGKNSTWEGKTTAATSADINVGS
FT                   ASLKFDWNNAGAGADKEVVSVGSQGNERIIKHVAAGSVMPNSTDAINGGQVYSVIETFG
FT                   KLGVTVLGAEVDSGTKQFKATTFTKLKDKDGSETSPAPTTFKQAIEKSIETINKGLKFK
FT                   GDKSAGSNNEAKQLYLGSTLTIKGAESTAQTPAQGAGVAKHQNITTTAKDGGILEIALN
FT                   TNLKDITSIGKDGDNVLTFANGASGSSGGNSAVLKVGGSELTFTKADGNKVTITGLADG
FT                   KSDGDAVTVKQLTASQLHYLSVKNGTSNTSTGTRTDNYNNDGAKGDKSIAIGVNTKTDM
FT                   GAIGAVALGSGAEVKSEYGVAIGHGTVVGTGAKNSIAISATKDSDKGNLQNAEWAISIG
FT                   NKNNVSGGNDIVALGSNITISKNNGKSNDSVIAIGNTVTLQNAKQSIGVGRDTKITNAE
FT                   WAVSIGNNNSITGGNDIVALGSNITVSGSGNDSVLVFGNSAKAESASNSVVIGREAESK
FT                   AQSAVVLGKGANVKQNATGAVAIGEGATVEENAGDSVALGKNSKASDKKNAPSGAEVFA
FT                   GKNSLKITWASAGTSSDMAKDKTVVSVGDKGSERIITNVAAGKVETGSTDAINGGQLAE
FT                   VISIFGKLGFDVLGAEKHDTDDGFKQSTFAKVEYKRASQGTQQGQQQEQAKAPTTFREA
FT                   INESITAINKGLMFSADQSAVTNGTQNTPHYLGSTLSIVRLGMNQAGSSATPAPAGTSS
FT                   QPNIAEFKGDNLITQYTRETNGNAKIEIGFKNAPIFEKVTLSQKQMYENGTGSGSGASG
FT                   STVGENDLITKGYLEQALNKFKFKVENGSGKPIEIGRGDTLKFTNGQNIQVTVANGNGS
FT                   ATQPSSSASASAPAPTPAAPAPSPAPAAAPPSASASSTTTTPTTSTTTTGTPTAPTTAV
FT                   VTIATTDTLENIKSISSPKGSAGGNGAGSNEEVTKLSLTSENATFQVGTTGAKVNINKE
FT                   GIALMPQGANNTGGANGANPFADTASITIKAGAKPVNKDSLESFEKGQEPSITFSTKET
FT                   DGKKIGSGKITGLKDLENGADGTSAVNKNYVDEQVKNLNNNRPFDFYLGNEKVVKGADG
FT                   SFKKLKDGTLQDISEEEKKQVVIKAEPSTAPIGISNVASGLGLEAQTEEEKKKTQEKSA
FT                   ELTKAVEEKVKAVSKEAKALSDKAQTFTDLALAVSSLEQAINALPEGNDKTQAEAKLKE
FT                   NQMKLDEAKKALEQARNDLKEAQTGLTKAEEAYEQNYKGYEKVVELVKPDSSAELTNVA
FT                   TIGDLQAVAKSGLKFKGNDDMEIRTALSGTLAIKGEEGANGNKFNSDRTAAGNIKVEMS
FT                   QDGKGLEVKLSDQLKNMTSFETREINGKKSRLDSNGLNVENTSTKERSQLNENRLAFYE
FT                   NDKLGLNLDGKSRALRLGEKSVISINAKGEALVSDLNTSSSGMAIANKNYVDTKDNELR
FT                   TQLNTTDRNLRAGIAGALAAAGLPMSSVPGKSMFAASAGTFKGQNALALGYSRVSDNGK
FT                   ITLRLQGTRSSTGDVGGSVGVGYQW"
FT   gene            complement(432942..433523)
FT                   /locus_tag="HSM_0378"
FT   CDS_pept        complement(432942..433523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0378"
FT                   /product="peptidylprolyl isomerase FKBP-type"
FT                   /note="PFAM: peptidylprolyl isomerase FKBP-type; KEGG:
FT                   hso:HS_1631 FKBP-type peptidyl-prolyl cis-trans isomerase
FT                   (rotamase)"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32016"
FT                   /db_xref="GOA:B0UWS4"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWS4"
FT                   /protein_id="ACA32016.1"
FT                   /translation="MKVEKNVVVSIAYQVRTEDGVLVDEAPANQPLEYLHGHQNLVIGL
FT                   ENALEGKSVGDKFEVRVKPEEGYGEYNENMVQRVPKDIFVGVDELVVGMRFIADTDLGP
FT                   LPVVITEVNENEVVVDGNHMLAGQELHFSVEVIATREATLEEMAHGHIHTEGGCCAHDN
FT                   DEEGHHCGCGGHHHEHHEHHGCCGNHGCKS"
FT   gene            complement(433580..433993)
FT                   /locus_tag="HSM_0379"
FT   CDS_pept        complement(433580..433993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0379"
FT                   /product="protein of unknown function DUF1260"
FT                   /note="PFAM: protein of unknown function DUF1260; KEGG:
FT                   hso:HS_1630 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32017"
FT                   /db_xref="GOA:B0UWS5"
FT                   /db_xref="InterPro:IPR009671"
FT                   /db_xref="InterPro:IPR016716"
FT                   /db_xref="InterPro:IPR036701"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWS5"
FT                   /protein_id="ACA32017.1"
FT                   /translation="MTALVDLQEETRKIITDLLNDGSDPDALYIIEHHIAHDDFDKLEK
FT                   IAVDAFKAGYEVSEAEEFEDEQGKSIFCFDIISEVNLKAEIIDAQQKDLLPLITKFGGI
FT                   YDGWGTYFEDPNATEDEYGNDGEFFDEYPNEDE"
FT   gene            complement(434010..434495)
FT                   /locus_tag="HSM_0380"
FT   CDS_pept        complement(434010..434495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0380"
FT                   /product="RNA methyltransferase, TrmH family, group 2"
FT                   /note="TIGRFAM: RNA methyltransferase, TrmH family, group
FT                   2; PFAM: tRNA/rRNA methyltransferase (SpoU); KEGG:
FT                   hso:HS_1629 possible tRNA/rRNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32019"
FT                   /db_xref="GOA:B0UWS6"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWS6"
FT                   /protein_id="ACA32019.1"
FT                   /translation="MLDIVLYEPEIPQNTGNIIRLCANTGFRLHLIEPLGFTWDDKKLR
FT                   RSGLDYHEFAQIKKHKTFNEFLNTEQPNRLFALTTKGTPAHSQVNFELGDYLMFGPETR
FT                   GIPMPILDNLPTTQKIRIPMIENSRSMNLSNAVAVTVYEAWRQLNYINAMNLSPLPK"
FT   gene            complement(434667..436283)
FT                   /locus_tag="HSM_0381"
FT   CDS_pept        complement(434667..436283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0381"
FT                   /product="Phosphoenolpyruvate carboxykinase (ATP)"
FT                   /EC_number="4.1.1.49"
FT                   /note="PFAM: phosphoenolpyruvate carboxykinase (ATP); KEGG:
FT                   hso:HS_1628 phosphoenolpyruvate carboxykinase (ATP)"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32020"
FT                   /db_xref="GOA:B0UWS7"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR015994"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UWS7"
FT                   /protein_id="ACA32020.1"
FT                   /translation="MTDLNKVINELGELGIYDVKEIVHNPSYEQLFEEETKPGLAGFEK
FT                   GVVTTSGAVAVDTGIFTGRSPKDKYIVLDEKTKNTVWWTSDAAKNDNKPMNQETWQSLK
FT                   GLVTKQLSGKRLFVIDAFCGANPDTRLAVRIVTEVAWQAHFVKNMFIRPSDEELQNFKP
FT                   DFTVMNGSKVTNPNWKEQGLNSENFVAFNITEGVQLIGGTWYGGEMKKGMFSMMNYFLP
FT                   LKGIASMHCSANVGKDGDVAIFFGLSGTGKTTLSTDPKRQLIGDDEHGWDDDGVFNYEG
FT                   GCYAKTIKLSAESEPDIYRAIRRDALLENVVVREDGSVDFDDGSKTENTRVSYPIYHID
FT                   NIVKPVSKAGHATKVIFLTADAFGVLPPVSKLTPEQTKYYFLSGFTAKLAGTERGITEP
FT                   TPTFSACFGAAFLSLHPTQYAEVLVKRMKDSGAEAYLVNTGWNGTGKRISIKDTRGIID
FT                   AILDGSIESAEMGSLPIFDLAIPKALPGVDPAILDPRDTYADKAQWQAKAEDLASRFVK
FT                   NFEKYATNEEGKALIAAGPKA"
FT   gene            complement(436463..437722)
FT                   /locus_tag="HSM_0382"
FT   CDS_pept        complement(436463..437722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0382"
FT                   /product="Glycine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /note="PFAM: Orn/Lys/Arg decarboxylase major region;
FT                   glycine hydroxymethyltransferase; aromatic amino acid
FT                   beta-eliminating lyase/threonine aldolase; KEGG:
FT                   hso:HS_1627 glycine/serine hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32021"
FT                   /db_xref="GOA:B0UWS8"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UWS8"
FT                   /protein_id="ACA32021.1"
FT                   /translation="MLKRSMNIADYDPVLWQAIQDENLRQEEHIELIASENYASPRVME
FT                   AQGCQFTNKYAEGYPGKRYYGGCEYADIVEQLAIDRAKALFGADYANVQPHSGSQANAA
FT                   VYMALLNPGDTILGMSLAHGGHLTHGASVSFSGKIYKAEQYGITSEGLIDYDALRKQAH
FT                   EVKPKMIVGGFSAYSQIVDWAKMREIADEVGAYLFVDMAHVAGLIAAGVYPSPMPHAHV
FT                   VTTTTHKTLAGPRGGLILANGNEELYKKLNSAVFPAGQGGPLVHVIAAKAVCFKEALEP
FT                   EFKTYQAQVVKNAKAMVKVFKQRGYNVVSNGTENHLFLVDLVNHGLTGKAADAALSRAN
FT                   ITVNKNAVPNDPQKPFVTSGIRVGTPAVTRRGFNEEDVAELAGWMCDILDSMNKDNHEQ
FT                   VIADTKEKVLAICKRLPVYP"
FT   gene            complement(437865..439163)
FT                   /locus_tag="HSM_0383"
FT   CDS_pept        complement(437865..439163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0383"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="TIGRFAM: phosphoribosylamine--glycine ligase; PFAM:
FT                   phosphoribosylglycinamide synthetase; protein of unknown
FT                   function DUF201; KEGG: hso:HS_1626
FT                   phosphoribosylamine--glycine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32022"
FT                   /db_xref="GOA:B0UWS9"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWS9"
FT                   /protein_id="ACA32022.1"
FT                   /translation="MNILIIGNGGREHALVWKVAQSPLASKIFVAPGNAGTAMETDGKC
FT                   AVENVAISATDIDALVNFAQENQIGLTIVGPEAPLVLGVVDAFRASGLKIFGPTQAAAQ
FT                   LEGSKAFTKDFLARHHIPTAEYRSFTDAEKAIAYVREKDAPIVVKADGLATGKGVIVAM
FT                   TLAEAEKAIQDMLSGNAFGKAGSKVVIEEFLEGEEASFIVMVDGKNVEPMATSQDHKRV
FT                   GENDTGPNTGGMGAYSPAPVVTPEIHTRIMQQIIYPTVNGMAKEGNIYTGFLYAGLMID
FT                   KHGQPKVIEFNCRFGDPETQPVMMRMRSDLVELCLNACEGKLDQVKSEWSEQAALGIVL
FT                   AAEGYPNNYRKGDEIQGLPISAGENQKVFLAGVEQKGERLLTNGGRVLCVTAMGENVFA
FT                   AQQQALKLAKQIQWSGRFYRQDIGYRAVARENQ"
FT   gene            complement(439160..440776)
FT                   /locus_tag="HSM_0384"
FT   CDS_pept        complement(439160..440776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0384"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; KEGG: pmu:PM0223 DcaA protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32023"
FT                   /db_xref="GOA:B0UWT0"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR040423"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWT0"
FT                   /protein_id="ACA32023.1"
FT                   /translation="MKNIIVLLSYSAVLLISEILYRYFFGINSLYKISESFLIIFILIS
FT                   LFYFSKYKITRFIILLFFSCSTLVNNVHYEVYQSWINGTNYLLMFKEYWEVTNAGIHML
FT                   DKISGGIIWGVFDILIFSSISRFRKKTYLIADILFLLSMAYIFIRSFYSDQELGITSNP
FT                   GYSRIKANYFSFGYFIGRTLPYDLFNLSNVSVYYKDKPKPKPKFSFQIPNIIWIMGESV
FT                   SANNVSALGYERETTPFLTSLSKNFPTETLLKPAYSAGSRTAISLPSLFNAIPKPNGLE
FT                   QIVSGRTNLFRLAKEQGYETYFYSSQPENQMMIMSLMGKTWVDDLRFPNSLGYKSSEGM
FT                   HDHNLFPLLENIDLSEVGGGKKHFVVLHQRGSHTPYAYYLSEQEKVFKENTPLDKYDST
FT                   IYNTDKLIEKVFNYLKTSLKPEDWVLIYTSDHGQFVSNEVYNQGTLNEANYLVPIFIYS
FT                   ENKFLQDIFHNHFSSCKKMFHQQLATFLINIMSYDMDISDCRDGTINHSILTGDSGYLN
FT                   IKENTPPAFFIPKKQLRKEKQ"
FT   gene            complement(440792..442390)
FT                   /locus_tag="HSM_0385"
FT   CDS_pept        complement(440792..442390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0385"
FT                   /product="phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase"
FT                   /EC_number="2.1.2.3"
FT                   /note="TIGRFAM: phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase; PFAM: MGS domain
FT                   protein; AICARFT/IMPCHase bienzyme formylation region;
FT                   KEGG: hso:HS_1625 phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32024"
FT                   /db_xref="GOA:B0UWT1"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UWT1"
FT                   /protein_id="ACA32024.1"
FT                   /translation="MQLNHPIRQALLSVSDKSGIVEFAQGLVRRGVKLLSTGGTAKLLA
FT                   ENGIPVTEVSDYTGFPEMMEGRVKTLHPKIHGGILGRRGIDDEVMMQHQIDAIDMVVVN
FT                   LYPFAATVAKPDCTLEDAVENIDIGGPTMVRSAAKNHQHVAIVVNNSDFNAILAEMDQN
FT                   RNSLTLETRFDLAIKAFEHTAQYDSMIANYFGQMVKPYFRAEEEAEAKCGQFPRTLNLN
FT                   FIRKQSMRYGENGHQKAAFYVEQDVKEASVSTAKQLQGKALSYNNIADTDAALECVKSF
FT                   SEPACVIVKHANPCGVALGKDILEAYNRAYQTDPTSAFGGIIAFNRELDEDTAKAIIER
FT                   QFVEVIIAPTVSSAAQEIVKSKKNVRLLMCGNWESAIQRLDFKRVNGGLLVQEADLSMV
FT                   DLADLEVVSKRQPTKQELEDLLFCWKVAKFVKSNAIVYAKNNQTVGIGAGQMSRVYSAK
FT                   IAGIKAKDEGLEVKGCVMASDAFFPFRDGIDAAAKVGIECVIHPGGSMRDQEVIDAANE
FT                   HNMVMVLTKMRHFRH"
FT   gene            complement(442525..443034)
FT                   /locus_tag="HSM_0386"
FT   CDS_pept        complement(442525..443034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0386"
FT                   /product="protein of unknown function DUF335 SprT"
FT                   /note="PFAM: protein of unknown function DUF335 SprT;
FT                   SMART: protein of unknown function SprT; KEGG: hso:HS_1624
FT                   SprT protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32025"
FT                   /db_xref="GOA:B0UWT2"
FT                   /db_xref="InterPro:IPR006640"
FT                   /db_xref="InterPro:IPR023483"
FT                   /db_xref="InterPro:IPR035240"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWT2"
FT                   /protein_id="ACA32025.1"
FT                   /translation="MPKTEQNLAEFRHIKMQIQRRLRDCLILAEQYFQCNFEMPTVSYD
FT                   VRGMKAGVAYLQQNSIKLNRTLLLENPQQFIQQVVPHELAHLIVYQQFGRVKPHGSEWQ
FT                   HVMNKIFQLPADTCHQFDVTNVRGKTFTYQCQCQTHQLSARRHHNIQQKSAVYFCKKCQ
FT                   GILVRI"
FT   gene            complement(443112..444266)
FT                   /locus_tag="HSM_0387"
FT   CDS_pept        complement(443112..444266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0387"
FT                   /product="Methionine adenosyltransferase"
FT                   /EC_number="2.5.1.6"
FT                   /note="PFAM: S-adenosylmethionine synthetase; KEGG:
FT                   hso:HS_1623 S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32026"
FT                   /db_xref="GOA:B0UWT3"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UWT3"
FT                   /protein_id="ACA32026.1"
FT                   /translation="MSSYLFTSESVSEGHPDKIADQISDAVLDEILRQDPKARVACETY
FT                   VKTGMALVGGEITTSAWVDIENLTRQVICDIGYKHSDIGFDGHSCAVLNAIGKQSSDIN
FT                   QGVDRESPLDQGAGDQGIMFGYATNETDVLMPAAITYAHRLMERQAQVRKKGILDWLRP
FT                   DAKSQVTLKYEDNRIVGIDAVVLSTQHSDNVDQKTVHEGVMEEIIKPILPAEWLSKETK
FT                   YFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGAARHGGGAFSGKDPSKVDRSAAYAARY
FT                   VAKNIVAAGLADRCEIQLSYAIGVAEPTSIMVETFGTGKVANELLVGLIREFFDLRPYG
FT                   LIKMLDLIQPIYRQTAAYGHFGRAQFPWEKVDRAEELRAAASLK"
FT   gene            444543..445121
FT                   /locus_tag="HSM_0388"
FT   CDS_pept        444543..445121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0388"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: hso:HS_1622
FT                   (di)nucleoside polyphosphate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32027"
FT                   /db_xref="GOA:B0UWT4"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR022927"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UWT4"
FT                   /protein_id="ACA32027.1"
FT                   /translation="MIDFDGYRPNVGIVICNAERQVLWAKRYGQNSWQFPQGGINDNET
FT                   AEQAMYRELYEEAGLTPKDVEILYVSKHWLRYKLPKRLLRHDNRPICIGQKQRWFLLQL
FT                   VSDEKRINMQHTKSPEFDGWRWVSFWYPVRQVVTFKKDVYRKVMKEFALFLFDTNLKSR
FT                   LSVPEEKKMFSSVKKKLIHKKNHKYSSNQ"
FT   gene            445132..445926
FT                   /locus_tag="HSM_0389"
FT   CDS_pept        445132..445926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0389"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   hso:HS_1621 possible permease"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32028"
FT                   /db_xref="GOA:B0UWT5"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWT5"
FT                   /protein_id="ACA32028.1"
FT                   /translation="MLTFFLICLGVGTFAGFLAGLFGIGGGLIIVPTLVYLLPMVGVPD
FT                   NLLMSTALGTSFATIVITSFSSAQRHYKLGNVVWDAVKILIPTLMLSTFVFTGIVSQLD
FT                   KSLSSKLFAVLVAYMAIRMVISTKIQIKNTKKLTPLSSVIGGVLIGIVSSIAGIGGGGF
FT                   IVPFLNSRGVDIKKAIGSSAVCGMLLGLSGALSFMRSGWGVTEMPEYSLGYVYLPAVLG
FT                   ITITSFFTSKIGATTTSKLPVPTLKRYFAIMLCVIALNMLFK"
FT   sig_peptide     445132..445203
FT                   /locus_tag="HSM_0389"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.620) with cleavage site probability 0.391 at
FT                   residue 24"
FT   gene            445936..446748
FT                   /locus_tag="HSM_0390"
FT   CDS_pept        445936..446748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0390"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /note="PFAM: prolipoprotein diacylglyceryl transferase;
FT                   KEGG: hso:HS_1620 prolipoprotein diacylglyceryl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32030"
FT                   /db_xref="GOA:B0UWT6"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWT6"
FT                   /protein_id="ACA32030.1"
FT                   /translation="MNTFFQMPYIDPVMFSLGPVSLHWYGVMYLLGFGFAYWLGMARAK
FT                   KSNGVWTSEQLEQLLYNGFFGVILGGRIGDVFFYNVDKFFADPLYLFRIWEGGMSFHGG
FT                   LIGVILAMIWTSRRQRRCFWQTADFVAPLIPFGLGMGRIGNFINSELWGRVTDVPWAII
FT                   PYASTAPRHPSQLYEAFLEGFILLIILNFYIRKPRPTGSVAGLFLIGYGIFRFLVEYVR
FT                   EIDHNVNTIDDLLTRGQLLCLPMIFGGLAVMIWSYSRSKANKSAVKKG"
FT   gene            446755..447606
FT                   /locus_tag="HSM_0391"
FT   CDS_pept        446755..447606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0391"
FT                   /product="Thymidylate synthase"
FT                   /EC_number="2.1.1.45"
FT                   /note="PFAM: thymidylate synthase; KEGG: hso:HS_1619
FT                   thymidylate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32031"
FT                   /db_xref="GOA:B0UWT7"
FT                   /db_xref="InterPro:IPR000398"
FT                   /db_xref="InterPro:IPR020940"
FT                   /db_xref="InterPro:IPR023451"
FT                   /db_xref="InterPro:IPR036926"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UWT7"
FT                   /protein_id="ACA32031.1"
FT                   /translation="MRQYLNLCQRIIDQGHWVENERTGKRCLTVINADLTYDVANNQFP
FT                   LITTRKSYWKAAIAEFLGYIRGYDNAADFRKLGTKTWDANANENQAWLNNPVRKGTDDM
FT                   GRVYGVQGRRWRKPNGETVDQLRKIVNNLSKGIDDRGEILTFFNPGEIDLGCLRPCMHT
FT                   HTFSLLGDTLYLTSYQRSCDVPLGLNFNQIQVFTFLALMAQITGKKAGQAYHKIINAHI
FT                   YEDQFELMRDVQLKREPFPLPRLEINPDIKTLEDLETWVTMDDFKVIGYQCHEAIKYPF
FT                   SV"
FT   gene            447628..448128
FT                   /locus_tag="HSM_0392"
FT   CDS_pept        447628..448128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0392"
FT                   /product="CMP/dCMP deaminase zinc-binding"
FT                   /note="PFAM: CMP/dCMP deaminase zinc-binding; KEGG:
FT                   hso:HS_1618 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32032"
FT                   /db_xref="GOA:B0UWT8"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWT8"
FT                   /protein_id="ACA32032.1"
FT                   /translation="MRSDFDEKMMRYALSLADKAEALGEIPVGAVLVDKQGDILAEGWN
FT                   LSIIHNDPTAHAEIIALRQAGQKLQNYRLLDTTLYVTLEPCTMCAGAILHSRIGRLVFG
FT                   AYDYKTGAVGSRFHFFNDYKMNHMLEITGGVLQEECSQKISTFFQKRRKQKKHLKPNFK
FT                   PFL"
FT   gene            complement(448099..450132)
FT                   /locus_tag="HSM_0393"
FT   CDS_pept        complement(448099..450132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0393"
FT                   /product="excinuclease ABC, B subunit"
FT                   /note="TIGRFAM: excinuclease ABC, B subunit; PFAM: helicase
FT                   domain protein; UvrB/UvrC protein; type III restriction
FT                   protein res subunit; SMART: DEAD-like helicases; KEGG:
FT                   hso:HS_1617 excinuclease ABC, subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32033"
FT                   /db_xref="GOA:B0UWT9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWT9"
FT                   /protein_id="ACA32033.1"
FT                   /translation="MSKINSKPFILHSDFQPAGDQPQAIAKLAENLNDGLAHQTLLGVT
FT                   GSGKTFTIANVIAKLNRPAMVLAPNKTLAAQLYAEMKAFFPENAVEYFVSYYDYYQPEA
FT                   YVPSSDTFIEKDASINDQIEQMRLSATKSFLERRDTIVVASVSAIYGLGDPDSYLKMML
FT                   HLQHGAIVDQRQILAKLAELQYTRNDQVFQRGTFRVRGEIIDIFPAESDDRAVRIELFD
FT                   DEIERLSLFDPLTGANFGAIPRYTIYPKTHYVTPRERILEAIEKIKLELQARREYLLAN
FT                   NRLVEEQRLTQRTQFDIEMMNELGYCSGIENYSRYLSGRDEGEPPPTLFDYIPSDGLLI
FT                   IDESHVTVPQIGGMYRGDRSRKETLVEYGFRLPSALDNRPLRFEEFERLAPQTIYVSAT
FT                   PGPYELEKSGDEIIDQVVRPTGLLDPEVEIRPVAIQVDDLLSEARKRAEQNERVLVTTL
FT                   TKRMAEDLTDYLEEHGIRVRYLHSDIDTVERVEIIRDLRLGEFDVLVGINLLREGLDIP
FT                   EVSLVAILDADKEGFLRSERSLIQTIGRAARNLNGKAILYADSITKSMQKAIDETHRRR
FT                   EKQMKYNAEKGVVPQALNKKVGELLDIGQGAITKSKTKARAKTVAESSALYQKINSPKD
FT                   YQQQVKKLEQQMYKFAQDLEFEKAAAIRDQLQELKERFKVGL"
FT   gene            450581..460450
FT                   /locus_tag="HSM_0394"
FT   CDS_pept        450581..460450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0394"
FT                   /product="YadA domain protein"
FT                   /note="PFAM: YadA domain protein; Haemagluttinin domain
FT                   protein; Hep_Hag repeat-containing protein; KEGG:
FT                   hso:HS_1616 possible large adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32034"
FT                   /db_xref="GOA:B0UWU0"
FT                   /db_xref="InterPro:IPR005594"
FT                   /db_xref="InterPro:IPR008635"
FT                   /db_xref="InterPro:IPR008640"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR024973"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWU0"
FT                   /protein_id="ACA32034.1"
FT                   /translation="MNKIFKTKYDITTGQCKAVSELASNRQIASSSESKPKCGGFWGNF
FT                   LRAFKVLPLALLLAGFFSNFAYAANVWLENKKDLSQNGQLNEGTGVWFDGSNMENPSKT
FT                   ESTILSSGENSTGEFAQKAGFKNKSFNRTVVIGSRAVGGGDATTVIGYRAIAGANLSER
FT                   HKLSSQGTSIGYRTFARGEGATAMGNDSTAWGDNAIAIGSDNAKATSTSQIDSRAERPL
FT                   SRDVWNLVHSKRSDFLYTDEYATTYQKLDTYDKYLGVKDDSEAYKLKRSHTWARGHNSI
FT                   AIGARSIAYGDNSTAMGTLATAIGNYSTSLGAFSMAFGDRSIAIGNESYVYAGGSVGVG
FT                   NEVQAISDGAMVYGLESYAGGDGSIAIGKRALANVEMGDMFKNAVENGKNLYEAESTFS
FT                   KLGELDNSVQDYFKPSTEYQQGSGEHKAKRNKNSGKQDATGGLAIGYYVSALGENSLAL
FT                   GRQAYAKGDRSMAIGPYAYGAEEKTAALGYRSKAIGKQSMALGSLSRAEGKNSIAIGVN
FT                   SAVKNESSSNKRNGVNTIAIGNETEATMDNSVALGYKSTTKYFYNKSDNSTATLNGDEA
FT                   ISLPSYAPEGTSYKLQTDNAAGIVSVGWKKSDSELGLRRIVGVAAGALDSDVATVGQLK
FT                   ALYYVKKEGVVTYYTKEPDGKITKLTKDGSKFYRVNTKDGTPYKELQEVDAKDVFVGPK
FT                   GANEETREEMKDGKKYSLGNMGNLIKFANILDGEISATSDQAVTGGQLNDLNGKLGLTL
FT                   NSKKTGFEKVQFDAVEVADENVKKGKIENFKEALTDSIAAINRGYKFIDDNSQNSDKDT
FT                   PFYLGSTIKIVAGNISAQPNSKPQETYLGKNLKTKFEKEPSNNSIAKFTIGLKDDPTFT
FT                   KVSLEAEQTYNSDPSKNTVKDTKELITKGYLDGALKNVASSFTVKGDDTSKSLSIDKNH
FT                   TTLTIKGGNNITTAVDTNQKALTISLNESLTGITSISGKNGSGSNRSAVAKIEFDSTAS
FT                   GSNASTPNVKITTGGGTFIFSENGLNLGSKKITGLAEGSDDTDAVTFKQLKDSKLHFLS
FT                   VKAPTSPESKSNYNNDGAKAEGAIAIGVDAKTDKANAIVIGNSVTVDQEKSIALGNDIN
FT                   IKQSKAGYSTVAIGNKITMNESGGSIVLSAMNQWNGPDDGITLNNVGWGVILGNKTKIE
FT                   GGNDIVALGNNMNVTRSNGSKHDLNSNLIILGNGAKAHDAKESVVIGNVADVKAQSAVA
FT                   IGKGATIEANATGAVAIGESATVSTNAGDSIALGKNSKAEMKKAAPTGFTVNAGANDLK
FT                   ITWSSAGAGGSKSVVSVGDKGSERIITNVAAGKVDTDSTEAVNGGQLKSVIDVFANLGV
FT                   TVLGAEKNDTGDGFKKSKFDAVKTGDTVNSQAQVKSEKPFKTAIEDNITAINKGLKFAG
FT                   DNGGEAKQLYLGSTLTIKGATGPASKPTTSAGQNGAGTHQNIFTTAKNTGILEIALNEE
FT                   LKGIKSVANGDDVKIELKTTGTGGNGTTKSIVFTAGDTNNKVTLTGNKFSGVSEISSKD
FT                   SKSKLTLGADNATVELEHGKSKLELKDTEATITAGTDAGSIKINNNGDTKIELSPESGS
FT                   TVTLAKDSTNGVKATGLSTVGLDGDNTLVFKNGTNSTNTAELKVGGAALTFTSTGNGTG
FT                   GTAQTVKISNVAAGKIDTSSTEAITGKQLADLATHLGVSVDSGKTGFTAPSFEVIKGGT
FT                   KDATSGKNGPTTFKGAIDQLITAVNGGLTFKGNDNSSTKLQLGGTLTIDSSTVGSGSEK
FT                   DITAKLEPSNGNDSKDAGKLTLTLNKATSVDKNDEKVITSKAVATELEKYTKTADLGNA
FT                   YLKIDGSNIGDASNKKTFGGHVGIAEIKLDGEKSSTELVQADAVIKYLKGTGPDSVKIS
FT                   DSTKTMAKGNYSISIGHEAVSENAESIAIGYMTHAQNKKSIALGNESEVLGEKSIAIGT
FT                   ENKIDGEGKYSTVLGVENKVSSKFTYLIGYNNDIKGDNTFVLGSNILTDNSIKNAVILG
FT                   DRSKGEANAVSVGGAGDGEQRRIVYVATPTDKYDAVNKQYVDGLGLKFKGNDNKEIHKK
FT                   LSDTLEIVGKGLNKAQTTKFNGTNGNIAVKENKGKLEISLNRDLKGIKSISDRKNKNIA
FT                   TEIRFNSKNSTSSIPNSLTNNLTISSNGGTFEFNRTGLHINNKQITGLRSGLLEKHNGQ
FT                   DRERKDLNYLIGDEFKNSSIQTHAVNVGDLAKISKEIVEKGYKYKADIPSNNSNDTSIK
FT                   LGSTISIVKWTDTPATGQPAVTVGTGTTSQTSAVKYTGDNLTTRYTYDSSNGNAKIEIG
FT                   FKDAPTFSKVTLSQAQTYGKGSSVGNNDLISKSYLDAALKDFKFNVEYGGKQVQIGRGD
FT                   TLKFADGLNIKLELKEVEKPANEATSTINSNMETSTPAPTTVSTPSDGANDADVATTTA
FT                   EVTIDTTEELKNITSISSKGSAGGNDADSTVEVTKLTLEADKGATFRVGNTGAKVNVNS
FT                   DGISLTPKGASGTSPSDDVASITIKAGSKPVDSNSIDLLDPANGPSIAFAAKGGSNGSK
FT                   EGTGTIKYLKDRTVSKNNGNGDKYGEGDNKGNAATEGAVKELYESGLKFAGNEGEPVHK
FT                   KLGETLSIKGEGAVGETATDNIVVRAKEGELQIGLTKNIRNIDTISIAGTGDNSGKDVF
FT                   IDAEGMTTTAQLEDGTVLVNNQTAEGVSTIAKKEDGSILVNNQTAEANILSNGKHTTEV
FT                   KAGEVAIKDKSGQEIVSLKVAEGENGQDGKGATLAFAKDGENGTGVIMGLKDLDATADG
FT                   SSAANKNYVDEKMSDLDSNRPFNFYIQEGKEYTKVVKGRDGKFYDPELLQGAKYDVDSK
FT                   KYIAQDGQEVTPESDKVIIRAEPTTAPIGINNVASGLGILAIEESEKQQLTQAVEDKKN
FT                   KVSESEKALAQTTADVKSKQQALTEKTNELSQVASERPVLLMQKADLEQQLKGLGASDP
FT                   RRATAQAALDKVKEALTQNDQKVTEATKTANEASEALKQAKVALADNVLKAYAAQQALA
FT                   TAEETLRNKEFGVDKVKDLLSGSSNIAEDNVATIKDVKALAKAGLSFEGNDGKRLHKDL
FT                   SETLAIKGEENASGDKFNSNHTAAGNIKVEMAQDGKGLEVKLSDQLKNLTSVETKKDDQ
FT                   GRSTTLLSRGVMVQNDTTKEQAQFSENRLAFFKDGALGLNLDGKSRALKVGEKAIISIN
FT                   DKGEALVSDLNEFSSGMTITNKNYVDTKNNELRTQLNNTDRTLRAGIAGSNAAAGLASV
FT                   SMPGKSMLAISAAGYGGENAVAIGYSRMSDNGKIMLQLQGNRNSRGKAAGSVSIGYQW"
FT   gene            460772..462007
FT                   /locus_tag="HSM_0395"
FT   CDS_pept        460772..462007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0395"
FT                   /product="tryptophan halogenase"
FT                   /note="PFAM: monooxygenase FAD-binding; FAD dependent
FT                   oxidoreductase; tryptophan halogenase; KEGG: hso:HS_1615
FT                   possible dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32035"
FT                   /db_xref="GOA:B0UWU1"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWU1"
FT                   /protein_id="ACA32035.1"
FT                   /translation="MEKFDVVIIGAGPSGSVSASLLHKQGLKVCVLEKQHFPRFVIGES
FT                   LLPYCMDILQEADLVEAVHAEKSFQFKNGAAFTWGNRYTYFDFTDKFTAGPGTTYQVRR
FT                   GIFDKILIDETAKKGVEVRFGHEVSAFDNQGDQAELAVKTEQGEEYRLSAGFVLDASGY
FT                   GRVLPRLLYLETPSHLPIRIAHFTHIDDNIDDPIFDRNKILITTHPEHRDVWLWLIPFA
FT                   DNRCSIGVVGLPEILAGESETVLKKFALECPMLSKILAKANWENEFPYRHIQGYSANVK
FT                   TLHGKHFALLGNAAEFLDPVFSSGVTIALHSARLASRLIARGLQGQAVDWQQEFADPLM
FT                   VGVNAFRTYVNGWYDYSFQDVIYARNPQPEIRQMLSSILAGYAWDEKNPFVTKSSPRLK
FT                   ALAELCGEATQD"
FT   gene            462083..463690
FT                   /locus_tag="HSM_0396"
FT   CDS_pept        462083..463690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0396"
FT                   /product="protein of unknown function DUF195"
FT                   /note="PFAM: protein of unknown function DUF195; KEGG:
FT                   hso:HS_1614 possible DNA recombination protein RmuC"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32036"
FT                   /db_xref="GOA:B0UWU2"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWU2"
FT                   /protein_id="ACA32036.1"
FT                   /translation="MPSFENLSFITALLFFCICLILFFIFVRKQREVEALQQELDKNIN
FT                   IFNQLLNKYERIKDEKTQLGQQVVKAQTLVETGQIRLSERDEKILYLQKELDKEQLRCE
FT                   QVSQLVTGLKERLGVVSTQAESFQQQLNQSRAEKEKRDCAWADLNQKHTALQQELTELK
FT                   VTLSEKEKNFVEQQQNFSQAKQLLSVEFQNLANRILEEKSQRFNQTNQQTLDSLLKPFR
FT                   EQIDGFQKRVNEIHSESLKGNASLESEIKKVLDIGLAMSKEANNLTSALKGEKKTLGNW
FT                   GEVQLERTLQLAGLIENEHYSSQVHFKNEQGKHNYPDFILHLPDNKHLIIDSKISLVAY
FT                   ESAVNSDDENQRKLGLQEHVKALKNHIDDLSRKDYSNLIGMRSPNFVLMFVAVEAAYIE
FT                   AMKHDSNLFNYGYEKNVILVSHTTLMPILRTVANLWRIERGNLEAKEISAKAGEIYNQI
FT                   CVVAERLNKLGNSLSGVSNHYNNTVTALVGQQGLVGKVERFKDLSAKANKIMPEIELLH
FT                   NDINVEKLIAVQAEVEEK"
FT   gene            463750..464679
FT                   /locus_tag="HSM_0397"
FT   CDS_pept        463750..464679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0397"
FT                   /product="ADP-L-glycero-D-manno-heptose-6-epimerase"
FT                   /note="TIGRFAM: ADP-L-glycero-D-manno-heptose-6-epimerase;
FT                   PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; KEGG: hso:HS_1613
FT                   ADP-L-glycero-D-manno-heptose-6-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32037"
FT                   /db_xref="GOA:B0UWU3"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR011912"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UWU3"
FT                   /protein_id="ACA32037.1"
FT                   /translation="MIIVTGGAGLIGSNIIAALNDMGRRDILVVDNLTDGTKFVNLVDL
FT                   DIADYCDKEDFIASIIAGDDFGDIDAIFHQGACSATTEWNGKYLMQNNYEYSKELLHYC
FT                   LLREIPFFYASSAATYGDKTDFIEERQFEGPLNVYGYSKFLFDEYVRQILPQATSPVCG
