(data stored in ACNUC7421 zone)

EMBL: CP000949

ID   CP000949; SV 1; circular; genomic DNA; STD; PRO; 5774330 BP.
XX
AC   CP000949; AAVY01000000-AAVY01000062;
XX
PR   Project:PRJNA17053;
XX
DT   12-MAR-2008 (Rel. 95, Created)
DT   11-SEP-2019 (Rel. 142, Last updated, Version 7)
XX
DE   Pseudomonas putida W619 chromosome, complete genome.
XX
KW   .
XX
OS   Pseudomonas putida W619
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales;
OC   Pseudomonadaceae; Pseudomonas.
XX
RN   [1]
RP   1-5774330
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Dalin E., Tice H., Pitluck S., Chain P., Malfatti S.,
RA   Shin M., Vergez L., Schmutz J., Larimer F., Land M., Hauser L.,
RA   Kyrpides N., Kim E., Taghavi S., Vangronsveld D., van der Lelie D.,
RA   Richardson P.;
RT   "Complete sequence of Psuedomonas putida W619";
RL   Unpublished.
XX
RN   [2]
RP   1-5774330
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Dalin E., Tice H., Pitluck S., Chain P., Malfatti S.,
RA   Shin M., Vergez L., Schmutz J., Larimer F., Land M., Hauser L.,
RA   Kyrpides N., Kim E., Taghavi S., Vangronsveld D., van der Lelie D.,
RA   Richardson P.;
RT   ;
RL   Submitted (21-FEB-2008) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 690cba0d05f08ce7fae5e22e3126fd33.
DR   BioSample; SAMN02598376.
DR   EnsemblGenomes-Gn; EBG00001456513.
DR   EnsemblGenomes-Gn; EBG00001456514.
DR   EnsemblGenomes-Gn; EBG00001456515.
DR   EnsemblGenomes-Gn; EBG00001456516.
DR   EnsemblGenomes-Gn; EBG00001456517.
DR   EnsemblGenomes-Gn; EBG00001456518.
DR   EnsemblGenomes-Gn; EBG00001456519.
DR   EnsemblGenomes-Gn; EBG00001456520.
DR   EnsemblGenomes-Gn; EBG00001456521.
DR   EnsemblGenomes-Gn; EBG00001456522.
DR   EnsemblGenomes-Gn; EBG00001456523.
DR   EnsemblGenomes-Gn; EBG00001456524.
DR   EnsemblGenomes-Gn; EBG00001456525.
DR   EnsemblGenomes-Gn; EBG00001456526.
DR   EnsemblGenomes-Gn; EBG00001456527.
DR   EnsemblGenomes-Gn; EBG00001456528.
DR   EnsemblGenomes-Gn; EBG00001456529.
DR   EnsemblGenomes-Gn; EBG00001456530.
DR   EnsemblGenomes-Gn; EBG00001456531.
DR   EnsemblGenomes-Gn; EBG00001456532.
DR   EnsemblGenomes-Gn; EBG00001456533.
DR   EnsemblGenomes-Gn; EBG00001456534.
DR   EnsemblGenomes-Gn; EBG00001456535.
DR   EnsemblGenomes-Gn; EBG00001456536.
DR   EnsemblGenomes-Gn; EBG00001456537.
DR   EnsemblGenomes-Gn; EBG00001456538.
DR   EnsemblGenomes-Gn; EBG00001456539.
DR   EnsemblGenomes-Gn; EBG00001456540.
DR   EnsemblGenomes-Gn; EBG00001456541.
DR   EnsemblGenomes-Gn; EBG00001456542.
DR   EnsemblGenomes-Gn; EBG00001456543.
DR   EnsemblGenomes-Gn; EBG00001456544.
DR   EnsemblGenomes-Gn; EBG00001456545.
DR   EnsemblGenomes-Gn; EBG00001456546.
DR   EnsemblGenomes-Gn; EBG00001456547.
DR   EnsemblGenomes-Gn; EBG00001456548.
DR   EnsemblGenomes-Gn; EBG00001456549.
DR   EnsemblGenomes-Gn; EBG00001456550.
DR   EnsemblGenomes-Gn; EBG00001456551.
DR   EnsemblGenomes-Gn; EBG00001456552.
DR   EnsemblGenomes-Gn; EBG00001456553.
DR   EnsemblGenomes-Gn; EBG00001456554.
DR   EnsemblGenomes-Gn; EBG00001456555.
DR   EnsemblGenomes-Gn; EBG00001456556.
DR   EnsemblGenomes-Gn; EBG00001456557.
DR   EnsemblGenomes-Gn; EBG00001456558.
DR   EnsemblGenomes-Gn; EBG00001456559.
DR   EnsemblGenomes-Gn; EBG00001456560.
DR   EnsemblGenomes-Gn; EBG00001456561.
DR   EnsemblGenomes-Gn; EBG00001456562.
DR   EnsemblGenomes-Gn; EBG00001456563.
DR   EnsemblGenomes-Gn; EBG00001456564.
DR   EnsemblGenomes-Gn; EBG00001456565.
DR   EnsemblGenomes-Gn; EBG00001456566.
DR   EnsemblGenomes-Gn; EBG00001456567.
DR   EnsemblGenomes-Gn; EBG00001456568.
DR   EnsemblGenomes-Gn; EBG00001456569.
DR   EnsemblGenomes-Gn; EBG00001456570.
DR   EnsemblGenomes-Gn; EBG00001456571.
DR   EnsemblGenomes-Gn; EBG00001456572.
DR   EnsemblGenomes-Gn; EBG00001456573.
DR   EnsemblGenomes-Gn; EBG00001456574.
DR   EnsemblGenomes-Gn; EBG00001456575.
DR   EnsemblGenomes-Gn; EBG00001456576.
DR   EnsemblGenomes-Gn; EBG00001456577.
DR   EnsemblGenomes-Gn; EBG00001456578.
DR   EnsemblGenomes-Gn; EBG00001456579.
DR   EnsemblGenomes-Gn; EBG00001456580.
DR   EnsemblGenomes-Gn; EBG00001456581.
DR   EnsemblGenomes-Gn; EBG00001456582.
DR   EnsemblGenomes-Gn; EBG00001456583.
DR   EnsemblGenomes-Gn; EBG00001456584.
DR   EnsemblGenomes-Gn; EBG00001456585.
DR   EnsemblGenomes-Gn; EBG00001456586.
DR   EnsemblGenomes-Gn; EBG00001456587.
DR   EnsemblGenomes-Gn; EBG00001456588.
DR   EnsemblGenomes-Gn; EBG00001456589.
DR   EnsemblGenomes-Gn; EBG00001456590.
DR   EnsemblGenomes-Gn; EBG00001456591.
DR   EnsemblGenomes-Gn; EBG00001456592.
DR   EnsemblGenomes-Gn; EBG00001456593.
DR   EnsemblGenomes-Gn; EBG00001456594.
DR   EnsemblGenomes-Gn; EBG00001456595.
DR   EnsemblGenomes-Gn; EBG00001456596.
DR   EnsemblGenomes-Gn; EBG00001456597.
DR   EnsemblGenomes-Gn; EBG00001456598.
DR   EnsemblGenomes-Gn; EBG00001456599.
DR   EnsemblGenomes-Gn; EBG00001456600.
DR   EnsemblGenomes-Gn; EBG00001456601.
DR   EnsemblGenomes-Gn; EBG00001456602.
DR   EnsemblGenomes-Gn; EBG00001456603.
DR   EnsemblGenomes-Gn; EBG00001456604.
DR   EnsemblGenomes-Gn; EBG00001456605.
DR   EnsemblGenomes-Gn; EBG00001456606.
DR   EnsemblGenomes-Gn; EBG00001456607.
DR   EnsemblGenomes-Gn; EBG00001456608.
DR   EnsemblGenomes-Gn; EBG00001456609.
DR   EnsemblGenomes-Gn; EBG00001456610.
DR   EnsemblGenomes-Gn; EBG00001456611.
DR   EnsemblGenomes-Gn; EBG00001456612.
DR   EnsemblGenomes-Gn; EBG00001456613.
DR   EnsemblGenomes-Gn; EBG00001456614.
DR   EnsemblGenomes-Gn; EBG00001456615.
DR   EnsemblGenomes-Gn; EBG00001456616.