FT                   FKYFNVYGPREQHKGSMASVAFHLNNQMLKGENPKLFAGSEHFLRDFVYVGDVAKVNLW
FT                   AWQHGISGIYNCGTGRAESFEQVARAVLNYHGKGEIETIPFPEHLKSRYQEYTQANLTK
FT                   LRAAGYQAEFKSVAEGVAEYMQWLNRKS"
FT   gene            464815..465855
FT                   /locus_tag="HSM_0398"
FT   CDS_pept        464815..465855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0398"
FT                   /product="lipopolysaccharide heptosyltransferase II"
FT                   /note="TIGRFAM: lipopolysaccharide heptosyltransferase II;
FT                   PFAM: glycosyl transferase family 9; KEGG: hso:HS_1612
FT                   ADP-heptose--LPS heptosyltransferase II"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32038"
FT                   /db_xref="GOA:B0UWU4"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011910"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWU4"
FT                   /protein_id="ACA32038.1"
FT                   /translation="MKILVIGPSWVGDMIMSHSLYQTLKQQYPDCLIDVLAPNWCKPLL
FT                   ARMPEVRNAITMPIGHGSFDLKGRYRIGKSLRNQYDMAIVLPNSLKSAFIPAFAKIPVR
FT                   RGWIGESRYFLLNDWRRNKNDYPMMVQRYVALGYDKTVLPTAKHLAIPKPYLQVDAQEL
FT                   EQTLETFAKQTALCTNRPVIGFCPGAEFGPAKRWPHYHYADLARQLIEQGYAVRLFGSA
FT                   KDKEVGEQISQALPQKLQHYCVNLAGETDLNQAVDLISDCVAVVSNDSGLMHIAAALNK
FT                   PLVAVYGPTSPEYTPPLSDNAVIIRLIEGGLIKVRKSQDSSEGYHQSLIDITPQMVIEK
FT                   LQDFLN"
FT   gene            465857..466822
FT                   /locus_tag="HSM_0399"
FT   CDS_pept        465857..466822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0399"
FT                   /product="lipopolysaccharide heptosyltransferase I"
FT                   /note="TIGRFAM: lipopolysaccharide heptosyltransferase I;
FT                   PFAM: glycosyl transferase family 9; KEGG: hso:HS_1611
FT                   lipopolysaccharide heptosyltransferase-1"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32039"
FT                   /db_xref="GOA:B0UWU5"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011908"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWU5"
FT                   /protein_id="ACA32039.1"
FT                   /translation="MKVCLIKTSSMGDVIHTLPALTDAQNAIADLQVDWVVEENFAEIP
FT                   RWHSAVNHVIPLAIRRWRKQLFSAQTRNEWKNYRTLLQQNQYDAVIDAQGLVKSALFGA
FT                   SLAKGVKHGYDRHSIREPFASFFYDKKYTISYQQHAVERIRQLFAQSLGYELPHEKGDY
FT                   GIAKHFVHSTENAQHYVVFVHSTTRADKHWLDAEWKKLAQKLTALGLQIRLPWGNEKEK
FT                   ARADWIAQDIQSAVVLPKLSLTELAQQITYAKAVVSVDTGLAHLTAALDVPNITLYGAT
FT                   DPKLIGTYGKHQHYIQKQGMALISAEDVLSELQSKEILKF"
FT   gene            complement(466872..467696)
FT                   /locus_tag="HSM_0400"
FT   CDS_pept        complement(466872..467696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0400"
FT                   /product="Diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /note="PFAM: diaminopimelate epimerase; KEGG: hso:HS_1610
FT                   diaminopimelate epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32042"
FT                   /db_xref="GOA:B0UWU6"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UWU6"
FT                   /protein_id="ACA32042.1"
FT                   /translation="MQFSKMHGLGNDFVVVDAVTQNIYFPTEVIKRLADRNRGIGFDQL
FT                   LVVEPPYDPDLDFHYRIFNADGSEVSQCGNGARCFARFVVLKGLTNKKEIAVSTAKGKM
FT                   MLCVKDDDMVCVNMGEPIWEPNKIPFNANKFEKNYIIRTDIQTLLCGVVSMGNPHCVTQ
FT                   VEDIQHANIEILGPLLESHERFPERVNAGFMQIINRNHIKLRVYERGAGETQACGSGAC
FT                   AAVAVGIMQGVLGSCVQVDLPGGRLMIEWQGKGHPLYMTGEATHIYDGVIRL"
FT   gene            468014..468646
FT                   /locus_tag="HSM_0401"
FT   CDS_pept        468014..468646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0401"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hso:HS_0337 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32043"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWU7"
FT                   /protein_id="ACA32043.1"
FT                   /translation="MRIIANHDGNPPISASSRQNTFSPSIFFETTYNILPQTEIGLGLG
FT                   YIKRKGFEHSASWGIHGGGEYAPISDNTGIETYKIPRYASLPIYFILKQDYALSRNTNL
FT                   YFKANLGYSINKISNTQYKYYTDLEQENVFKLSEFQSGLRPMKVKNGLYLGLGLGIEYK
FT                   AFLAEIGYYHTKSKVTRKNYNYEIRNSIYESTSYNNDAIRLTLGVKF"
FT   gene            complement(468685..469182)
FT                   /locus_tag="HSM_0402"
FT   CDS_pept        complement(468685..469182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0402"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein B"
FT                   /note="TIGRFAM: molybdopterin-guanine dinucleotide
FT                   biosynthesis protein B; PFAM: molybdopterin-guanine
FT                   dinucleotide biosynthesis MobB region; KEGG: hso:HS_1609
FT                   molybdopterin-guanine dinucleotide biosynthesis protein B"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32044"
FT                   /db_xref="GOA:B0UWU8"
FT                   /db_xref="InterPro:IPR004435"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0UWU8"
FT                   /protein_id="ACA32044.1"
FT                   /translation="MQPMLGITGYSGSGKTTLLEKLLPELLRLGLRVSVIKHSHHNAQI
FT                   DKEGKDSWRMKEVGATQVMLACDNRWALMTETPKPVTLDYLAQQFSPQLTDLILVEGFK
FT                   QDPIAKILLHRQNMTKPCPPCDEYVIALATDYPVQTSVPLLDINNPTQIATFILAWYKT
FT                   KT"
FT   gene            complement(469196..469630)
FT                   /locus_tag="HSM_0403"
FT   CDS_pept        complement(469196..469630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0403"
FT                   /product="positive regulator of sigma E, RseC/MucC"
FT                   /note="PFAM: Positive regulator of sigma(E) RseC/MucC;
FT                   KEGG: hso:HS_1608 possible positive sigma-E factor
FT                   regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32045"
FT                   /db_xref="GOA:B0URG8"
FT                   /db_xref="InterPro:IPR007359"
FT                   /db_xref="InterPro:IPR026268"
FT                   /db_xref="UniProtKB/TrEMBL:B0URG8"
FT                   /protein_id="ACA32045.1"
FT                   /translation="MLTERAIVIAYHQGKATVKCQSKNACSQCTAKNTCGTSALSELTG
FT                   KSPEHIFIVNSLIPLKIGQIVELGLQESSLISTALLLYIIPLMTLLSATLIANQIFSQE
FT                   LWGAIFILFCTALSFVLIHSYSKKWQHKKAFQPILLRIIQ"
FT   gene            complement(469638..470576)
FT                   /locus_tag="HSM_0404"
FT   CDS_pept        complement(469638..470576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0404"
FT                   /product="sigma E regulatory protein, MucB/RseB"
FT                   /note="PFAM: MucB/RseB family protein; KEGG: hso:HS_1607
FT                   sigma-E factor regulatory protein RseB precursor"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32046"
FT                   /db_xref="InterPro:IPR005588"
FT                   /db_xref="InterPro:IPR033434"
FT                   /db_xref="InterPro:IPR033436"
FT                   /db_xref="InterPro:IPR038484"
FT                   /db_xref="UniProtKB/TrEMBL:B0URG9"
FT                   /protein_id="ACA32046.1"
FT                   /translation="MLKIFSFLTALLTFSVSTFAQENIEPEQLLEKMIAAQNTLNYEIY
FT                   FVQATPTNIDSLRYRHINQDGKSYAQLITLDGVQQEIIQHENLVSYFQPNFQAFSLKSG
FT                   HIMDNLPVVMWSDVKQLSDYYDIVTIGRNRVADRIVQTLRILPKDDFRYQYLVFIDEQN
FT                   HLLLRSDMLDREGNLLEQFRVVNLYLGDELIELGSYIDNVIFPPLLSEPKTQQQNWKPE
FT                   WLPKGFKLISQSITIEKDNKHPIESQFYSDGLFSFALYLSNSIVDNDGERFWKQGSTTF
FT                   YSNTLGNKELTFVGQLPLFSAKRIIQDIRIK"
FT   sig_peptide     complement(470514..470576)
FT                   /locus_tag="HSM_0404"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 21"
FT   gene            complement(470640..471224)
FT                   /locus_tag="HSM_0405"
FT   CDS_pept        complement(470640..471224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0405"
FT                   /product="anti sigma-E protein, RseA"
FT                   /note="PFAM: Anti sigma-E protein RseA family protein; Anti
FT                   sigma-E protein RseA domain protein; KEGG: hso:HS_1606
FT                   sigma-E factor negative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32047"
FT                   /db_xref="GOA:B0URH0"
FT                   /db_xref="InterPro:IPR005572"
FT                   /db_xref="InterPro:IPR005573"
FT                   /db_xref="InterPro:IPR026279"
FT                   /db_xref="InterPro:IPR036147"
FT                   /db_xref="UniProtKB/TrEMBL:B0URH0"
FT                   /protein_id="ACA32047.1"
FT                   /translation="MQKELLSAYIDGEHCGNKFTDTLCQNKDLQNSWSNYHLIRSIIRK
FT                   ESKVLLGSDFTARMGTLIEQEEKIQIEHSLESQPTLAEVEKLPFIQKIRSFFSPMLQMA
FT                   VAATVCFVAVLGVQSFNHERAGKNTLDTPTLQTLPFNNSVQEISYNVPRKEIITQEQVE
FT                   QRNKRIGIMLQNYELQRRLHTDSFGLPNNEH"
FT   gene            complement(471257..471832)
FT                   /locus_tag="HSM_0406"
FT   CDS_pept        complement(471257..471832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0406"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-70; RNA polymerase
FT                   sigma-70 RpoE type; PFAM: sigma-70 region 2 domain protein;
FT                   sigma-70 region 4 domain protein; Sigma-70 region 4 type 2;
FT                   KEGG: hso:HS_1605 RNA polymerase sigma-E factor"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32048"
FT                   /db_xref="GOA:B0URH1"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014286"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:B0URH1"
FT                   /protein_id="ACA32048.1"
FT                   /translation="MAEQLTDQALVEKVQQGDKKAFNLLVARYQNKVAGLLTRYISQND
FT                   IPDVVQESFIKAYRSIESFRGESAFYTWLYRIAVNTAKNYLTAQGRRPPTEDILAEDAE
FT                   SYNVGTNLRDVNTPENEILSGELKKVVFDTISNLQEDLKTAITLREMEGLSYEEIAEIM
FT                   DCPVGTVRSRIFRAREIIESKIQPLIQR"
FT   gene            complement(471938..472192)
FT                   /locus_tag="HSM_0407"
FT   CDS_pept        complement(471938..472192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0407"
FT                   /product="protein of unknown function DUF339"
FT                   /note="PFAM: protein of unknown function DUF339; KEGG:
FT                   hso:HS_1604 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32049"
FT                   /db_xref="InterPro:IPR005631"
FT                   /db_xref="InterPro:IPR036714"
FT                   /db_xref="UniProtKB/TrEMBL:B0URH2"
FT                   /protein_id="ACA32049.1"
FT                   /translation="MEKYNKFRIEWDCRRGMLELDKVIMPFFQQYFDELPDAKKDIFLR
FT                   LLACSDLQLFSWFFNKTPAADLELQEMVDHIQENLNLYQ"
FT   gene            complement(472366..473007)
FT                   /locus_tag="HSM_0408"
FT   CDS_pept        complement(472366..473007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0408"
FT                   /product="2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase"
FT                   /note="TIGRFAM: 2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase; PFAM: KDPG and
FT                   KHG aldolase; KEGG: hso:HS_1603
FT                   2-dehydro-3-deoxyphosphogluconate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32050"
FT                   /db_xref="GOA:B0URH3"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031337"
FT                   /db_xref="InterPro:IPR031338"
FT                   /db_xref="UniProtKB/TrEMBL:B0URH3"
FT                   /protein_id="ACA32050.1"
FT                   /translation="MRYTTEQIIDKLKQLKVVPVIALDKAEDILPLAKTLSENGLPVVE
FT                   ITFRSEAAEEAIKLVHQQYPEVLIAAGTVLTKEQVLAAKNAGANCIVTPGFNPNIVKYC
FT                   QELNIPVTPGVNNPMAIESALELGIQAVKFFPAEASGGVKMIKALLGPYGNLQIMPTGG
FT                   ISPQNIKDYLAIPNVVACGGSWFVEKSLIKSQQWEEIGRLTREVVELVKS"
FT   gene            complement(473055..474458)
FT                   /locus_tag="HSM_0409"
FT   CDS_pept        complement(473055..474458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0409"
FT                   /product="Glucuronate isomerase"
FT                   /EC_number="5.3.1.12"
FT                   /note="PFAM: Glucuronate isomerase; KEGG: hso:HS_1602
FT                   glucuronate isomerase (uronate isomerase)"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32051"
FT                   /db_xref="GOA:B0URH4"
FT                   /db_xref="InterPro:IPR003766"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0URH4"
FT                   /protein_id="ACA32051.1"
FT                   /translation="MMKFMTEDFLLSTSTAQKLYHDYAEEQPIFDYHCHLNPKEIAENR
FT                   QFNDLAEIWLEGDHYKWRAMRSAGVEEHLITGSADKYSKYLAFANTVPKCIGNPIYHWT
FT                   HLELRRPFGITDTIFSPETAEKIWHKGKELLQQPEFSARGIMKKMNVNLVGTTDDPIDS
FT                   LEYHKAIAEDNTFDVEVVPSFRPDRAFKIELPLFNDYIEQLGKVADIEINTFDKLKQAL
FT                   SKRIEHFDKYGCKSADHGMEIVRFSPIPDEKTLDQILQKRLNNQPIEEEEIAQFSTALL
FT                   VWLGTEYHKHHWVMQLHIGAIRNNNTRMFKLLGADAGFDSIGDRAFAESLSRLLDSMDQ
FT                   TDQLPKTILYCLNPRDNEMLGTMIGNFQTGGIAGKIQFGSGWWFNDQKDGMERQLQQLS
FT                   QLGLLSQFVGMLTDSRSFLSYTRHEYFRRILCEMIGGWVERGEAPNDLNLLGKMVKDIC
FT                   YDNAKRYFK"
FT   gene            complement(474468..475883)
FT                   /locus_tag="HSM_0410"
FT   CDS_pept        complement(474468..475883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0410"
FT                   /product="sugar (Glycoside-Pentoside-Hexuronide)
FT                   transporter"
FT                   /note="TIGRFAM: sugar (Glycoside-Pentoside-Hexuronide)
FT                   transporter; PFAM: major facilitator superfamily MFS_1;
FT                   KEGG: hso:HS_1601 glucuronide permease"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32053"
FT                   /db_xref="GOA:B0URH5"
FT                   /db_xref="InterPro:IPR001927"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR039672"
FT                   /db_xref="UniProtKB/TrEMBL:B0URH5"
FT                   /protein_id="ACA32053.1"
FT                   /translation="MSSTQRPFGLKDKLAYMAGDIANDLSFMMSAFFLMLFYTNVLQIE
FT                   GYVVGLLFLVSRFIDAFTDIGMGRLVDTIKPFKEGRFRGLIRRATPFICISGFLLFLHI
FT                   VKDWSYTAKLVYITVTYIVWGSLAYTAVNIPYGSMASVITTKADERAGLSIFRTVGANI
FT                   AVLFISFVIPLIIYKEVEGKQVIIPEMFTYIMGAFMICAFILYQICWRFSVERVQLPEK
FT                   EGRRHNKSHNKSDCLDDVKAIFSSLFSNSALLIFILIAIILLLATLIIGTMNPYLYVDY
FT                   FNSKLALSFGGILGAVTTFMVAPFAQNIVKKYGKKESASVGLLITAVIYSVLFFVKITN
FT                   VWLFIIVALIATLGLSYFQIIIWAFITDIIDNQFIKTGRREDGTIYAVYSFARKIGQAL
FT                   AGGLGGFALSYIGYSAKIPQQPQEVLESIYNFATGVPALACILIFLLLKYVYPLSKEKV
FT                   DENASILEQKITQ"
FT   gene            complement(475909..477669)
FT                   /locus_tag="HSM_0411"
FT   CDS_pept        complement(475909..477669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0411"
FT                   /product="glycoside hydrolase family 3 domain protein"
FT                   /note="PFAM: glycoside hydrolase family 3 domain protein;
FT                   KEGG: hso:HS_1600 possible beta-hexosamidase A, glycoside
FT                   hydrolase family 3"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32054"
FT                   /db_xref="GOA:B0URH6"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:B0URH6"
FT                   /protein_id="ACA32054.1"
FT                   /translation="MSVDLTKKPYYLKDEDIQWVKNTIANMTLEEKIGQLFVNMGSSRS
FT                   EEYLTDVLNRYHIGAVRYNPGPAEEVYDQNYILQTKSKIPLLIAANTEAGGNGACSDGT
FT                   EIGLQVKIGATDDAKYAYEMGRVAGIEAAAIGCNWSFAPIVDISYNWRNPIISNRVFGS
FT                   NPEKVLEMSLAYMKGIQESGIAPAAKHFPGDGVDERDQHLSFSVNSFSCEEWDKTFGKV
FT                   YQGLIDAGLPSLMAGHIHLPAYEQHFNPNLAYEDCLPATLSKPILTDLLRGKLGFNGVV
FT                   VTDASHMVAMTSAMKRSEMLPTAIAAGCDLFLFFNDPDEDFGYMMEGYKNGIITEERLH
FT                   DALTRILGLKAKLGLHNRPRETLLEPKEQALAKIGLPEHKAIFRDVADKAITLVKHKQD
FT                   IFPINVERFPRILLVNVKGTDGGFGKMVAGSQRSATEILKEKLEEKGFTVSIYTSPMDN
FT                   ILKMSDEEQVKTIRNEYSQKRPITTLTDHYDLIINVANVQMSTVQRIVWQATKGTPDIP
FT                   FYVHEVPTIFVSVQCPFHLVDVPQVKTYINAYDGKEPTIELLVEKLMGNSEFKGISPVD
FT                   AFCGYKDTRI"
FT   gene            complement(477711..478526)
FT                   /locus_tag="HSM_0412"
FT   CDS_pept        complement(477711..478526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0412"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hso:HS_1599 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32055"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B0URH7"
FT                   /protein_id="ACA32055.1"
FT                   /translation="MTTFIPKHKFIVCIDSDGCAMDTMNIKHDKCFGPYAVEIFGLTDE
FT                   ARFIEIWNRINLYSQTRGINRFKGLILSLEEYGYEQDFTQLKHWVNTTSELSNRSLIQA
FT                   IQDNHTDDLKLALAWSEKVNMGIKTLHTQDKPFRLVKRSLAIIKEFADIAVVSSANNEA
FT                   ILDEWTRHGLFPFVDLVYGQDEGTKTHCLNQLAQYGYQPNNILMVGDSPGDLNSANEAS
FT                   VNFFPILCGNEDESWDQLVLETLGKLVYQKFDSQYQAQLVAKFNANLTA"
FT   gene            complement(478536..479381)
FT                   /locus_tag="HSM_0413"
FT   CDS_pept        complement(478536..479381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0413"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   hso:HS_1598 oxidoreductase, short-chain alcohol
FT                   dehydrogenase/reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32056"
FT                   /db_xref="GOA:B0URH8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0URH8"
FT                   /protein_id="ACA32056.1"
FT                   /translation="MNIANNHDFKGKVVVITGAGGVLCAFFAQEIAKTGAKVALLDINL
FT                   ESAEQYAQAIVQNGGIAKAYKTNVLDLESIQQTRDAIEKDFGTCDVLINGAGGNSPKAT
FT                   TDNEFHEFNLADSTKSFFDLDKNGIEFVFNLNYLGTLLPTQVFAKDMIGKKGANIINVS
FT                   SMNAYTPLTKIPAYSGAKAAISNFTQWLAVYFSKVGIRCNAIAPGFLVSNQNRGLLFDS
FT                   EGNPTARANKILTNTPMGRFGEAHELMGGILFLMDENYASFINGVVLPIDGGFSAYSGV
FT                   "
FT   gene            479631..480392
FT                   /locus_tag="HSM_0414"
FT   CDS_pept        479631..480392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0414"
FT                   /product="GntR domain protein"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: hso:HS_1597 uxu operon regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32057"
FT                   /db_xref="GOA:B0URH9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0URH9"
FT                   /protein_id="ACA32057.1"
FT                   /translation="MMATSPEELRSYKKIGQELKAELLRGTYGIGDKLPAERDLSQYFN
FT                   VSRTVIREALIMLELENLVEVRKGSGVYVINLPKSSSEETEDLPDVGPFELLQARQLLE
FT                   SSIAEFAAIQATRADVLHLKEILDRERRTLECGDDEDYIADEDFHKAIAEITQNEVVIR
FT                   MQKDLWEYRINSPMWKGLHAHISDQSYRYLWLKDHENIIVAIQRKNPVLARKMMWQHLE
FT                   NVKQKLFELSDLDDPNFDGYLFNVSPLAADF"
FT   gene            480411..481595
FT                   /locus_tag="HSM_0415"
FT   CDS_pept        480411..481595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0415"
FT                   /product="mannonate dehydratase"
FT                   /EC_number="4.2.1.8"
FT                   /note="TIGRFAM: mannonate dehydratase; PFAM: Mannonate
FT                   dehydratase; KEGG: hso:HS_1596 mannonate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32058"
FT                   /db_xref="GOA:B0URI0"
FT                   /db_xref="InterPro:IPR004628"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0URI0"
FT                   /protein_id="ACA32058.1"
FT                   /translation="MEQTWRWYGPNDPVSLDDVRQAGATGVVTALHHIPNGQVWSVEEI
FT                   NKRKALLEEKGLVWSVVESVPIHEDIKTQTGNYQQWIDNYKQTLRNLASCGIDIVCYNF
FT                   MPVLDWTRTDLEYEMPDGSKALRFDQVAFAAFELYILKRPGAEETYSPEEQAEAKAYFD
FT                   QMSEADIAKLTKNIIAGLPGSEEGYTLEEFQAQLDRYKGISTEKFRTHLAYFLNEIVPV
FT                   AQEVGIRMAIHPDDPPRPILGLPRIVSTIDDMQWFVDTQPLAANGFTFCTGSYGVLAEN
FT                   DLVKMAEKFADRIYFVHLRSTQREENPRSFHEADHLAGDVNMFGVTKALLTEEYRRKAN
FT                   GDNRLIPMRPDHGHQMLDDLKKKTNPGYSAIGRLRGLAEFRGLELALKKVYFND"
FT   gene            complement(481817..482344)
FT                   /locus_tag="HSM_0416"
FT   CDS_pept        complement(481817..482344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0416"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hso:HS_1595 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32059"
FT                   /db_xref="UniProtKB/TrEMBL:B0URI1"
FT                   /protein_id="ACA32059.1"
FT                   /translation="MFKRISLFLCIGLISACSVKSVTSYTSSENNIKTVINLDNDKIDQ
FT                   KSYATAYAVAVQSYQGRVNKEYHVNAFVSGVKDWYSAKISVPINQIKEKLFQRNGLDSD
FT                   VHTYYSGILFAFGLQTNFNRLSSTCWSHLDQASLTQGIYDAMLDLKNNRVRSEDDQYLV
FT                   QGSEQILKLCVK"
FT   sig_peptide     complement(482279..482344)
FT                   /locus_tag="HSM_0416"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.548 at
FT                   residue 22"
FT   gene            482505..483116
FT                   /locus_tag="HSM_0417"
FT   CDS_pept        482505..483116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0417"
FT                   /product="protein of unknown function DUF489"
FT                   /note="PFAM: protein of unknown function DUF489; KEGG:
FT                   hso:HS_1594 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32060"
FT                   /db_xref="GOA:B0URI2"
FT                   /db_xref="InterPro:IPR007451"
FT                   /db_xref="InterPro:IPR035932"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0URI2"
FT                   /protein_id="ACA32060.1"
FT                   /translation="MANYQDITFALAGVCQAAKLVQQLAMNGTVDQEILRTGLSTLLQT
FT                   APEDTLAVYGGQKSNLKLGLETLMEQLNGSDVTLNRYWLGLLALEGKLHKNAQAKSELA
FT                   RRIQYLPTQLAHYDLLDEQMLSTLASIYVDVISPLGARIQVQGSPLYLQQLMTQNRIRA
FT                   CLLTGIRSAVLWRQVGGTKWQFLFSRRKLVATAQQIYSSI"
FT   gene            483140..484507
FT                   /locus_tag="HSM_0418"
FT   CDS_pept        483140..484507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0418"
FT                   /product="adenylosuccinate lyase"
FT                   /note="TIGRFAM: adenylosuccinate lyase; PFAM: fumarate
FT                   lyase; Adenylosuccinate lyase domain protein; KEGG:
FT                   hso:HS_1593 adenylosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32061"
FT                   /db_xref="GOA:B0URI3"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR013539"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:B0URI3"
FT                   /protein_id="ACA32061.1"
FT                   /translation="MQFNALTALSPIDGRYQDKVTALRSIFSEFGLLKFRVTVEVRWLQ
FT                   KLSATGTIQEVSSLSKEANDYLNQLVENFSLQDAERIKEIERITNHDVKAVEYFLKEKS
FT                   LAIPELVAISEFIHFACTSEDINNLSYALMLKNARDEVLLPEWRKLIDEITRLATEYKA
FT                   IPLLSRTHGQPASPTTIGKEMANVVYRLQRQFKQLQHVEILGKINGAVGNYNAHLSAYP
FT                   EIDWHQFSQEFVTSLGLTWNPYTTQIEPHDYIAEFFDNVARFNTIIIDFDRDLWGYIAL
FT                   NHFKQRTIAGEIGSSTMPHKVNPIDFENSEGNLGLANAVMSHLGAKLPISRWQRDLTDS
FT                   TVLRNLGVGLGYCLIAYAATLKGISKLEVNEPHLREELNQNWEVLAEPIQTVMRRYGIE
FT                   KPYEKLKELTRGKRVNAEAMREFIEKLEIPAHEKARLKQLTPETYIGSAISLVEKL"
FT   gene            complement(484587..485024)
FT                   /locus_tag="HSM_0419"
FT   CDS_pept        complement(484587..485024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0419"
FT                   /product="putative acetyltransferase, GNAT family"
FT                   /note="KEGG: hso:HS_1592 possible acetyltransferase, GNAT
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32062"
FT                   /db_xref="GOA:B0URI4"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B0URI4"
FT                   /protein_id="ACA32062.1"
FT                   /translation="MKIFKAELWNLDALLSLFEQYRLTHNMIENPERTLIFLSNRIRFS
FT                   ESIFFLAVDNQQNPVGFIQLYPRFSSLQLQRYWQLNDIFVKNTQNKSEIYTALIAKAKE
FT                   FVSYTQSTLLVMEQNLQQPELLIREGFKLNRQKSIFELNLT"
FT   gene            485192..485959
FT                   /locus_tag="HSM_0420"
FT   CDS_pept        485192..485959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0420"
FT                   /product="Triose-phosphate isomerase"
FT                   /EC_number="5.3.1.1"
FT                   /note="PFAM: triosephosphate isomerase; KEGG: hso:HS_1591
FT                   triosephosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32064"
FT                   /db_xref="GOA:B0URI5"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0URI5"
FT                   /protein_id="ACA32064.1"
FT                   /translation="MARRPLVMGNWKLNGSKAFTKELITGLKDELNAVSGCDVAIAPPV
FT                   MYLAEAEAALVSSDIALGTQNVDLNKQGAFTGDISTEMLKDFGVKYVIIGHSERRQYHH
FT                   ESDEFIAKKFGVLKDAGLVPVLCIGESEAENEAGKTEEVCARQIDAVMNTLGVEAFNGA
FT                   VIAYEPIWAIGTGKSATPAQAQAVHAFIRGHIAKQSQAVAERVIIQYGGSINDANAAEL
FT                   FTQPDIDGALVGGASLKASAFAVIVKAAAKAKN"
FT   gene            486057..487337
FT                   /locus_tag="HSM_0421"
FT   CDS_pept        486057..487337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0421"
FT                   /product="Three-deoxy-D-manno-octulosonic-acid transferase
FT                   domain protein"
FT                   /note="PFAM: glycosyl transferase group 1;
FT                   Three-deoxy-D-manno-octulosonic-acid transferase domain
FT                   protein; KEGG: hso:HS_1590 3-deoxy-D-manno-octulosonic-acid
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32065"
FT                   /db_xref="GOA:B0URI6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:B0URI6"
FT                   /protein_id="ACA32065.1"
FT                   /translation="MWSFFYTSIMYCIQPFVLVYNLIRSFKSPNYRKRILERYAFYPSL
FT                   TEPKPNGVVIHAASVGEVIAATPLVKKIQQQYPHLSITFTTVTPTGSDRVKAAFGQSVF
FT                   HVYLPYDLPDAILRFIDFVKPKMCIVIETEIWPNLIKQLYLRDIPFVIANARLSERSAK
FT                   RYGWVKAQLQNMFSQISLIAPQDEVSLQRYIDLGYNPSKLKLTGNIKYDLVVNDELVQK
FT                   ITALRQSWSQNRPVWIAASTHEGEEMIILQAHQKLLKTYPQLLLILVPRHPERFNLVAE
FT                   LIEKQKLNYIRRSAHVNPDLLTQVVLGDTMGELMLMYGISDIAFVGGSLVKHGGHNPLE
FT                   PLAFKLPVISGQYTFNFPVVYQNLSEVQGVVLVNENSQELESAVKNLLSSPELCERYGN
FT                   AGYEVLVQNRGALQRLFELLQPYLEKE"
FT   gene            487337..487813
FT                   /locus_tag="HSM_0422"
FT   CDS_pept        487337..487813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0422"
FT                   /product="pantetheine-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /note="TIGRFAM: pantetheine-phosphate adenylyltransferase;
FT                   cytidyltransferase-related domain; PFAM:
FT                   cytidylyltransferase; KEGG: hso:HS_1589 lipopolysaccharide
FT                   core biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32066"
FT                   /db_xref="GOA:B0URI7"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0URI7"
FT                   /protein_id="ACA32066.1"
FT                   /translation="MTTVIYPGTFDPITNGHMDIIQRSAVLFSKVIVAVAKNPSKQPLF
FT                   NLAERVELVQLSVVHLDNVEVIGFDDLLANVVKARQIDAIIRGVRTTMDFEYESQLAHL
FT                   NRLLTNGVESLFLPPTEQWSYVSSTIVRDIFLHQGDVSRLVPAAVLRALEKRAK"
FT   gene            487887..489725
FT                   /locus_tag="HSM_0423"
FT   CDS_pept        487887..489725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0423"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: hso:HS_1588 ABC transporter, ATP-binding/permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32067"
FT                   /db_xref="GOA:B0URI8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B0URI8"
FT                   /protein_id="ACA32067.1"
FT                   /translation="MLNKIFVWFESRLNPYPEQTFNHLHQGLFRFIWSNLEGMKKWIFL
FT                   LAFLSFGLGAMEAILFQFMGVLVEWLSQYDVQTLWVEKGAYLVGMLILLLFSIIWSFLA
FT                   SATRLQTLQGVFPMRLRWNFHRLMLGQSLSFYQDEFAGRVSAKVMQTALALRDTVLTLA
FT                   DMMVYILVYFVTSGIVLAALDIWLLVPFVLWLIVFVVILWIVIPELAKKAEQQADSRSL
FT                   MTGRITDAYANISTVKLFSHGAREAAYAKRSMQDFMMTVHAQMRLATSLDTLTYSTNVA
FT                   LTLSTGILGIVLWGKGLVGVGAIATALAMALRVNGLSRWIMWEMARLFENIGTVNDGMS
FT                   TLTKPLTIVDKPDAQDLEIKQGNIHFNNVDFAYTPDKPLLTNFNLHIKAGEKVGLIGRS
FT                   GAGKSTIVNLLLRFYETQQGSITIDGQSVADVSQESLRRQIGLVTQDTSLLHRSVRDNI
FT                   VYGRPEATEEEMVEAAKRAEAAEFIPFLSDSQGRQGYDAHVGERGVKLSGGQRQRIAIA
FT                   RVMLKDAPILLLDEATSALDSEVEIAIQNSLDKMMENKTVIAIAHRLSTIAAMDRLIVL
FT                   DQGRIVEQGTHTELLEKNGLYAKLWQHQSGGFLSEY"
FT   gene            complement(489808..490683)
FT                   /locus_tag="HSM_0424"
FT   CDS_pept        complement(489808..490683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0424"
FT                   /product="Myo-inositol catabolism IolB domain protein"
FT                   /note="PFAM: Myo-inositol catabolism IolB domain protein;
FT                   KEGG: hso:HS_1587 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32068"
FT                   /db_xref="GOA:B0URI9"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR021120"
FT                   /db_xref="InterPro:IPR024203"
FT                   /db_xref="UniProtKB/TrEMBL:B0URI9"
FT                   /protein_id="ACA32068.1"
FT                   /translation="MISAKSYQYDHIGENMSYLLSKSRKDNPAANGEVQKITPESAGWE
FT                   YVGFEMYHLQAGQTLSFNTETTETCFVLVSGKATVSAGGETYNNIGNRTTPFEKIPPYS
FT                   VYAPHHQQIEIKAETYLELAVCRAPSNGDLPVRLITPEQVGVERRGFGNNKRLVHNILP
FT                   ETEKADALLVVEVFTDEGNTSSYPSHKHDQKDSPDETYLEESYYHRFDKPQGFALQRVY
FT                   TDDRTLDECMAVYDGDVVLVPKGYHPVATIAGYNNYYLNVMAGPVRKWKFTWEQDHQWI
FT                   NSSAYADKFK"
FT   gene            490875..492260
FT                   /locus_tag="HSM_0425"
FT   CDS_pept        490875..492260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0425"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   hso:HS_1586 permease, possible MFS superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32069"
FT                   /db_xref="GOA:B0URJ0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B0URJ0"
FT                   /protein_id="ACA32069.1"
FT                   /translation="MKSFLQKYGFTPASFFQLILITVNAQLIYAFWDIRNSVPGGFPAA
FT                   LGVTDQQAGYLYSMQGLVIILGTIALGWVGDRFSIRSIMLLSTVGVGGISLFLTLSSPG
FT                   LSMPVLLACFFSMLFFSEVLFKPANFKALRISTTEKHQGMVFGLFEFGRGLLAFLISLL
FT                   WTVMLYYKVGPKAMMMTSCIIVIITGIAVFFIVPKDQKVGDEDTQVNTTKEAIQGVARV
FT                   AKLPVVWIAGINVFCIYGAFVAAGTYFARFLQGGYGTSAVAAAVFATVVIALRMLPLVS
FT                   SVLVEKVFASTAHFMRMMQIILVVILSVIGIIFFTNHPDISLYADGYIPDNTPVGLISS
FT                   SMFWTLVVLMLCASACIFMIRGVYYAPIGEMGVDKKHSSAAMSFAITIGYFPALLAPIV
FT                   LGGLVKSPAKDATGQIIRSYLTDTQVLACAFFGLAILALISVFMSHTLIKMKQKQQLKT
FT                   SNQ"
FT   gene            492271..493119
FT                   /locus_tag="HSM_0426"
FT   CDS_pept        492271..493119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0426"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hso:HS_1585 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32070"
FT                   /db_xref="GOA:B0URJ1"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="UniProtKB/TrEMBL:B0URJ1"
FT                   /protein_id="ACA32070.1"
FT                   /translation="MNGQKIIGSQCITQCNPDLRITELIIPGTHDSATSTCYERYYRTQ
FT                   DLSIAEQLDCGVRFLDIRLRKEMVAAHREWVSDIRAEEIFEKCGEFLQKNPQEFVLMRI
FT                   QNANERKDDFPEYGEALLSKVQQYKSLFYAWEHSQIVQDGNPKWPTIAQAAGKIVPIEC
FT                   APPSMSINKINGELWAANWHDNSQILLQDLWDGPTVEEKCVAIKTLIEKGREVHSDILL
FT                   LNHISATNGELQYPDAYAAYLNEYSSRLWKQLAKRSFRGVQIYDFINPSICQELLRLNF
FT                   D"
FT   gene            493280..494788
FT                   /locus_tag="HSM_0427"
FT   CDS_pept        493280..494788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0427"
FT                   /product="methylmalonate-semialdehyde dehydrogenase"
FT                   /note="TIGRFAM: methylmalonate-semialdehyde dehydrogenase;
FT                   PFAM: aldehyde dehydrogenase; KEGG: hso:HS_1584
FT                   NAD-dependent aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32071"
FT                   /db_xref="GOA:B0URJ2"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:B0URJ2"
FT                   /protein_id="ACA32071.1"
FT                   /translation="METVLNFINGKQVASKGTKAWPIYNPATGEQIRQVMMSTAEEVNE
FT                   AVEVAQKAFPAWAATSPLRRARVMFKFKQLLERDWDDLARLITEEHGKVFSDAQGELTR
FT                   GLEVVEFACGIPHLVKGEFSEQAGRGIDIHSAMQPLGVCVGITPFNFPAMVPMWMFPIA
FT                   LACGNTFILKPAKADPSLSIRLAELLKEAGLPDGVFNVVHGDRQDNEILLRDPRVKAVS
FT                   FVGSTTAAAHVHAIGSAHGKRVQALGAAKNHGLVMPDVDIEATANALLGAAFGAAGERC
FT                   MALPLAVTIDDETADKLVAALKPKVEALRYGPGLTKEGEKENDFGPLITRQHRDNVKRY
FT                   VDIGVSEGATLVVDGRDKFPAGYENGFFIGGCLFDHVTPDMTIYKEEIFGPVLGIVRAK
FT                   NFQEAMKLINEHQFGNGAAIFTNNGAAAREFAYQVQAGMVGVNVPIPVPMAFHCFGGWK
FT                   ESAYGALNAYGPDGVRFYTKMKTVTTRWPEKDLSSQAAFSMPTL"
FT   gene            494872..496008
FT                   /locus_tag="HSM_0428"
FT   CDS_pept        494872..496008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0428"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: hso:HS_1583 possible dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32072"
FT                   /db_xref="GOA:B0URJ3"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0URJ3"
FT                   /protein_id="ACA32072.1"
FT                   /translation="MKKVRVGLIGTGYIGRCHAIAYAQAPTVFPLEAELVLEYLAEITP
FT                   ELAQQKAQEFGFNRSTGDWRDVVSDPNIDVVDICTPNFLHKEIALAAIANGKHVYSEKP
FT                   LALTAVDAKIMYEAAKKAGVRTLVGFNYIKNPTTQLAREIIERGEIGEVIHFYGTHNED
FT                   YLASDTTPLDWHCVREKAGLGALGDLAAHIVQMSQYLVGSDIEKVIGDMETVVKERPNP
FT                   QNLAERLPVENEDQATAMVRFANGCMGTIETSRIACGRKMGLTYVITGTKGTITYTQER
FT                   MAELKLYLHDEDPARQGFKTILTGPLHADYKNFCVSAGHGIGFNDQKTVEIRDLVNGIA
FT                   NNHNMYPDFEEGFKVSRVLDAIAQSCQERRWVNVKEIA"
FT   gene            496303..497238
FT                   /locus_tag="HSM_0429"
FT   CDS_pept        496303..497238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0429"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: hso:HS_1582 ABC
FT                   transporter, periplasmic sugar-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32073"
FT                   /db_xref="GOA:B0URJ4"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B0URJ4"
FT                   /protein_id="ACA32073.1"
FT                   /translation="MKKTLLAMLCGGLLLTSQAVIAKNYVIGAPMNSFADKWQTYLQDA
FT                   VRDFDEKHDDVQIKLADSNSDPNIQVNLVQNFIDQNVDALLVVPTDPTVVKRIGVLAKK
FT                   AGIPLIVVNRKPNDEHMQYVTSFVGSDEIEGGRIQGNFIVNTLAGKNAESLILLGPLGQ
FT                   DAVTKRTQGNEEIFAQHKNIKVVSKQEGRWERDRGLAIAENVLAGNKGINVIVSNNDEM
FT                   AIGAILATRKLGIKDEDITIVGLDATPDALEYLGKGLDATVFQSAQGQGYTGAEMAYLA
FT                   AKGEKVPSVKWVPFELVTPDKKEEYQARYK"
FT   sig_peptide     496303..496371
FT                   /locus_tag="HSM_0429"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.961 at
FT                   residue 23"
FT   gene            497325..498260
FT                   /locus_tag="HSM_0430"
FT   CDS_pept        497325..498260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0430"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: hso:HS_1581 ABC
FT                   transporter, periplasmic sugar-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32075"
FT                   /db_xref="GOA:B0URJ5"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B0URJ5"
FT                   /protein_id="ACA32075.1"
FT                   /translation="MFKKSLFILLGVASLFSPIVTAKNLTVGVAMYSLSDKYPTYLQDA
FT                   MKKFDQEKADVTFRYADANSDPARMLSDIETFIDSGVDALLVMPTDSDIIKAIGVKAKK
FT                   AKIPLVVVTNKPKDEDMKYITSYVGSEEITGGEMQANFIVEQLKGKPANAIILMGPLGW
FT                   DAQIKRTEGNENILRKHPEIQVISKQEGKWDRAKAIDITENLLSGSQKIDVVISNNDEM
FT                   AIGALLAARKKGIADEDMLIVGLDATPDALEYLGKGLDATIYQSASGQGRTSAEIAYKA
FT                   AKGESVPKLNFIPFELVTPDKKAQYIDKYR"
FT   sig_peptide     497325..497393
FT                   /locus_tag="HSM_0430"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            498341..499858
FT                   /locus_tag="HSM_0431"
FT   CDS_pept        498341..499858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0431"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: hso:HS_1580 sugar ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32076"
FT                   /db_xref="GOA:B0URJ6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0URJ6"
FT                   /protein_id="ACA32076.1"
FT                   /translation="MNDLSRSPYILDMRNVSKTFPGVKALDGINLKVKRGTIHALMGEN
FT                   GAGKSTLMKILYGIYTPDAGGELILDDKPFKPSAPIDAIRTGLTMVPQEISPAGNLTIA
FT                   DNFYLGREITRGKFFLNQKEMDCKTAEILNELGIPMDVTAKMSDVSVAKAQLVAIATAV
FT                   SNDAKVIIMDEPTTALTEVEVEQLYKIIETVRQRGISIIFISHKLDEVFRVSDEITVIR
FT                   DGQYVGTKLTSEVTKDELISMMVGRDMSEMFQRERIVISDEVVLEIKNFSRAGKYHDIN
FT                   FQVRRGEIFGIAGLVGAGRSEIVEGLFGYKLADSGEIYVHGEKADIKTPLDAMKYKIGF
FT                   VTEDRKLTGLFLNLSITDNMIMPRMSPYLENFLVSVTKAQKSANAQKDKLKIKAPNVEV
FT                   ITNNLSGGNQQKVLLARWLLLEPDILILDEPTKGIDVGAKAELYKLMVELAKQGKSIIM
FT                   ITSDMLELLSMSDRVMVMHEGRVAGIIPQEELTQERVLELASGLGQV"
FT   gene            499896..500852
FT                   /locus_tag="HSM_0432"
FT   CDS_pept        499896..500852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0432"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: inner-membrane translocator; KEGG: hso:HS_1579
FT                   ABC transporter, possible ribose permease"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32077"
FT                   /db_xref="GOA:B0URJ7"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B0URJ7"
FT                   /protein_id="ACA32077.1"
FT                   /translation="MSNATLKKILNAYGMVFILIALFLALSASIDGFFSARTVWSIIEQ
FT                   VSMFGIIAIGVTFAIITTGIDLSSGSMVAMTSVVAASIVTGGDTVSSALLAFAISIVLG
FT                   AAMGAINGSLTAFGSIPPFIATLGMMIIARGGAQLYSSGRPIDASSEAFTWISDVDFFG
FT                   LPGLVLVYIVIVIASHILLSRSTFGRHVYAVGGNLNAAKICGINTTKTLIWVYVFAGAL
FT                   SGLVGALLAARTYAGNPSYGLSWELDAIAAAVIGGVSLSGGIGTIPMCVIGALIIGTTN
FT                   KGLNMLGVDPYWQQIIKGLIIVVAVLIDTLKRRRKAN"
FT   sig_peptide     499896..499979
FT                   /locus_tag="HSM_0432"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.978) with cleavage site probability 0.463 at
FT                   residue 28"
FT   gene            501039..502976
FT                   /locus_tag="HSM_0433"
FT   CDS_pept        501039..502976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0433"
FT                   /product="thiamine pyrophosphate protein central region"
FT                   /note="PFAM: thiamine pyrophosphate protein domain protein
FT                   TPP-binding; thiamine pyrophosphate protein central region;
FT                   thiamine pyrophosphate protein TPP binding domain protein;
FT                   KEGG: hso:HS_1578 myo-inositol catabolism protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32078"
FT                   /db_xref="GOA:B0URJ8"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR030817"
FT                   /db_xref="UniProtKB/TrEMBL:B0URJ8"
FT                   /protein_id="ACA32078.1"
FT                   /translation="MKTVRLTVAQALVKFLDNQYIEFDGKVTKFVEGIFGIFGHGNVLG
FT                   LGQALEQDSGELIVRQGRNEQGMAHVAIGFAKQKLRKQIYACTSSVGPGAANMITAAAT
FT                   ATANRIPLLLLPGDVFATRQPDPVLQQIEQTYDLSISTNDAFRAVSKYWDRVSRPEQLM
FT                   TACINAMRVLTDPAETGAVTIALPQDVQTEAYDFPEYFLQKRIHRIERTPPTEAMLQDA
FT                   LTLIQNAKKPLIICGGGVRYSEAAEQLKAFAEIYNIPFAETQAGKSAVVSEHYLNVGGI
FT                   GVTGCVAANLLAPEADLVIGIGTRYTDFTTGSKWIFNNDEVKFLNINVARFDAYKLDGV
FT                   QVTADAKETLEKLTALLATTGYQAQWGDKVAQAKKALETELERVHNITYTEDFVPEIDD
FT                   RLNREAVYAEFMEMTKSCLAQTRVLGILNETLGENDVIVGAAGSLPGDLQRIWQSKGEN
FT                   TYHLEYGYSCMGYEVNAALGVKVAEPHREVYALLGDGSYMMLHSELVTSIQENRKINVI
FT                   LFDNMTNGCINNLQIGHGMDSFATEFRFRNKNTNKLDGGFVPVNFAMNAASYGCKTYQV
FT                   TTEEELRLALADAKKQQVSTLIDIKVLPKTMAKGYESWWHVGVAEVSNKAEINAAYEDS
FT                   VAHIEVARRY"
FT   gene            503050..503946
FT                   /locus_tag="HSM_0434"
FT   CDS_pept        503050..503946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0434"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: hso:HS_1577 myo-inositol catabolism protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32079"
FT                   /db_xref="GOA:B0URJ9"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR023952"
FT                   /db_xref="InterPro:IPR030823"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0URJ9"
FT                   /protein_id="ACA32079.1"
FT                   /translation="MKAENVKLGIAPIGWTNDDLPEIGKENTFEQCVSEMALAGFTGSE
FT                   VGSKYPRDIDVLKRKLDLRGIQICNAWFSTFFVDGKKEETIKGFIEHRDFLHAMGAKVI
FT                   GCSEQSRSIQGQKKAIFKEKTIFTEAEWQLLAEGYNELAKLAAEKGMKVCLHHHMGTGI
FT                   QTPAEIDKYMEITNDDVYLLFDSGHLYYSEGSQQVMLEVLEKYIHRVVHVHLKDVRDEV
FT                   VAEVKANDLSFLEGVVKGTFTVPGDGVIDFKPIFDILEKYDYKGWMVVEAEQDPAIANP
FT                   LEYAIKGRQYIREVAGV"
FT   gene            503948..504958
FT                   /locus_tag="HSM_0435"
FT   CDS_pept        503948..504958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0435"
FT                   /product="Inositol 2-dehydrogenase"
FT                   /EC_number="1.1.1.18"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: hso:HS_1576 dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32080"
FT                   /db_xref="GOA:B0URK0"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR030827"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0URK0"
FT                   /protein_id="ACA32080.1"
FT                   /translation="MIKVGIIGAGRIGRVHSESITKYVKGAEIKAISDVRVTEELKEWA
FT                   NGMGIPNVYEDYKLILQDAEIDAVLVCSSTNTHAPISIEAARAGKHIFCEKPIDADVDR
FT                   IQQVLAEVEKAGVKFQVGFNRRFDHNFKAIKNAVVNGDIGEPHVIRVTSRDPDAPPIEY
FT                   VKVSGGMLFDMTIHDFDMVRYLSGSEVTEVYAAGGVLVDPKIGEAGDIDTAVITLKLAN
FT                   GAIAVIDNSRKAVYGYDQRAEVFGSKGAIQTANDTPSTAILSNVNGVIAEKPKYFFLER
FT                   YMQSFADEMACFVDSVVNDKPTLVNGTDGLQPVLIAIAAKKSLDEGRPVKMSEIS"
FT   gene            complement(505019..505837)
FT                   /locus_tag="HSM_0436"
FT   CDS_pept        complement(505019..505837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0436"
FT                   /product="protein of unknown function DUF558"
FT                   /note="PFAM: protein of unknown function DUF558; KEGG:
FT                   hso:HS_1575 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32081"
FT                   /db_xref="GOA:B0URK1"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:B0URK1"
FT                   /protein_id="ACA32081.1"
FT                   /translation="MTKSAVNFTALLISVIIATKLTNPLNNMRIPRIYHPTSLENQQTC
FT                   QLSDDAANHVGRVLRMQVGEQIELFDGSNHIYPAIITQTNKKAIEVNILSRQLDNRESP
FT                   LFIHLGQVISRGERMEFTIQKSVELGVNIITPLWSERCGVKLDKDRMEKKIQQWQKIAI
FT                   SACEQCGRNIVPEIRPLMKLQDWCAEQDGTLKLNLHPRAKYTIRTLPEIPPQGVRLLIG
FT                   PEGGLSAQEISQTETQGFTEILLGKRVLRTETTALSAITALQVCFGDLAT"
FT   gene            complement(505874..507184)
FT                   /locus_tag="HSM_0437"
FT   CDS_pept        complement(505874..507184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0437"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   hso:HS_1574 putrescine-ornithine antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32082"
FT                   /db_xref="GOA:B0URK2"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004754"
FT                   /db_xref="InterPro:IPR027566"
FT                   /db_xref="UniProtKB/TrEMBL:B0URK2"
FT                   /protein_id="ACA32082.1"
FT                   /translation="MSTQKSNKIGVVQLTILTMVNMMGSGIIMLPTKLAEIGTISIVSW
FT                   LVTAVGSTALAYAFAQCGMFSKKSGGMGGYAEYSFGKAGNFMANYTYGVSLVIANTAIA
FT                   ISAVGYGSELLNVTLSPISIALCTIFTLWLATVLNFGGARITGNISSFTIWGVIIPVVG
FT                   ICLIGWFWFSGEMYVSAWNPHNVPTFEAIGVSISMTLWAFLGLESACANTDVVENPERN
FT                   VPIAVLGGTLGAAVIYIVSTNVIAGIVPNLELANSTAPFGLAFAHMFEETTGKVVMGLM
FT                   VMSCFGSLLGWQFTIAQVFKSSAEEGYFPAFFKKVTSKNAPIIGMVTITAIQSLLALMT
FT                   ISPSLNKQFNILVDLAVVTNVIPYLLSMAALMVLLKVEKVALNKAKITTFVAFIGSLYS
FT                   LYALYAAGEQAMLYGSIVTFIGWTLYGFISYKFDIKK"
FT   gene            complement(507242..509401)
FT                   /locus_tag="HSM_0438"
FT   CDS_pept        complement(507242..509401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0438"
FT                   /product="Ornithine decarboxylase"
FT                   /EC_number="4.1.1.17"
FT                   /note="PFAM: Orn/Lys/Arg decarboxylase major region;
FT                   Orn/Lys/Arg decarboxylase domain protein; KEGG: hso:HS_1573
FT                   ornithine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32083"
FT                   /db_xref="GOA:B0URK3"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR005308"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011193"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR027464"
FT                   /db_xref="InterPro:IPR027568"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:B0URK3"
FT                   /protein_id="ACA32083.1"
FT                   /translation="MLKLKIAHSPLVQKYFTSTRELVLLNQTDFTDIGAIILTAEDVKY
FT                   IQQIKTTEFNIPIFVVLNEGETLSDEYFDQVYHVQDLNSYDINLYSRQIETAASLYEQK
FT                   MLPPFFKMLSEYVEMGNLAFDCPGHQGGQYFRKHPAGRYLYDFYGENIFRSDICNADVK
FT                   LGDLLIHEGAPCDAQQHAAKVYNADKTYFVLNGTSASNKVVCNALLAPGDLVLFDRNNH
FT                   KSNHHGALIQAGATPVYLETARNPFGFIGGIDNHCFEEAYLKKLIAEVAPEKLEEKRPF
FT                   RLAIIQLGTYDGTIYNAKQVVERIGHLCDYILFDSAWVGYEQFIPMMKDCSPLLLDLDE
FT                   NDPGIIVTQSVHKQQAGFSQTSQIHKKDKHIKGQARYCNHKRFNNAFMLHASTSPFYPL
FT                   FATLDVNAQIQGSPAGKRLWAECVEVGIEARKLMLKHCTLIKPFIPPYVKGKKWQDHDT
FT                   KEIANDLEFFNFHANDTWHKFEGYTDNQYFVDPCKFMLTTPGINIETGEYEDFGIPATI
FT                   LANFLRENGIIPEKCDLNSILFLLTPAETLTKMQTLVAQIAAFEKHIKQNSLLKDVLPT
FT                   VYKNNEERYQGYTIRQLCQEMHNLYVSRNVKQLQRDLFRKTTLPEYAMNPQKANIEFVR
FT                   NKIELVPLTDIVGRIAAEGALPYPPGVLCVVPGERWSTTVQQYFLALEEGINVLPGFAP
FT                   EIQGVYLQKDPDGRTRAYGYVLTEA"
FT   gene            complement(509682..509846)
FT                   /locus_tag="HSM_0439"
FT   CDS_pept        complement(509682..509846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0439"
FT                   /product="unknown protein"
FT                   /note="KEGG: pmu:PM0805 unknown"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32084"
FT                   /db_xref="InterPro:IPR021237"
FT                   /db_xref="UniProtKB/TrEMBL:B0URK4"
FT                   /protein_id="ACA32084.1"
FT                   /translation="MLDHNYSQEYNPIKGRSLMAHIRRTRHLMKPSHRSCFSFAILHSK
FT                   SDPYQFFSI"
FT   gene            complement(510013..510345)
FT                   /locus_tag="HSM_0440"
FT   CDS_pept        complement(510013..510345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0440"
FT                   /product="SirA family protein"
FT                   /note="PFAM: SirA family protein; KEGG: hso:HS_1572
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32086"
FT                   /db_xref="GOA:B0URK5"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR022931"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:B0URK5"
FT                   /protein_id="ACA32086.1"
FT                   /translation="MGNKIFHTLLILTLKKLDAIIHAFYSNKEIIMTDIIVTQTLNTIG
FT                   LRCPEPIMLLRKKIRHMQEGEILLILADDPATTRDIPSFCQFMDHNLLKSDLENTPFKY
FT                   WIKKGK"
FT   gene            510325..510933
FT                   /locus_tag="HSM_0441"
FT   CDS_pept        510325..510933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0441"
FT                   /product="protein of unknown function UPF0029"
FT                   /note="PFAM: protein of unknown function UPF0029; Domain of
FT                   unknown function DUF1949; KEGG: hso:HS_1571 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32087"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR015796"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:B0URK6"
FT                   /protein_id="ACA32087.1"
FT                   /translation="MKYLIPQSAVVFEEEIKKSRFITYLQHAEGLEQAKAFWHSIKNQH
FT                   PNARHHCWATVSLQPGNSQGLGFSDDGEPSGTAGKPMLNVLLGSGIGEISAVVVRYYGG
FT                   ILLGTGGLVRAYGNGVQQALQLLQTSLKIERKIYQLYCAYHQVNWLHVLFEKYNIRIIS
FT                   QHFLQDVQFELGISDDKLAAFQNDLSSYSAGQLRLLENK"
FT   gene            510945..512408
FT                   /locus_tag="HSM_0442"
FT   CDS_pept        510945..512408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0442"
FT                   /product="potassium uptake protein, TrkH family"
FT                   /note="TIGRFAM: potassium uptake protein, TrkH family;
FT                   PFAM: cation transporter; KEGG: hso:HS_1570 potassium
FT                   uptake system protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32088"
FT                   /db_xref="GOA:B0URK7"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:B0URK7"
FT                   /protein_id="ACA32088.1"
FT                   /translation="MHILSILRIVGILVTCFSITMLIPAFIALIYGDGGGKAFILSFFY
FT                   NLSAGVGLWWLCRAHKASLRSREGFLIVTMFWVLLSLLAVIPFMLFDELTLSLADAVFE
FT                   SFSALTTTGATVILGLDHLPKSILFYRQLLQWIGGMGLIVLVVAIIPLLGIGSGHLYRA
FT                   ESSGPMKDQKALPRIGEVAKLLWFLYCILTIFCAFAYWVAGMSWFDAISHSFSTVSNGG
FT                   MSNYDASLGYFDNPAIYLISAGFMLISGCNFALHIRALTNWKYQPVWKIYARDPEFRFF
FT                   CAIQGIFIFLLSLGLYLTYENYSVFDAFSQGALQSVSMAMTSGYTLFDLNQLPAFLGML
FT                   LVFMAILGGCAGSTTGGLKMIRVLVVWLQIKREFKHLVHPHLVIPIKLGKMLLVQRVID
FT                   GIWGFLIAFFLTYWVCVFAVILCGMNAADAMLSVFATLTNVGPGLGIISQSFSQVPDNA
FT                   KYVFSFAMAAGRLEIFSLLLLFTPTFWKS"
FT   gene            512408..512920
FT                   /locus_tag="HSM_0443"
FT   CDS_pept        512408..512920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0443"
FT                   /product="Protoporphyrinogen oxidase"
FT                   /EC_number="1.3.3.4"
FT                   /note="KEGG: hso:HS_1569 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32089"
FT                   /db_xref="GOA:B0URK8"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR026816"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B0URK8"
FT                   /protein_id="ACA32089.1"
FT                   /translation="MKTLILYLSREGQTKKIAEYIGTKFEKSAVQSLLDFSGDLATFDR
FT                   IIIGASVRYGHFDQRLYQFLQKNTALLQQKESSFFGVNLTARKENKNTPETNVYVRKFL
FT                   QRIRWKPKYVGVFAGALFYPRYSWFDRMMIRLIMKITGGETDVSKEIEYTDWEKVDDFV
FT                   LKIRQGE"
FT   gene            513285..514817
FT                   /locus_tag="HSM_R0014"
FT   rRNA            513285..514817
FT                   /locus_tag="HSM_R0014"
FT                   /product="16S ribosomal RNA"
FT   gene            514878..514954
FT                   /locus_tag="HSM_R0015"
FT                   /note="tRNA-Ile1"
FT   tRNA            514878..514954
FT                   /locus_tag="HSM_R0015"
FT                   /product="tRNA-Ile"
FT   gene            515049..515124
FT                   /locus_tag="HSM_R0016"
FT                   /note="tRNA-Ala1"
FT   tRNA            515049..515124
FT                   /locus_tag="HSM_R0016"
FT                   /product="tRNA-Ala"
FT   gene            515385..518372
FT                   /locus_tag="HSM_R0017"
FT   rRNA            515385..518372
FT                   /locus_tag="HSM_R0017"
FT                   /product="23S ribosomal RNA"
FT   gene            518502..518616
FT                   /locus_tag="HSM_R0018"
FT   rRNA            518502..518616
FT                   /locus_tag="HSM_R0018"
FT                   /product="5S ribosomal RNA"
FT   gene            519037..519393
FT                   /locus_tag="HSM_0445"
FT   CDS_pept        519037..519393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0445"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bce:BC4488 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32090"
FT                   /db_xref="UniProtKB/TrEMBL:B0URK9"
FT                   /protein_id="ACA32090.1"
FT                   /translation="MKLAFGDYVHCIFAEPTHSPCMLTASYRHVPDADLQGEWEMTKFV
FT                   FNKKEFPLEPKSLFYDWLYLNVLFSEHNTALREDFFQTGYNAFSDIEFNPEKSFSCQAR
FT                   TLALCVSLYENNAI"
FT   gene            519568..522381
FT                   /locus_tag="HSM_0446"
FT   CDS_pept        519568..522381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0446"
FT                   /product="ATP-dependent exoDNAse (exonuclease V) alpha
FT                   subunit-like protein-helicase superfamily I member"
FT                   /note="KEGG: cps:CPS_2955 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32091"
FT                   /db_xref="GOA:B0URL0"
FT                   /db_xref="InterPro:IPR025285"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="UniProtKB/TrEMBL:B0URL0"
FT                   /protein_id="ACA32091.1"
FT                   /translation="MSENFSPLQSIEPDLYRLAKDAGHHLHSDPQSSLIKLRCFTEQFV
FT                   LLLCKQLHIELVDNESLSDRMRKADFKTYVPKEIQQKLHLLRIAGNKAVHTSFSHLDFS
FT                   EVADCLREAYLLGKWLYLNRVPTTCYPDFILPSPNHSIEQLQQHILSLKEENKKLNEHS
FT                   QKIIAENAKLHLSFTELGEIRRVQAEKLQENTEKVNLESDKTLARLKKYRLRDCYSQFK
FT                   LTDGQKTLEDQLDQFLADPKQHIFLLKGYAGTGKIFITLGLTDYLDLIERSYYLSAPTG
FT                   KAARVISEKTRKGASTIHSAIYNLDKLVEYQDEKDPKTYKFYTALKVNTDISDCVYIID
FT                   ESSMVSDVYTDGEFMRFGSGCLLKDLMEYINIDQNDHNKKIIFIGDNAQLPPIGMNNSP
FT                   ALDSKYLATKYRLNSLEYELTEVVRQKSGSGIIQNAVKIRECINKKEFNRLNMDLNYHD
FT                   IHQIEAKDTIQTYLESCGHKINDESMIIACLNADVQTYNEAIRQYFFPDKYEICRGDKV
FT                   MSLRNRKIGGVRIANGDFALVRWVSDETETKTVPLKKKLENGEVETKVIELNFRDVEIG
FT                   FRNTDGKAVFVKTKIIENTLYSKDPQLSSDEHKALYIDFSMRIRNERGIEYRKNKEEFK
FT                   NAILSDPYFNALPLKFGYAITCHKAQGSEWNNVIVQCNNTHQNQHALGYSRWLYTAITR
FT                   SSKQLYLIDPPKFNAWDKLKKTTPTSISPILLQPQLEKTEERPKMKNDQTTAPLKPAFN
FT                   AAELSAISQLIYQTVSTTINNADIINIESKQYHDIYTVLQDQHKIRFKVAYNGKNQITH
FT                   INCIENLQVVPLLESQLKTLEGKTFFIAAQEKNEITFSYDFLNEFHQQVIFNFLSKNKI
FT                   TICSVDEKQWNIRYEFANKSEGTATLDIYFNGKHEFTNIKPIQPKSTSNEFLETVHRLL
FT                   MSELCKC"
FT   gene            522375..522641
FT                   /locus_tag="HSM_0447"
FT   CDS_pept        522375..522641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0447"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32092"
FT                   /db_xref="UniProtKB/TrEMBL:B0URL1"
FT                   /protein_id="ACA32092.1"
FT                   /translation="MLTFTSKEVFAERKNGNAEQAYKMAKQLMANNPNDEWNQRALAWC
FT                   LVDLIKHSTQQHQEAIHYINEFKLIDVVKKDELLTKQLNYFEK"
FT   gene            522651..524294
FT                   /pseudo
FT                   /locus_tag="HSM_0448"
FT                   /note="hypothetical protein"
FT   gene            complement(524912..525670)
FT                   /locus_tag="HSM_0450"
FT   CDS_pept        complement(524912..525670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0450"
FT                   /product="uridine phosphorylase"
FT                   /note="TIGRFAM: uridine phosphorylase; PFAM: purine or
FT                   other phosphorylase family 1; KEGG: hso:HS_1519 uridine
FT                   phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32094"
FT                   /db_xref="GOA:B0URL2"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010058"
FT                   /db_xref="InterPro:IPR018016"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:B0URL2"
FT                   /protein_id="ACA32094.1"
FT                   /translation="MSDVFHLGLTKASLDGAELAIVPGAPERVERIARLLDNPKFLAST
FT                   REFTSWLGYIDQKAVVVCSTGIGGPSVSIAVEELAQLGIRTFLRIGTTGAIQPHINVGD
FT                   ILITTGAVRLDGASRHFAPLEYPAVAHFDCMSALHHAVSNEPGDSVHIGITASSDTFYP
FT                   GQERYDTYSGKVCRHYQGSLKQWQALNVMNYEMESATLFTMCSALGLRAGMVSGVIVNR
FT                   TQQEIPNEQTIHQTEQKAIEAVIKAATLLI"
FT   gene            525954..526772
FT                   /locus_tag="HSM_0451"
FT   CDS_pept        525954..526772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0451"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hso:HS_1518 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32095"
FT                   /db_xref="GOA:B0URL3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B0URL3"
FT                   /protein_id="ACA32095.1"
FT                   /translation="MDIKLHLNATTTPKIRAYLQKSDKSDLELAEQLGISVQTVRRWRN
FT                   RQDVNDRSHRPKKINRTLSFEQEYLICYLRKYFALSLDELLEAGRNLINQRVSRAVISR
FT                   CLKKYGLNIANKKDLPSQVGCTFLAMFPLPKEISKEEDYLFILIEKLTGYISCACLDRK
FT                   LQRQQSIINYFKSSLPYEIKEIELAEDITHHAIVQAFAKKTKVVTSTLILQSAVNFEQD
FT                   FIRLVSGYYTDSRLGFDAQLLRYEEYLNKHLKRNRLKKLSPYDYLMKYRR"
FT   gene            complement(526787..527095)
FT                   /locus_tag="HSM_0452"
FT   CDS_pept        complement(526787..527095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0452"
FT                   /product="phosphotransferase system PTS
FT                   lactose/cellobiose-specific IIA subunit"
FT                   /note="PFAM: phosphotransferase system PTS
FT                   lactose/cellobiose-specific IIA subunit; KEGG: vfi:VF0607
FT                   PTS system, diacetylchitobiose-specific IIA component"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32096"
FT                   /db_xref="GOA:B0URL4"
FT                   /db_xref="InterPro:IPR003188"
FT                   /db_xref="InterPro:IPR036542"
FT                   /db_xref="UniProtKB/TrEMBL:B0URL4"
FT                   /protein_id="ACA32096.1"
FT                   /translation="MSEQLEMQLMNLILQAGICRSALMEALQHAKKQQFEEVDRLLKQA
FT                   DDALLAAHHAQTELIGQDEGEGKLPVTIIMVHAQDHVMNAVLLMDIIKEFIELYRKK"
FT   gene            complement(527092..527403)
FT                   /locus_tag="HSM_0453"
FT   CDS_pept        complement(527092..527403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0453"
FT                   /product="phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit"
FT                   /note="PFAM: phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit; KEGG: vfi:VF0604
FT                   PTS system, cellobiose-specific IIB component"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32097"
FT                   /db_xref="GOA:B0URL5"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013012"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:B0URL5"
FT                   /protein_id="ACA32097.1"
FT                   /translation="MKRILLICDLGMSTSLVVKRMKQAAEAQGLPVEIEAKGMQSFRSL