DR   EnsemblGenomes-Gn; EBG00001456617.
DR   EnsemblGenomes-Gn; EBG00001456618.
DR   EnsemblGenomes-Gn; EBG00001456619.
DR   EnsemblGenomes-Gn; EBG00001456620.
DR   EnsemblGenomes-Gn; EBG00001456621.
DR   EnsemblGenomes-Gn; EBG00001456622.
DR   EnsemblGenomes-Gn; EBG00001456623.
DR   EnsemblGenomes-Gn; EBG00001456624.
DR   EnsemblGenomes-Gn; EBG00001456625.
DR   EnsemblGenomes-Gn; EBG00001456626.
DR   EnsemblGenomes-Gn; EBG00001456627.
DR   EnsemblGenomes-Gn; EBG00001456628.
DR   EnsemblGenomes-Gn; EBG00001456629.
DR   EnsemblGenomes-Gn; EBG00001456630.
DR   EnsemblGenomes-Gn; EBG00001456631.
DR   EnsemblGenomes-Gn; EBG00001456632.
DR   EnsemblGenomes-Gn; EBG00001456633.
DR   EnsemblGenomes-Gn; EBG00001456634.
DR   EnsemblGenomes-Gn; EBG00001456635.
DR   EnsemblGenomes-Gn; EBG00001456636.
DR   EnsemblGenomes-Gn; EBG00001456637.
DR   EnsemblGenomes-Gn; EBG00001456638.
DR   EnsemblGenomes-Gn; EBG00001456639.
DR   EnsemblGenomes-Gn; EBG00001456640.
DR   EnsemblGenomes-Gn; EBG00001456641.
DR   EnsemblGenomes-Gn; EBG00001456642.
DR   EnsemblGenomes-Gn; EBG00001456643.
DR   EnsemblGenomes-Gn; EBG00001456644.
DR   EnsemblGenomes-Gn; EBG00001456645.
DR   EnsemblGenomes-Gn; EBG00001456646.
DR   EnsemblGenomes-Gn; EBG00001456647.
DR   EnsemblGenomes-Gn; EBG00001456648.
DR   EnsemblGenomes-Gn; EBG00001456649.
DR   EnsemblGenomes-Gn; EBG00001456650.
DR   EnsemblGenomes-Gn; EBG00001456651.
DR   EnsemblGenomes-Gn; EBG00001456652.
DR   EnsemblGenomes-Gn; EBG00001456653.
DR   EnsemblGenomes-Gn; EBG00001456654.
DR   EnsemblGenomes-Gn; EBG00001456655.
DR   EnsemblGenomes-Gn; EBG00001456656.
DR   EnsemblGenomes-Gn; EBG00001456657.
DR   EnsemblGenomes-Gn; EBG00001456658.
DR   EnsemblGenomes-Gn; EBG00001456659.
DR   EnsemblGenomes-Gn; EBG00001456660.
DR   EnsemblGenomes-Gn; EBG00001456661.
DR   EnsemblGenomes-Gn; EBG00001456662.
DR   EnsemblGenomes-Gn; EBG00001456663.
DR   EnsemblGenomes-Gn; EBG00001456664.
DR   EnsemblGenomes-Gn; EBG00001456665.
DR   EnsemblGenomes-Gn; EBG00001456666.
DR   EnsemblGenomes-Gn; EBG00001456667.
DR   EnsemblGenomes-Gn; EBG00001456668.
DR   EnsemblGenomes-Gn; EBG00001456669.
DR   EnsemblGenomes-Gn; EBG00001456670.
DR   EnsemblGenomes-Gn; EBG00001456671.
DR   EnsemblGenomes-Gn; EBG00001456672.
DR   EnsemblGenomes-Gn; EBG00001456673.
DR   EnsemblGenomes-Gn; EBG00001456674.
DR   EnsemblGenomes-Gn; EBG00001456675.
DR   EnsemblGenomes-Gn; EBG00001456676.
DR   EnsemblGenomes-Gn; EBG00001456677.
DR   EnsemblGenomes-Gn; EBG00001456678.
DR   EnsemblGenomes-Gn; EBG00001456679.
DR   EnsemblGenomes-Gn; EBG00001456680.
DR   EnsemblGenomes-Gn; EBG00001456681.
DR   EnsemblGenomes-Gn; EBG00001456682.
DR   EnsemblGenomes-Gn; PputW619_R0001.
DR   EnsemblGenomes-Gn; PputW619_R0002.
DR   EnsemblGenomes-Gn; PputW619_R0003.
DR   EnsemblGenomes-Gn; PputW619_R0004.
DR   EnsemblGenomes-Gn; PputW619_R0005.
DR   EnsemblGenomes-Gn; PputW619_R0006.
DR   EnsemblGenomes-Gn; PputW619_R0007.
DR   EnsemblGenomes-Gn; PputW619_R0008.
DR   EnsemblGenomes-Gn; PputW619_R0009.
DR   EnsemblGenomes-Gn; PputW619_R0010.
DR   EnsemblGenomes-Gn; PputW619_R0011.
DR   EnsemblGenomes-Gn; PputW619_R0012.
DR   EnsemblGenomes-Gn; PputW619_R0013.
DR   EnsemblGenomes-Gn; PputW619_R0014.
DR   EnsemblGenomes-Gn; PputW619_R0015.
DR   EnsemblGenomes-Gn; PputW619_R0016.
DR   EnsemblGenomes-Gn; PputW619_R0017.
DR   EnsemblGenomes-Gn; PputW619_R0018.
DR   EnsemblGenomes-Gn; PputW619_R0019.
DR   EnsemblGenomes-Gn; PputW619_R0020.
DR   EnsemblGenomes-Gn; PputW619_R0021.
DR   EnsemblGenomes-Gn; PputW619_R0022.
DR   EnsemblGenomes-Gn; PputW619_R0023.
DR   EnsemblGenomes-Gn; PputW619_R0024.
DR   EnsemblGenomes-Gn; PputW619_R0025.
DR   EnsemblGenomes-Gn; PputW619_R0026.
DR   EnsemblGenomes-Gn; PputW619_R0027.
DR   EnsemblGenomes-Gn; PputW619_R0028.
DR   EnsemblGenomes-Gn; PputW619_R0029.
DR   EnsemblGenomes-Gn; PputW619_R0030.
DR   EnsemblGenomes-Gn; PputW619_R0031.
DR   EnsemblGenomes-Gn; PputW619_R0032.
DR   EnsemblGenomes-Gn; PputW619_R0033.
DR   EnsemblGenomes-Gn; PputW619_R0034.
DR   EnsemblGenomes-Gn; PputW619_R0035.
DR   EnsemblGenomes-Gn; PputW619_R0036.
DR   EnsemblGenomes-Gn; PputW619_R0037.
DR   EnsemblGenomes-Gn; PputW619_R0038.
DR   EnsemblGenomes-Gn; PputW619_R0039.
DR   EnsemblGenomes-Gn; PputW619_R0040.
DR   EnsemblGenomes-Gn; PputW619_R0041.
DR   EnsemblGenomes-Gn; PputW619_R0042.
DR   EnsemblGenomes-Gn; PputW619_R0043.
DR   EnsemblGenomes-Gn; PputW619_R0044.
DR   EnsemblGenomes-Gn; PputW619_R0045.
DR   EnsemblGenomes-Gn; PputW619_R0046.
DR   EnsemblGenomes-Gn; PputW619_R0047.
DR   EnsemblGenomes-Gn; PputW619_R0048.
DR   EnsemblGenomes-Gn; PputW619_R0049.
DR   EnsemblGenomes-Gn; PputW619_R0050.
DR   EnsemblGenomes-Gn; PputW619_R0051.
DR   EnsemblGenomes-Gn; PputW619_R0052.
DR   EnsemblGenomes-Gn; PputW619_R0053.
DR   EnsemblGenomes-Gn; PputW619_R0054.
DR   EnsemblGenomes-Gn; PputW619_R0055.
DR   EnsemblGenomes-Gn; PputW619_R0056.
DR   EnsemblGenomes-Gn; PputW619_R0058.
DR   EnsemblGenomes-Gn; PputW619_R0059.
DR   EnsemblGenomes-Gn; PputW619_R0060.
DR   EnsemblGenomes-Gn; PputW619_R0061.
DR   EnsemblGenomes-Gn; PputW619_R0062.