FT                   IQDFDCVLLGPQISYKLQECQTIGAEFGKPVACIDMMSYGMTDGEKILAQALSLLEEK"
FT   gene            complement(527413..528858)
FT                   /locus_tag="HSM_0454"
FT   CDS_pept        complement(527413..528858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0454"
FT                   /product="Leucyl aminopeptidase"
FT                   /EC_number="3.4.11.1"
FT                   /note="PFAM: peptidase M17 leucyl aminopeptidase domain
FT                   protein; KEGG: rma:Rmag_0211 leucyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32098"
FT                   /db_xref="GOA:B0URL6"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="UniProtKB/TrEMBL:B0URL6"
FT                   /protein_id="ACA32098.1"
FT                   /translation="MNIEFPLYDWQTQLEIKNALLFFWKEDRDFLQQQPCLKPLLSILD
FT                   MESKIEIGRNISNAGLYSLPFSKKEVAENPHLMGKIRHFLMEKMAHSDAQRILLHWGKE
FT                   TVKLERQINEQLIISYLNLSYHPKYLGFKETAASPEFGVIVETPEQKRQLSNNYLELCK
FT                   IVLGMITARKISDLPSDIATPEYIAKKLNSYAHKSQLSIRCLDAEELQNHGLNTLYAVG
FT                   KSGLHPPFLIQVDYQGSPDCNQTYCFVGKGITFDTGGLWLKTGDGMKTMKYDMCGAALL
FT                   IGLLETVVENSLPINIRIIVGVAENMINEKAMRPGEIVRSYSGKTIEIINTDAEGRLIL
FT                   ADLLSFAAEQKPSVIIDVATLTGAVVKALGYDISGVMTNNTEILHQLNLAAIQTQEAIW
FT                   QLPCDDRFLGQVESHIADYCNTPPNNAAICVSAGYFLSRFVNDCTWAHLDISGTTLFRD
FT                   QGIYSSGKPLHLLYQFLKNNVSK"
FT   gene            complement(528855..529817)
FT                   /locus_tag="HSM_0455"
FT   CDS_pept        complement(528855..529817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0455"
FT                   /product="Asparaginase"
FT                   /EC_number="3.5.1.1"
FT                   /note="PFAM: peptidase T2 asparaginase 2; KEGG:
FT                   lga:LGAS_1433 asparaginase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32099"
FT                   /db_xref="GOA:B0URL7"
FT                   /db_xref="InterPro:IPR000246"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:B0URL7"
FT                   /protein_id="ACA32099.1"
FT                   /translation="MNNSRWGMIATWRMAFEGLCQAVELLKNKGSARDAILTAVTQVEN
FT                   YPLYKSVGYGGLPNEEGDVELDAAFMDGTSLALGAVAGLRNIANPILVAEALSHERFNS
FT                   FLVGHGAEKWALKKGFPAKDMLTPRVKTFYEKRYQETLGRGLSPYSGHDTVGIIALDKN
FT                   NNICVGTSTSGLFMKRHGRVGDSPISGSGFYADSHIGAATATGLGEDLMKGCTSYEIVR
FT                   KMKEGMTPQQAADATINELEIRLLERYGTAGDLSVVCMNMQGEFGVSTNIDNFSFVVST
FT                   EQYNPIIYLAKRENGITQYEPASESWLQAYLDRIHGELK"
FT   gene            complement(529818..531092)
FT                   /locus_tag="HSM_0456"
FT   CDS_pept        complement(529818..531092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0456"
FT                   /product="PTS system, lactose/cellobiose family IIC
FT                   subunit"
FT                   /EC_number="2.7.1.69"
FT                   /note="TIGRFAM: PTS system, lactose/cellobiose family IIC
FT                   subunit; PTS system, cellobiose-specific IIC subunit; PFAM:
FT                   phosphotransferase system EIIC; KEGG: bsu:BG10562 putative
FT                   PTS cellobiose-specific enzyme IIC component"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32100"
FT                   /db_xref="GOA:B0URL8"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004501"
FT                   /db_xref="InterPro:IPR004796"
FT                   /db_xref="UniProtKB/TrEMBL:B0URL8"
FT                   /protein_id="ACA32100.1"
FT                   /translation="MSLFKQIENKLMATAGKLAQQRHLGAIRDAYISFMPFIIVGSILL
FT                   VISSFPSQSYKDFMTATFGKGWDNIIEIPFNAVFSTMSIFIAFLVAYRLGERLNIDKLS
FT                   SGILSLSAFLILTPFVKVENVGSVISTQWLGSKGLFIAMLGAIIWTELFAFLIRKNIVI
FT                   KMPDGVPPAVQQSFSALIPALLIMILVLGIRILFSKTEYNTIHEFVYTVLATPIRHFGT
FT                   SYIGALLTVFMIDILWSVGINSGSMVNGILRPFWLDNQAENLAAMQNGLTPPHVITEQF
FT                   FDMIFMGGSGSTLALVLAMLIFSRSQHAKKVSRLAAGSSVFNINEPVLFGLPVILNPIM
FT                   LIPFNLAPLVITTVQYVAMYLDIVATTTGVYIPWTLPPVLSGFIVTGHISGALIQVINL
FT                   FIAAMIYLPFFRIIDKQYRMKEGQV"
FT   gene            531276..532007
FT                   /locus_tag="HSM_0457"
FT   CDS_pept        531276..532007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0457"
FT                   /product="CutC family protein"
FT                   /note="PFAM: CutC family protein; KEGG: hso:HS_1517 copper
FT                   homeostasis protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32101"
FT                   /db_xref="GOA:B0URL9"
FT                   /db_xref="InterPro:IPR005627"
FT                   /db_xref="InterPro:IPR023648"
FT                   /db_xref="InterPro:IPR036822"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0URL9"
FT                   /protein_id="ACA32101.1"
FT                   /translation="MDIEICIDNIESALIAQNSGADRLEVCGCLALGGVTPPYSLIKTV
FT                   LDVCNIPCYVMIRPRSGDFLFNAHEIKMMEQDIHIAKQLGAQGVVIGALTENGEIDLSI
FT                   CHRLISAAEGLGVTFHRAFDLCSDPYHGLEQLIELGCERVLTSGQQRTAFEGRYVLKTL
FT                   VQQAKGRIKIMAGAGVNPNNALELVKISKVDELHLSAKTFRQSSMKGNSSVTMGNKAED
FT                   DYKIWTTDRNQIIAIKKLFQE"
FT   gene            532182..535082
FT                   /locus_tag="HSM_0458"
FT   CDS_pept        532182..535082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0458"
FT                   /product="SNF2-related protein"
FT                   /note="PFAM: SNF2-related protein; helicase domain protein;
FT                   type III restriction protein res subunit; SMART: DEAD-like
FT                   helicases; KEGG: hso:HS_1516 ATP-dependent RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32102"
FT                   /db_xref="GOA:B0URM0"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022737"
FT                   /db_xref="InterPro:IPR023949"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="InterPro:IPR040765"
FT                   /db_xref="InterPro:IPR040766"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0URM0"
FT                   /protein_id="ACA32102.1"
FT                   /translation="MLFAIGQRWISESENSLGLGIITGQDNRTVTISFPASDEIRIYAL
FT                   ASAPLTRVLFQKGDEITHQLGWKAKVVDVMIRNELAFYLVQRLDNNEEIAVQEMELAHQ
FT                   ISFSKPQDRLFSTQIDRNEHFVLRYKALKHQQEQFQSSLRGLRGNRAGLIPHQLHIAQE
FT                   VGRRIAPRVLLADEVGLGKTIEAGMILQQQLLAEKVQRVLILVPETLQHQWLVEMLRRF
FT                   NLHFSLFDEERCADFDNPEDHVEANPFVAENLIICALDWLVQQPKRAKQALAGEFDLLI
FT                   VDEAHHLTWSEDSPSIAYELVMQLSAVIPAVLLLTATPEQLGQQSHFARLHLLDPNRFY
FT                   SYRAFEKEQQQYQPVAKAVQSLLSEHILTVEEQNHLAELLSEQDIEPMLKVINSQADTE
FT                   QKQVARGELMSNLIDRHGTGRLLFRNTRQGVQGFPHRIYHQIKLDLPTQYQNAINVLKM
FT                   LGEIKDPELFYPEQIFQKMNADATWWRFDPRVDWLIHLVKSLREEKILVICQDAITATQ
FT                   LEQALREKEGIRSAVFHENMSIIERDRASAYFAQQEEGAQVLLSSSIGSEGRNFQFACH
FT                   LVLFHLPNNPDLLEQCIGRLDRIGQRRDIQIYVPCFADTPQIRLAQWYHEGLNAFEETC
FT                   PMGAILHEKCGAKLTEFLTSDTTDDFQSFIQQTHQQQLQLKSELEQGRDRLLELNSNGG
FT                   IQAQQLANDIAIQDGSTELIDFTLNLFDIIGVEQEDLGEKSIVISPTGTMLVPDFPGLK
FT                   EEGVTVTFDRDLALAREELEFLTWDHPIVRNGIDLIVSGDIGKSAVALLVNKQLPTGTL
FT                   LLELVYIIESQSPRGLQLTRFLPPTPLRLLLDIKGNDLSHQISFQGLQKQLKPMGKNMA
FT                   TKVIKIMRPAIEQLIKQSEKNVVEPAKMIIEQAKQLADQSLSAEINRLYALQAVNKNIR
FT                   PEEIEQLESQRTLSLELLNQANWRLDSLRVIVSNKE"
FT   gene            535084..535749
FT                   /locus_tag="HSM_0459"
FT   CDS_pept        535084..535749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0459"
FT                   /product="pseudouridine synthase"
FT                   /note="PFAM: pseudouridine synthase; KEGG: hso:HS_1515
FT                   ribosomal large subunit pseudouridine synthase A"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32103"
FT                   /db_xref="GOA:B0URM1"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:B0URM1"
FT                   /protein_id="ACA32103.1"
FT                   /translation="MALIDYRPPLEPYLDIVYRDDHILVVNKPSGLLSVSGNQPQYYDS
FT                   AMSRVKEKYGFCEPAHRLDMATSGVLLFAMSKMADRELKRQFREREPKKHYQALIWGHL
FT                   AQDTGSVNLPLICDWENRPRQKVCFVHGKRAVTNFKVLHRFENNITQVRLTPITGRSHQ
FT                   LRLHMLALGHPILGDKFYAHPQAKSLAPRLCLHAEFLQITHPLTKKVIQFRTPADFPM"
FT   gene            complement(535812..536576)
FT                   /locus_tag="HSM_0460"
FT   CDS_pept        complement(535812..536576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0460"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: hso:HS_1514
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32105"
FT                   /db_xref="GOA:B0URM2"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:B0URM2"
FT                   /protein_id="ACA32105.1"
FT                   /translation="MSIKKIIFVIFTVLLLNACADSSSINQQSASSYVQIIGQAEAKGV
FT                   VDKSSPTAKRIHKIFKKMHPYADKENNTGQVFTWQLNVIKSKEMNAWAMPEGKMVFYTG
FT                   LVDNLKLTDDEIATVMGHEMAHALKEHGKKKANLGTFTNVVAQVAHVALSTKIGTDASG
FT                   LIVGLAADWGLNKPYSRSAEEEADEVGLFLMAKSGYNPKAAPQLWEKMKKASGGSKGLL
FT                   DKLISTHPTDDVRQANLLKLMPQAIEYYKNRQ"
FT   sig_peptide     complement(536514..536576)
FT                   /locus_tag="HSM_0460"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.905 at
FT                   residue 21"
FT   gene            complement(536635..537162)
FT                   /locus_tag="HSM_0461"
FT   CDS_pept        complement(536635..537162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0461"
FT                   /product="Inorganic diphosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="PFAM: Inorganic pyrophosphatase; KEGG: hso:HS_1513
FT                   inorganic pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32106"
FT                   /db_xref="GOA:B0URM3"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:B0URM3"
FT                   /protein_id="ACA32106.1"
FT                   /translation="MGLENVPAGKALPDDIYVVIEIPANSDPIKYEVDKESGALFVDRF
FT                   MATAMFYPANYGYVNNTLSSDGDPVDVLVPTPYPLQPGSVIRCRPVGVLKMTDEAGGDA
FT                   KVVAVPHTKLSKEYDYIKDVDDLPALLKAQIQHFFESYKALEAGKWVKVEGWEGVEAAR
FT                   QEILESFERAKK"
FT   gene            537334..538584
FT                   /locus_tag="HSM_0462"
FT   CDS_pept        537334..538584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0462"
FT                   /product="aromatic amino acid transporter"
FT                   /note="TIGRFAM: aromatic amino acid transporter; PFAM:
FT                   aromatic amino acid permease; KEGG: hso:HS_1562
FT                   tryptophan-specific transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32107"
FT                   /db_xref="GOA:B0URM4"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR013059"
FT                   /db_xref="InterPro:IPR013061"
FT                   /db_xref="InterPro:IPR018227"
FT                   /db_xref="UniProtKB/TrEMBL:B0URM4"
FT                   /protein_id="ACA32107.1"
FT                   /translation="MTKKIPSLFGGAMIIAGGTIGAGMLANPTSTAGVWFLGSTLILIY
FT                   TWFCMTTSGLMLLEANLHYPTGASFDTIVKDLLGKGWNLINGVSVAFVLYILTYAYITS
FT                   GGGITQGFFNQLLSSTENAVDIGRSSGSLIFCIVLAGFVWFSTKAVDRFSVVLIAGMVI
FT                   SFFLSITNLVGSVNTEVLLNAVQGEQQYLPYALVALPVCLVSFGFHQNVPSLVKYYDRN
FT                   ASQVLKAIFIGTGIALVIYILWQLAIQGNLPRAEFIPVIEKGGDISALLDALSKYLQTD
FT                   YIALTLKFFAYMAIASSFLGVTLGLFDYIADLFKFDDSVAGRTKTALITFLPPLLLSLQ
FT                   FPYGFVLAIGYAGLAATIWAVIVPALLAKASRKKFKSSSFTAYGGNFMIYFVIAFGLLN
FT                   ILAQLAMQFGFLPEFRG"
FT   sig_peptide     537334..537432
FT                   /locus_tag="HSM_0462"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.328 at
FT                   residue 33"
FT   gene            538744..539286
FT                   /locus_tag="HSM_0463"
FT   CDS_pept        538744..539286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0463"
FT                   /product="Uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /note="PFAM: phosphoribosyltransferase; KEGG: hso:HS_1561
FT                   pyrimidine operon regulatory protein / uracil
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32108"
FT                   /db_xref="GOA:B0URM5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR023050"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B0URM5"
FT                   /protein_id="ACA32108.1"
FT                   /translation="MAEKIIIAEHQFMRTISRISHEIIEKHQSLDDIVIVGIKRRGAEL
FT                   AELIKRKIIEFSGIELPSIDLDITSYRDDLEYVDQQHQLPVYSGASNYINIQNKTVILV
FT                   DDVLFTGRTIRAALDALVDFGRAAKVELVIFVDRGHRELPIRADYVGKNIPTSRSEQVQ
FT                   VRTMQFDDRYEVALVTK"
FT   gene            539348..540313
FT                   /locus_tag="HSM_0464"
FT   CDS_pept        539348..540313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0464"
FT                   /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
FT                   /note="PFAM: PpiC-type peptidyl-prolyl cis-trans isomerase;
FT                   SurA domain; KEGG: hso:HS_1560 peptidyl-prolyl cis-trans
FT                   isomerase, PPIC-type"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32109"
FT                   /db_xref="GOA:B0URM6"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR015391"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:B0URM6"
FT                   /protein_id="ACA32109.1"
FT                   /translation="MKKRNKKMKVFNFKAVLFSIIGLLSITITAQAAERVVATVDGNPI
FT                   LESQVKKVLGKRANNEENRQIALNSIIDDLLVQKAIQELGIKVAPAHVDSVIENIAAQN
FT                   GLTFGQFLDVLDYQGINYQAYRQQIAYQILISEVRNQAIGSSVNVTREEIQDLGLKLFK
FT                   QAKKQGKEKKVTAPEYNVRHILLKLNPLLNDAQAKAKLTQIRADILANKITFADAALKY
FT                   SKDYLSGADGGSLGFMFPEAYVPEFAKVIRTSKKGVISTPFKTEFGWHILEVTDIRNAD
FT                   ITREAYMQEAYQQIVNQQLQEASGDWIKALRKRAHIQYFN"
FT   sig_peptide     539348..539446
FT                   /locus_tag="HSM_0464"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 33"
FT   gene            540389..541234
FT                   /locus_tag="HSM_0465"
FT   CDS_pept        540389..541234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0465"
FT                   /product="dimethyladenosine transferase"
FT                   /note="TIGRFAM: dimethyladenosine transferase; PFAM:
FT                   ribosomal RNA adenine methylase transferase; KEGG:
FT                   hso:HS_1559 dimethyladenosine transferase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32110"
FT                   /db_xref="GOA:B0URM7"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0URM7"
FT                   /protein_id="ACA32110.1"
FT                   /translation="MKSKTHLGHTARKRFGQNFLHDNNIIQNIVMAIYPQKEQFLVEIG
FT                   PGLGALTEPVAEKVERLTVIELDRDLAERLRHHPFLHQKLNVIEYDAMQFNFEQLYIDE
FT                   NLAEKNQKLRVFGNLPYNISTPLMFHLFKYHAIIQDMHFMLQKEVVKRLCAAPNSKAYG
FT                   RLTIMAQYFCQVLPVLEVPPTAFKPAPKVESAVVRLIPHKELPYPVKDLYWLNRVTTQA
FT                   FNQRRKTLRNALSTLFSAEKLTALAIDLEARAENLSIADYARLANYLADNPPTEDLQSE
FT                   "
FT   gene            541285..542106
FT                   /locus_tag="HSM_0466"
FT   CDS_pept        541285..542106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0466"
FT                   /product="bis(5'nucleosyl)-tetraphosphatase, ApaH"
FT                   /EC_number="3.6.1.41"
FT                   /note="TIGRFAM: bis(5'-nucleosyl)-tetraphosphatase
FT                   (symmetrical); PFAM: metallophosphoesterase; KEGG:
FT                   hso:HS_1558 bis(5'-nucleosyl)-tetraphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32111"
FT                   /db_xref="GOA:B0URM8"
FT                   /db_xref="InterPro:IPR004617"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0URM8"
FT                   /protein_id="ACA32111.1"
FT                   /translation="MATYLVGDLQGCYDELQLLLETVQFNPVQDKLYLVGDLVARGDKS
FT                   LECLRFVKSLGAAAQMVLGNHDLHLISTALGIKKVSLQDHVEAIFTAPDFVELIDWLRH
FT                   QPLLVHDEKCDFVMSHAGISPDWDLDTAKSCAREVENELQHGDYHYLISNMYDNQPDRW
FT                   SADLQGLQRLRYSINVFTRMRFCYRDHRLDFACKASVEKAPQELIPWFNLDNPLFKVQN
FT                   LVFGHWASLVDTPTPANIYALDTGCVWGNRMTMLRWEDKQYFVQGALKDYF"
FT   gene            542393..544975
FT                   /locus_tag="HSM_0467"
FT   CDS_pept        542393..544975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0467"
FT                   /product="leucyl-tRNA synthetase"
FT                   /note="TIGRFAM: leucyl-tRNA synthetase; KEGG: hso:HS_1557
FT                   leucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32112"
FT                   /db_xref="GOA:B0URM9"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0URM9"
FT                   /protein_id="ACA32112.1"
FT                   /translation="MQEQYRPDLIEADVQKYWAEKKTFKAVKDPFKEKYYCLSMFPYPS
FT                   GRLHMGHVRNYTIGDVISRYQRMNGKNVLQPMGWDAFGLPAEGAAIKNKTAPAKWTYEN
FT                   IEYMKNQLKVLGFGFDWDREITTCKPEYYKWEQWFFTELYKKGLVYKKTSTVNWCPNDE
FT                   TVLANEQVHEGGCWRCDTPVEQKEIPQWFIKITDYAEQLLSDLDQLPEWPDMVKTMQRN
FT                   WIGRSEGVEITFNVAHSDQTLTVYTTRPDTFYGVSYLAVAAAHPLAENAAKNNPELAAF
FT                   IHEAKNTKVAEAELATMEKKGMATGLYAVHPMTGKQLPIWVANFVLMHYGTGAVMAVPA
FT                   HDQRDYEFAQKYQLPLFPVIKPADNSAWDFSKQAYTEHGITINSAEFDGLDFEATFNGI
FT                   ADKLEKIGVGKRQVNYRLRDWGVSRQRYWGAPIPMLTLENGDVVVAPLQDLPIVLPEDV
FT                   VMDGVKSPIKADPEWAKTTYNGQVALKETDTFDTFMESSWYYARYTSPQYQQAMLDADE
FT                   TNYWLPVDQYIGGIEHATMHLLYFRFFHKLLRDAGFVTSDEPSKKLLCQGMVLADAFYY
FT                   TSPTNERIWVSPTKVTLERDEKGRIIKAVDDEGHELVHSGMTKMSKSKNNGIDPQEMVE
FT                   KYGADTVRLFMMFASPAEMTLEWQESGVEGANRFLRRLWNLVFEYNQNPAQTALDPTAL
FT                   SVEQKALRREVHKTIAKVSDDIGRRQTFNTAIAAIMELMNKLTKASLSNEQDRAVMAEA
FT                   LNAVVRMLYPITPHICFQLWQDLGNESAIDFAPWVIADAEAMVEDEKLVVIQVNGKVRA
FT                   KVTVPADMSEDEIKQVALAEENVQKFLNGLTVVKTIYVPGKLFSFVAK"
FT   gene            545024..545527
FT                   /locus_tag="HSM_0468"
FT   CDS_pept        545024..545527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0468"
FT                   /product="Rare lipoprotein B"
FT                   /note="PFAM: Rare lipoprotein B; KEGG: hso:HS_1556
FT                   conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32113"
FT                   /db_xref="GOA:B0URN0"
FT                   /db_xref="InterPro:IPR007485"
FT                   /db_xref="UniProtKB/TrEMBL:B0URN0"
FT                   /protein_id="ACA32113.1"
FT                   /translation="MFKKIKIALLGIGILLISACGFHFQNGELIPYELRTLVLESNDPH
FT                   SKMSIALRRQLQANNVSIVDNQNNVTVLRLNSTKNTEQVASVFKRGYEAEKILTLEVWA
FT                   TVSLPNKQSYPIFANVNRTFFDNSRAALAKSAEKEIIWNDMREQAARQLIGKMIALQTQ
FT                   LQGK"
FT   sig_peptide     545024..545107
FT                   /locus_tag="HSM_0468"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.975) with cleavage site probability 0.811 at
FT                   residue 28"
FT   gene            545527..546567
FT                   /locus_tag="HSM_0469"
FT   CDS_pept        545527..546567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0469"
FT                   /product="DNA polymerase III, delta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="TIGRFAM: DNA polymerase III, delta subunit; PFAM:
FT                   DNA polymerase III delta; KEGG: hso:HS_1555 DNA polymerase
FT                   III, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32114"
FT                   /db_xref="GOA:B0URN1"
FT                   /db_xref="InterPro:IPR005790"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR010372"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032780"
FT                   /db_xref="UniProtKB/TrEMBL:B0URN1"
FT                   /protein_id="ACA32114.1"
FT                   /translation="MNRIFSEQLQLSLNKRLSTVYYLVGQDPLLLTESRDAIVQTAILQ
FT                   GFDEKLEITVDNTTNWRSILEQAQSIGLFFKRQMLILTLPENPTALIQRNLQELITSLH
FT                   TDILLILQMAKLTKPMEKQTWFELAGQKEPQAVLVNCQTPTVDQLPRWISQRAYSMKLE
FT                   IVPEAINLLCYSYENNLLALKQVLQLLDLLYPDHKLTFNRVNSVIEQSSVFTVFQWIDT
FT                   LLEGKLERAVRILQGLKAEDVQPIILLRALQRELLTILQLTQPQQHIANIDIPLVSSQL
FT                   KERFDRLKVWQNRRPFFIQAIQRMTYRKLYMIIQQLADLERKTKADFSHDIWNELDNLS
FT                   AKICCF"
FT   gene            546694..547344
FT                   /locus_tag="HSM_0470"
FT   CDS_pept        546694..547344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0470"
FT                   /product="cell division ATP-binding protein FtsE"
FT                   /note="TIGRFAM: cell division ATP-binding protein FtsE;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase; KEGG:
FT                   hso:HS_1554 cell-division ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32116"
FT                   /db_xref="GOA:B0URN2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0URN2"
FT                   /protein_id="ACA32116.1"
FT                   /translation="MIRFENVSKAYLGGNPALQGLNFHLPIGSMTYVVGHSGAGKSTLL
FT                   KLIMGMERANGGKIWFNGHNITRLSKYEIPFLRRQIGMVHQDYRLITEYTIAENVALPL
FT                   IISGIHPKEAETRALAALDRVGLRERAKHYPVYLSGGEQQRVDIARAIVHKPQLLLADE
FT                   PTGNLDIKLSLGIFNLFEELNQLGMTVLIATHDLTLVQQKPKPCLVLENGYLR"
FT   gene            547354..548292
FT                   /locus_tag="HSM_0471"
FT   CDS_pept        547354..548292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0471"
FT                   /product="putative protein insertion ABC transporter, inner
FT                   membrane subunit FtsX"
FT                   /note="TIGRFAM: putative protein insertion ABC transporter,
FT                   inner membrane subunit FtsX; PFAM: protein of unknown
FT                   function DUF214; KEGG: hso:HS_1553 cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32117"
FT                   /db_xref="GOA:B0URN3"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:B0URN3"
FT                   /protein_id="ACA32117.1"
FT                   /translation="MAYRPIYASWGVQVHYVLKAVLAGLIKKKYSTLMTILVIAVSLTI
FT                   PTVSYLLWKNLYHATTKFSPKTEFTLFLHKNLSETDANIVVEKIRQQEGVESLNYISRK
FT                   ESLNEFRHFSGFSEGLDILDDNPLPAVVMIKLTQEYNENTKRHQLRENLFKIKGVDDIR
FT                   LDNEWLEKLTALSWLIAHIAIFCAVLMVCSVFLVIGNSIRSDVYSSQANIEIMKLLGAT
FT                   DQFILRPYLYTGMIYAILGALFAGIFSAALIGYFTSAVKYVTDIFAVSFTLQGITIIEL
FT                   LFLFVCCTLMGYLSAWLSASRYMNLLHKNIR"
FT   gene            548419..549534
FT                   /locus_tag="HSM_0472"
FT   CDS_pept        548419..549534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0472"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /note="TIGRFAM: aspartate-semialdehyde dehydrogenase; PFAM:
FT                   Semialdehyde dehydrogenase NAD - binding; Semialdehyde
FT                   dehydrogenase dimerisation region; KEGG: hso:HS_1552
FT                   aspartate-semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32118"
FT                   /db_xref="GOA:B0URN4"
FT                   /db_xref="InterPro:IPR000319"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR011534"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0URN4"
FT                   /protein_id="ACA32118.1"
FT                   /translation="MKNVGFIGWRGMVGSVLMDRMVQENDFTNINPVFFTTSQVGQKAP
FT                   VFAGKDAGELKNAFDIAELQKLDIIVTCQGGDYTNEVYPKLKATGWNGYWVDAASALRM
FT                   KDDAIIVLDPVNQHVISEGLQKGIKTFVGGNCTVSLMLMAIGGLFERDLVEWVSVATYQ
FT                   AASGAGAKNMHELLVQMGQLEDSVKDELANPATSILDIERKVTAKMRAEDFSTTNFGAA
FT                   LAGSLIPWIDKLLPETGQTKEEWKGYAETNKILGLSNNPIPVDGLCVRIGALRCHSQAF
FT                   TIKLKKDLPLDEIEQIIASHNEWVKVIPNDKEVTLRELTPAKVTGTLSIPVGRLRKLAM
FT                   GPEYLAAFTVGDQLLWGAAEPVRRILKQLVL"
FT   gene            complement(549727..550764)
FT                   /locus_tag="HSM_0473"
FT   CDS_pept        complement(549727..550764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0473"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine
FT                   cyclo-ligase; PFAM: AIR synthase related protein; AIR
FT                   synthase related protein domain protein; KEGG: hso:HS_1551
FT                   phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32119"
FT                   /db_xref="GOA:B0URN5"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0URN5"
FT                   /protein_id="ACA32119.1"
FT                   /translation="MSKQSLSYKDAGVDINAGNTLVERIKSDVKRTTRPEVIGGLGGFG
FT                   ALCALPSKYKDPILVSGTDGVGTKLRLAIDLKKHDTIGVDLVAMCVNDLVVQGAEPLFF
FT                   LDYYATGKLDVDVAADVIKGIADGCVQAGCALVGGETAEMPGMYHTGDYDLAGFCVGVV
FT                   EKSEIIDGSNVKAGDALLALASSGPHSNGYSLIRKVIEVSGIDPTTAQLAEHSFAEQVL
FT                   APTKIYVKPVLQLIKHTDVHAICHLTGGGFWENIPRVLPSSVKAVINEKSWEWHPIFKW
FT                   LQEQGNIDRYEMYRTFNCGVGMIIALPQEDVETALALLQQVGEKAWVIGKIEHANADEE
FT                   KVVIC"
FT   gene            complement(550953..551627)
FT                   /locus_tag="HSM_0474"
FT   CDS_pept        complement(550953..551627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0474"
FT                   /product="DNA mismatch repair endonuclease mutH"
FT                   /note="TIGRFAM: DNA mismatch repair endonuclease mutH;
FT                   PFAM: DNA mismatch repair protein MutH; KEGG: hso:HS_1550
FT                   DNA mismatch repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32120"
FT                   /db_xref="GOA:B0URN6"
FT                   /db_xref="InterPro:IPR004230"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011337"
FT                   /db_xref="InterPro:IPR037057"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0URN6"
FT                   /protein_id="ACA32120.1"
FT                   /translation="MTALTPPQHEAELLQRAKSIAGLTFAELAEELNLVVPPDLKRDKG
FT                   WVGMLIETALGATAGSKAEQDFSHLGIELKTIPVNQQGYPLETTFVSLAPLAQNSGVTW
FT                   HSSHVRYKLSKVLWIPIEGERQIPLAERHVGVPILWQPSSSQEQRLRQDWEELMDYIVL
FT                   GKLTEITARIGEVLQLRPKGANSRALTKGIGKNGEIIDTLPLGFYLRKEFTAEILHDFL
FT                   MD"
FT   gene            complement(551624..552166)
FT                   /locus_tag="HSM_0475"
FT   CDS_pept        complement(551624..552166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0475"
FT                   /product="methylated-DNA--protein-cysteine
FT                   methyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /note="TIGRFAM: methylated-DNA--protein-cysteine
FT                   methyltransferase; PFAM: Methylated-DNA-[protein]-cysteine
FT                   S-methyltransferase DNA binding; KEGG: hso:HS_1549
FT                   methylated-DNA-protein-cysteine methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32121"
FT                   /db_xref="GOA:B0URN7"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR008332"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:B0URN7"
FT                   /protein_id="ACA32121.1"
FT                   /translation="MQPTFYCYYHSPIGRLLMLSQNNQLTNLDFELEQIEPNSRWIFNQ
FT                   NLPLFLQVTSALDRYFKGEAEDFSDLSLHPQGTKFQQKIWQALRRIPYGQSASYSELAG
FT                   FIDHPKAVRAVGGAVGRNPISIIIPCHRILGKQKQLTGFGGGLPAKRYLLQLEKIDYID
FT                   RGIEYVKPKLLQKYHQS"
FT   gene            complement(552218..553408)
FT                   /locus_tag="HSM_0476"
FT   CDS_pept        complement(552218..553408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0476"
FT                   /product="membrane protein involved in aromatic hydrocarbon
FT                   degradation"
FT                   /note="PFAM: membrane protein involved in aromatic
FT                   hydrocarbon degradation; KEGG: hso:HS_1548 outer membrane
FT                   protein P1"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32122"
FT                   /db_xref="InterPro:IPR005017"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:B0URN8"
FT                   /protein_id="ACA32122.1"
FT                   /translation="MQSKINLNGNVSVSAGKALQGQGASGQPITEEATQKNIVPGALIP
FT                   NMYFVAPINDKFAVGAAMNVNFGLKSQYKSNYEAGVFGGTTELNSINLNLSGSYRISKG
FT                   LSIGVGLNAVYAKAKIERRAGILDKGVNKLASLPKLKKIFSPLASMVDANSPIVQLQDN
FT                   NAWGLGWNIGAVYEFNQGNRIGIAYHSKVDINFKDSDALRYRLAGSGSIEPYRNRGKLT
FT                   LHLPDYLEISGFHQLTEKFAMHYSYKYTKWSRLQSLHAVYDNGQVAFHKDENFDDSSRV
FT                   ALGATYNVNDKLTLRAGIAYDESAEHPSASIPDTDRTWYSLGATYHFTPNLSVDVGFAH
FT                   LRGKKRQFKEGYEIGNTVSYPGNRGQVTNVQLAVVSADYQSTARANLYGLNLSYRF"
FT   gene            complement(553398..553649)
FT                   /locus_tag="HSM_0477"
FT   CDS_pept        complement(553398..553649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0477"
FT                   /product="outer membrane protein P1"
FT                   /note="KEGG: hso:HS_1548 outer membrane protein P1"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32123"
FT                   /db_xref="InterPro:IPR005017"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:B0URN9"
FT                   /protein_id="ACA32123.1"
FT                   /translation="MKKMKFTKNFFTPTLIASALALSTTYANAAAFQLAEVSSSGLGRA
FT                   YAGEAAIADNAAVVATNPALMSLFNTKQFSMGGGLCAV"
FT   sig_peptide     complement(553560..553649)
FT                   /locus_tag="HSM_0477"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 30"
FT   gene            553890..554186
FT                   /locus_tag="HSM_0478"
FT   CDS_pept        553890..554186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0478"
FT                   /product="conserved hypothetical protein 743"
FT                   /note="PFAM: conserved hypothetical protein 743; KEGG:
FT                   hso:HS_1547 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32124"
FT                   /db_xref="InterPro:IPR005272"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="UniProtKB/TrEMBL:B0URP0"
FT                   /protein_id="ACA32124.1"
FT                   /translation="MSENVLKCTPEETKACCCADVGTIIDNSELSVDFSQVYENETTAQ
FT                   EALAYLTEKARKAETESCDIRSEIKEVNGNYQLNATFTFSCQAETLIFQLSIR"
FT   gene            554339..555028
FT                   /locus_tag="HSM_0479"
FT   CDS_pept        554339..555028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0479"
FT                   /product="Pirin domain protein"
FT                   /note="PFAM: Pirin domain protein; Cupin 2 conserved barrel
FT                   domain protein; KEGG: hso:HS_1546 conserved hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32125"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR041602"
FT                   /db_xref="UniProtKB/TrEMBL:B0URP1"
FT                   /protein_id="ACA32125.1"
FT                   /translation="MFYIRKANERGHANHGWLDSYHTFSFAGYYDPKFMGFSSLRVINE
FT                   DRVKAGFGFGTHPHKNMEILSYVLEGTIAHQDSMGNVQTISAGECQIMSAGTGITHSEF
FT                   NPSSTENLHFYQIWIQPNELNIAPRYEQKAFAHHEGATLILSPHAENGAFKIYQDMKLW
FT                   RYQLRAGTQTDITLDSNRSYWIQVVKGTFFINGQTVSTSDGVAINQERLAKIETENDIE
FT                   FLIFDLA"
FT   gene            complement(555136..555978)
FT                   /locus_tag="HSM_0480"
FT   CDS_pept        complement(555136..555978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0480"
FT                   /product="RNA polymerase, sigma 32 subunit, RpoH"
FT                   /note="TIGRFAM: RNA polymerase sigma factor RpoH; RNA
FT                   polymerase sigma-70; PFAM: sigma-70 region 2 domain
FT                   protein; sigma-70 region 4 domain protein; KEGG:
FT                   hso:HS_1545 RNA polymerase sigma-32 factor"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32127"
FT                   /db_xref="GOA:B0URP2"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:B0URP2"
FT                   /protein_id="ACA32127.1"
FT                   /translation="MNKETQAMMLVPQGSIEGYIHAAYDYPMLTAEEEKELAERLYYHQ
FT                   DLDAAKTLILSHLRFVIHVARGYSGYGLPQADLIQEGNIGLMKAVKRFNPEVGVRLVSF
FT                   AVHWIKAEIHEYVLRNWRIVKVATTKAQRKLFFNLRKTKQRLGWFSDKEVDMVANELGV
FT                   SKEDVLEMESRMTGSDVGFDLPVDDDESYAPALYLEDKSSNFAAELENENFETQAADQV
FT                   ANALAELDERSRDIIKSRWLDDEKATLHDLAAKYNISAERVRQLETNALKKLKSAVSF"
FT   gene            complement(556101..556415)
FT                   /locus_tag="HSM_0481"
FT   CDS_pept        complement(556101..556415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0481"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hso:HS_1544 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32128"
FT                   /db_xref="InterPro:IPR016755"
FT                   /db_xref="UniProtKB/TrEMBL:B0URP3"
FT                   /protein_id="ACA32128.1"
FT                   /translation="MDFQTILTSLPSIEHLSGLDILANDQVVHHIPAEQGKLGSLRVYN
FT                   ALAQKFNGKLDRTCAEKGVQLFAEHVLDAKENPGKHPNIDLLLQVIEQNVEYVLVPILK
FT                   "
FT   gene            complement(556431..557456)
FT                   /locus_tag="HSM_0482"
FT   CDS_pept        complement(556431..557456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0482"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /EC_number="1.3.1.98"
FT                   /note="TIGRFAM: UDP-N-acetylenolpyruvoylglucosamine
FT                   reductase; PFAM: FAD linked oxidase domain protein;
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase domain
FT                   protein; KEGG: hso:HS_1511
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32129"
FT                   /db_xref="GOA:B0URP4"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:B0URP4"
FT                   /protein_id="ACA32129.1"
FT                   /translation="MENLQDFHTFHLPSKAKKIIKITALSELIEQWKLAKKNALPILFL
FT                   GQGSNVLFVDDFKGIVFINQLMGIEHKQDANFHYLHVNGGENWHNLVQWSLTQGIYGLE
FT                   NLALIPGCAGSAPIQNIGAYGVEFKDVCDYVDVLDLQKNTIFRLSNEECAFAYRESIFK
FT                   RQYREGYFITAVGLKLAKNWQPVLKYGTLTEFDTHQVNAQEIFAEICHIRQSKLPNPDE
FT                   FGNSGSFFKNPIISAQAFSLLQQDYPTIPFFPQPDGTIKLAAGWLIDQAGLKGYQIGGA
FT                   AVHQQQALVIINKDNASSADVVKLAQHIHQTVILKFNVYLRPEVRFIGENGEVDSTAYI
FT                   S"
FT   gene            complement(557466..559244)
FT                   /locus_tag="HSM_0483"
FT   CDS_pept        complement(557466..559244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0483"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase dimerisation and phosphoacceptor region; KEGG:
FT                   hso:HS_1510 nitrate/nitrite sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32130"
FT                   /db_xref="GOA:B0URP5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR016380"
FT                   /db_xref="InterPro:IPR029095"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR042295"
FT                   /db_xref="UniProtKB/TrEMBL:B0URP5"
FT                   /protein_id="ACA32130.1"
FT                   /translation="MNNKVCGIQHILLYDSVRILFKDFHMNIKNHSVSTKIANYLLLII
FT                   IFVSLISIMSLAIMQSNKSDAELINVSGSLRMQSYRLFYEMEYEPDNVERALRQYRLSL
FT                   HSEPLLKISRHFLVPNDVRQSYRNLIKRWEIMEKHAKENNKDAYRAEIASYVDQVDQFV
FT                   NTLQYFAELKLKIAVLSILVAMIVILAMVSYVIYFTRKRVVTPLEKLALASSQVQIGQF
FT                   NHIPLDTKSDDEIGRLALVFTQMAAELKKLYATLEEKVNEKTQKLSQANRSLTMLYHCS
FT                   QLVTTKAIEPKLFQQMLKQVMINEHLRYLELIVHGAEHWHISLGTKQDPVDLQSMDLEI
FT                   ENNQLGIMRWQAGLPCPDLRTMHNVSQMLSRTLYFYQMQRQQQHLLLMEERSIIARELH
FT                   DSLAQVLSYLKIQLTLLKHTLQQETQDAKAKSQEIIQDFEQAVTAGYLQLRELLATFRL
FT                   TIQEANLQVALEQVIDSLRNQTSMRMRVDCSLPSQTFNAQQLVHALQIVREATLNAIKH
FT                   SQGTEIEVLAYTNDDGEYELAVRDNGIGIPSLKEPTGHYGLNIMLERSNQLNARLSIQN
FT                   HSTGGTEVKLTLPNTF"
FT   gene            559358..562198
FT                   /locus_tag="HSM_0484"
FT   CDS_pept        559358..562198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0484"
FT                   /product="type III restriction protein res subunit"
FT                   /note="PFAM: type III restriction protein res subunit;
FT                   protein of unknown function DUF450; SMART: DEAD-like
FT                   helicases; KEGG: dvl:Dvul_0853 type III restriction enzyme,
FT                   res subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32131"
FT                   /db_xref="GOA:B0URP6"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR013670"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0URP6"
FT                   /protein_id="ACA32131.1"
FT                   /translation="MVKNSTINQHPEQQTKDIIDEKLIQAGWLIQTVKAYNPNAGLGIA
FT                   VREYPTGTGPVDYLLFVDREPVAIIEAKQENFAYKLNTIEEQSARYAKSELKNIAQADI
FT                   AFLYESTGTITRFTNCNDPTPRAREVFNFHRPETLQKWATEGKNTLRAKLKALPVLNPQ
FT                   NLPACELNLRDCQLTAIENIQTSLAKDLPRALIQMATGAGKTYTAINIMYRLLKYTGKR
FT                   RILFLVDTVNLGEQAEQEMLVFTPPDDNRKFTELYNTQVIKSPHIPKGVEVCICTIQRM
FT                   YSLLKGEDVAIPDDSVELEEWENRLKEPLSVAYQPNLPPEFFDFIFIDECHRSIYNLWR
FT                   QVLDYFDAYLIGLTATPDNRTFGFFNQNVVSEYSHEQAVADGVNVGNEVFLINTKISIQ
FT                   GGKFKAEELVEYRERTTRRKRWQQQDTDESYTAKQLDRDIVNPSQIRTIIRTFRDHLPI
FT                   IFPNRQEVPKTLIFAQNDSHADDIIKMVREEFGQGNEFCKKITYKAKDDILDENGDIVE
FT                   QGEEPKTILANFRNSYHPRIAVTVDMIATGTDVRPLECLLFMRDVKSRNYFEQMKGRGT
FT                   RTLDKDGLQKVSPPAPSAKTHYVIVDAIGVTKSLKTSSIQLDTKRSVSFAELGRAVVFG
FT                   GAFDMDSISSLACRLSRLDKQLSQDEQQQISEILGGVALSQVVKDLFHAINADEIHKHA
FT                   CEQEGISLDETPSEETLLKVQKQRVRTATKTLSMELITALDEIRKQHEQKIDHELDEVT
FT                   HVGWAENDEAITQNFADWINEHKDGITALQIFYNQPYQRQAFTLAMIKELANAIKKAKP
FT                   KLAFSHIWQAYARLDQVSEQKQNELTALVGLIRRVVGIDNKITPFAHIVRKNFQKWTFE
FT                   HNARADKKLTEEQMAWLAMIKEHIITSFSIKSDDFELTPFNQHGGLGQAYDVLCGITQN
FT                   DDFDALLDEINQRWTA"
FT   gene            562219..563214
FT                   /locus_tag="HSM_0485"
FT   CDS_pept        562219..563214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0485"
FT                   /product="conserved hypothetical DNA binding protein"
FT                   /note="KEGG: hit:NTHI0317 conserved hypothetical DNA
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32132"
FT                   /db_xref="InterPro:IPR003497"
FT                   /db_xref="InterPro:IPR011204"
FT                   /db_xref="UniProtKB/TrEMBL:B0URP7"
FT                   /protein_id="ACA32132.1"
FT                   /translation="MSDLIIYQTDDGKTQVSLLVEQGEAWLTQNQLAELFDTSVPNITT
FT                   HIKNILQDNELDEDSVIKDYLITASDGKNYQVKHYSLAMILAIGFRVRSPRGVQFRKWV
FT                   NSTLQTYLEKGFLIDKERLKNPQGRLDYFDELLADIREIRASEMRFYQKVRELFSLSSD
FT                   YDKTDKATQMFFAETQNKLLFAVTHHTAAELILSRADADLPNMGLTAWKGKVVRKGDVV
FT                   IAKNYLTADELDSLNRLVTIFLESAELRVKNRQDLTLSFWRNNVDNLLEFNGFAILDNQ
FT                   GSRTNAQAQTIAHERYEQFHAKRQAQKLINADSQDWQELQTLEIELKKAK"
FT   gene            563222..564637
FT                   /locus_tag="HSM_0486"
FT   CDS_pept        563222..564637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0486"
FT                   /product="restriction modification system DNA specificity
FT                   domain"
FT                   /note="PFAM: restriction modification system DNA
FT                   specificity domain; KEGG: mbu:Mbur_0508 restriction
FT                   modification system DNA specificity subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32133"
FT                   /db_xref="GOA:B0URP8"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:B0URP8"
FT                   /protein_id="ACA32133.1"
FT                   /translation="MSKHTMTANNTLPQGWKKYNLFEICKPKQWKTIAVKDLTDTGYPV
FT                   YGANGVIGYYHKYNHENATVLLTCRGATCGEIHISKPYSYINGNAMCMDNLSEKITIEF
FT                   LYFYLKSINLSFIISGSAQPQITQVGLKKLEIPVPPLPTQQAIVNKIETLFADIDAGID
FT                   RLKTAQKQLKQYRQSLLKNAFNGELTKDWREQNADNLPSSSELLAQIQQAREAHHAKQL
FT                   ADWQSAVEKWEQTRKIGKKPSKPKAQTQAVQFEESLEDLPSGWGTIKINQVANIFTGAT
FT                   PLKSNPNYYINGSIPWVTSGSLNNAFVECADNFVTDLALKETNLKLLPKHTLLIAMYGE
FT                   GKTRGKCSELLIEATTNQAIAGIVLYENFPISRQFLKFYMFKNYADLRRQSSGGVQPNL
FT                   NLSLVGNIVFPFPCLTEQTEIVRILESKLSAYDQLATTLSKQLKQAELLKQAVLKSAFS
FT                   ARLEIDQGGDKQC"
FT   gene            564631..564834
FT                   /locus_tag="HSM_0487"
FT   CDS_pept        564631..564834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0487"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32134"
FT                   /db_xref="InterPro:IPR038461"
FT                   /db_xref="UniProtKB/TrEMBL:B0URP9"
FT                   /protein_id="ACA32134.1"
FT                   /translation="MLNWNDIEQMLISGNLCQEKLYLEYKEAKNDVPKAVWESYSAFAN
FT                   QSGGLYFARGCRKTKSAYFRRG"
FT   gene            564878..565087
FT                   /locus_tag="HSM_0488"
FT   CDS_pept        564878..565087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0488"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32135"
FT                   /db_xref="InterPro:IPR038461"
FT                   /db_xref="UniProtKB/TrEMBL:B0URQ0"
FT                   /protein_id="ACA32135.1"
FT                   /translation="MEKASCALLNSDDVRQFGIQGKTVIAVYVRKAETTQRPVHLNQDY
FT                   RRSFIRLNTGDHRLNDSELRSFLI"
FT   gene            565134..566492
FT                   /locus_tag="HSM_0489"
FT   CDS_pept        565134..566492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0489"
FT                   /product="putative transcriptional regulator"
FT                   /note="KEGG: gka:GK0575 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32136"
FT                   /db_xref="InterPro:IPR025831"
FT                   /db_xref="InterPro:IPR038475"
FT                   /db_xref="UniProtKB/TrEMBL:B0URQ1"
FT                   /protein_id="ACA32136.1"
FT                   /translation="MDYLNRETLNKYRHLLKAHNPSSPLLILSDERFAKKAGIFSIDAT
FT                   TGKQGITYAALLLFGKGEAIKGVFPHFFFEYIEKSEENRRYDLRITDFDLEDGNLFEFY
FT                   LKIEPRIIALGKDTHFKLDKLTRTEENEITEALREALVNAIAHADYFNNARHLKIVKTT
FT                   NQISFENAGIMLVEVEQAILGNRSECRNGKIHDLLRRIGLCERQGEGVRDIFAHWKSRY
FT                   FNTPKLESHIDHTKLTLTFQDGEIAKWQEKLTACLGKDFLKLKEIGKDCLLYIAVNGQQ
FT                   ASHKHMTDKMPQYSSRAITLALAQLKNKGLLSVSGEKRSDRVYHLLELIADKSKCDYVD
FT                   NSLTVQDKTIENQMVIENNSLGYIQDRIQDRIQDNLASLLEILNDTAYSTSELLTLLAL
FT                   KSRPSFVKNYLNKALQAELIEMTIPDKPTSRNQRYRLTRTGKQLLAKLKRDTQ"
FT   gene            566489..567985
FT                   /pseudo
FT                   /locus_tag="HSM_0490"
FT                   /note="N-6 DNA methylase"
FT   gene            568291..568572
FT                   /locus_tag="HSM_0492"
FT   CDS_pept        568291..568572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0492"
FT                   /product="NapD family protein"
FT                   /note="PFAM: NapD family protein; KEGG: hso:HS_1509
FT                   periplasmic nitrate reductase, component NapD"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32138"
FT                   /db_xref="GOA:B0URQ2"
FT                   /db_xref="InterPro:IPR005623"
FT                   /db_xref="UniProtKB/TrEMBL:B0URQ2"
FT                   /protein_id="ACA32138.1"
FT                   /translation="MKENKNAKNHAEEWHVCGLIIQVNPQKIAQVKTALLTIPHTEIPA
FT                   EDEKGKLVVVMQSDDPQVLLNHMENSRNIDGVIDLSLIYHQQDDNVEQ"
FT   gene            568599..571082
FT                   /locus_tag="HSM_0493"
FT   CDS_pept        568599..571082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0493"
FT                   /product="periplasmic nitrate reductase, large subunit"
FT                   /note="TIGRFAM: periplasmic nitrate reductase, large
FT                   subunit; PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; molybdopterin oxidoreductase
FT                   Fe4S4 region; KEGG: hso:HS_1508 periplasmic nitrate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32139"
FT                   /db_xref="GOA:B0URQ3"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010051"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="InterPro:IPR041957"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0URQ3"
FT                   /protein_id="ACA32139.1"
FT                   /translation="MNLSRRDFMKANAALAAASVAGLIIPVKNVNAADTSITWDKAVCR
FT                   FCGTGCAVLVGTKDGRVVASQGDPDAEVNRGLNCIKGYFLPKIMYGKDRLTHPMLRMKN
FT                   GQYDKEGEFTPVTWDFAFKTMAEKFKSALKAKGPNGVGMFTSGQSTIFEGVAKSKLFKA
FT                   GLLSNNIDPNARHCMASAAVAFVRTFGIDEPMGCYDDIEHADAFVLWGSNMAEMHPILW
FT                   SRISDRRLANPDTVSVNVLSTFEHRSFELADLGILLKPQSDLAILNYIANYLIENNAIN
FT                   REFIEKHTKFKRGETDIGYGLRPQDPREQTAKNVKTAGKMYDSSFEEFKKLVAPYTLEK
FT                   AHEISGVPKEQLEKLAKLYADPNKKVVSYWTMGINQHTRGVWANHLIYNIHLLTGKISL
FT                   PGCGPFSLTGQPSACGTAREVGTFIHRLPADLVVIKPEHRKIAEKIWKLPEGLISDKLG
FT                   FHAVAQSRALKDGKMQVLWQMCNNNMQAGPNINEETYPGWRNPDNFIVVSDPYPTVSAL
FT                   SADLILPTAMWVEKEGAYGNAERRTQFWRQQVKAPGEAKSDLWQLVEFSKYFTTDEVWP
FT                   AEILAKNPAYQGKTLYEVLYLNGQVNQYSNDELKGRLNDEAYHFGFYIQKGLFEEYASF
FT                   GRGHGHDLADFDTYHKARGLRWPVVDGKETLWRYREGYDPYVKAGEGVSFYGQADKRAV
FT                   ILAVPYEPPAEVPDRKYDLWLTTGRILEHWHTGSMTRRVPELHRSFPNNLVWMNPNDAK
FT                   KRGLKHGDKIKVISRRGEITSYIDTRGRNKCPEGLIYTTFFDAGQLANKLILDATDPIS
FT                   KETDFKKCAVKVVKA"
FT   sig_peptide     568599..568697
FT                   /locus_tag="HSM_0493"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.989 at
FT                   residue 33"
FT   gene            571133..571885
FT                   /locus_tag="HSM_0494"
FT   CDS_pept        571133..571885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0494"
FT                   /product="MauM/NapG family ferredoxin-type protein"
FT                   /note="TIGRFAM: MauM/NapG family ferredoxin-type protein;
FT                   PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain protein;
FT                   KEGG: hso:HS_1507 ferredoxin-type protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32140"
FT                   /db_xref="InterPro:IPR004494"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B0URQ4"
FT                   /protein_id="ACA32140.1"
FT                   /translation="MKKIAFTPERRKFLRDTVRTCGGLAGLGVLLGLQQHQSLARQGVA
FT                   LRPPGALANDQDFTAACIRCGQCVQACPYKMLHLASLLSSIEAGTPYFIAREKACEMCE
FT                   DIPCVKACPSGALDNQLDDISKATMGLAVLLDHETCLNWQGLRCDVCYRVCPLIDKAIT
FT                   LEKHRNERTGKHAVFIPTVHSNACTGCGKCEEACVLEEAAIKVLPNTLAKGMLGEHYRL
FT                   GWQEKDKVGHSLAPKDLISLPIRQPESK"
FT   sig_peptide     571133..571255
FT                   /locus_tag="HSM_0494"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.742) with cleavage site probability 0.693 at
FT                   residue 41"
FT   gene            571885..572757
FT                   /locus_tag="HSM_0495"
FT   CDS_pept        571885..572757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0495"
FT                   /product="ferredoxin-type protein, NapH/MauN family"
FT                   /note="TIGRFAM: ferredoxin-type protein, NapH/MauN family;
FT                   PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain protein;
FT                   KEGG: hso:HS_1506 ferredoxin-type protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32141"
FT                   /db_xref="GOA:B0URQ5"
FT                   /db_xref="InterPro:IPR011886"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B0URQ5"
FT                   /protein_id="ACA32141.1"
FT                   /translation="MANSPKHSGRESREKLGFWRANRFLILRRVTQFNILTMFLSGPYL
FT                   NFWILKGNYSGSLLFDTIPLTDPLIVAESLATGYLPNSSTIIGTIIVVSIYALLGSKVF
FT                   CGWVCPLNVVTDCAAWLRRKLGIRQSAKLPRGLRYGILLMILMGSAVSGVLLWEWINPV
FT                   SALGRALIYGVGATTWLILAVFLFDLFIVEHGWCGHLCPIGAIYGVIGAKSLLRIKVVE
FT                   QQKCDHCMDCYHICPEPQVLRAPLHGKNNESRFVLSKDCISCGRCIDVCAEKVFIFSNR
FT                   FNHSGSDQK"
FT   gene            572754..573179
FT                   /locus_tag="HSM_0496"
FT   CDS_pept        572754..573179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0496"
FT                   /product="Nitrate reductase cytochrome c-type subunit
FT                   (NapB)"
FT                   /note="PFAM: Nitrate reductase cytochrome c-type subunit
FT                   (NapB); KEGG: hso:HS_1505 periplasmic nitrate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32142"
FT                   /db_xref="GOA:B0URQ6"
FT                   /db_xref="InterPro:IPR005591"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:B0URQ6"
FT                   /protein_id="ACA32142.1"
FT                   /translation="MMKKTLLFITALFVSSAFATQKVGKNYQDAVENVPAAFHNHIKES
FT                   TTPALNYVNQPPMIPHSVANYQVTKNTNQCLNCHSPENSRITGATRISPTHFTDRDGNV
FT                   TGQTAPRRYFCLHCHVSQADVAPIVPNEFKPMKGYGN"
FT   sig_peptide     572754..572813
FT                   /locus_tag="HSM_0496"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.988 at
FT                   residue 20"
FT   gene            573194..573805
FT                   /locus_tag="HSM_0497"
FT   CDS_pept        573194..573805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0497"
FT                   /product="NapC/NirT cytochrome c domain protein"
FT                   /note="PFAM: NapC/NirT cytochrome c domain protein; KEGG:
FT                   hso:HS_1504 cytochrome c-type protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32143"
FT                   /db_xref="GOA:B0URQ7"
FT                   /db_xref="InterPro:IPR005126"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR024717"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="InterPro:IPR038266"
FT                   /db_xref="UniProtKB/TrEMBL:B0URQ7"
FT                   /protein_id="ACA32143.1"
FT                   /translation="MANEKSNIIVRLSKSGWKWFRKPSRAVSVLILLSFIAGIIFWGGF
FT                   NTAFEYTNTEEFCSSCHMNDVVPEYRHSVHYMNRSGVKADCADCHLPHEFIPKWTRKIG
FT                   AAKEVYAYITGKVDTKEKFEAHRLEMAQREWARMKANDSQECRHCHNFNDMDTTQQKNV
FT                   AQKMHRMAQEQGKTCIDCHKGIAHQLPNMKDVQSGFLPEQ"
FT   sig_peptide     573194..573346
FT                   /locus_tag="HSM_0497"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.783) with cleavage site probability 0.387 at
FT                   residue 51"
FT   gene            complement(573900..577793)
FT                   /locus_tag="HSM_0498"
FT   CDS_pept        complement(573900..577793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0498"
FT                   /product="phosphoribosylformylglycinamidine synthase"
FT                   /EC_number="6.3.5.3"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine synthase;
FT                   PFAM: AIR synthase related protein; AIR synthase related
FT                   protein domain protein; KEGG: hso:HS_1503
FT                   phosphoribosylformylglycinamidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32144"
FT                   /db_xref="GOA:B0URQ8"
FT                   /db_xref="InterPro:IPR010073"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR040707"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:B0URQ8"
FT                   /protein_id="ACA32144.1"
FT                   /translation="MLHIFRGTPALSNFRLNQLFSGFQQDNLPIVSCYAEFLHFAHLSE
FT                   ALTEVEREKLEELLRYGPTQKSQEPYGECFVVIPRIGTISSWASKATDIAHNCDLNKVL
FT                   RLERGIAYYFKFNRTLTAEEEQQLVFRIYDPMMESIVRSPQEAAVLFEQHDPKPFTTVD
FT                   ILTGGHVALEKANVTLGLALAKDEIDYLVENFTALGRNPTDVELYMFAQANSEHCRHKI
FT                   FNADWIIDGKKQDKSLFKMIKNTFEKTPDYVLSAYKDNAAVMEGSKVGRFFPDQDGQYR
FT                   YHQEDTHILMKVETHNHPTAISPFPGAATGSGGEIRDEGATGRGAKPKAGLVGFSVSNL
FT                   CIPNFPQPWENALSKPSRIASALDIMIEGPLGGAAFNNEFGRPALLGYFRTYEEKVNSF
FT                   NGEEVRGYHKPIMLAGGIGNIRHEHVQKGEIPVGAKLIVLGGAAMNIGLGGGAASSMAS
FT                   GKSKEDLDFASVQRDNPEMERRCQEVIDRCWQLGSENPILFIHDVGAGGLSNAMPELVH
FT                   DGGRGGRFELRKILCDEKGMSPLEIWCNESQERYVLAVSPEKLPLFEAICQRERASFAV
FT                   IGEATEQQQLTLQDSHFNNNPIDLPMNILLGKTPKMIRDVKSAKVNNPQLDQSMIQIKE
FT                   ALFRVLRLPAVAEKTFLITIGDRSVTGMVARDQMVGPWQVPVADCAVTTASLDSYHGEA
FT                   MSIGERTPVALLDFAASARLAVAESITNIAATDIGNIRRIKLSANWMAAAGHGGEDAGL
FT                   YEAVKAIGEELCPQLGLTIPVGKDSMSMKTTWQEEGYQKSVTAPLSVIISAFARVEDVR
FT                   KTVTPQLRLDKGDSRLLLIDLGEGKNRLGATALAQVYKQLGDVPADVVNVSLLKGFFNA
FT                   MQALVKQEKLLAYHDRSDGGLIVTLAEMAFAGHCGISIDISALGDNDLGVLFNEELGAV
FT                   IQVKESDLKAVRAVLTEHGLIHLTKELGIVTADDHIEITRSTRVLLSEKRSVLRGIWAE
FT                   LTHQMQRLRDNPDCADQEFEMKKDPNDKGLSAYLTYDLNEKITAPYIHKGTKPRIAILR
FT                   EQGVNSHYEMAAAFDRAGFNAIDVHMSDLQKGRHHLQDFNALVACGGFSYGDVLGAGGG
FT                   WAKSILFNTALRDQFSAFFHRQDTLALGVCNGCQMLSNLAEIIPGTENWGRFVRNKSER
FT                   FEARVAMVRINDTHSVWFNGMSGSHMPIAVSHGEGRIEFKHDQQLQALKAQNLIAAQYI
FT                   DSQLNPTEIYPANPNGSAEGITALSNSNGRVAIMMPHPERVFRAVNNSWYPENWQEDGA
FT                   WMRLFQNARVALG"
FT   gene            complement(577974..579011)
FT                   /locus_tag="HSM_0499"
FT   CDS_pept        complement(577974..579011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0499"
FT                   /product="peptidase M23B"
FT                   /note="PFAM: Peptidoglycan-binding LysM; peptidase M23B;
FT                   KEGG: hso:HS_1502 lipoprotein B"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32145"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:B0URQ9"
FT                   /protein_id="ACA32145.1"
FT                   /translation="MKKFLPLSISITVLAACSSHTPAPVENAKDLAPSIIKPINGTNST
FT                   AWEPQVIQQKMPESMRVPKATNSTYQPEIIQQNQQKTESIAKKQALQNFEIPRDPKTNV
FT                   PVYSKIDKGFYKGDTYKVRKGDTMFLIAYISGMDIKELATLNNMSEPYHLSIGQILKIA
FT                   NNIPDSNMIPTQTINESEVTQNTVNETWNANRPTNEQMNPVATPTHSTMPINKTPPATS
FT                   NIAWIWPTNGKIIQGFSSADGGNKGIDISGSRGQAVNAAAAGRVVYAGDALRGYGNLII
FT                   IKHNDSYLSAYAHNESILVKDQQEVKAGQQIAKMGSSGTNTIKLHFEIRYKGQSVDPMR
FT                   YLPKN"
FT   sig_peptide     complement(578925..579011)
FT                   /locus_tag="HSM_0499"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.751 at
FT                   residue 29"
FT   gene            complement(579052..579627)
FT                   /locus_tag="HSM_0500"
FT   CDS_pept        complement(579052..579627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0500"
FT                   /product="SNARE associated Golgi protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   hso:HS_1501 possible lipoprotein B"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32148"
FT                   /db_xref="GOA:B0URR0"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:B0URR0"
FT                   /protein_id="ACA32148.1"
FT                   /translation="MKIFGTLYDKTMQWANHRFATFWLTFVSFIEAIFFPIPPDVMLIP
FT                   MSINKPKCATKFAFYAAMASAIGGAIGYGLGYYAFDFIQSYIQQWGYQQHWETALSWFK
FT                   EWGIWVVFVAGFSPIPYKIFTICAGVMQMAFLPFLLTAFISRIARFLLVTHLAAWSGKK
FT                   FAAKLRQSIEFIGWSVVIIAIVVYLVLK"
FT   gene            complement(579657..580397)
FT                   /locus_tag="HSM_0501"
FT   CDS_pept        complement(579657..580397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0501"
FT                   /product="stationary-phase survival protein SurE"
FT                   /EC_number="3.6.1.11"
FT                   /note="TIGRFAM: stationary-phase survival protein SurE;
FT                   PFAM: Survival protein SurE; KEGG: hso:HS_1500
FT                   stationary-phase survival protein, acid phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32149"
FT                   /db_xref="GOA:B0URR1"
FT                   /db_xref="InterPro:IPR002828"
FT                   /db_xref="InterPro:IPR030048"
FT                   /db_xref="InterPro:IPR036523"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0URR1"
FT                   /protein_id="ACA32149.1"
FT                   /translation="MHILLSNDDGIQAEGIKTLAKELRKFAQVTVVAPDRNRSAASSSL
FT                   TLVEPLRPMKLDNGDYSINGTPADCVHLALNGFLSGQIDLVVSGINAGVNLGDDVIYSG
FT                   TVAAALEGRHLSLPAIAVSLDGRQHYESAAIIVSQLIPKLYGRLLKSREIININVPDLP
FT                   YSEIKGIKVCHLGYRAAAADIIKQKDPRGEEIYWIGPIGLAENESEGTDFHAVKNGYVS
FT                   ITPIQTDMTAYHSMTALQQWLDKE"
FT   gene            complement(580421..581428)
FT                   /locus_tag="HSM_0502"
FT   CDS_pept        complement(580421..581428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0502"
FT                   /product="tRNA pseudouridine synthase D TruD"
FT                   /note="PFAM: tRNA pseudouridine synthase D TruD; KEGG:
FT                   hso:HS_1499 tRNA pseudouridine synthase D"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32150"
FT                   /db_xref="GOA:B0URU7"
FT                   /db_xref="InterPro:IPR001656"
FT                   /db_xref="InterPro:IPR011760"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR020119"
FT                   /db_xref="InterPro:IPR042214"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0URU7"
FT                   /protein_id="ACA32150.1"
FT                   /translation="MNELAYLQTMPKQTALLKTHCADFVVKEQLGYEMSGDGEFVAVKV
FT                   RKTDCNTLFVAEKLAHFAGIPAKNMGYAGLKDRKAITEQWFCLQMPGQPTPDFNQFQLD
FT                   GVEILEVTRHNRKIRTGSLDGNHFEILLREAQEDADLKVRLENIKKNGFPNYFTEQRFG
FT                   RDGHNLTQALRWAKGEINVKDRKKRSFYLSAARSEIFNLIVSARIRQGLHHKILVNDIL
FT                   QLSGSHSWFHADQKEDFNLLQQRLAQQDIQITAPLIGENVQIASDVENEIIAKHQELLY
FT                   LMHQEKMKSARRPILMQAQHLSWSFIPEGLKLTFYLPAGSYATALVRELVNINE"
FT   gene            complement(581428..581916)
FT                   /locus_tag="HSM_0503"
FT   CDS_pept        complement(581428..581916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0503"
FT                   /product="2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /EC_number="4.6.1.12"
FT                   /note="TIGRFAM: 2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase; PFAM: MECDP-synthase; KEGG: hso:HS_1498
FT                   2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32151"
FT                   /db_xref="GOA:B0URU8"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0URU8"
FT                   /protein_id="ACA32151.1"
FT                   /translation="MIRIGHGFDVHAFGGEGPIIIGGVAIPYEKGLVAHSDGDVALHAL
FT                   TDALLGAMALGDIGKLFPDTDIQYKGADSRRLLRTAYQAILDKGYQVGNVDITIIAQAP
FT                   KMRPYIDSMRTVIAQDLHCDIEQVNVKATTTEKLGFTGRSEGIACEAVVLLIKQNGTK"
FT   gene            complement(581929..583734)
FT                   /locus_tag="HSM_0504"
FT   CDS_pept        complement(581929..583734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0504"
FT                   /product="potassium efflux system protein"
FT                   /note="TIGRFAM: potassium efflux system protein; PFAM:
FT                   TrkA-N domain protein; sodium/hydrogen exchanger; KEGG:
FT                   hso:HS_1497 glutathione-regulated potassium-efflux system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32152"
FT                   /db_xref="GOA:B0URU9"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B0URU9"
FT                   /protein_id="ACA32152.1"