DR   EnsemblGenomes-Gn; PputW619_R0063.
DR   EnsemblGenomes-Gn; PputW619_R0064.
DR   EnsemblGenomes-Gn; PputW619_R0065.
DR   EnsemblGenomes-Gn; PputW619_R0066.
DR   EnsemblGenomes-Gn; PputW619_R0067.
DR   EnsemblGenomes-Gn; PputW619_R0068.
DR   EnsemblGenomes-Gn; PputW619_R0069.
DR   EnsemblGenomes-Gn; PputW619_R0070.
DR   EnsemblGenomes-Gn; PputW619_R0071.
DR   EnsemblGenomes-Gn; PputW619_R0072.
DR   EnsemblGenomes-Gn; PputW619_R0073.
DR   EnsemblGenomes-Gn; PputW619_R0074.
DR   EnsemblGenomes-Gn; PputW619_R0075.
DR   EnsemblGenomes-Gn; PputW619_R0076.
DR   EnsemblGenomes-Gn; PputW619_R0077.
DR   EnsemblGenomes-Gn; PputW619_R0078.
DR   EnsemblGenomes-Gn; PputW619_R0079.
DR   EnsemblGenomes-Gn; PputW619_R0080.
DR   EnsemblGenomes-Gn; PputW619_R0081.
DR   EnsemblGenomes-Gn; PputW619_R0082.
DR   EnsemblGenomes-Gn; PputW619_R0083.
DR   EnsemblGenomes-Gn; PputW619_R0084.
DR   EnsemblGenomes-Gn; PputW619_R0085.
DR   EnsemblGenomes-Gn; PputW619_R0086.
DR   EnsemblGenomes-Gn; PputW619_R0087.
DR   EnsemblGenomes-Gn; PputW619_R0088.
DR   EnsemblGenomes-Gn; PputW619_R0089.
DR   EnsemblGenomes-Gn; PputW619_R0090.
DR   EnsemblGenomes-Gn; PputW619_R0091.
DR   EnsemblGenomes-Gn; PputW619_R0092.
DR   EnsemblGenomes-Gn; PputW619_R0094.
DR   EnsemblGenomes-Gn; PputW619_R0095.
DR   EnsemblGenomes-Gn; PputW619_R0096.
DR   EnsemblGenomes-Gn; PputW619_R0097.
DR   EnsemblGenomes-Gn; PputW619_R0098.
DR   EnsemblGenomes-Gn; PputW619_R0099.
DR   EnsemblGenomes-Gn; PputW619_R0100.
DR   EnsemblGenomes-Gn; PputW619_R0101.
DR   EnsemblGenomes-Gn; PputW619_R0102.
DR   EnsemblGenomes-Tr; EBT00001610774.
DR   EnsemblGenomes-Tr; EBT00001610775.
DR   EnsemblGenomes-Tr; EBT00001610776.
DR   EnsemblGenomes-Tr; EBT00001610777.
DR   EnsemblGenomes-Tr; EBT00001610778.
DR   EnsemblGenomes-Tr; EBT00001610779.
DR   EnsemblGenomes-Tr; EBT00001610780.
DR   EnsemblGenomes-Tr; EBT00001610781.
DR   EnsemblGenomes-Tr; EBT00001610782.
DR   EnsemblGenomes-Tr; EBT00001610783.
DR   EnsemblGenomes-Tr; EBT00001610784.
DR   EnsemblGenomes-Tr; EBT00001610785.
DR   EnsemblGenomes-Tr; EBT00001610786.
DR   EnsemblGenomes-Tr; EBT00001610787.
DR   EnsemblGenomes-Tr; EBT00001610788.
DR   EnsemblGenomes-Tr; EBT00001610789.
DR   EnsemblGenomes-Tr; EBT00001610790.
DR   EnsemblGenomes-Tr; EBT00001610791.
DR   EnsemblGenomes-Tr; EBT00001610792.
DR   EnsemblGenomes-Tr; EBT00001610793.
DR   EnsemblGenomes-Tr; EBT00001610794.
DR   EnsemblGenomes-Tr; EBT00001610795.
DR   EnsemblGenomes-Tr; EBT00001610796.
DR   EnsemblGenomes-Tr; EBT00001610797.
DR   EnsemblGenomes-Tr; EBT00001610798.
DR   EnsemblGenomes-Tr; EBT00001610799.
DR   EnsemblGenomes-Tr; EBT00001610800.
DR   EnsemblGenomes-Tr; EBT00001610801.
DR   EnsemblGenomes-Tr; EBT00001610802.
DR   EnsemblGenomes-Tr; EBT00001610803.
DR   EnsemblGenomes-Tr; EBT00001610804.
DR   EnsemblGenomes-Tr; EBT00001610805.
DR   EnsemblGenomes-Tr; EBT00001610806.
DR   EnsemblGenomes-Tr; EBT00001610807.
DR   EnsemblGenomes-Tr; EBT00001610808.
DR   EnsemblGenomes-Tr; EBT00001610809.
DR   EnsemblGenomes-Tr; EBT00001610810.
DR   EnsemblGenomes-Tr; EBT00001610811.
DR   EnsemblGenomes-Tr; EBT00001610812.
DR   EnsemblGenomes-Tr; EBT00001610813.
DR   EnsemblGenomes-Tr; EBT00001610814.
DR   EnsemblGenomes-Tr; EBT00001610815.
DR   EnsemblGenomes-Tr; EBT00001610816.
DR   EnsemblGenomes-Tr; EBT00001610817.
DR   EnsemblGenomes-Tr; EBT00001610818.
DR   EnsemblGenomes-Tr; EBT00001610819.
DR   EnsemblGenomes-Tr; EBT00001610820.
DR   EnsemblGenomes-Tr; EBT00001610821.
DR   EnsemblGenomes-Tr; EBT00001610822.
DR   EnsemblGenomes-Tr; EBT00001610823.
DR   EnsemblGenomes-Tr; EBT00001610824.
DR   EnsemblGenomes-Tr; EBT00001610825.
DR   EnsemblGenomes-Tr; EBT00001610826.
DR   EnsemblGenomes-Tr; EBT00001610827.
DR   EnsemblGenomes-Tr; EBT00001610828.
DR   EnsemblGenomes-Tr; EBT00001610829.
DR   EnsemblGenomes-Tr; EBT00001610830.
DR   EnsemblGenomes-Tr; EBT00001610831.
DR   EnsemblGenomes-Tr; EBT00001610832.
DR   EnsemblGenomes-Tr; EBT00001610833.
DR   EnsemblGenomes-Tr; EBT00001610834.
DR   EnsemblGenomes-Tr; EBT00001610835.
DR   EnsemblGenomes-Tr; EBT00001610836.
DR   EnsemblGenomes-Tr; EBT00001610837.
DR   EnsemblGenomes-Tr; EBT00001610838.
DR   EnsemblGenomes-Tr; EBT00001610839.
DR   EnsemblGenomes-Tr; EBT00001610840.
DR   EnsemblGenomes-Tr; EBT00001610841.
DR   EnsemblGenomes-Tr; EBT00001610842.
DR   EnsemblGenomes-Tr; EBT00001610843.
DR   EnsemblGenomes-Tr; EBT00001610844.
DR   EnsemblGenomes-Tr; EBT00001610845.
DR   EnsemblGenomes-Tr; EBT00001610846.
DR   EnsemblGenomes-Tr; EBT00001610847.
DR   EnsemblGenomes-Tr; EBT00001610848.
DR   EnsemblGenomes-Tr; EBT00001610849.
DR   EnsemblGenomes-Tr; EBT00001610850.
DR   EnsemblGenomes-Tr; EBT00001610851.
DR   EnsemblGenomes-Tr; EBT00001610852.
DR   EnsemblGenomes-Tr; EBT00001610853.
DR   EnsemblGenomes-Tr; EBT00001610854.
DR   EnsemblGenomes-Tr; EBT00001610855.
DR   EnsemblGenomes-Tr; EBT00001610856.
DR   EnsemblGenomes-Tr; EBT00001610857.
DR   EnsemblGenomes-Tr; EBT00001610858.
DR   EnsemblGenomes-Tr; EBT00001610859.
DR   EnsemblGenomes-Tr; EBT00001610860.
DR   EnsemblGenomes-Tr; EBT00001610861.
DR   EnsemblGenomes-Tr; EBT00001610862.
DR   EnsemblGenomes-Tr; EBT00001610863.
DR   EnsemblGenomes-Tr; EBT00001610864.
DR   EnsemblGenomes-Tr; EBT00001610865.
DR   EnsemblGenomes-Tr; EBT00001610866.
DR   EnsemblGenomes-Tr; EBT00001610867.
DR   EnsemblGenomes-Tr; EBT00001610868.
DR   EnsemblGenomes-Tr; EBT00001610869.
DR   EnsemblGenomes-Tr; EBT00001610870.
DR   EnsemblGenomes-Tr; EBT00001610871.
DR   EnsemblGenomes-Tr; EBT00001610872.
DR   EnsemblGenomes-Tr; EBT00001610873.
DR   EnsemblGenomes-Tr; EBT00001610874.
DR   EnsemblGenomes-Tr; EBT00001610875.
DR   EnsemblGenomes-Tr; EBT00001610876.
DR   EnsemblGenomes-Tr; EBT00001610877.
DR   EnsemblGenomes-Tr; EBT00001610878.
DR   EnsemblGenomes-Tr; EBT00001610879.
DR   EnsemblGenomes-Tr; EBT00001610880.
DR   EnsemblGenomes-Tr; EBT00001610881.
DR   EnsemblGenomes-Tr; EBT00001610882.
DR   EnsemblGenomes-Tr; EBT00001610883.
DR   EnsemblGenomes-Tr; EBT00001610884.
DR   EnsemblGenomes-Tr; EBT00001610885.
DR   EnsemblGenomes-Tr; EBT00001610886.
DR   EnsemblGenomes-Tr; EBT00001610887.
DR   EnsemblGenomes-Tr; EBT00001610888.
DR   EnsemblGenomes-Tr; EBT00001610889.
DR   EnsemblGenomes-Tr; EBT00001610890.
DR   EnsemblGenomes-Tr; EBT00001610891.
DR   EnsemblGenomes-Tr; EBT00001610892.
DR   EnsemblGenomes-Tr; EBT00001610893.
DR   EnsemblGenomes-Tr; EBT00001610894.
DR   EnsemblGenomes-Tr; EBT00001610895.
DR   EnsemblGenomes-Tr; EBT00001610896.
DR   EnsemblGenomes-Tr; EBT00001610899.
DR   EnsemblGenomes-Tr; EBT00001610901.
DR   EnsemblGenomes-Tr; EBT00001610903.
DR   EnsemblGenomes-Tr; EBT00001610907.
DR   EnsemblGenomes-Tr; EBT00001610910.
DR   EnsemblGenomes-Tr; EBT00001610913.
DR   EnsemblGenomes-Tr; EBT00001610916.
DR   EnsemblGenomes-Tr; EBT00001610920.
DR   EnsemblGenomes-Tr; EBT00001610923.
DR   EnsemblGenomes-Tr; EBT00001610926.
DR   EnsemblGenomes-Tr; EBT00001610930.
DR   EnsemblGenomes-Tr; EBT00001610933.
DR   EnsemblGenomes-Tr; EBT00001610936.
DR   EnsemblGenomes-Tr; EBT00001610938.
DR   EnsemblGenomes-Tr; EBT00001610942.
DR   EnsemblGenomes-Tr; EBT00001610944.
DR   EnsemblGenomes-Tr; EBT00001610946.
DR   EnsemblGenomes-Tr; EBT00001610948.
DR   EnsemblGenomes-Tr; EBT00001610951.
DR   EnsemblGenomes-Tr; EBT00001610954.
DR   EnsemblGenomes-Tr; EBT00001610958.
DR   EnsemblGenomes-Tr; EBT00001610962.
DR   EnsemblGenomes-Tr; EBT00001610964.
DR   EnsemblGenomes-Tr; EBT00001610967.
DR   EnsemblGenomes-Tr; EBT00001610968.
DR   EnsemblGenomes-Tr; EBT00001610971.
DR   EnsemblGenomes-Tr; EBT00001610974.
DR   EnsemblGenomes-Tr; EBT00001610979.
DR   EnsemblGenomes-Tr; EBT00001610982.
DR   EnsemblGenomes-Tr; EBT00001610985.
DR   EnsemblGenomes-Tr; EBT00001610987.
DR   EnsemblGenomes-Tr; EBT00001610988.
DR   EnsemblGenomes-Tr; EBT00001610989.
DR   EnsemblGenomes-Tr; EBT00001610990.
DR   EnsemblGenomes-Tr; EBT00001610991.
DR   EnsemblGenomes-Tr; EBT00001610992.
DR   EnsemblGenomes-Tr; EBT00001610993.
DR   EnsemblGenomes-Tr; EBT00001610994.
DR   EnsemblGenomes-Tr; EBT00001610995.
DR   EnsemblGenomes-Tr; EBT00001610996.
DR   EnsemblGenomes-Tr; EBT00001610997.
DR   EnsemblGenomes-Tr; EBT00001610998.
DR   EnsemblGenomes-Tr; EBT00001610999.
DR   EnsemblGenomes-Tr; EBT00001611000.
DR   EnsemblGenomes-Tr; EBT00001611001.
DR   EnsemblGenomes-Tr; EBT00001611002.
DR   EnsemblGenomes-Tr; EBT00001611003.
DR   EnsemblGenomes-Tr; PputW619_R0001-1.
DR   EnsemblGenomes-Tr; PputW619_R0002-1.
DR   EnsemblGenomes-Tr; PputW619_R0003-1.
DR   EnsemblGenomes-Tr; PputW619_R0004-1.
DR   EnsemblGenomes-Tr; PputW619_R0005-1.
DR   EnsemblGenomes-Tr; PputW619_R0006-1.
DR   EnsemblGenomes-Tr; PputW619_R0007-1.
DR   EnsemblGenomes-Tr; PputW619_R0008-1.
DR   EnsemblGenomes-Tr; PputW619_R0009-1.
DR   EnsemblGenomes-Tr; PputW619_R0010-1.
DR   EnsemblGenomes-Tr; PputW619_R0011-1.
DR   EnsemblGenomes-Tr; PputW619_R0012-1.
DR   EnsemblGenomes-Tr; PputW619_R0013-1.
DR   EnsemblGenomes-Tr; PputW619_R0014-1.
DR   EnsemblGenomes-Tr; PputW619_R0015-1.
DR   EnsemblGenomes-Tr; PputW619_R0016-1.
DR   EnsemblGenomes-Tr; PputW619_R0017-1.
DR   EnsemblGenomes-Tr; PputW619_R0018-1.
DR   EnsemblGenomes-Tr; PputW619_R0019-1.
DR   EnsemblGenomes-Tr; PputW619_R0020-1.
DR   EnsemblGenomes-Tr; PputW619_R0021-1.
DR   EnsemblGenomes-Tr; PputW619_R0022-1.
DR   EnsemblGenomes-Tr; PputW619_R0023-1.
DR   EnsemblGenomes-Tr; PputW619_R0024-1.
DR   EnsemblGenomes-Tr; PputW619_R0025-1.
DR   EnsemblGenomes-Tr; PputW619_R0026-1.
DR   EnsemblGenomes-Tr; PputW619_R0027-1.
DR   EnsemblGenomes-Tr; PputW619_R0028-1.
DR   EnsemblGenomes-Tr; PputW619_R0029-1.
DR   EnsemblGenomes-Tr; PputW619_R0030-1.
DR   EnsemblGenomes-Tr; PputW619_R0031-1.
DR   EnsemblGenomes-Tr; PputW619_R0032-1.
DR   EnsemblGenomes-Tr; PputW619_R0033-1.
DR   EnsemblGenomes-Tr; PputW619_R0034-1.
DR   EnsemblGenomes-Tr; PputW619_R0035-1.
DR   EnsemblGenomes-Tr; PputW619_R0036-1.
DR   EnsemblGenomes-Tr; PputW619_R0037-1.
DR   EnsemblGenomes-Tr; PputW619_R0038-1.
DR   EnsemblGenomes-Tr; PputW619_R0039-1.
DR   EnsemblGenomes-Tr; PputW619_R0040-1.
DR   EnsemblGenomes-Tr; PputW619_R0041-1.
DR   EnsemblGenomes-Tr; PputW619_R0042-1.