FT                   /translation="MVAEGANPLVSVVTLLAAAVVAVPLFKRLGLGSVLGYLAAGLVIG
FT                   PFGFGLFTDPEGIIHIAELGVVMFLFIIGLEMKPSHIWGLRNYIFLLGAFQITLCTSAL
FT                   TYIATLFGFDWKVAFVAASGFVLTSTAIVMQELSERNDLTSPRGQRIISILLFEDLLIV
FT                   PLLAFVAFLSPDKVTSTDPLWHKIAISGTAFAVLVAAGLWLLNPLFKMLAKTKTREVMT
FT                   AAALLVVLGSALLMEEGGFSMAMGAFLAGVLLSESSFRHQLEADIEPFRGLLLGLFFLG
FT                   VGMSLNLSVVAENWFLIIFGVLLFMLVKGFIIYLIALITKTGNANSIDRAFIMAQGGEF
FT                   AFVLFSAAASQNVISEEMQANMTAIVVLSMILTPLFIIAQKKYIIPRLKPTQPERKADH
FT                   IDEQHPTILIGLGRFGQVVNRMLVMTGHHPTIIDKDANLIAGMKKLGIKCYYGDAARPE
FT                   LLHAAGVENAELLIIAIDNREQTLQIVEQARKMNPQIKIIARAHDRIHVYNLYGAGANI
FT                   QIRETFDSALRTSKQALLSLGMNEDIVAEIGDVYFRKDCHSVKLMAEVYDPKLSRFENK
FT                   ELIQIALDVDQEMMAEIQQIMKKEH"
FT   gene            complement(583740..584423)
FT                   /locus_tag="HSM_0505"
FT   CDS_pept        complement(583740..584423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0505"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /note="TIGRFAM: 2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase; PFAM:
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol synthase; KEGG:
FT                   hso:HS_1496 2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32153"
FT                   /db_xref="GOA:B0URV0"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/TrEMBL:B0URV0"
FT                   /protein_id="ACA32153.1"
FT                   /translation="MDREIVAIIPAAGIGCRMQADRPKQYLKILGKTILEHTLSIFLSC
FT                   EKISQIVLSVAENDPYLIDIELLRNPRINMVIGGKNRAESVLNGLRHLKNKKAWVLVHD
FT                   AARPCLRNEDLDTLLQVEDQNGAILAIPAVDTIKRSNSVLQIQCTEDRNQLWLAQTPQF
FT                   FPVHLLQHALEQAAKRGIIVTDEALAMELAGFRPHLVAGHSDNIKVTRPEDLALAEFFL
FT                   TRKQR"
FT   gene            complement(584424..584705)
FT                   /locus_tag="HSM_0506"
FT   CDS_pept        complement(584424..584705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0506"
FT                   /product="Septum formation initiator"
FT                   /note="PFAM: Septum formation initiator; KEGG: hso:HS_1495
FT                   cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32154"
FT                   /db_xref="GOA:B0URV1"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="InterPro:IPR023081"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0URV1"
FT                   /protein_id="ACA32154.1"
FT                   /translation="MRLFILSLFALLVMFQYDFWFGKNGYLDYQDIKAEIIQRKQENKK
FT                   LSQRNQTIFAEIQDLKNGIEAIEERARMEHEMIKQNEVFYRIVKNKNR"
FT   gene            complement(584715..585191)
FT                   /locus_tag="HSM_0507"
FT   CDS_pept        complement(584715..585191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0507"
FT                   /product="transcription elongation factor GreB"
FT                   /note="TIGRFAM: transcription elongation factor GreB; PFAM:
FT                   transcription elongation factor GreA/GreB domain protein;
FT                   KEGG: hso:HS_1494 transcription elongation factor"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32155"
FT                   /db_xref="GOA:B0URV2"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006358"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:B0URV2"
FT                   /protein_id="ACA32155.1"
FT                   /translation="MPKSNYITRSGWNILDQELKYLWKDERPKITQAVSDAAALGDRSE
FT                   NAEYIYGKRRLREIDRRVRFLMKRLEVLQIVDYNPKQEGKVFFGAWVALEDEQGEEKQY
FT                   RIVGCDEFDPAKNWISIDSPVARALIGKEVDDEIKVATPSGIVSLYINRIWYEK"
FT   gene            585371..587674
FT                   /locus_tag="HSM_0508"
FT   CDS_pept        585371..587674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0508"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="PFAM: RNA binding S1 domain protein; SMART:
FT                   Resolvase RNase H domain protein fold; KEGG: hso:HS_1493
FT                   transcription accessory protein, RNA-binding protein
FT                   containing S1 domain"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32156"
FT                   /db_xref="GOA:B0URV3"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:B0URV3"
FT                   /protein_id="ACA32156.1"
FT                   /translation="MLNQQIAGIIAKELAVLPSQILSAIQLLDDGNTIPFIARYRKEMT
FT                   GGLDDTQLRHFETRLIYLRELEDRRQTILNSIEEQGKLTDELRSQIEQTQSKTELEDLY
FT                   LPYKPKRRTKGQIAIEAGIEPLADLLWNAPENEPEIVAADYINAEQGFADIKSVLDGAR
FT                   YILMERFAEDAQLLAKIRQYLQKSAVLVSNVLEGKEAEGEKFRDYFEHQELLRNVPSHR
FT                   ALAMFRGRNEGFLQLRLNADPEQEEGVRHSYCEEIIREHLGIHLTQQPADKWREQVISW
FT                   TWRIKISLHLETELMSSLREKAEDEAIDVFAQNLTSLLMAAPAGAKNTMGLDPGLRTGV
FT                   KVAIVDNTGKLVATETVYPHTGQMNTAMSVIYQLIKQHNVELIAIGNGTASRETERFAK
FT                   DVINKIEQNKPQTVVVSEAGASVYSASELAAQEFPELDVSLRGAVSIARRLQDPLAELV
FT                   KIEPKAIGVGQYQHDVNQTQLARKLDAVVEDCVNAVGVDLNTASAPLLARVAGMTKHLA
FT                   QNIVAYRNENGRFESRNQLKKVPRLGPKAFEQCAGFMRIAQGKNPLDASGVHPEAYPVV
FT                   EKILQATEKSIQDLMGNVSAVRQLDAKQFTDEQFGMPTVLDIFKELEKPGRDPRGQFKT
FT                   AVFMDGVEEITDLKAGMILEGSVTNVTNFGAFVDIGVHQDGLVHISSLSDKFVENSHEV
FT                   VKTGDIVKVKVLEVDVARKRIGLTMRLDENPSKTDRTSVKTTSVHVKEVNKNRKSSNNV
FT                   MGNAFADALKNWKK"
FT   gene            587741..589057
FT                   /locus_tag="HSM_0509"
FT   CDS_pept        587741..589057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0509"
FT                   /product="branched-chain amino acid transport system II
FT                   carrier protein"
FT                   /note="PFAM: branched-chain amino acid transport system II
FT                   carrier protein; KEGG: hso:HS_1492 branched-chain amino
FT                   acid carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32157"
FT                   /db_xref="GOA:B0URV4"
FT                   /db_xref="InterPro:IPR004685"
FT                   /db_xref="UniProtKB/TrEMBL:B0URV4"
FT                   /protein_id="ACA32157.1"
FT                   /translation="MNKNTFFVGFMLFAIFFGAGNLIFPPKLGFDSGSEFIPSILGFVL
FT                   TGVGLPLLGIVVSAFYNGGYKEALKQIHPAFSLIFLIAIYLSIGPFFAGPRTGATAYEF
FT                   VILPFMGEATSISKLVFFAVYFSLTLWLSLNPTKLVDRIGSILTPILLVAIIALVIRSV
FT                   FLLSGQDIPSVTVNTSGSFFNGVIEGYFTMDALASVAFSVVVLNAIRNKTDLSVSLKQQ
FT                   TIFAAFIAAIALGLIYVALGWIGNNISINADVLADLQAKKQDLGTYILNDVTTLAFGEL
FT                   GRTLLGIIVSLACLTTAVGLAVAVSEYFNEIYPKISYKTYVVLFCLVSFVIANLGLKEV
FT                   ISLSLPVLLILYPIAMTVILLLFVNIIFPTPILAHRLSLGLVTVVSVLSVFGVGKIEFI
FT                   EQLPLKPYSMEWLPFALVGFILGCFLHIFFSKEKSVLKR"
FT   gene            complement(589095..589676)
FT                   /locus_tag="HSM_0510"
FT   CDS_pept        complement(589095..589676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0510"
FT                   /product="HesB/YadR/YfhF-family protein"
FT                   /note="PFAM: HesB/YadR/YfhF-family protein; nitrogen-fixing
FT                   NifU domain protein; KEGG: hso:HS_1491 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32159"
FT                   /db_xref="GOA:B0URV5"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR017726"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0URV5"
FT                   /protein_id="ACA32159.1"
FT                   /translation="MQITISEAAQAHFRRLLDQQEEGTNIRIFVVNPGSPNAECGVSYC
FT                   PKNAVETTDHEIKYSEFSAFIDEVSFPFLEDAEIDYITEEMGSQLTLKAPNAKMRKVAD
FT                   DAPLIERVEYAIQTQINPQLAGHGGHITLIEITKDGKAILQFGGGCNGCSMVDVTLKDG
FT                   IEKQLLAMFADELTGVKDVTEHQRGEHSYY"
FT   gene            complement(589769..590467)
FT                   /locus_tag="HSM_0511"
FT   CDS_pept        complement(589769..590467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0511"
FT                   /product="competence protein"
FT                   /note="KEGG: hso:HS_1490 competence protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32160"
FT                   /db_xref="GOA:B0URV6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B0URV6"
FT                   /protein_id="ACA32160.1"
FT                   /translation="MNWFNFSCVHCQKPLNFAHRHLCYQCDKQISRLNYCGRCGAVLSK
FT                   NQAFRGQMFCGNCAKQSPNWQQMVVIGRYQPPLSTLIHQFKFQNRYYLDRTLAQLMLLA
FT                   IYHARREYLFSLPEVIVPVPLHHFRQWYRGYNQAYLIAKQLSRQLSIPLDNKLVVRQKY
FT                   TKMQRGLNEKARRSNLHNAFNVNIKRAKQYHSIALIDDVITTGSTLNEIAKLLKQAGIN
FT                   VIHVWGLAKT"
FT   gene            590614..591426
FT                   /locus_tag="HSM_0512"
FT   CDS_pept        590614..591426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0512"
FT                   /product="Cof-like hydrolase"
FT                   /note="TIGRFAM: Cof-like hydrolase; HAD-superfamily
FT                   hydrolase, subfamily IIB; PFAM: Haloacid dehalogenase
FT                   domain protein hydrolase; Haloacid dehalogenase domain
FT                   protein hydrolase type 3; KEGG: hso:HS_1489 possible Cof
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32161"
FT                   /db_xref="GOA:B0URV7"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B0URV7"
FT                   /protein_id="ACA32161.1"
FT                   /translation="MSLTDYREKISMVFFDIDETLFSKEKDHLPASTYFALKSLREKGV
FT                   LVGIATGRARCTFPAKINQMIDELGIDIFVTANGQHVEYQGRTLARYAIDKNKLYKLVE
FT                   FFDQYGIDYVQVANTEIKISSLNPILTDAFNPISTNYQVDPRYFERHDVLQILSFYEDK
FT                   SYDELIAQSNILEGLKTVRWHPNSVDIFDKDGSKARGIQVVVEHLGLNMENVMAFGDGL
FT                   NDIEMLSAVGVGVAMGNGHELLKQQANYVTDHIEENGIYNFLHKVGLV"
FT   gene            591558..592598
FT                   /locus_tag="HSM_0513"
FT   CDS_pept        591558..592598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0513"
FT                   /product="aminodeoxychorismate lyase"
FT                   /note="PFAM: aminodeoxychorismate lyase; KEGG: hso:HS_1488
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32162"
FT                   /db_xref="GOA:B0URV8"
FT                   /db_xref="InterPro:IPR003770"
FT                   /db_xref="UniProtKB/TrEMBL:B0URV8"
FT                   /protein_id="ACA32162.1"
FT                   /translation="MKKILFIVLLFLCGAGGSVFWAYWQITDFVKQPVKVKEEQLLTVV
FT                   RGTTGNKLAILLENEGLIENGKWLPWLLKLKPELNKIKAGTYSLVNVENIQDLLDVLNQ
FT                   GKEVQFNLQLIEGQRFKTWRKILENAPHLRQTLQGKSEKEIFTLLELPAYSKAVYEWKT
FT                   IDGWLYPDTYSYTPNSSDLALLKRAASRTIKALERAWQQRNVNLPLKNPYEMLILASIV
FT                   EKETALSEERAKVAGVFVNRLNKQMKLQTDPTVIYGMGDDYKGNIRKKDLLTPTPYNTY
FT                   VIDGLPPTPIAMVSEESLQAVAKPEQHDYLYFVADGSGGHKFSKTLAEHNRAVQEYLRW
FT                   YRSQSK"
FT   sig_peptide     591558..591611
FT                   /locus_tag="HSM_0513"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.760) with cleavage site probability 0.348 at
FT                   residue 18"
FT   gene            592608..593240
FT                   /locus_tag="HSM_0514"
FT   CDS_pept        592608..593240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0514"
FT                   /product="dTMP kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="PFAM: thymidylate kinase; KEGG: hso:HS_1487
FT                   thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32163"
FT                   /db_xref="GOA:B0URV9"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0URV9"
FT                   /protein_id="ACA32163.1"
FT                   /translation="MKTGKFIVIEGLEGAGKSSTHQVVVNTLTEFGIHEVVFTREPGGT
FT                   PLAEKLRYLIKHEAEELVTAKAELLMLYAARVQLVENVIKPALARGKWVVGDRHDLSSQ
FT                   AYQGGGRGLDRHLMTTLKNAVLGDFKPDFTLYLDIEPEIGLARAKGRGELDRIEQQNLD
FT                   FFHRTRERYLQLVQQDPNAVLINAGQPIELVQQDIRKAVQKFIEENV"
FT   gene            593164..594222
FT                   /locus_tag="HSM_0515"
FT   CDS_pept        593164..594222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0515"
FT                   /product="DNA polymerase III, delta prime subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="TIGRFAM: DNA polymerase III, delta prime subunit;
FT                   PFAM: DNA polymerase III delta subunit; KEGG: hso:HS_1486
FT                   DNA polymerase III, delta' subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32164"
FT                   /db_xref="GOA:B0URW0"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR015199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0URW0"
FT                   /protein_id="ACA32164.1"
FT                   /translation="MRGNLLSLCSKIFVKLCKNLLKKMCNLYPWLQPYYQQIIQPFLQE
FT                   KGHHALLFKAEQGIGIEQLIENIAGWLMCRKKDAPQSCRQCQSCALFRAGNHPDFYRLE
FT                   SLDNKDIGVEQVREMNEKVSQFAKQGGNKVVFIRQAERLTESAANALLKTLEEPRPHTY
FT                   FLLQMDFSAGLLATIYSRCQAWVINTPTEQQGLVWLQQQRQEKIADLQTALRINYNRPL
FT                   LALDCLEKGLLEQRTTFLRQFWLFYIRRSPLELLPHFTKENVLLQLDWMSAFLHDALKE
FT                   KLGVRQGWISQDLARGILQFNEKQNVEELLKAIQIIQKMRLNLTQINGVNQELILLEGL
FT                   TRLVTDVFERKE"
FT   gene            594231..595013
FT                   /locus_tag="HSM_0516"
FT   CDS_pept        594231..595013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0516"
FT                   /product="hydrolase, TatD family"
FT                   /note="TIGRFAM: hydrolase, TatD family; PFAM: TatD-related
FT                   deoxyribonuclease; KEGG: hso:HS_1485 conserved hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32165"
FT                   /db_xref="GOA:B0URW1"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B0URW1"
FT                   /protein_id="ACA32165.1"
FT                   /translation="MFIVDSHCHLDALDYENLHTDIADVVDKAKQRDVKHLLAVGVTLK
FT                   RFEQAYAQLALFKEVSLACGVHPLDLAEEPFDYQRLLRLAQDEKVVAIGETGLDYYYSI
FT                   ENKALQQSVFAQQIEIANQLSKPVIVHTRSARDDTIAILRENNAQKCGGVLHCFTENWG
FT                   MAKQALDLGFYISISGIITFKNAQELRDVVRQVPLESLLVETDSPYLAPVPYRGKQNQP
FT                   AYTREVCEYVATLKGLSAEDFAQITTQNFERLFKINVQ"
FT   gene            595041..595568
FT                   /locus_tag="HSM_0517"
FT   CDS_pept        595041..595568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0517"
FT                   /product="protein of unknown function DUF1523"
FT                   /note="PFAM: protein of unknown function DUF1523; KEGG:
FT                   hso:HS_1484 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32166"
FT                   /db_xref="GOA:B0URW2"
FT                   /db_xref="InterPro:IPR011088"
FT                   /db_xref="UniProtKB/TrEMBL:B0URW2"
FT                   /protein_id="ACA32166.1"
FT                   /translation="MRKIFKKVVLGLLFLFHVFLFSVVHYVTPHYDVTKVTGVEVKRVD
FT                   KDGPITKANPADGPTRDVYYIYTQKPNEENVMVYRNEDTRWSFPFYFKFGSADLQAKAQ
FT                   SFSVDHKLVEIKYYGWRLVMFDEFRNAVSVKEVSADTEASHSILAYVFYAFLLITLFFS
FT                   IQFVRGWFDSED"
FT   sig_peptide     595041..595109
FT                   /locus_tag="HSM_0517"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.786) with cleavage site probability 0.526 at
FT                   residue 23"
FT   gene            595629..596918
FT                   /locus_tag="HSM_0518"
FT   CDS_pept        595629..596918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0518"
FT                   /product="protein of unknown function DUF21"
FT                   /note="PFAM: CBS domain containing protein; protein of
FT                   unknown function DUF21; transporter-associated region;
FT                   KEGG: hso:HS_1483 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32167"
FT                   /db_xref="GOA:B0URW3"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B0URW3"
FT                   /protein_id="ACA32167.1"
FT                   /translation="MSLLQAILVIIGLIIISAVVSSAEISLAGSRKLKLQMLANEGDKR
FT                   AVQVLKLQEQPGRFITVVQIGLNMVAIFGGIVGESAIRPFLQEILSAYTQSFWVESAAS
FT                   WLAFIIVTVSFVLFADLMPKRLAMTSPEKVALSTVGIMSFCIVIFKPVVLIFDTIANGI
FT                   FRLLGISTMREESMTPADIVAIVDAGAEAGVLKAQEHYLIENIFEMQERTVTSTMTTRE
FT                   NIVFLDRSFEREQVITTIKNNPHSKLLICDHGLDKILGYVESHNLLTLYLQEQKVSLTE
FT                   PRILRKALFIPDTLSLYEVLELFKSSGEDFAVIVNEYALVVGIVTLNDVMSIVMGELVS
FT                   NEEEQIVRRDETSWLIDGATPLEDVARALEINEFPDEENYETIGGFMMYMLRKIPKKTD
FT                   FVLYDRYKFEIIDTENFKIDQLMVSLRKDI"
FT   sig_peptide     595629..595697
FT                   /locus_tag="HSM_0518"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.497 at
FT                   residue 23"
FT   gene            complement(597062..597505)
FT                   /locus_tag="HSM_0519"
FT   CDS_pept        complement(597062..597505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0519"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hso:HS_1482 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32168"
FT                   /db_xref="InterPro:IPR016596"
FT                   /db_xref="InterPro:IPR022548"
FT                   /db_xref="UniProtKB/TrEMBL:B0URW4"
FT                   /protein_id="ACA32168.1"
FT                   /translation="MKIFSTLLLAITLGLTGCARTVMDTPENDALAKQFLLPSKDESGI
FT                   YIYRDSIFGAALKKNLYIDGKLIGESAPKTYFYKRVIPGNHRLSTESEFSDNHLDITTD
FT                   GGKNYFIRQYIKPGAFVGGANLKQVDEDKGKATILKLKRALAQ"
FT   sig_peptide     complement(597440..597505)
FT                   /locus_tag="HSM_0519"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.667 at
FT                   residue 22"
FT   gene            complement(597527..598132)
FT                   /locus_tag="HSM_0520"
FT   CDS_pept        complement(597527..598132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0520"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hso:HS_1481 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32170"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:B0URW5"
FT                   /protein_id="ACA32170.1"
FT                   /translation="MKKISIAATVLLSCMASGAMAQDTFTGFFMGGEVHHSKHGYEGTL
FT                   SQTAKSETQKKSGKIGFGLFGGYGFNFGDSNFVGQAEVKLRTGGSKITSNNELLSKEKF
FT                   SFSVGYLQGYRISNNFMPYLKVSLNSHFYDLNAKKICDSCTIKGNSVVGIGAAVGVKYA
FT                   VTDKFDVGVEYQKVFLRNIKGDIRFKPQSLSLSASYYF"
FT   sig_peptide     complement(598067..598132)
FT                   /locus_tag="HSM_0520"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            complement(598461..599030)
FT                   /locus_tag="HSM_0521"
FT   CDS_pept        complement(598461..599030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0521"
FT                   /product="GPR1/FUN34/yaaH family protein"
FT                   /note="PFAM: GPR1/FUN34/yaaH family protein; KEGG:
FT                   hso:HS_1480 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32171"
FT                   /db_xref="GOA:B0URW6"
FT                   /db_xref="InterPro:IPR000791"
FT                   /db_xref="UniProtKB/TrEMBL:B0URW6"
FT                   /protein_id="ACA32171.1"
FT                   /translation="MSTTKDNLANPAPLGLCGFALTTWLLSLINNGMFSGENLGLVLAM
FT                   GFAFGGTAQMIAGMFEYKKGNTFGFTAFTSYGAFWWSFALFKVFFSQGVTSSFVGWYLA
FT                   AWGTFTLMMFIGTLAKTRALQAIFLALTITFYLLAAGDFTGNHNFSQLGGNFGLLTALL
FT                   AFYLAAADIINESFGKTILPIGEPKL"
FT   gene            599470..600672
FT                   /locus_tag="HSM_0522"
FT   CDS_pept        599470..600672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0522"
FT                   /product="drug resistance transporter, Bcr/CflA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, Bcr/CflA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   hso:HS_1479 bicyclomycin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32172"
FT                   /db_xref="GOA:B0URW7"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B0URW7"
FT                   /protein_id="ACA32172.1"
FT                   /translation="MLNTQSKQNASFVFILTLGILSMLPPLGVDMYLPAFLNIAQDLKV
FT                   SPEQVQHTLTFFTYGLAAGQLFWGPVGDSYGRKPVILLGVIVATITAFILTGINNIQNF
FT                   TALRFIQGFFGAAPVVLSGALLRDLFSKNELSRMLSMITLVFMIAPLLAPIIGGNLMRF
FT                   FHWHAIFYVISAMGMLSAVLVFYVIPETHKKENRIPLRLNIIARNFFSLWKQKEVLGYM
FT                   FMSAFGFGGLFAFVTAGSIVYIGLYGIAVENFGYFFMLNIGVMIIASFMNGRLVFKVGA
FT                   ERMLQVGLMVQFIAGLWLAFVAFFDLGFWSMAIGVAFFVGQNPLISSNAMTSILEKFPT
FT                   MAGTSNSMVGSVRFGMGAIVGTIVALFEMKTAAPMLLTMTICSLLAVSCYYFLTYRHLK
FT                   K"
FT   sig_peptide     599470..599556
FT                   /locus_tag="HSM_0522"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.928) with cleavage site probability 0.920 at
FT                   residue 29"
FT   gene            600682..600912
FT                   /locus_tag="HSM_0523"
FT   CDS_pept        600682..600912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0523"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hso:HS_1478 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32173"
FT                   /db_xref="GOA:B0URW8"
FT                   /db_xref="InterPro:IPR018886"
FT                   /db_xref="UniProtKB/TrEMBL:B0URW8"
FT                   /protein_id="ACA32173.1"
FT                   /translation="MALQPCPECRRKISECAISCPHCGFSLQEENLMLYREKLKKHCQY
FT                   NQEINRASIKIHLFWLAVFSIVIGIVGWLSN"
FT   gene            complement(600962..602470)
FT                   /locus_tag="HSM_0524"
FT   CDS_pept        complement(600962..602470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0524"
FT                   /product="lysyl-tRNA synthetase"
FT                   /note="TIGRFAM: lysyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (D K and N); nucleic acid binding
FT                   OB-fold tRNA/helicase-type; KEGG: hso:HS_1477 lysyl-tRNA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32174"
FT                   /db_xref="GOA:B0URW9"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR034762"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0URW9"
FT                   /protein_id="ACA32174.1"
FT                   /translation="MTEIIQELDLNGEMLVRREKLAALRAKGNAFPNTFRRNALAQDLH
FT                   TQYDEIESESLKTQGIEVKVAGRIMTRRVMGKATFITLQDMSGKIQLYVARDNLAEGVY
FT                   TDDVGNWDLGDIVGVKGTLFKTKTNELTIRATEVHLLTKALRPLPNKFHGLSDQETRYR
FT                   QRYLDLIANEDSRRTFIIRSKVIAGIREYFISKGFMEVETPMLQIIPGGASARPFITHH
FT                   NALDVDMYLRIAPELYLKRLVVGGFERVFELNRNFRNEGVSIRHNPEFTMLEYYQAYAD
FT                   YHDLMDNTEELLRKLALDILGTTIVPYGDLKFDFGKPFERITMHEAILKYGAEQGIVKE
FT                   DLYDFDRAVAVAQKLGIEVQKSWGLGSLVNAIFEEVAEHHLIQPTFLMAHPAEISPLAR
FT                   RNDENPDVTDRFELFIGGREIGNGFSELNDAEDQNERFDAQVAAKEAGDDEAMFKDEDF
FT                   VTALEHGLPPTAGEGLGIDRLAMLFANANSIRDVILFPAMKTKS"
FT   gene            complement(602547..603416)
FT                   /locus_tag="HSM_0525"
FT   CDS_pept        complement(602547..603416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0525"
FT                   /product="peptide chain release factor 2"
FT                   /note="TIGRFAM: peptide chain release factor 2; PFAM: Class
FT                   I peptide chain release factor; PCRF domain protein; KEGG:
FT                   msu:MS1542 protein chain release factor B"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32175"
FT                   /db_xref="GOA:B0URX0"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:B0URX0"
FT                   /protein_id="ACA32175.1"
FT                   /translation="MEDVDGLLELSVEAEDETTFNEAVAEAEELEKKLATLEFRRMFSG
FT                   QHDNCDCYVDLQAGSGGTEAQDWTEMLLRMYLRWAESKGFKTELVEVSSGDVAGLKSAT
FT                   IRIAGEYAFGWLRTETGIHRLVRKSPFDSNNRRHTSFAAAFVYPEIDDDIEIEINPADL
FT                   RIDVYRASGAGGQHVNKTESAVRITHIPSGIVVQCQNGRSQHQNKDQAMKQLKAKLYEM
FT                   EMMKKNADKQAMEDSKSDIGWGSQIRSYVLDDSRIKDLRTGVENRNTQAVLDGDLDRFI
FT                   EASLKAGL"
FT   gene            603776..604471
FT                   /locus_tag="HSM_0526"
FT   CDS_pept        603776..604471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0526"
FT                   /product="thiol:disulfide interchange protein"
FT                   /note="KEGG: hso:HS_1475 thiol:disulfide interchange
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32176"
FT                   /db_xref="GOA:B0URX1"
FT                   /db_xref="InterPro:IPR009094"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR018950"
FT                   /db_xref="InterPro:IPR033954"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B0URX1"
FT                   /protein_id="ACA32176.1"
FT                   /translation="MKKFLMVSLAMLMSTFVKADNNVTIRKNLQKLGMTDVEIMESPIK
FT                   NIKSVLTREGTLYVSEDGKYVLHGALYEITDKGIVNLTTKSLLVKLNNLKNEMIVYPAK
FT                   KEKYVITVFMDITCHYCHLLHQKIKEYNELGITVRYLAFPRAGLNSNTAKQMEAIWISR
FT                   DPVFALDEAEKGNLPKELKIPNMIQKHYELGIQFGVSGTPSIITESGEVIGGYVEPKKL
FT                   LQVLEDIRE"
FT   sig_peptide     603776..603835
FT                   /locus_tag="HSM_0526"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT   gene            604464..606185
FT                   /locus_tag="HSM_0527"
FT   CDS_pept        604464..606185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0527"
FT                   /product="single-stranded-DNA-specific exonuclease RecJ"
FT                   /note="TIGRFAM: single-stranded-DNA-specific exonuclease
FT                   RecJ; PFAM: phosphoesterase RecJ domain protein;
FT                   phosphoesterase DHHA1; KEGG: hso:HS_1474 single-strand
FT                   DNA-specific exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32177"
FT                   /db_xref="GOA:B0URX2"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR004610"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="InterPro:IPR041122"
FT                   /db_xref="UniProtKB/TrEMBL:B0URX2"
FT                   /protein_id="ACA32177.1"
FT                   /translation="MNKFIKRRDVAIDVQVCEHPLLDRIYRARQIKNPQQLDRTLKSML
FT                   APDLLHGIGSAVDLLVTAREKQQKIVIVGDFDVDGATSTALIVLALRQLGFTDVDYLVP
FT                   NRFEQGYGLSVEVAKLALEKNVELLITVDNGVSSFDGVVFLKNAGVQVLITDHHLPPEI
FT                   LPPAHAIVNPNLTQCNFPSKFLAGVGVAFYVMLALRAKLRDLGIFTTQTQPNFTELLDL
FT                   VALGTISDVVPLDQNNRILAYQGLARIRAERCRPGIRALAEIANRNMSRLTASDLGFSI
FT                   GPRLNAAGRLDNMSVGVELLLTDDMQHARQLAFELDSLNQARKEIEQGMKQEALEICRN
FT                   LTALSKQLPLGIVLYQVDWHQGVLGILASRIKDKFHRPTIAFAQDQVGILKGSARSIEG
FT                   LHMRDVLERIHSRYPDMILKFGGHAMAAGLSIREELFTQFQQAFIQTVTEWLKEEQLQG
FT                   IIWTDGQLAPAFLNLETAELLRQAGPWGQGFPEPCFDGEFTILRQSIVGEKHLKMLVEP
FT                   KQGGPLLDAIAFNIDKDYYPDFSIKHARIAYKLDSNEFRGNRHVQLLVDYIEPLDH"
FT   gene            606234..606383
FT                   /locus_tag="HSM_0528"
FT   CDS_pept        606234..606383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0528"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hit:NTHI1387 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32178"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B0URX3"
FT                   /protein_id="ACA32178.1"
FT                   /translation="MTEEYGVFTYPYVIINGKYVLTASTLYNDDYSVAVLDFLIHQIQV
FT                   ESRK"
FT   gene            606380..607069
FT                   /locus_tag="HSM_0529"
FT   CDS_pept        606380..607069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0529"
FT                   /product="Adenosylhomocysteine nucleosidase"
FT                   /EC_number="3.2.2.9"
FT                   /note="PFAM: purine or other phosphorylase family 1; KEGG:
FT                   hso:HS_1473 MTA/SAH nucleosidase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32179"
FT                   /db_xref="GOA:B0URX4"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0URX4"
FT                   /protein_id="ACA32179.1"
FT                   /translation="MKVGIVGAMAQEVEILASLIENKNVVHIAGCTIYQGNIQDKEVAL
FT                   LQSGIGKVAAAMGTTLLLQMFKPDIVINTGSAGGVSSGLKVGDVVVSTQTVYHDADVTA
FT                   FGYAKGQLPACPPAFISDPKLTALVENVAEQQGINLTSGLICSGDSFINSAEKLAWIKA
FT                   NFPEVVAIEMEATAIAQVCHKFNIPFVVIRAISDVGDGEASISFEEFLPLAARQSSSMV
FT                   LKILQSL"
FT   gene            607181..607300
FT                   /locus_tag="HSM_0530"
FT   CDS_pept        607181..607300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0530"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hin:HI1720 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32181"
FT                   /db_xref="UniProtKB/TrEMBL:B0URX5"
FT                   /protein_id="ACA32181.1"
FT                   /translation="MTKYNQSFKQQVIKFYLQNGKNRSLTRQHFQLEKSTLRH"
FT   gene            607402..607560
FT                   /locus_tag="HSM_0531"
FT   CDS_pept        607402..607560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0531"
FT                   /product="transposase"
FT                   /note="KEGG: hin:HI1721 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32182"
FT                   /db_xref="UniProtKB/TrEMBL:B0URX6"
FT                   /protein_id="ACA32182.1"
FT                   /translation="MPLIDLKRSTFFYHLADKVDKNAEIKQKEAEIYHENNGNYGYRRI
FT                   TLILRKI"
FT   gene            607593..607736
FT                   /locus_tag="HSM_0532"
FT   CDS_pept        607593..607736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0532"
FT                   /product="transposase"
FT                   /note="KEGG: hin:HI1721 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32183"
FT                   /db_xref="GOA:B0URX7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="UniProtKB/TrEMBL:B0URX7"
FT                   /protein_id="ACA32183.1"
FT                   /translation="MLLRQAFDTLGELKQTIHEYIHYYNNERIQVKLKGPSPAEYRTQS