DR   EnsemblGenomes-Tr; PputW619_R0043-1.
DR   EnsemblGenomes-Tr; PputW619_R0044-1.
DR   EnsemblGenomes-Tr; PputW619_R0045-1.
DR   EnsemblGenomes-Tr; PputW619_R0046-1.
DR   EnsemblGenomes-Tr; PputW619_R0047-1.
DR   EnsemblGenomes-Tr; PputW619_R0048-1.
DR   EnsemblGenomes-Tr; PputW619_R0049-1.
DR   EnsemblGenomes-Tr; PputW619_R0050-1.
DR   EnsemblGenomes-Tr; PputW619_R0051-1.
DR   EnsemblGenomes-Tr; PputW619_R0052-1.
DR   EnsemblGenomes-Tr; PputW619_R0053-1.
DR   EnsemblGenomes-Tr; PputW619_R0054-1.
DR   EnsemblGenomes-Tr; PputW619_R0055-1.
DR   EnsemblGenomes-Tr; PputW619_R0056-1.
DR   EnsemblGenomes-Tr; PputW619_R0058-1.
DR   EnsemblGenomes-Tr; PputW619_R0059-1.
DR   EnsemblGenomes-Tr; PputW619_R0060-1.
DR   EnsemblGenomes-Tr; PputW619_R0061-1.
DR   EnsemblGenomes-Tr; PputW619_R0062-1.
DR   EnsemblGenomes-Tr; PputW619_R0063-1.
DR   EnsemblGenomes-Tr; PputW619_R0064-1.
DR   EnsemblGenomes-Tr; PputW619_R0065-1.
DR   EnsemblGenomes-Tr; PputW619_R0066-1.
DR   EnsemblGenomes-Tr; PputW619_R0067-1.
DR   EnsemblGenomes-Tr; PputW619_R0068-1.
DR   EnsemblGenomes-Tr; PputW619_R0069-1.
DR   EnsemblGenomes-Tr; PputW619_R0070-1.
DR   EnsemblGenomes-Tr; PputW619_R0071-1.
DR   EnsemblGenomes-Tr; PputW619_R0072-1.
DR   EnsemblGenomes-Tr; PputW619_R0073-1.
DR   EnsemblGenomes-Tr; PputW619_R0074-1.
DR   EnsemblGenomes-Tr; PputW619_R0075-1.
DR   EnsemblGenomes-Tr; PputW619_R0076-1.
DR   EnsemblGenomes-Tr; PputW619_R0077-1.
DR   EnsemblGenomes-Tr; PputW619_R0078-1.
DR   EnsemblGenomes-Tr; PputW619_R0079-1.
DR   EnsemblGenomes-Tr; PputW619_R0080-1.
DR   EnsemblGenomes-Tr; PputW619_R0081-1.
DR   EnsemblGenomes-Tr; PputW619_R0082-1.
DR   EnsemblGenomes-Tr; PputW619_R0083-1.
DR   EnsemblGenomes-Tr; PputW619_R0084-1.
DR   EnsemblGenomes-Tr; PputW619_R0085-1.
DR   EnsemblGenomes-Tr; PputW619_R0086-1.
DR   EnsemblGenomes-Tr; PputW619_R0087-1.
DR   EnsemblGenomes-Tr; PputW619_R0088-1.
DR   EnsemblGenomes-Tr; PputW619_R0089-1.
DR   EnsemblGenomes-Tr; PputW619_R0090-1.
DR   EnsemblGenomes-Tr; PputW619_R0091-1.
DR   EnsemblGenomes-Tr; PputW619_R0092-1.
DR   EnsemblGenomes-Tr; PputW619_R0094-1.
DR   EnsemblGenomes-Tr; PputW619_R0095-1.
DR   EnsemblGenomes-Tr; PputW619_R0096-1.
DR   EnsemblGenomes-Tr; PputW619_R0097-1.
DR   EnsemblGenomes-Tr; PputW619_R0098-1.
DR   EnsemblGenomes-Tr; PputW619_R0099-1.
DR   EnsemblGenomes-Tr; PputW619_R0100-1.
DR   EnsemblGenomes-Tr; PputW619_R0101-1.
DR   EnsemblGenomes-Tr; PputW619_R0102-1.
DR   EuropePMC; PMC2830310; 20031220.
DR   EuropePMC; PMC3194850; 21856827.
DR   EuropePMC; PMC3275731; 21811795.
DR   EuropePMC; PMC3790839; 24124510.
DR   EuropePMC; PMC3894933; 24465371.
DR   EuropePMC; PMC5099816; 27877169.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00166; PrrB_RsmZ.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00195; RsmY.
DR   RFAM; RF00444; PrrF.
DR   RFAM; RF00623; P1.
DR   RFAM; RF00624; P9.
DR   RFAM; RF00627; P15.
DR   RFAM; RF00628; P16.
DR   RFAM; RF00629; P24.
DR   RFAM; RF00630; P26.
DR   RFAM; RF01057; SAH_riboswitch.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01669; P14.
DR   RFAM; RF01671; P18.
DR   RFAM; RF01673; P20.
DR   RFAM; RF01674; P27.
DR   RFAM; RF01675; CrcZ.
DR   RFAM; RF01676; P31.
DR   RFAM; RF01683; P6.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01719; Pseudomon-1.
DR   RFAM; RF01720; Pseudomon-Rho.
DR   RFAM; RF01721; Pseudomon-groES.
DR   RFAM; RF01738; gabT.
DR   RFAM; RF01740; gyrA.
DR   RFAM; RF01754; radC.
DR   RFAM; RF01755; rmf.
DR   RFAM; RF01756; rne-II.
DR   RFAM; RF01758; sucA-II.
DR   RFAM; RF01759; sucC.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01772; rnk_pseudo.
DR   RFAM; RF01773; rpsL_psuedo.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF02012; group-II-D1D4-7.
DR   RFAM; RF02243; Xoo8.
DR   SILVA-LSU; CP000949.
DR   SILVA-SSU; CP000949.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4002720
CC   Source DNA and Bacteria available from Daniel van der Lelie
CC   (vdlelied@bnl.gov) and Safiyh Taghavi(taghavis@bnl.gov)
CC   Contacts: Daniel van der Lelie (vdlelied@bnl.gov)
CC             Safiyh Taghavi (taghavis@bnl.gov)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfmpageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5774330
FT                   /organism="Pseudomonas putida W619"
FT                   /strain="W619"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:390235"
FT   gene            386..1921
FT                   /locus_tag="PputW619_0001"
FT   CDS_pept        386..1921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: pen:PSEEN0001 chromosomal replication
FT                   initiator protein DnaA; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA domain; Chromosomal replication initiator
FT                   DnaA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70507"
FT                   /db_xref="GOA:B1J3Y2"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1J3Y2"
FT                   /protein_id="ACA70507.1"
FT                   /translation="MSVELWQQCVELLRDELPAQQFNTWIRPLQVEAEGDELRVYAPNR
FT                   FVLDWVNEKYLGRLLELLGENGSGIAPALSLLIGSRRSSAPRAAPNAPVSAAMAASLAQ
FT                   THAQPAAAPVMAVADPVSVPTAEPAQASDMAEASSRDSYDSMADSAPAPVAPGRTEQRN
FT                   VQVEGALKHTSYLNRTFTFETFVEGKSNQLARAAAWQVADNPKHGYNPLFLYGGVGLGK
FT                   THLMHAVGNHLLKKNPNAKVVYLHSERFVADMVKALQLNAINEFKRFYRSVDALLIDDI
FT                   QFFARKERSQEEFFHTFNALLEGGQQVILTSDRYPKEIEGLEERLKSRFGWGLTVAVEP
FT                   PELETRVAILMKKADQAKVELPHDAAFFIAQRIRSNVRELEGALKRVIAHSHFMGRDIT
FT                   IELIRESLKDLLALQDKLVSVDNIQRTVAEYYKIKISDLLSKRRSRSVARPRQVAMALS
FT                   KELTNHSLPEIGDMFGGRDHTTVLHACRKINELKESDADIREDYKNLLRTLTT"
FT   gene            1962..3065
FT                   /locus_tag="PputW619_0002"
FT   CDS_pept        1962..3065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: pen:PSEEN0002 DNA polymerase III, beta chain;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70508"
FT                   /db_xref="GOA:B1J3Y3"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3Y3"
FT                   /protein_id="ACA70508.1"
FT                   /translation="MHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVQGQQLSLT
FT                   GTDLEVELVGRVQLEEPAEPGEITVPARKLMDICKSLPNDVLIDIKVDEQKLLVKAGRS
FT                   RFTLSTLPANDFPTVEEGPGSLTCNLEQSKLRRLIERTSFAMAQQDVRYYLNGMLLEVS
FT                   RNTLRAVSTDGHRLALCSMSAAIEQDERHQVIVPRKGILELARLLTDPEGMVSIVLGQH
FT                   HIRANTGEFTFTSKLVDGKFPDYERVLPKGGDKLVIGDRQALREAFSRTAILSNEKYRG
FT                   IRLQLAAGQLKIQANNPEQEEAEEEISVDYDGASLEIGFNVSYLLDVLGVMTTEQVRLI
FT                   LSDSNSSALLQEAGNDDSSYVVMPMRL"
FT   gene            3081..4184
FT                   /locus_tag="PputW619_0003"
FT   CDS_pept        3081..4184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: pen:PSEEN0003 DNA
FT                   replication, recombinaison and repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70509"
FT                   /db_xref="GOA:B1J3Y4"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1J3Y4"
FT                   /protein_id="ACA70509.1"
FT                   /translation="MSLRRIMVTAVRNLHPVTLSPSPRINILYGANGSGKTSVLEAVHL
FT                   LGLARSFRSTRLNPVIQYEQAACTVFGEVQLSEGGTSNLGVSRERAGDFTIRIDGQNAK
FT                   SAAQLAELLPLQLINPDSFRLLEGAPKIRRQFLDWGVFHVEPRFMPAWQRLQKALRQRN
FT                   SWLRHGTLDPASQAAWDRELCLASAEIDEYRRNYIKALKPVFEQTLSELVELDGLTLSY
FT                   YRGWDKDRELNEVLASSLLRDQQMGHTQAGPQRADLRLRLAANNAADILSRGQQKLVVC
FT                   ALRIAQGHLVSQARRGHCIYLVDDLPSELDDQHRRALCRLLEELRCQVFITCVDHELLR
FT                   EGWQTETPVALFHVEQGRITQTHDHRE"
FT   gene            4189..6609
FT                   /locus_tag="PputW619_0004"
FT   CDS_pept        4189..6609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0004"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.6.2.3"
FT                   /note="KEGG: pen:PSEEN0004 DNA gyrase, subunit B; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: DNA gyrase subunit B domain
FT                   protein; ATP-binding region ATPase domain protein; TOPRIM
FT                   domain protein; DNA topoisomerase type IIA subunit B region
FT                   2 domain protein; SMART: DNA topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70510"
FT                   /db_xref="GOA:B1J3Y5"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3Y5"
FT                   /protein_id="ACA70510.1"
FT                   /translation="MSENQTYDSSSIKVLKGLDAVRKRPGMYIGDTDDGSGLHHMVFEV
FT                   VDNSIDEALAGHCDDITVIIHTDESISVRDNGRGIPVDVHKEEGVSAAEVIMTVLHAGG
FT                   KFDDNSYKVSGGLHGVGVSVVNALSEKLVLTVRRSGKIWEQTYVHGVPQAPMAVVGESE
FT                   TTGTHIHFKPSAETFKNIHFSWDILAKRIRELSFLNSGVGILLKDERSGKEEFFKYEGG
FT                   LRAFVEYLNTNKTPVNSQVFHFNVQREDGVGVEVALQWNDSFNENLLCFTNNIPQRDGG
FT                   THLVGFRSSLTRSLNSYIEQEGLAKKNKVSTTGDDAREGLTAIISVKVPDPKFSSQTKD
FT                   KLVSSEVKTAVEQEMNKYFADFLLENPNEAKAVVGKMIDAARAREAARKAREMTRRKGA
FT                   LDIAGLPGKLADCQEKDPALSELYLVEGDSAGGSAKQGRNRRTQAILPLKGKILNVEKA
FT                   RFDKMISSQEVGTLITALGCGIGREEYNIDKLRYHNIIIMTDADVDGSHIRTLLLTFFF
FT                   RQLPELVERGYIYIAQPPLYKVKKGKQEQYIKDDEAMEEYMTQSALEDASLHLDESAPA
FT                   VSGVQLEVLVNEFRGVMKTLKRLSRLYPEELTEHFIYLPEVTLEQLGDHAVMENWLAKL
FT                   QERLSNSQKSGLMYKATLREDKERNVWLPEVEITSHGLASYITFNRDFFGSNDYRTVVN
FT                   IGSKLASLLGEGAYVQRGERRKAIVEFKEGLDWLMNETTKRHTIQRYKGLGEMNPDQLW
FT                   ETTMDPTVRRMLKVTIEDAIAADQIFNTLMGDAVEPRRDFIESNALSVSNLDF"
FT   gene            7447..8085
FT                   /locus_tag="PputW619_0005"
FT   CDS_pept        7447..8085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0005"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_C6542 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70511"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3Y6"
FT                   /protein_id="ACA70511.1"
FT                   /translation="MTVRKVVTRRSNHYRGYFPSLKNKKPVPWESQLEGALFRLLELSP
FT                   AVIGYVPQPSEERVPSLQGYFKYYPDVQVFLADGREWWFEVKPHDRLKIASVRQRLDAA
FT                   ERYFNATARNFSVITEKLIEAEPLATNLRRLMYHRRGPELSHQALEEVMATFNEWPPMT
FT                   VADLLYVVGEGKAWRLLGLGVVGIDLDRSIDTDSPVFLQGGHRHANLFP"
FT   gene            8066..10024
FT                   /locus_tag="PputW619_0006"
FT   CDS_pept        8066..10024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0006"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   bur:Bcep18194_C6543 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70512"
FT                   /db_xref="GOA:B1J3Y7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3Y7"
FT                   /protein_id="ACA70512.1"
FT                   /translation="MQTFSLRVKLVVIVRGVLMVLEKRLIDRKLLFFDELGEPTKLSEK
FT                   EFYEAYEKREIEISADQPYLGRVPYVRNVPPDISCFPKKHGDEALRRRKYLDDLTKRGK
FT                   YKLPGDEDMIKKLRDIAKKIGDACAPSVSTIRRWAAKYIGQNVVKLIPQHAKKGRAAAI
FT                   QGELEVILEGVINKTYLQDTIPAVSVVVSEFEDQIKERNKSRLPSDQLKIPSGMTVRRY
FT                   IAKLDPYLVDKERLGKHAADKKHRVAAGVLRVHEILERWEIDHTLLDVQLVDETSGLCI
FT                   GRPYLTIVLDRFSRMVMGYLLHLSAPNTETVLRVIERSIRPKAELLKRFPKVRNEWWAR
FT                   GLPARIVPDNAAEFHAGDLIMGFNELGIEIMYPASRAPQRKGAVERFFSTQNLGLIHNL
FT                   PGTTFSNIQQRGDYDSEKNACFTLPQLEAVVVKWIVDGYHQTPHRGLDNRTPAQVWGTS
FT                   EANHVISLPVDLDSLECILAKRASVKVHHYGIEVAKVGYHSTELAELRMRLADGEKVNV
FT                   RYRDEAGHVWVHDRFRNLFFKVPAKDERMAGKSREVWKAAEKALREKYNEQPSFEATHR
FT                   CYQEIMEDADEARRSQTLRKRRAAAIAKIDKEGRVTESTPPPKVLAEVEWTGDSIPNIP
FT                   PAAFKVSVRRPAGSSKP"
FT   gene            10021..10980
FT                   /locus_tag="PputW619_0007"