FT                   SS"
FT   gene            complement(607788..608000)
FT                   /locus_tag="HSM_0533"
FT   CDS_pept        complement(607788..608000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0533"
FT                   /product="ribosomal protein L31"
FT                   /note="PFAM: ribosomal protein L31; KEGG: hso:HS_1472 50S
FT                   ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32184"
FT                   /db_xref="GOA:B0URX8"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0URX8"
FT                   /protein_id="ACA32184.1"
FT                   /translation="MKQGIHPEYKEITATCSCGNVIKTRSTVGKNLNLDVCSNCHPFYT
FT                   GKQRVVDTGGRVERFNKRFSIPSSK"
FT   gene            complement(608194..609852)
FT                   /locus_tag="HSM_0534"
FT   CDS_pept        complement(608194..609852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0534"
FT                   /product="YidE/YbjL duplication"
FT                   /note="TIGRFAM: YidE/YbjL duplication; PFAM: TrkA-C domain
FT                   protein; YidE/YbjL duplication domain protein; KEGG:
FT                   hso:HS_1470 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32185"
FT                   /db_xref="GOA:B0URX9"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006512"
FT                   /db_xref="InterPro:IPR023018"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0URX9"
FT                   /protein_id="ACA32185.1"
FT                   /translation="MSDIAITICILALVAVIGLWIGHWKIRGVGLGIGGVLFGGIIVAH
FT                   FMNQNGLKLDAHTLHFIQEFGLILFVYTIGIQVGPGFFASLLSAGLKLNGLATLIVVLG
FT                   AVSVFVLYKVVNVDLDIILGIYSGAVTNTPSLGAGQQILTELGIENANSTMGMAYAMAY
FT                   PFGICGILLSMWLIRLFFKIKVEEEEKQFQKASGQDKESLTTVNVKVTNPNLSGLRLID
FT                   IPGFDNKDVVCSRLKRQENISVPSADTIIAIDDVLHLVGEINALKKMKLVIGEEIDMPM
FT                   THLAGDLRSERIVVTNEKVLGKRIKHLGIHKKYGVVISRLNRAGVELVPTANTALQFGD
FT                   VLHIVGRSDTIGNATSIIGNAQQKLQQVQMLPVFIGIGLGVLLGSIPFYIPGFPVALKL
FT                   GLAGGPLVVALILARIGSVGKLYWFMPPSANLALREIGIVLFLAVVGLKSGGGFVDTLV
FT                   NGQGLEWMGYGMFITFIPLMITGIIARLYMKLNYLSLCGLLAGSMTDPPALAFANAIKE
FT                   DSGIAALSYATVYPLSMFLRIMSPQLLAILLWTAM"
FT   gene            610050..611846
FT                   /pseudo
FT                   /locus_tag="HSM_0535"
FT                   /note="ABC transporter, ATP-binding/permease protein"
FT   gene            612131..614257
FT                   /locus_tag="HSM_0537"
FT   CDS_pept        612131..614257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0537"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /EC_number="1.17.4.2"
FT                   /note="TIGRFAM: anaerobic ribonucleoside-triphosphate
FT                   reductase; PFAM: formate C-acetyltransferase glycine
FT                   radical; ATP-cone domain protein; KEGG: hso:HS_1468
FT                   anaerobic ribonucleoside-triphosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32186"
FT                   /db_xref="GOA:B0URY0"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:B0URY0"
FT                   /protein_id="ACA32186.1"
FT                   /translation="MGSFFVIKRDGSRAEFEIQRIINAIKKAASAVNIQDEMFCHKIGQ
FT                   LVCDNIFAHYQKEIDISHIQEIVENHLMASKYPQVARAYIEYRHERDLAREKRSNLTKE
FT                   IEGLIGQSNVELLNENANKDSKVIPTQRDLLAGIVAKHYAKRYILPKDVVDSHEKGEIH
FT                   YHDLDYAPFFPMFNCMLVDLKGMLTKGFKMGNADIEPPKSIGTATAVTAQIIAQVASHI
FT                   YGGTTVNRIDEVLAPYVQLSYEKHLKTAALWQIPDPKAYADSLIQKECFDAFQSLEYEV
FT                   NTLHTANGQTPFVTFGFGLGISWQERLIQKAILQNRIRGLGKNHKTPVFPKLVFTIKKG
FT                   VNQNSGDPNYDIKQLALECASKRMYPDILNYDQVVKVTGSFKAPMGCRSFLGAYEENNE
FT                   LVHDGRNNLGVVSLNLPRIALEAKGDEQQFYTLLEARLDLAKKALMTRIARLENTKARV
FT                   APILYMEGACGVRLKADDNVAQIFKNGRASISLGYIGIHETINALFGGKHIYDDTKLRK
FT                   KGIEIVSFLSEKVKHWKAETGYAFSLYSTPSENLCDRFCRLDTKQFGVVDGVTDKGYYT
FT                   NSYHLDVEKKVNPYDKLDFEMPYPRLASGGFICYGEYPNIQHNLKALEDVWDYSYERVP
FT                   YYGTNTPIDECYECGFTGEFSCTSKGFTCPKCGNHDSEKVSVTRRVCGYLGSPDARPFN
FT                   AGKQEEVKRRVKHL"
FT   gene            614273..614740
FT                   /locus_tag="HSM_0538"
FT   CDS_pept        614273..614740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0538"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein"
FT                   /note="TIGRFAM: anaerobic ribonucleoside-triphosphate
FT                   reductase activating protein; KEGG: hso:HS_1467 anaerobic
FT                   ribonucleoside-triphosphate reductase activating protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32187"
FT                   /db_xref="GOA:B0URY1"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012837"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:B0URY1"
FT                   /protein_id="ACA32187.1"
FT                   /translation="MNYLQYYPIDVVNGEGTRCTLFVSGCSHACKGCYNQKSWSFRAGV
FT                   LFDREMEDQIIRDLQDRRIRRQGLSLTGGDPLHPQNITALLPFVQRVKKECPDKDIWLW
FT                   TGYLLAELDELQRKMLPYIDVLIDGKFEQEKADPSLIWRGSANQVIYRFKL"
FT   gene            complement(615013..616740)
FT                   /locus_tag="HSM_0539"
FT   CDS_pept        complement(615013..616740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0539"
FT                   /product="RNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.49"
FT                   /note="PFAM: RNA-directed DNA polymerase (Reverse
FT                   transcriptase); Group II intron maturase-specific domain
FT                   protein; SMART: HNH nuclease; KEGG: pau:PA14_07480 putative
FT                   reverse transcriptase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32188"
FT                   /db_xref="GOA:B0URY2"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR025960"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:B0URY2"
FT                   /protein_id="ACA32188.1"
FT                   /translation="MKEQTHHTKKLVSSLAPATSHISQWHYINWYKANRYVKGMQVRIA
FT                   KATQESNWRKVKNLQRMLTHSFYAKALAVRRVTENTGKRTAGIDKRIWDTPESKWIAIQ
FT                   DLSSKGYQPKPLRRVFIPKSNGKKRPLGIPTMKDRAMQMLYLLALQPIAETTADNNSYG
FT                   FRLNRSTADAISHIHSIFSTKGNQSRQMAEWVLDADIHGCFDFINHDWLLKHIPMNKRI
FT                   LKKWLKSGVVEFGQLKPTTEGTPQGDIISPTLANMALDGLEKELIKHFGAKNSLKIAKH
FT                   RTYLVRYADDFIISGISKELLEEQVIPMVKNFLAERGLSLSESKTKVVHIEHGFDFLGW
FT                   TVKRFDKKLIIKPSKKNAKAFYDKVKQSISKMKMAKQDDLIKVLNPMIRGWTNYHKHVV
FT                   AKVIFNRMDSLIWKALWRWCRRRHPNKGKIWIKEKYFYSNATRNWIFGTVTNSNKEEQI
FT                   PINLLYCGYVKIKRHRKIKSQYKPFLPEWEMYGENLAQARMYDEQSHRQQWQALYKEQK
FT                   GKCALCNTSITKESGWHDHHIIYKMYGGTDSLNNRCLVHPECHQQIHRLNLNVAKPTA"
FT   gene            complement(618335..619339)
FT                   /locus_tag="HSM_0540"
FT   CDS_pept        complement(618335..619339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0540"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase, type I"
FT                   /note="TIGRFAM: glyceraldehyde-3-phosphate dehydrogenase,
FT                   type I; PFAM: glyceraldehyde 3-phosphate dehydrogenase;
FT                   KEGG: hso:HS_1466 glyceraldehyde 3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32190"
FT                   /db_xref="GOA:B0URY3"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR006436"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0URY3"
FT                   /protein_id="ACA32190.1"
FT                   /translation="MTIKIGINGFGRIGRIVFRAAQTRDDIEVVGINDLIDVEYMAYML
FT                   KYDSTHGRFDGTVEVKDGNLVVNGKAIRVTSERDPANLKWNELGVDVAVEATGLFLDDA
FT                   TARKHITAGAKKVVLTGPSKDATPMFVNGVNFDAYAGQDIVSNASCTTNCLAPLAKVIN
FT                   DKFGIKDGLMTTVHATTATQKTVDGPSAKDWRGGRGAAQNIIPSSTGAAKAVGKVIPAL
FT                   NGKLTGMAFRVPTPNVSVVDLTVNLEKPATYAEICAEIKRASENEMKGVLGYTEDAVVS
FT                   TDFNGCSLTSVFDAAAGIALTDTFVKLVSWYDNETGYSNKVLDLVAHVHNYKG"
FT   gene            complement(619572..619721)
FT                   /locus_tag="HSM_0541"
FT   CDS_pept        complement(619572..619721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0541"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hso:HS_1465 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32191"
FT                   /db_xref="GOA:B0URY4"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:B0URY4"
FT                   /protein_id="ACA32191.1"
FT                   /translation="MVGWLVGWLVGWLVGWLVGWLVGWLVGWLVGWLVNMIFFLFPYEK
FT                   SFSA"
FT   gene            619796..620599
FT                   /locus_tag="HSM_0542"
FT   CDS_pept        619796..620599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0542"
FT                   /product="Choline/ethanolamine kinase"
FT                   /note="PFAM: Choline/ethanolamine kinase; KEGG: hso:HS_1461
FT                   LicA protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32192"
FT                   /db_xref="GOA:B0URY5"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B0URY5"
FT                   /protein_id="ACA32192.1"
FT                   /translation="MTNKNYLLYVDNEKYVLRLPGVMTSNLISRHYEMNNSILMSQAEF
FT                   NVETIYFNADNGIKITKFLEKGINFNHNNIHQYEYLFLISKELYKLHHSDIQFNNEFNV
FT                   FETFQQYFDLLKDKNGFFCFNKNIPLIYEFFIKISKNNSFYNIKCPCHNDLVPENILMK
FT                   NNKLFFIDWEYSGMNAPLFDVAAFFLESRIPEEKQKYFLVHYDHHLDFEKSRMEILFHQ
FT                   FTQDVLWFLWTLIKEENNEKFENYASTRINRAYELMKELVKNGFI"
FT   gene            620586..621518
FT                   /locus_tag="HSM_0543"
FT   CDS_pept        620586..621518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0543"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: hso:HS_1460 possible lic-1 operon
FT                   protein (LicB)"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32193"
FT                   /db_xref="GOA:B0URY6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B0URY6"
FT                   /protein_id="ACA32193.1"
FT                   /translation="MGLFSEDKRLVHVGYFCGLLSGLFWAISGISYEKLYLDFPMLNAF
FT                   ALNIIILSIAEITLLLMAYGYLIKRKLLPHFNKVSLLAILGGCLGGPVGMICYLQSLQY
FT                   VGVSYAATISICYPIIASILSIKFLAVKASRRTLFSFVFIVLLLMPVMYQGENSEIRIL
FT                   GIIFAFSCALCWALEIVISSYVMQHYLSDQVYLFRQIGSSLGYFLIILFMFFYGTYDNL
FT                   IDFNFFKDVNLWKLEWIVIISSGFSYFLYYKSIAILNPIRAMALNITYSLWAIVLSAVL
FT                   LSKEISIFLLMIGIIVLMNIFIVAKGEEK"
FT   gene            621515..622213
FT                   /locus_tag="HSM_0544"
FT   CDS_pept        621515..622213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0544"
FT                   /product="LicC protein"
FT                   /note="KEGG: hso:HS_1459 LicC protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32194"
FT                   /db_xref="InterPro:IPR017189"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B0URY7"
FT                   /protein_id="ACA32194.1"
FT                   /translation="MNAIILAAGLGSRFREITQKKHKALLPLPNGIPNIEQTIIYLKQA
FT                   GIHEIHIVTGYFSEQFDFLSGKYGVNLIYNKFYKKYNNIYSFHCAIEHFGESFVIDSDV
FT                   TLFSNIFNDKLKRSQYFLIQRNKSHNKEWIPIVKDNRVIDIIIDSLELPSLLGVSFWSN
FT                   NDAVKIKSFLADYVNNENLLLDSSLYWDNIPMENLKELDIGVKLLNIKEAYEIDNLSEY
FT                   EFIFHHLKGK"
FT   gene            622215..623015
FT                   /locus_tag="HSM_0545"
FT   CDS_pept        622215..623015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0545"
FT                   /product="LicD family protein"
FT                   /note="PFAM: LicD family protein; KEGG: hso:HS_1458
FT                   lipopolysaccharide choline phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32195"
FT                   /db_xref="InterPro:IPR007074"
FT                   /db_xref="UniProtKB/TrEMBL:B0URY8"
FT                   /protein_id="ACA32195.1"
FT                   /translation="MKKLSLRELQLASLDILKYFDQLCAKNDIQYSLGGGTLIGAVRHK
FT                   GFIPWDDDIDVYMHRDHYQKFVNIWKSETHDKYELSLAEDIHGMFPGEMTKIFDKNTLI
FT                   IDTKGRKSGIFIDIFIYDSVPNAPAVIYKVMKKHRRLKLRFSSCRKRWYKANNESLIQS
FT                   IFFRLSQYLFNKMMLNLKQFQDKYPIDEAEYIGLVLSDYGGWKKSYMPKKYFNSVVYLD
FT                   FEESKFPVMNGYHEHLTMYYGDYMELPPVSEQKPQHTIEAYILD"
FT   gene            623124..623750
FT                   /locus_tag="HSM_0546"
FT   CDS_pept        623124..623750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0546"
FT                   /product="Guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /note="PFAM: guanylate kinase; SMART: guanylate
FT                   kinase/L-type calcium channel region; KEGG: hso:HS_1457
FT                   guanylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32196"
FT                   /db_xref="GOA:B0URY9"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0URY9"
FT                   /protein_id="ACA32196.1"
FT                   /translation="MCRGNLYIISAPSGAGKSSLISALLERDKNDSMTVSISHTTRSPR
FT                   PGEIDGVHYHFVSHEKFEQLILENSFLEYAKVFGGNYYGTSLLNIEKNLAAGIDVFLDI
FT                   DWQGARQIREKRPDVKSIFILPPSISALEKRLIGRGQDSQDIIAKRMEKAADEISHYDE
FT                   YDYVIINADFDQALVDLEHILRAERLTVNYQKTQNAALIHQLLVK"
FT   gene            623805..624077
FT                   /locus_tag="HSM_0547"
FT   CDS_pept        623805..624077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0547"
FT                   /product="DNA-directed RNA polymerase, omega subunit"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, omega subunit;
FT                   PFAM: RNA polymerase Rpb6; KEGG: hso:HS_1456 DNA-directed
FT                   RNA polymerase, omega chain"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32197"
FT                   /db_xref="GOA:B0URZ0"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0URZ0"
FT                   /protein_id="ACA32197.1"
FT                   /translation="MARVTVQDAVEKVGNRFDLILTAARRARELQLHKREPLVPEDNDK
FT                   PTVIALREIEKGLINNDIMNAHERREALEQETAELNTISLLYQNN"
FT   gene            624158..626281
FT                   /locus_tag="HSM_0548"
FT   CDS_pept        624158..626281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0548"
FT                   /product="(p)ppGpp synthetase I, SpoT/RelA"
FT                   /EC_number="2.7.6.5"
FT                   /note="KEGG: hso:HS_1455 guanosine-3'5'-bis(diphosphate)
FT                   3'-pyrophosphohydrolase; TIGRFAM: RelA/SpoT family protein;
FT                   PFAM: TGS domain protein; metal-dependent phosphohydrolase
FT                   HD sub domain; RelA/SpoT domain protein; SMART:
FT                   metal-dependent phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32198"
FT                   /db_xref="GOA:B0URZ1"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:B0URZ1"
FT                   /protein_id="ACA32198.1"
FT                   /translation="MYLFESLEKIIRGYLSPSQIELVRHAFVIARDAHEGQARASGEPY
FT                   ITHPVAVASIIAEMHLDHEAVVAALLHDVIEETPYTEEQLKEEFGASVAEIVEGVSKLD
FT                   KLKFRTRKEAEVENFRKMILAMTKDIRVVLIKLADRTHNMRTLGALRPEKRRRIAKETL
FT                   EIYAPLAHRLGIEHIKNELEDLGFEAMYPQRYAVLRKVIQIARGNRKDMIECIASDIKG
FT                   RLTEVGITARVFGREKHLYAIYQKMRLKDQQFHSIMDIYAFRTVVKDVDTCYRVLGQMH
FT                   SLYKPRPGRVKDYIAVPKANGYQSLHTSMIGPHGVPVEVQIRTEEMDRMAEMGVAAHWA
FT                   YKQSGRNDSTTAQIRAQRWLRSLVELQQSVGNSFEFIESVKSEFFPKEIYVFTPKGRIV
FT                   ELPKGATAVDFAYAVHTDVGHHCVAATVDRKPYPLSFALQSGQTIDISIDENSKPNSGW
FT                   LNFVVTAKARTSIRQALKSLGADDAVNLGKRQLLQALLPKKLSDIPPHIVQEVLDDLKL
FT                   TSFNDLLMEIGLGNQISGAIAYRLVGEPLKIDTDGNPKNNTELLQIKSSEGLSTTFGQC
FT                   CHPIPGDPIVAYTSSGKGLVIHHKDCANLKKRKENTEHYMQVQWEDEDTSIEFETELRI
FT                   ELLNQQGALPHLMSMISSLDSRIHSIWTEEQDGRLYQIVILLTVKNTEHLEQIMRKIKS
FT                   VPGFLSVKRNINN"
FT   gene            626281..628362
FT                   /locus_tag="HSM_0549"
FT   CDS_pept        626281..628362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0549"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /note="TIGRFAM: ATP-dependent DNA helicase RecG; PFAM:
FT                   helicase domain protein; nucleic acid binding OB-fold
FT                   tRNA/helicase-type; DEAD/DEAH box helicase domain protein;
FT                   SMART: DEAD-like helicases; KEGG: hso:HS_1454 ATP-dependent
FT                   DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32199"
FT                   /db_xref="GOA:B0URZ2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:B0URZ2"
FT                   /protein_id="ACA32199.1"
FT                   /translation="MGGQFLDAIPLTSLSGVGAAIAEKLGRIGLFSLQDLLFHLPIRYE
FT                   DRTRITPIIDLRIDQHATIEGIVQTCDIQFGRRPVLVVTLSDGTAKIALRFFNFNAGMK
FT                   NGFQLGARVKAFGEIKRGRFMAEIHHPEYEIIRDNRPLQLAETLTPIYATTEGLKQNTL
FT                   RKLTEQALALLEKMPLAELLPRAFNPHDFSLKQAIYVLHRPPPDISLELLEQGKHPAQL
FT                   RLIFEELLAHNLAMQKVRCGSQHFSALPLRYQTALKQNFLDLLPYQPTNAQQRVVAEIE
FT                   YDLGRSFPMMRLVQGDVGSGKTLVVALAALTAIDNGKQVALMVPTEILAEQHTANFQRW
FT                   FEPLGIRVGCLTGKVKGKFRQATLEEISQGNIQMVVGTHALFQDDVKFAELVLVVIDEQ
FT                   HRFGVHQRLMLREKGKYAGIYPHQLIMTATPIPRTLAMVAYADLDTSIIDELPPGRTPI
FT                   QTIAVSEERRTEIVARVYNACVNEKRQAYWVCTLIDESEVLEAQAAESIAEDLQKALPV
FT                   LRIGLIHGRMKVSEKQEVMRQFKNAELNLLVATTVIEVGVDVPNASLMIIENAERLGLA
FT                   QLHQLRGRVGRGSTASYCVLMYKSPLSKVSRKRLEVMRSSQDGFFISEQDLEIRGPGEV
FT                   LGTKQTGVAEFKVADLIRDRKMLPTVQHYARLLITRSPKLADDLIQRWLKNKEIYTNA"
FT   gene            628432..629235
FT                   /locus_tag="HSM_0550"
FT   CDS_pept        628432..629235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0550"
FT                   /product="glutamate racemase"
FT                   /EC_number="5.1.1.3"
FT                   /note="TIGRFAM: glutamate racemase; PFAM: Asp/Glu racemase;
FT                   KEGG: hso:HS_1453 glutamate racemase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32201"
FT                   /db_xref="GOA:B0URZ3"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0URZ3"
FT                   /protein_id="ACA32201.1"
FT                   /translation="MRFSIQPTILFFDSGVGGLSVYKETKQLLPDCHYLYGFDNGFFPY
FT                   SEKDEKDIIDRTLRICQKINQTYPLDLIVIACNTASTVVLPELRRNFSIPIVGTVPAIK
FT                   PAAEMSETKHIGLIATKGTIKRTYVNDLIKNYAYHCMVEKIGSTKLVEIAEQKLRGGEV
FT                   DLNVLKQELSPWKTMKSLDSVVLGCTHFPLIKEEIECCLPQVKFFVSSGKAIAKRVKFL
FT                   LKGIEVRSKIQKKNLIFCTKPLEDDKSVQQILDFGEFENLVILSD"
FT   gene            629614..631146
FT                   /locus_tag="HSM_R0019"
FT   rRNA            629614..631146
FT                   /locus_tag="HSM_R0019"
FT                   /product="16S ribosomal RNA"
FT   gene            631207..631283
FT                   /locus_tag="HSM_R0020"
FT                   /note="tRNA-Ile2"
FT   tRNA            631207..631283
FT                   /locus_tag="HSM_R0020"
FT                   /product="tRNA-Ile"
FT   gene            631378..631453
FT                   /locus_tag="HSM_R0021"
FT                   /note="tRNA-Ala2"
FT   tRNA            631378..631453
FT                   /locus_tag="HSM_R0021"
FT                   /product="tRNA-Ala"
FT   gene            631714..634701
FT                   /locus_tag="HSM_R0022"
FT   rRNA            631714..634701
FT                   /locus_tag="HSM_R0022"
FT                   /product="23S ribosomal RNA"
FT   gene            634831..634945
FT                   /locus_tag="HSM_R0023"
FT   rRNA            634831..634945
FT                   /locus_tag="HSM_R0023"
FT                   /product="5S ribosomal RNA"
FT   gene            635002..635116
FT                   /locus_tag="HSM_R0024"
FT   rRNA            635002..635116
FT                   /locus_tag="HSM_R0024"
FT                   /product="5S ribosomal RNA"
FT   gene            635128..635204
FT                   /locus_tag="HSM_R0025"
FT                   /note="tRNA-Asp1"
FT   tRNA            635128..635204
FT                   /locus_tag="HSM_R0025"
FT                   /product="tRNA-Asp"
FT   gene            635219..635294
FT                   /locus_tag="HSM_R0026"
FT                   /note="tRNA-Trp1"
FT   tRNA            635219..635294
FT                   /locus_tag="HSM_R0026"
FT                   /product="tRNA-Trp"
FT   gene            635838..636359
FT                   /locus_tag="HSM_0551"
FT   CDS_pept        635838..636359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0551"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: hso:HS_1567 permease, possible
FT                   drug/metabolite transporter superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32202"
FT                   /db_xref="GOA:B0URZ4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B0URZ4"
FT                   /protein_id="ACA32202.1"
FT                   /translation="MSEPLKVSAIAGTCFAVSGVFIISWSGSSQWLSILYAILAGSGYG
FT                   LFSVLIKKFNLNGGIPLTRLLMMFGALYLFYPFVTHFQHIEIQWNTTVILNLVALALLP
FT                   TLIGFYCTTKALVYLSASKVQVTELSEPIFTMVLAWLLLNEVPNQTFFLGAFCIVLGIA
FT                   LINQMLHFKK"
FT   gene            636597..637931
FT                   /locus_tag="HSM_0552"
FT   CDS_pept        636597..637931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0552"
FT                   /product="anaerobic c4-dicarboxylate antiporter, Dcu
FT                   family"
FT                   /note="TIGRFAM: anaerobic c4-dicarboxylate antiporter, Dcu
FT                   family; PFAM: anaerobic c4-dicarboxylate membrane
FT                   transporter; KEGG: hso:HS_1566 possible anaerobic
FT                   C4-dicarboxylate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32203"
FT                   /db_xref="GOA:B0URZ5"
FT                   /db_xref="InterPro:IPR004668"
FT                   /db_xref="UniProtKB/TrEMBL:B0URZ5"
FT                   /protein_id="ACA32203.1"
FT                   /translation="MLYLEFLFLLLMLYVGSRYGGIGLGVVSGIGLAIEVFIFRMPVGK
FT                   APIDVMLIILAVVTCASVLEAAGGLKFMLQMAERVLRSNPKRVTILGPLVTYFMTFMLG
FT                   TGHSVYSIMPIIGDVALKNNIRPERPMAAASVASQLAITSSPLSAAVVFYLGKITALPG
FT                   FEHITLLDIICVTVPATLAGTIALSLYSLRRGKELEYDKEYQRRLQDPIWRERILNTTS
FT                   TTLNEVLPPAAKQSVYLFLLSLVVIVMIAMFPEIRTIGSASKPISMSLIIQMMMLCFGG
FT                   ITLLVTKTNPQVVPNGVVFKSGMVAAIAIFGIAWMSDTYFQYAMPQFKAGIVDMVKAYP
FT                   WTFALALFAVSVVINSQAATAVMMLPVGIELGLSPALLVGLMAATYAYFFIPNYPSDIA
FT                   TVNFDVTGTTKIGKYYFNHSFMAPGLIGVFTACVVGYLIAQVVIR"
FT   gene            638435..642463
FT                   /locus_tag="HSM_0553"
FT   CDS_pept        638435..642463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0553"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, beta subunit;
FT                   PFAM: RNA polymerase Rpb2 domain 6; RNA polymerase Rpb2
FT                   domain 7; RNA polymerase Rpb2 domain 2; RNA polymerase beta
FT                   subunit; RNA polymerase Rpb2 domain 3; KEGG: hso:HS_1565
FT                   DNA-directed RNA polymerase, beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32204"
FT                   /db_xref="GOA:B0URZ6"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0URZ6"
FT                   /protein_id="ACA32204.1"
FT                   /translation="MVYSYTEKKRIRKSFGKRPQVLNVPYLLTIQLDSFDKFIQRDPDG
FT                   QQGLEAAFRSIFPIVSNNGNTELQYVSYQLGEPVFDVRECQIRGTTYAASLRVKLRLVS
FT                   YDKDAASGTIKDIKEQEVYMGEIPLMTSNGTFVINGTERVVVSQLHRSPGVFFDSDKGK
FT                   THSSGKVLYNARIIPYRGSWLDFEFDPKDNLYARIDRRRKLPATIILRALNYTTEEILD
FT                   LFFDKVSFEIKDNKLLMTLVPERLRGETASFDIEANGKVYIERGRRITARHIKALEKDK
FT                   ITQVEVPTEYIVGKVSAKDYVDLTTGEIICPANMEISLELLEKLSQAGYKNIETLFTND
FT                   LDFGPYISETLRVDPSYDRLSALVEIYRMMRPGEPPTKEAAEGLFDNLFFSSERYDLSA
FT                   VGRMKFNRSLGIEDTTGSGTLSKEDIVNVMRKLIDIRNGRGEVDDIDHLGNRRIRSVGE
FT                   MAENQFRIGLVRVERAVKERLSLGDLESVTPQDLINAKPISAAVKEFFGSSQLSQFMDQ
FT                   NNPLSEVTHKRRISALGPGGLTRERAGFEVRDVHATHYGRVCPIETPEGPNIGLINSLS
FT                   VYARTNDYGFLETPYRKVVNGQVTEEIEYLSAIEEGKYVIAQANSNLDNELRFTDAFVT
FT                   CRGEHGESGLYRPEEIHYMDVSTQQVVSVAAALIPFLEHDDANRALMGANMQRQAVPTL
FT                   RADKPLVGTGMEKPVALDSGVAVVAKRGGTIQYVDASRIVVKVNEDETIAGEAGIDIYN
FT                   LIKYTRSNQNTCINQIPCVQLGEPIERGEILADGPSTDLGELALGQNMRVAFMPWNGYN
FT                   FEDSMLVSERVVQEDRFTTIHIQELSCVARDTKLGSEEITADIPNVGEAALSKLDESGI
FT                   VYIGAEVKGGDILVGKVTPKGETQLTPEEKLLRAIFGEKASDVKDSSLRVPNGTSGTVI
FT                   DVQVFTRDGVEKDKRALEIEEMQLKQAKKDLVEELEILEAGLFARVRNLLLSGGFNDKQ
FT                   LENLDRTQWLEQTLVDEDKQNQLEQLAEQYEELRKDFEHKLEIKRSKIIQGDDLAPGVL
FT                   KVVKVYLAVKRQIQPGDKMAGRHGNKGVISKINPVEDMPYDENGQPVDIVLNPLGVPSR
FT                   MNIGQILETHLGLAAKGIGDQINAMIKQKQDVEKLRGYIQKAYDLGDGSQKVDLSTFTD
FT                   EEVLRLAKNLRKGMPLATPVFDGAHEKEIKALLELGGLPTSGQIILFDGRTGEKFERPV
FT                   TVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAA
FT                   YTLQEMLTVKSDDVNGRTKMYKNIVGGTHQMDPGTPESFNVIMKEIRSLGINIDLDEE"
FT   gene            642554..646816
FT                   /locus_tag="HSM_0554"
FT   CDS_pept        642554..646816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0554"
FT                   /product="DNA-directed RNA polymerase, beta' subunit"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, beta' subunit;
FT                   PFAM: RNA polymerase alpha subunit; RNA polymerase Rpb1
FT                   domain 3; RNA polymerase Rpb1 domain 1; RNA polymerase Rpb1
FT                   domain 5; RNA polymerase Rpb1 domain 4; SMART: RNA
FT                   polymerase I subunit A domain protein; KEGG: hso:HS_1564
FT                   DNA-directed RNA polymerase beta' subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32205"
FT                   /db_xref="GOA:B0URZ7"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0URZ7"
FT                   /protein_id="ACA32205.1"
FT                   /translation="MKDLVKFLKAQSKTSEDFDVIKIGLASPDMIRSWSYGEVKKPETI
FT                   NYRTFKPERDGLFCARIFGPVKDYECLCGKYKRLKHRGVICEKCGVEVTQAKVRRERMG
FT                   HIELASPVAHIWFLKSLPSRIGLLLDMPLRDIERVLYFESYIVIEPGMTDLERGQLLTE
FT                   EQFLDAEDRWQDEFDAKMGAEAIQALLRDMDLEVECETLREELQSTNSETKRKKITKRL
FT                   KLLESFIQSGNKPEWMVMTVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLK
FT                   RLLDLIAPDIIVRNEKRMLQESVDALLDNGRRGRAITGSNRRPLKSLADMIKGKQGRFR
FT                   QNLLGKRVDYSGRSVITVGPYLHLHQCGLPKKMALELFRPFIYAKLESRGFATTIKAAK
FT                   KMVEREDAIVWDILADVIREHPILLNRAPTLHRLGIQAFEPILIEGKAIQLHPLVCAAF
FT                   NADFDGDQMAVHVPLTLEAQLEARALMMSTNNILSPANGEPIIVPSQDVVLGLYYMTRD
FT                   KVNGKGEGMLLQDSREAEKAYRTGQAELHSRVKVRITEYVKNAIGEFEPQTHLVDTTIG
FT                   RAILWMIAPKGMPFSLFNQTLGKKAISKLINESYRRLGLKESVLFADHIMYTGFAYAAR
FT                   SGSSVGIDDMVIPQKKYEIISAAEEEVAEIQEQFQSGLVTAGERYNKVIDIWAAANERV
FT                   AKAMMENLSQEEVINREGQPEKQASFNSIFMMADSGARGSAAQIRQLAGMRGLMARPDG
FT                   SIIETPITANFREGLNVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVAQDLVIIE
FT                   DDCGTHEGIVMTPLIEGGDVKEALRDRVLGRVAAEDILKPGTNEVLISRNTLLDEKLCD
FT                   VIDENSVDSIKVRSVVTCDTDFGVCAKCYGRDLARGHLINQGEAVGVIAAQSIGEPGTQ
FT                   LTMRTFHIGGAASAAAKESSVQVKNTGTLRLTNVKFVTNKEGKLVLTSRNTELTIIDTF
FT                   GRTKEHYKVPYGAVLNHADGEEVTAGETVANWDPHTMPVISEVSGFVKFVEIVDGLTVT
FT                   RQTDELTGLSSIVVQDVGERATAGKDLRPALKLVDAQGNDIFIPGTDVMAQYFLPGKAI
FT                   VSLDDGAEVFVGEPLARIPQESVGTKDITGGLPRVADLFEARKPKEPAILAEISGIVSF
FT                   GKETKGKRRLLITPMEGETYEEMIPKWRQLNVFEGELVQRGDLISDGAETPHDILRLRG
FT                   VHAVTDYIVNEVQEVYRLQGVKINDKHIEVIVRQMLRKAIITNAYDSEFLEGEQVEVAR
FT                   VKIVNRKRAEEGKPLVEFERELLGITKASLATESFISAASFQETTRVLTEAAVAGKRDE
FT                   LRGLKENVIVGRLIPAGTGFAYHQNRQKNRLVGGMENTTEVKLSAVDEEEIASEFTFSA
FT                   EDATANLAEMLNMADDAE"
FT   gene            647153..648004
FT                   /locus_tag="HSM_0555"
FT   CDS_pept        647153..648004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0555"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="PFAM: helix-turn-helix protein RpiR; sugar isomerase
FT                   (SIS); KEGG: ecv:APECO1_2361 putative transcriptional
FT                   regulator RpiR"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32206"
FT                   /db_xref="GOA:B0URZ8"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B0URZ8"
FT                   /protein_id="ACA32206.1"
FT                   /translation="MEKSLSLIPNIRMKREGMTNTEKRVVDWLLDATKFNKSTALNAIA
FT                   NDLDVSEALIVKVAKLLGFSGFRDLRKQITTSFEENQLDTFELSSQDTPQDLVDKVFNV
FT                   SLQTISEGKAILNSKVISEAAKCFFNAQNRDLYAAGGSNTICDDIEHKFLRIGIRCNTY
FT                   RDIHLMMMSASLLTENDVILVVSHSGKTTDLLKVVYEAKQNGAKIICITHSDISPIAVI
FT                   SDFVICTPAPDTPLLGKNASARILQLILVDAFFVSVAQQNIHLSEMNLEKTFTATKYFR
FT                   KK"
FT   gene            648199..649134
FT                   /locus_tag="HSM_0556"
FT   CDS_pept        648199..649134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0556"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: ecj:JW4049 D-allose
FT                   transporter subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32207"
FT                   /db_xref="GOA:B0URZ9"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B0URZ9"
FT                   /protein_id="ACA32207.1"
FT                   /translation="MKRFKTLKSCLAILGLVCSVSVYSAEYAVILKTLSNPFWVAMKEG