FT   CDS_pept        10021..10980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0007"
FT                   /product="AAA ATPase"
FT                   /note="SMART: AAA ATPase; KEGG: bur:Bcep18194_C6544
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70513"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008868"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3Y8"
FT                   /protein_id="ACA70513.1"
FT                   /translation="MNAINLYECYEHGEYSFTLRDRFIHSPQVERALTRLGDIHGDSRR
FT                   TRASKGLLIQGPSGVGKSTLVKEYIRSLEELESHDPQKRTVLFVEMPSSPTKKNLAAAI
FT                   LAELKDPFAEARGHSAEVKFARVVLLLKNLGVEMLVLDEAQHLVDYRRNGAYEAADWIK
FT                   SLMNETSIAFVLIGLKRTENLLLANEQLRRRFSATVAYDRFTFSANTSLHFVMLLQAIE
FT                   GELPVQTISFVEPAMIKRFYLASYGLIDYLIKIVDRAVWLVQVQDLVGIELPVLAQAFE
FT                   DEVWSYATEDRNPFSASFNFQPLFGKREPFETFEESST"
FT   gene            11056..12972
FT                   /locus_tag="PputW619_0008"
FT   CDS_pept        11056..12972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0008"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pst:PSPTO_0030 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70514"
FT                   /db_xref="InterPro:IPR009492"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3Y9"
FT                   /protein_id="ACA70514.1"
FT                   /translation="MFGLLINPRPHQDESLLGYLQRLAKANGLPRKELLTAFARADETD
FT                   VADWLQMMEGPLSWPAVSAEFRDPRPKGVKLWTTHHARYCPICLGEAGYWRESWGLTLV
FT                   TTCSVHGTELHGRCPNCLKETDPSAMSANSCQACGTSLSGTNFEIAPASDTAAWLTSGF
FT                   EDRFYADSLPADAGLAALTYEQFHELSSRLAVRSLPTERTQPLKVADSGSLEISRLMAN
FT                   AAGVVLMNWPLAFRELLSGLKAVHSDNEHWTLSRSFGPIYHDIHRDLDDSCFDFLRREF
FT                   ESFLQHAWEAPLAKRNRNLSEETIERHRWVSFDSAAEACGLGVSVIKRLHQEGQIAYRE
FT                   KVHEDRVFTVVDLDHLKAISQHLQGVADMKETSTLLSLCRNRVRQLLAGGTLQFFGGEP
FT                   RPGERWLIDCRSINELIDEKLPTSSDQSLVSINYLAKHSLPKGGGLVELVQAIRAGELR
FT                   AYGPAENGSVAVGAWLLKPQDFAAWQQARAENKSPVFPGLSVVKAAALLGVKEQCAYAF
FT                   VRLGLLWSTAVERGRRTQLMVKPQAIDRFRRGYILGPEIAVYLGKSTREAFKHLWEARF
FT                   RPVAGPSIPNAACRQYVWVRSKKLIDYLASEAAQIDDPEAITFLSTPIAQPRDCRFRHV
FT                   GSR"
FT   gene            13029..13388
FT                   /locus_tag="PputW619_0009"
FT   CDS_pept        13029..13388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0009"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pst:PSPTO_4755 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70515"
FT                   /db_xref="InterPro:IPR035616"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3Z0"
FT                   /protein_id="ACA70515.1"
FT                   /translation="MSRLAEFRLLEQQLAAQLAELEALKNDSALKQEMEFETKLRSLLN
FT                   EYGYGLRQVVLILDPQAVASTDMAPKTSRKPREVKVYKNPHSGEVVETKGGNQRTLKAW
FT                   KNEYGAEVVESWLAN"
FT   gene            13760..14092
FT                   /locus_tag="PputW619_0010"
FT   CDS_pept        13760..14092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0010"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pmy:Pmen_2213 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70516"
FT                   /db_xref="InterPro:IPR021245"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3Z1"
FT                   /protein_id="ACA70516.1"
FT                   /translation="MNTAKSIAALMLVIASSSALAEGGSDRLHGKMIQANEQAMRAYAA
FT                   ANGKKPPEVIHYRYGMKLDVARVISMTSLKGSCDVMPTQMNYEDSTGELKILEYRSAGI
FT                   NCRGQN"
FT   sig_peptide     13760..13825
FT                   /locus_tag="PputW619_0010"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            complement(14190..14645)
FT                   /locus_tag="PputW619_0011"
FT   CDS_pept        complement(14190..14645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0011"
FT                   /product="protein of unknown function DUF411"
FT                   /note="PFAM: protein of unknown function DUF411; KEGG:
FT                   pmy:Pmen_2215 protein of unknown function DUF411"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70517"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR007332"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3Z2"
FT                   /protein_id="ACA70517.1"
FT                   /translation="MTSKRRFLGLSTAASLLIASAAFAAEPLTIDVHRDANCGCCKKWI
FT                   AHLEANGFKVVDHVETDMRAVKQELGVAPRLASCHTAVIDGKFVEGHVPAAQVQELIKR
FT                   NDLAGVAVPGMPAGSPGMEVDGMKHAYQVIGLTKSGDDQVVASYPDT"
FT   sig_peptide     complement(14571..14645)
FT                   /locus_tag="PputW619_0011"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            complement(14635..15414)
FT                   /locus_tag="PputW619_0012"
FT   CDS_pept        complement(14635..15414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0012"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pmy:Pmen_2216 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70518"
FT                   /db_xref="GOA:B1J3Z3"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3Z3"
FT                   /protein_id="ACA70518.1"
FT                   /translation="MKKTITTLVAAGAVTSAAVLGAAYFGLVNVGADDPHFPAVHAFLA
FT                   MARDRSIEVRASDIEVPNLKDPALIQAGAGNYNAMCIGCHLAPGVEKTELSQALYPSPP
FT                   NLTEIGVSGDPAAAFWTIKHGIKATGMPAWGKSMDDQYIWGIVAFLDQLPQLNAEQYQM
FT                   MVASSGGHQHGGGESDMHNHEGQHGGAKSGHGNHDDSAANGVAEESHDHGSSHSESSSV
FT                   AEHHGEHESGEAHSDHHTGSTPKTHVHKDGKEHTHDK"
FT   sig_peptide     complement(15349..15414)
FT                   /locus_tag="PputW619_0012"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.647 at
FT                   residue 22"
FT   gene            complement(15424..16539)
FT                   /locus_tag="PputW619_0013"
FT   CDS_pept        complement(15424..16539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0013"
FT                   /product="copper resistance B precursor"
FT                   /note="PFAM: copper resistance B precursor; KEGG:
FT                   pmy:Pmen_2217 copper resistance B precursor"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70519"
FT                   /db_xref="GOA:B1J3Z4"
FT                   /db_xref="InterPro:IPR007939"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3Z4"
FT                   /protein_id="ACA70519.1"
FT                   /translation="MANSVARPSLLAFAVSLGVLGVSPSFAAEMDHSGMDHSAMGHGAM
FT                   QMDHASSQAAMPGMDHSQMGASKQPTQPAPVDHSKMGHGQPKAKPASMDHSKMDHGSMK
FT                   GMDHGSMEGMDHGAMGHSTMGNGNADSPTPTSRTPIPVLTDADRQAAFPPLDGHKMDDS
FT                   GFNSFFLLDQLEYQDADEGSTLAWDASGWVGGDINRLWIRSEGERTNGVTEDAELQLLY
FT                   GRSVSPWWDVVAGVRQDFKPEDPQTWAAFGIQGLALYDFEAEATAFIGENGQTAARLEG
FT                   EYDILLTNRLILQPTAEANFYGKNDPERGVGSGLANTEVGLRLRYEIVRQFAPYIGVTW
FT                   SRSYGKTADFIRDEGGDVDEARFVAGIRMWF"
FT   sig_peptide     complement(16456..16539)
FT                   /locus_tag="PputW619_0013"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 28"
FT   gene            complement(16529..16870)
FT                   /locus_tag="PputW619_0014"
FT   CDS_pept        complement(16529..16870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0014"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: psa:PST_3382 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70520"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3Z5"
FT                   /protein_id="ACA70520.1"
FT                   /translation="MNWRYEMSKPMKRSAFFLSAAMVGLLAVYAPSSWSSDNHDQHSQK
FT                   SSNAAQSNGSKSKQAQGMNHEGMDHGSMKGMDHGSMEGMDHGSMEGMDHSKMMESHGSD
FT                   KAKAGKNGQ"
FT   sig_peptide     complement(16763..16870)
FT                   /locus_tag="PputW619_0014"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 36"
FT   gene            complement(16867..18825)
FT                   /locus_tag="PputW619_0015"
FT   CDS_pept        complement(16867..18825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0015"