FT                   IENEAKALGVDVDIFASPSEGDYQSQLQLFEDLINKNYKGIAFAPLSPANLVMPAAKAY
FT                   RKGIYLVNLDEKIDIKNLQKAKGNVEAFITTDNVAVGGKAAQFIVDKLGSEGGEVAIIE
FT                   GKAGNASGEARRRGAREVFVKSSSIKLVASQPADWDRIKALDVATNVLSRNPNLKAFYV
FT                   ANDTMAMGVAQAVINAGKQGKILVVGTDGVPEARKMVSERKLTATIAQDPAMIGAKGLK
FT                   LLVDAARAGKQIPVDVEPKIETVDSILISQ"
FT   sig_peptide     648199..648273
FT                   /locus_tag="HSM_0556"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 25"
FT   gene            649182..650717
FT                   /locus_tag="HSM_0557"
FT   CDS_pept        649182..650717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0557"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ecc:c5093 D-allose transport ATP-binding protein
FT                   alsA"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32208"
FT                   /db_xref="GOA:B0US00"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0US00"
FT                   /protein_id="ACA32208.1"
FT                   /translation="MAIPLIQMKNISKSFGVVQALKNVNLDIYTNEIHALLGENGAGKS
FT                   TLMKVLSGLHMPSSGSIIIKDKEYDHLDHKIATELGIGIIYQELSLIDELSVLENLYIG
FT                   RLPTKKFWGIPIVDWSKMRSQASIILLRLGIKVDLDEKVGNLSISYKQMIEIAKVLISD
FT                   VKIIIMDEPTSSLTNSEIDYLFFIMNQLRNDGKAIIYISHKMNEIRQICDRYTILKDGS
FT                   SVASGMIKEISNQEIIRLMVGRDIESRFISRQHTVSNEVIFEVKNLIGKKFKQVNNVSF
FT                   SLKKGEILGFAGLVGAGRTELMNCIFGIDKRISGEIYLNGKKITPSSPLEAVKKGMAYI
FT                   TESRRENGFFSNFSIKQNIAVSKSLKDGGYKGAVGIFSPSKEAKLAQQQQDLLSIKCAS
FT                   IEQNITELSGGNQQKVIIGKWIVCDPEVLIFDEPTRGIDIGAKTEIYKIMRKLAEQGKA
FT                   ILMVSSELPEIMSVCDRIVVFREGAISSILENTKALTEETIMRWALPETKEVN"
FT   gene            650717..651667
FT                   /locus_tag="HSM_0558"
FT   CDS_pept        650717..651667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0558"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: inner-membrane translocator; KEGG: ecc:c5092
FT                   D-allose transport system permease protein alsC"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32209"
FT                   /db_xref="GOA:B0US01"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B0US01"
FT                   /protein_id="ACA32209.1"
FT                   /translation="MMNTGKFNFSQFWDKYGTFFILAVIVLIFGSISSQYFLKASNIQQ
FT                   IFVQSSVTALIGMGEFFAILIAGIDLSVGAILALSGMVTAQLMIIGIDPLVASIIGGIL
FT                   VGGGLGAINGALVNYTGLHPFIITLGTNAIFRGITLVISDANSIYGFSFEFVDFFAQDI
FT                   FFIPVPVIFVVVIAILLWFVTTKTRLGRNIYALGGNKESAYYSGIDVKFHTMAVFIISG
FT                   ICAGLAGVVSTARLGAAEPLAGVGFETYAIASAIIGGTSFFGGKGRIFAVVIGGLIIGT
FT                   INNGLNILQVQTYYQLVVMGGLIIIAVALDRLISR"
FT   gene            651685..652371
FT                   /locus_tag="HSM_0559"
FT   CDS_pept        651685..652371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0559"
FT                   /product="Ribulose-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /note="PFAM: ribulose-phosphate 3-epimerase; KEGG:
FT                   ecj:JW4046 allulose-6-phosphate 3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32210"
FT                   /db_xref="GOA:B0US02"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B0US02"
FT                   /protein_id="ACA32210.1"
FT                   /translation="MKVFISPSLMCMDLTKFKEQIEFLDQKVAYFHIDIMDGHYVPNLT
FT                   LSPFFVSQVKKLATKPLDCHLMVTNPENYIDDLAKAGCDMITLHVETISGQAFRLIEKI
FT                   RYLEMKVGIIFNPETPIEKAKYYLSKADKVTILTVDPGFAGQSFIPEMLEKVAELKLFR
FT                   ETHQLNYEIEIDGSCNPKTYEMLIKAGADVLIVGSSGLFNNSDNIVEAWDMLEKEIERI
FT                   LSKGML"
FT   gene            652371..653261
FT                   /locus_tag="HSM_0560"
FT   CDS_pept        652371..653261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0560"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: ecp:ECP_4326
FT                   D-allose kinase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32212"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:B0US03"
FT                   /protein_id="ACA32212.1"
FT                   /translation="MKKVFVGIDMGATHIRICVMDEHHQILSTDKRKTLEVLKNQPLYG
FT                   LTTFCKEFTTDFIIQRIVIGLPAAVSLDRKEILSVPNLSLSKQELDGLVPMLEQYFHCD
FT                   VQLERDVNLQLIYDVNDYQRNNKLVIGVYLGTGMGFSIWNQGKLFIGGHGVAGELGHIP
FT                   YGDEHLQCGCGNMGCLETNCSGTALRKWYDKQQANYPLEQLFDRAIQEKFIQNYLIKVA
FT                   KAISTAVNLFDPHTLILGGGVIDMQKFPFEQLKILIRKHLRKPLPYNELEILKAKPSSI
FT                   NGAIGGAIYAINKEK"
FT   gene            653261..653734
FT                   /locus_tag="HSM_0561"
FT   CDS_pept        653261..653734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0561"
FT                   /product="sugar-phosphate isomerase, RpiB/LacA/LacB family"
FT                   /EC_number="5.3.1.26"
FT                   /note="TIGRFAM: sugar-phosphate isomerase, RpiB/LacA/LacB
FT                   family; ribose 5-phosphate isomerase B; PFAM:
FT                   Ribose/galactose isomerase; KEGG: llc:LACR_1638 galactose
FT                   6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32213"
FT                   /db_xref="GOA:B0US04"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR004785"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/TrEMBL:B0US04"
FT                   /protein_id="ACA32213.1"
FT                   /translation="MKTIAIGSDHIGLALKTFLIEKLEKQGHNLLDLGAVSQERTDYPI
FT                   YAEKVAYAVKRNVADVGILICGTGVGISIAANKISGIRCALCSDELTALMCREHNNCNI
FT                   IAFGANIISSEKAISLATLWLNTPYDGGRHQKRLDMMEMLEKTGSYCGLVTER"
FT   gene            complement(654233..655564)
FT                   /locus_tag="HSM_0562"
FT   CDS_pept        complement(654233..655564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0562"
FT                   /product="heat shock protein HslVU, ATPase subunit HslU"
FT                   /note="TIGRFAM: heat shock protein HslVU, ATPase subunit
FT                   HslU; PFAM: ATPase AAA-2 domain protein; SMART: AAA ATPase;
FT                   KEGG: hso:HS_1542 ATP-dependent ClpY-related protease"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32214"
FT                   /db_xref="GOA:B0US05"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0US05"
FT                   /protein_id="ACA32214.1"
FT                   /translation="MSEMTPREIVSELDQHIIGQADAKRAVAIALRNRWRRMQLQEPLR
FT                   HEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLT
FT                   DSAMKLVRQTEIEKNRFRAEEMAEERVLDTLLPPAKDQWGQIEERDTNTNTRQIFRKKL
FT                   REGQLDDREIEIDIAAPNIGVEIMAPPGMEEMTNQLQSMFQNLSSGQTKKRKMKIKDAL
FT                   KALIDDEAAKLINPEELKQKAIDAVEQNGIVFIDEIDKICKKGEYSGADVSREGVQRDL
FT                   LPLVEGSTVNTKHGMVKTDHILFIASGAFQVARPSDLIPELQGRLPIRVELSALTAKDF
FT                   ERILTEPNASLTEQYQALMATEGVDIEFTESAVKKIAEAAFRVNEKTENIGARRLHTVM
FT                   ERLMDKISFDASEMSGQNVIIDGDYVTGALGDVVENEDLSHFIL"
FT   gene            complement(655582..656109)
FT                   /locus_tag="HSM_0563"
FT   CDS_pept        complement(655582..656109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0563"
FT                   /product="20S proteasome A and B subunits"
FT                   /note="PFAM: 20S proteasome A and B subunits; KEGG:
FT                   hso:HS_1541 heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32215"
FT                   /db_xref="GOA:B0US06"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0US06"
FT                   /protein_id="ACA32215.1"
FT                   /translation="MTTIVSVRRKGQVVVGGDGQVSLGNTVMKGNARKVRRLYNGKVLT
FT                   GFAGGTADAFTLFELFERKLEMHQGHLLKSAVELAKEWRTDRALRRLEAMLIVADKTES
FT                   LIITGNGDVVQPEEDQILAIGSGGNYALSAARALVENTDLSAREIVEKSLKIAGDICVF
FT                   TNLTHTIEELSE"
FT   gene            656396..657460
FT                   /locus_tag="HSM_0564"
FT   CDS_pept        656396..657460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0564"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /note="TIGRFAM: uroporphyrinogen decarboxylase; PFAM:
FT                   Uroporphyrinogen decarboxylase (URO-D); KEGG: hso:HS_1540
FT                   uroporphyrinogen decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32216"
FT                   /db_xref="GOA:B0US07"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0US07"
FT                   /protein_id="ACA32216.1"
FT                   /translation="MTVLKNDRYLKALLREPVDMTPVWMMRQAGRYLPEYKATRAKAGD
FT                   FMSLCRNADLACEVTLQPLRRYDLDAAILFSDILTIPDAMGLGLSFGVGEGPKFARPID
FT                   NKSAVQNLPIPDPEQELQYVMNAVRTIRRELKGEVPLIGFSGSPWTLATYMVEGGSSKA
FT                   FTKIKKMMYSEPKILHLLLDKLADAVILYLNAQINAGVQAVMVFDTWGGVLGHREYLDF
FT                   SLQYMHKIVDGLIRENDGYKVPVTLFTKGGGLWLEAMASTGCDALGLDWTVNLAEAKAR
FT                   VGHKVALQGNMDPSVLYASPARIEQEVQQILADFGQGSGHVFNLGHGIHQDVPEISPKV
FT                   FVDAVHQYSIFYHQ"
FT   gene            657477..658067
FT                   /locus_tag="HSM_0565"
FT   CDS_pept        657477..658067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0565"
FT                   /product="protein of unknown function DUF416"
FT                   /note="PFAM: protein of unknown function DUF416; KEGG:
FT                   hso:HS_1539 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32217"
FT                   /db_xref="InterPro:IPR007338"
FT                   /db_xref="InterPro:IPR023381"
FT                   /db_xref="UniProtKB/TrEMBL:B0US08"
FT                   /protein_id="ACA32217.1"
FT                   /translation="MRNPIHKRLEKFESWKNITFMLCLCERMYPNFYLFCQMTEQMDKA
FT                   KIYQNILNLVWEYLTVKNAKINFENQLEKLENIIPDVNNYEFFGVVPALDACEGLSELL
FT                   HAIIAGETLEKAIKISQLSLQTVITLLETQQDKAFSEAELKQSEEIELELDVQWQIYRT
FT                   LNEPEERDIRLILDLKNELRESRVSNIGIEIAQ"
FT   gene            658226..658501
FT                   /locus_tag="HSM_0566"
FT   CDS_pept        658226..658501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0566"
FT                   /product="histone family protein DNA-binding protein"
FT                   /note="PFAM: histone family protein DNA-binding protein;
FT                   KEGG: hso:HS_1538 DNA-binding protein HU"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32218"
FT                   /db_xref="GOA:B0US09"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:B0US09"
FT                   /protein_id="ACA32218.1"
FT                   /translation="MNKTDLIDAIAGAAELNKKQAKAALEATLGAIAGSLKAGEAVQLI
FT                   GFGTFKVNERKARTGRNPQTGAEIQIAASKVPAFVAGKALKDSVNS"
FT   gene            658663..659445
FT                   /locus_tag="HSM_0567"
FT   CDS_pept        658663..659445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0567"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: regulatory protein DeoR; Helix-turn-helix type
FT                   11 domain protein; regulatory protein DeoR; KEGG:
FT                   hso:HS_1537 transcriptional regulator, DeoR family"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32219"
FT                   /db_xref="GOA:B0US10"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B0US10"
FT                   /protein_id="ACA32219.1"
FT                   /translation="MKRNFYPRNTEQRRQVIMQLLQDKGEISVEQLVQYFNTSEVTIRK
FT                   DLSALESTGFLLRKYGGAVLILQEPLEANHEELLSNRKLAIAKAAAERIADNNRIIIDS
FT                   GSTTAALIKQLNNKQGLVVMTNSLSVANQLRSLEYAPTLLMTGGTWDTGSESFQGKVAE
FT                   QVLYSYNFDQLFIGADGIDLARGTTTFNELVGLSQVMAEVAQEVIVMVESQKIGRKMPN
FT                   LELTWQQIDVLITDELLSDKVKKQIELLGVEVVCVSAV"
FT   gene            659471..661303
FT                   /locus_tag="HSM_0568"
FT   CDS_pept        659471..661303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0568"
FT                   /product="glucosamine--fructose-6-phosphate
FT                   aminotransferase, isomerizing"
FT                   /note="TIGRFAM: glucosamine--fructose-6-phosphate
FT                   aminotransferase, isomerizing; PFAM: glutamine
FT                   amidotransferase class-II; sugar isomerase (SIS); KEGG:
FT                   hso:HS_1536 glucosamine-fructose-6-phosphate"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32220"
FT                   /db_xref="GOA:B0US11"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:B0US11"
FT                   /protein_id="ACA32220.1"
FT                   /translation="MCGIVGAVAQRDVAKILIDGLYRLEYRGYDSAGVAILNEQRHVQI
FT                   VRRVGKVQALDDAIEKQQLSGGTGIAHTRWATHGEPSEINAHPHCSGKIIVVHNGIIEN
FT                   YQELQEVLQQRGYIFQSQTDTEVISHLVEWELRSANTLLEAVQKAIAQLRGAYGTVVMN
FT                   QDEPEHLIVARSGSPLVIGLGIGENFLASDPLALLNVTHRFIYLEEGDVAEITCHSVDI
FT                   FDFNGKQVERAVHKNNFETDVIDKGPYRHYMQKEIFEQPQAIMNTLDGRILNGQVNIEA
FT                   IAPNAEEILRQVEHIQIVACGTSYNAGMVARYWFESIARVSCNVEIASEFRYRKSVTRP
FT                   NSLFITLSQSGETADTLAALRLAKQSGDMSAMTICNVASSSLVRESDFAFMTRAGVEIG
FT                   VASTKAFTTQLTCLLLLNVVLGRIKGSINVEQERNIIRSLQRLPAQVESALVFDKQIQK
FT                   LSEDFAEKHHTLFLGRGEYYPIAMESALKLKEISYIHAEAYAAGELKHGPLALIDGDMP
FT                   VIVVAPENDLLEKVKSNIEEVRARGGRLYIFADHEFGFGNSDSFKTLVLPKVDAITAPI
FT                   FYTVPLQLLSYYIALIKGTDVDQPRNLAKAVTVE"
FT   gene            complement(661375..662205)
FT                   /locus_tag="HSM_0569"
FT   CDS_pept        complement(661375..662205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0569"
FT                   /product="lipoprotein, YaeC family"
FT                   /note="TIGRFAM: lipoprotein, YaeC family; PFAM: NLPA
FT                   lipoprotein; KEGG: hso:HS_1535 outer membrane lipoprotein 1
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32221"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:B0US12"
FT                   /protein_id="ACA32221.1"
FT                   /translation="MKLNKLFATIAIASTVALTACNDDKKTETVANQNKPAKIKVGVMA
FT                   GPEHQVAEKAAQIAKEKYNLAVEFVIFNDYALPNTAVSKGDLDINAMQHKPYLDKDTQS
FT                   KNITNLEIVGNTFVYPLAGYSKKIKNISELKDGDTVAVPNDPSNLARALILLEKQGLIK
FT                   LKDNTNLFSTALDIIENPKNLEIKEVDTSVAARALDDVALAVVNNTYAGQVGLNSAEHG
FT                   IFTEDKDSPYVNIIVARKDNKDSVEVQNFVKAYQTEEVYQEAYKHFKDGVAKGW"
FT   sig_peptide     complement(662143..662205)
FT                   /locus_tag="HSM_0569"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.646 at
FT                   residue 21"
FT   gene            complement(662241..662930)
FT                   /locus_tag="HSM_0570"
FT   CDS_pept        complement(662241..662930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0570"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: hso:HS_1534 D-methionine
FT                   ABC transporter, permease"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32223"
FT                   /db_xref="GOA:B0US13"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B0US13"
FT                   /protein_id="ACA32223.1"
FT                   /translation="MLDNLLITFNQQLTPEMWSKIALSTWETVYMTIVSTFIAVLIGLP
FT                   IGCVTFLTGKKQILENSNANKIFNVIINIGRSVPYIILLLILIPVTSYIVGSSLGTNAA
FT                   IVSLSVAAIPFFARLTSNALFEIPTGLTETAKALGATNWQIITKFYLPEALPSLINGIT
FT                   LTFVTLIGYTAMAGTQGGGGLGSLAINYGVHRGMGFITWISTIIIVLFVIISQKLGDDL
FT                   AKKVDHR"
FT   gene            complement(662920..663957)
FT                   /locus_tag="HSM_0571"
FT   CDS_pept        complement(662920..663957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0571"
FT                   /product="D-methionine ABC transporter, ATPase subunit"
FT                   /note="TIGRFAM: D-methionine ABC transporter, ATPase
FT                   subunit; PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: hso:HS_1533 D-methionine ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32224"
FT                   /db_xref="GOA:B0US14"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012692"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/TrEMBL:B0US14"
FT                   /protein_id="ACA32224.1"
FT                   /translation="MIKLKNISKVFNVSGKNLTALDNVSLEVPRGQICGVIGASGAGKS
FT                   TLIRCINLLERPTSGSVIVDNTDLTQLSDNELIHARRHIGMIFQHFNLLSSRTVFDNVA
FT                   LPLELEKTDKTQIKQKVDALLNLVGLYDKKDVYPANLSGGQKQRVAIARALANSPKVLL
FT                   CDEATSALDPATTQSILKLLKEINRTLGITILLITHEMDVVKRICDQVAVINKGQLIEQ
FT                   GSVGDIFSNPKTLLAQEFIHSTFHINLPEEYMENLPATPKHAKSYPIIKFEFTGRSVDA
FT                   PLLSQASKQFGVDLSILSSQIDYAGEVKFGFVIAEVEGEEEAITQTKIYLMENNVRVEV
FT                   LGYVG"
FT   gene            664112..664666
FT                   /locus_tag="HSM_0572"
FT   CDS_pept        664112..664666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0572"
FT                   /product="D,D-heptose 1,7-bisphosphate phosphatase"
FT                   /note="TIGRFAM: D,D-heptose 1,7-bisphosphate phosphatase;
FT                   histidinol-phosphate phosphatase family protein; hydrolase,
FT                   HAD-superfamily, subfamily IIIA; PFAM: Polynucleotide
FT                   kinase 3 phosphatase central region; KEGG: hso:HS_1532
FT                   conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32225"
FT                   /db_xref="GOA:B0US15"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B0US15"
FT                   /protein_id="ACA32225.1"
FT                   /translation="MNKAIFLDRDGTLNIDHGYVHEIDKFQFIAGSIEALKQLKSMGFL
FT                   LVLVTNQSGIARGYFSEEQFLQLTEWMDWSLADRGVDLDGIYYCPHHLEGIGEYKQDCD
FT                   CRKPKNGMLLQAIKELNIDPARSFMVGDKKEDLLAGKSAGIKKNILVRSGKEITDDGLS
FT                   LADYVLDTIADLPELIKKLKF"
FT   gene            complement(664818..665894)
FT                   /locus_tag="HSM_0573"
FT   CDS_pept        complement(664818..665894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0573"
FT                   /product="protein of unknown function DUF1603"
FT                   /note="PFAM: protein of unknown function DUF1603; KEGG:
FT                   hpy:HP1471 type IIS restriction enzyme R protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32226"
FT                   /db_xref="GOA:B0US16"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:B0US16"
FT                   /protein_id="ACA32226.1"
FT                   /translation="MFDVNSSKKIFHASNIEVFDEQVLDSYPYVVRKTGENGIKGYIKE
FT                   SEEFLNPSNTLSFAQDTFTVFYQKNKYFTGNKVKVLVPKFKIFNEVISEFFVAVFNNLL
FT                   SNLSWGDGSNVEMIKSFVIQLPTKDNKIDFEFMESFISELEDERIRELSAYLTVSRLDN
FT                   YELSSEEKEALDKFELISNNWNLFKIQDIFNVKSSKKRFDANKVEILNCGFPYIVRMST
FT                   NNGIKGYLNQDEQLLNHGNTIAFGQDTATMFYQEKPYFTGDKIKILECRYDKFNKINSM
FT                   FLISTMRKSFSTFSWGANSFSEKVINNQIIKLPTKNNEIDFSYMELLISAVQKLVIKDV
FT                   VMWKDKKIEATKQLVGRN"
FT   gene            complement(665954..667997)
FT                   /pseudo
FT                   /locus_tag="HSM_0574"
FT                   /note="N-6 DNA methylase; type IIS restriction enzyme M
FT                   protein"
FT   gene            complement(668254..669396)
FT                   /locus_tag="HSM_0576"
FT   CDS_pept        complement(668254..669396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0576"
FT                   /product="Glycerate kinase"
FT                   /EC_number="2.7.1.31"
FT                   /note="PFAM: glycerate kinase; KEGG: hso:HS_1524 glycerate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32227"
FT                   /db_xref="GOA:B0US17"
FT                   /db_xref="InterPro:IPR004381"
FT                   /db_xref="InterPro:IPR018193"
FT                   /db_xref="InterPro:IPR018197"
FT                   /db_xref="InterPro:IPR036129"
FT                   /db_xref="UniProtKB/TrEMBL:B0US17"
FT                   /protein_id="ACA32227.1"
FT                   /translation="MKIVIAPDSFKESLTALEVAQAIENGFKKIYPNADYVKVPMADGG
FT                   EGTVQSLADALQGKLISVEVTAPLGNKTQAEFAISGDGKIAIIEMAAASGLHLVPIEKR
FT                   NPYYTTSYGTGELINAALDLGVSQIILGIGGSATNDGGVGMLQALGIKFKDAQGKEIGL
FT                   GGLALQQIAHIDTAHLDQRLTQVQFNVACDVNNPLCGEKGASATFGPQKGATPEMVQQL
FT                   DQALLHFSRIVERDCGKRIAERPGSGAAGGMGGGLLLLPQVQLKSGVQIVIDTVNLAEI
FT                   IKDADLVITGEGRIDSQTIHGKTPIGVAKTAKLANKPVIAITGCLREDYEVVYEHGIDA
FT                   VFPIIRQLDSLPEILAQGRQNLESTAQNIARMHLLVQRSH"
FT   gene            complement(669422..670681)
FT                   /locus_tag="HSM_0577"
FT   CDS_pept        complement(669422..670681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0577"
FT                   /product="Citrate transporter"
FT                   /note="PFAM: Gluconate transporter; Citrate transporter;
FT                   KEGG: hit:NTHI0171 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32228"
FT                   /db_xref="GOA:B0US18"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:B0US18"
FT                   /protein_id="ACA32228.1"
FT                   /translation="MITVTALGAIVALFTAIVLILKKVPPAYGMIIGALVGGLIGGADL
FT                   SQTVTLMIGGAQGITTAVMRILAAGVLAGVLIESGAASTIADTIVKKLGESRSLLALIL
FT                   AAMLLTAVGVFIDVAVITVAPIALALAKRSNLSKMAILLAMIGGGKAGNIMSPNPNAIA
FT                   ASDAFNIPLTSVMTAGIIPAVFGLIITYFLAKSLMNKGSKVSEKEIVGITGELPKFLPA
FT                   IIAPLFTIILLALRPLFGIKIDPLIALPLGGIVGTICMNKTRYLNQYAVIGLGKMAPVA
FT                   VMLLGTGTLAGVIANSELKELLIEGLTASGLPSYLLAPISGGLMSLASASTTAGTAVAS
FT                   QVFGATLIELSVSGIAAAAMIHAGATVFDHMPHGSFFHATGGSVNMDIKERLKLIPYET
FT                   AVGLIMTIISTLIFGVWQLF"
FT   gene            complement(670809..671927)
FT                   /locus_tag="HSM_0578"
FT   CDS_pept        complement(670809..671927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0578"
FT                   /product="transcriptional regulator, CdaR"
FT                   /note="PFAM: sugar diacid recognition domain protein; KEGG:
FT                   hso:HS_1521 possible sugar diacid utilization regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32229"
FT                   /db_xref="InterPro:IPR008599"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:B0US19"
FT                   /protein_id="ACA32229.1"
FT                   /translation="MNMKLSVSLAQNIVQRTNRVLHKPINVMNETGIIIASSNPHRLQQ
FT                   RHIGAIYSIRHNQTIEINQELAEKWLFEVQPGINLPISYLGEILGVVGISGDPDTVRSY
FT                   GEMVKMTAELMIEQHFLLEKERWDKRYKEEFILGLLKGKLNEAEIEKQSAFFGLTLHTK
FT                   SAVIIIQILHPTAEKLQKLAGYLEQSINHFAILSHDKIALIQPAEELQALLGTKGLQKL
FT                   FPPYLLPSGLKGLKVAIGSEVENNRNISLSFQTALSTLRYGETYFPKKSIYFFNQYKLP
FT                   ALLDNLRSTWQSKELLKPIDTLYQQDENHLLQKTLQQYFFSNCDLALTSQQLFIHINTL
FT                   RYRLSKIEKITGLSFNKIDEKFTLYLSTLLNQ"
FT   gene            672278..673810
FT                   /locus_tag="HSM_R0027"
FT   rRNA            672278..673810
FT                   /locus_tag="HSM_R0027"
FT                   /product="16S ribosomal RNA"
FT   gene            673887..673962
FT                   /locus_tag="HSM_R0028"
FT                   /note="tRNA-Glu1"
FT   tRNA            673887..673962
FT                   /locus_tag="HSM_R0028"
FT                   /product="tRNA-Glu"
FT   gene            674150..677137
FT                   /locus_tag="HSM_R0029"
FT   rRNA            674150..677137
FT                   /locus_tag="HSM_R0029"
FT                   /product="23S ribosomal RNA"
FT   gene            677267..677381
FT                   /locus_tag="HSM_R0030"
FT   rRNA            677267..677381
FT                   /locus_tag="HSM_R0030"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(677604..677888)
FT                   /locus_tag="HSM_0579"
FT   CDS_pept        complement(677604..677888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0579"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hso:HS_1452 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32230"
FT                   /db_xref="UniProtKB/TrEMBL:B0US20"
FT                   /protein_id="ACA32230.1"
FT                   /translation="MRFCLIGLCILLTSCIVPTSTKDQTAIPVPIFIGVSEQTDFDAIH
FT                   VCTLKPFTQEYRSEHTNRGRAKLNVQRQCQAQHSEMFCEEKDIVCRTYE"
FT   sig_peptide     complement(677823..677888)
FT                   /locus_tag="HSM_0579"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.968) with cleavage site probability 0.669 at
FT                   residue 22"
FT   gene            complement(678110..678757)
FT                   /locus_tag="HSM_0580"
FT   CDS_pept        complement(678110..678757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0580"
FT                   /product="L-fuculose phosphate aldolase"
FT                   /EC_number="4.1.2.17"
FT                   /note="TIGRFAM: L-fuculose phosphate aldolase; PFAM: class
FT                   II aldolase/adducin family protein; KEGG: hso:HS_1451
FT                   L-fuculose phosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32232"
FT                   /db_xref="GOA:B0US21"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR004782"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:B0US21"
FT                   /protein_id="ACA32232.1"
FT                   /translation="MDRSLLSKKIIFTCLEMTRLGLNQGTAGNVSVRYKDGMLITPTGM
FT                   PYELLTENNIVYVDKHGKHEEGKFPSSEWHFHLAVYEARPDVDAVVHNHSINCAAVSIL
FT                   EKPIPPFHYMIAVGGADHIPCVPYATFGTHELAEHVKQGIKKCKAILLAHHGLIAAEKN
FT                   LDKALWLAHEVEVLAQWYMKLLATGLEIPLLTPKEMEIVLEKFKSYGLRIEK"
FT   gene            complement(678771..679205)
FT                   /locus_tag="HSM_0581"
FT   CDS_pept        complement(678771..679205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0581"
FT                   /product="RbsD or FucU transport"
FT                   /note="PFAM: RbsD or FucU transport; KEGG: hso:HS_1450
FT                   fucose operon FucU protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32233"
FT                   /db_xref="GOA:B0US22"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="InterPro:IPR023751"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0US22"
FT                   /protein_id="ACA32233.1"
FT                   /translation="MLKGIHPAISPDLLKILAEMGHGDELVLSDAHFPAHQLHHKVVRA
FT                   DGISINSLLTGITPLFEFDTYTEAPLIMMQAVEGDSLDPAVEQSYLQTIKSAVGNVPKL
FT                   ARMDRFAFYERAKQAYAVVITGETAKYGNIIIKKGVTPVK"
FT   gene            complement(679199..680656)
FT                   /locus_tag="HSM_0582"
FT   CDS_pept        complement(679199..680656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0582"
FT                   /product="L-fuculokinase"
FT                   /note="TIGRFAM: L-fuculokinase; PFAM: carbohydrate kinase
FT                   FGGY; KEGG: hso:HS_1449 L-fuculokinase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32234"
FT                   /db_xref="GOA:B0US23"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR013450"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:B0US23"
FT                   /protein_id="ACA32234.1"
FT                   /translation="MAIALIFDCGATNLRTIAINEAGKIVASHHTPNHTQPDPENSLYH
FT                   IWDIEEIYQKLIFCAEKTIVNLRQKQIDLAEIKGIGITTFGVDGAPFSKNRKQIFPIIS
FT                   WKCPRTLPVMEKLHQYLDVKKLYQRNGIGQYSFNTLFKLLWLKENKPDIFAEMDKWVFI
FT                   SSILTQRLTGQFSTDRTMAGTSMMTNIENDSWDKEVLDFLGLNEQHFPPMKRAGEKIGN
FT                   LLPEVAKYLGLSTHIPVLSCGHDTQFAIFGSGAKYNQPVLSSGTWEILMVRTQQAQAQW
FT                   QYVRDGLTIEFDSLPDAFNPGVQWVSSGVIEWLGKQFFSDVTKEQYYQTMIAEGETVPA
FT                   GSNGVKLVGNFDGKMEQTGEIKGLSMHTKRGEIYRAGLEYMAYRLKAGLNVLQKVGNFS
FT                   ADRLIVVGGGSKNKLWNQIRADVLGCPIDVIDIAESTVLGAAMFTLTGAGVFANVEEAQ
FT                   QKMKPTFRRIEPSTDMEFYKKLQEDIC"
FT   gene            complement(680738..682504)
FT                   /locus_tag="HSM_0583"
FT   CDS_pept        complement(680738..682504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0583"
FT                   /product="L-fucose isomerase"
FT                   /EC_number="5.3.1.25"
FT                   /note="TIGRFAM: L-fucose isomerase; PFAM: L-fucose
FT                   isomerase domain protein; L-fucose isomerase _1 domain
FT                   protein; L-fucose isomerase _2 domain protein; KEGG:
FT                   hso:HS_1448 L-fucose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32235"
FT                   /db_xref="GOA:B0US24"
FT                   /db_xref="InterPro:IPR004216"
FT                   /db_xref="InterPro:IPR005763"
FT                   /db_xref="InterPro:IPR009015"
FT                   /db_xref="InterPro:IPR012888"
FT                   /db_xref="InterPro:IPR012889"
FT                   /db_xref="InterPro:IPR015888"
FT                   /db_xref="InterPro:IPR038391"
FT                   /db_xref="InterPro:IPR038392"
FT                   /db_xref="InterPro:IPR038393"
FT                   /db_xref="UniProtKB/TrEMBL:B0US24"
FT                   /protein_id="ACA32235.1"
FT                   /translation="MTHLKSTPVKIGIRPTIDGRRMGVRESLEDQTMNMAKAVAQLIET
FT                   EVRHTNGQFVKCVIADTTIGGVAEAAACAEKFKRENVGAVITVTPCWCYGSETIDMDPH
FT                   MPKAIWGFNGTERPGAVYLAAALAGHNQMGLPAFSIYGTEVQEASDTTIPTDVKEKLLR
FT                   FARAGLAVATLRGKSYLSIGSVSMGIAGSIVNQAFFQEYLDMRNEYVDMTEIKRRLDRK
FT                   IYDEKEVKLAMEWVTQYCKEGIDVNAEENQRSSEERAKLWENVVKMTIICRDLMVGNPR
FT                   LAELGYVEESMGHNAISAGFQGQRHWTDHLPNGDFMEAILNSTYDWNGVRPPYILATEN
FT                   DSLNGVNMLFGNLLTGQAQIFADVRTYWSEDSVERVTGWRPESGFIHLLNSGSAALDGT
FT                   GQHTDPNGTSVIKPVWEVTKEDGKRCLENTRWCPAVHEYFRGGGLSSQFLTKGGMPFTI
FT                   HRINLVKGIGPVLQIAEGWSIALPENVHDILNKRTDQTWPTTWFVPRLTGTGAFTDVYS
FT                   VMANWGANHCVATYGHVGADLITLASMLRIPVCMHNVEEKDIFRPSAWSAFGQDKEGQD
FT                   YRACANFGPLYR"
FT   gene            complement(682700..683995)
FT                   /locus_tag="HSM_0584"
FT   CDS_