FT                   /product="copper-resistance protein, CopA family"
FT                   /note="TIGRFAM: copper-resistance protein, CopA family;
FT                   PFAM: multicopper oxidase type 1; multicopper oxidase type
FT                   2; multicopper oxidase type 3; KEGG: pmy:Pmen_2219
FT                   copper-resistance protein, CopA family"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70521"
FT                   /db_xref="GOA:B1J3U7"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006376"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR033138"
FT                   /db_xref="InterPro:IPR034279"
FT                   /db_xref="InterPro:IPR034282"
FT                   /db_xref="InterPro:IPR034284"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3U7"
FT                   /protein_id="ACA70521.1"
FT                   /translation="MQSKTTRRSFVKGLAATGLLGGLGMWRAPVWAVTSPGQPNVLTGT
FT                   DFDLYIGELPVNITGAARTAMAINGSLPGPILRWREGDTVTLRVRNRLKQDTSIHWHGI
FT                   ILPANMDGVPGLSFHGIAPDGMYEYKFKVHQNGTYWYHSHSGFQEQVGVYGALVIDAKD
FT                   PEPFTYDRDYVVMLSDWTDEDPARVMSKLKKQSDYYNFHKRTVGDFVDDVSEKGWSAAV
FT                   ADRKMWAEMKMSPTDLADVSGHTYTYLMNGQAPNGNWTGIFKPGEKIRLRFINGSAMTY
FT                   FDVRIPGLKMTVVAADGQYVKPVSIDEFRIAVAETYDVIVEPENEQAYTIFAQSMDRTG
FT                   YSRGTLAVREGLQAPVPAVDPRPLISMSDMGMDHGSMGGMDHGSMAGMDHSKMAGMDHG
FT                   SMAGMDHSKMAGMDHGSMAGMDHSKMAGMDHGSMAGMDHSKMAGMDHGSMAGMDHSKMA
FT                   GMDHGNMTGMDQSNMAASGAMQNHPASETNNPLVDMQTMTPTPKLSDPGIGLRDNGRRV
FT                   LTYSDLRSTFIDPDGREPGRTIELHLTGHMEKFAWSFDGIKFSDAEPLRLKYGERLRIT
FT                   LVNDTMMTHPIHLHGMWSDLEDEDGNFMVRKHTIDMPPGSKRSYRVTADALGRWAYHCH
FT                   LMYHMEMGMFREVRVDE"
FT   sig_peptide     complement(18727..18825)
FT                   /locus_tag="PputW619_0015"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 33"
FT   gene            complement(19008..19214)
FT                   /locus_tag="PputW619_0016"
FT   CDS_pept        complement(19008..19214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0016"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pmy:Pmen_2220 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70522"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3U8"
FT                   /protein_id="ACA70522.1"
FT                   /translation="MNMIKAIVMVVTFGMASLALAEGGADRTFARMEAARASSMQAYQV
FT                   AQEKKAEAPVTAQSQKHPGHESC"
FT   sig_peptide     complement(19149..19214)
FT                   /locus_tag="PputW619_0016"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 22"
FT   gene            19381..20058
FT                   /locus_tag="PputW619_0017"
FT   CDS_pept        19381..20058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0017"
FT                   /product="two component heavy metal response
FT                   transcriptional regulator, winged helix family"
FT                   /note="TIGRFAM: heavy metal response regulator; PFAM:
FT                   response regulator receiver; transcriptional regulator
FT                   domain protein; KEGG: psa:PST_3390 transcriptional
FT                   activator CopR"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70523"
FT                   /db_xref="GOA:B1J3U9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR006291"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3U9"
FT                   /protein_id="ACA70523.1"
FT                   /translation="MKLLVAEDEPKIGAYLQQGLTEAGFTVDRVVTGTDALQYALSEAY
FT                   DLLILDVMMPGLDGWEVLRMVRAAGKEVPVLFLTARDGVDDRVKGLELGADDYLVKPFA
FT                   FSELLARVRTLLRRGSSGYAQTTMKMADLEVDLLKRRATRNGKRIDLTAKEFSLLELLM
FT                   RRRGEVLPKSLIASQVWDMNFDSDTNVIEVAVRRLRAKIDDDFAPKLIHTVRGMGYLMD
FT                   VPE"
FT   gene            20058..21464
FT                   /locus_tag="PputW619_0018"
FT   CDS_pept        20058..21464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0018"
FT                   /product="heavy metal sensor signal transduction histidine
FT                   kinase"
FT                   /note="TIGRFAM: heavy metal sensor kinase; PFAM:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   HAMP region domain protein; histidine kinase A domain
FT                   protein; KEGG: pmy:Pmen_2235 heavy metal sensor signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70524"
FT                   /db_xref="GOA:B1J3V0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006290"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3V0"
FT                   /protein_id="ACA70524.1"
FT                   /translation="MRAQSSLVKRLTLMFMFAVIAVLVVAGVSFYMLSQHHFQMLDEQA
FT                   LAEKLESTRHILSLSAARDELEDQEPQLRALLGAHQDLSAEILDADGTVLFSDSKASRI
FT                   PERFKQASSGAVWDWQIDSRNFRGITSQLAIAQAQAPVTVMLMLDVTSHAHFFKTLQWW
FT                   FGIGLVISALVSAGLGWIVAKSGLRPVGQITKVATSMSARSLRERIPLEPVPLELQELI
FT                   LSFNGMLARLEDAFVRLSNFSADIAHELRTPVSNLLTHTEVVLTKKRDLDAYEDNLYSN
FT                   LEDLKRMSRMIDDMLFLAKADNGLIIPEQVDIDLVGLVSRLIEYYQLAAEDRSIRLALQ
FT                   GEGTIRGDRLMIDRAVSNILSNALRYTPEGHDIAVRIVEAADQVNLSVQNNGATIDPEH
FT                   INKIFDRFYRADPARREGSPSNAGLGLAITRSIIEAHGGRIWCTSADGVTSFHIALPHA
FT                   KQSTSKPQTA"
FT   sig_peptide     20058..20138
FT                   /locus_tag="PputW619_0018"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.913 at
FT                   residue 27"
FT   gene            21564..21848
FT                   /locus_tag="PputW619_0019"
FT   CDS_pept        21564..21848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0019"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pfo:Pfl_2393 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70525"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3V1"
FT                   /protein_id="ACA70525.1"
FT                   /translation="MAGVDSAIEPCPMQTMGMEMMAGMDHDCCQDTDPGSAADHSKACK
FT                   VGQECRTASTVQVEIINPTLTYSAPRPVDTYAVSLVNRAPPDPWRPPRA"
FT   gene            21935..23188
FT                   /locus_tag="PputW619_0020"
FT   CDS_pept        21935..23188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0020"
FT                   /product="outer membrane efflux protein"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   pap:PSPA7_4013 heavy metal RND efflux outer membrane
FT                   protein, CzcC family"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70526"
FT                   /db_xref="GOA:B1J3V2"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3V2"
FT                   /protein_id="ACA70526.1"
FT                   /translation="MTPPRYRLGMACLAALISLLSTLPAQATPLSLEEALQLAERNAPI
FT                   LQARQEQMTAARHAVIPAGELPDPRLNLGVQNLPVDGSDRWSMNRDFMTMQVVGLSQEV
FT                   PNRDKREARVETARASVERADAEAVFERLKVRAATAQAWVAAYTVQRKLQQFEDFYKEN
FT                   RLLAAAIRARLAGGTGATADALAPDQEAAQLDEQKDVLLTQAAQARAALKRWIGEDADP
FT                   QAQAFPRWPVSAPDYLHAIHAHPELATYNALTREAQAQVHQALAEKKSDWGWQVDYQRR
FT                   GPEFSNMVSLQVSFQLPLFAGSRQDPMIAARRAQVRQLEDEQEAALREHKAQLETDLAD
FT                   YQRLQRAVQRSRETLLPLAEDRVRLALADYRAGKSPLSEVLTARRQRVETRLQDIDLQG
FT                   QLAATAARLHFAYGEVRA"
FT   sig_peptide     21935..22018
FT                   /locus_tag="PputW619_0020"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 28"
FT   gene            23185..24651
FT                   /locus_tag="PputW619_0021"
FT   CDS_pept        23185..24651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0021"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; KEGG: pap:PSPA7_4014 heavy metal RND efflux
FT                   membrane fusion protein, CzcB family"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70527"
FT                   /db_xref="GOA:B1J3V3"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR021647"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3V3"
FT                   /protein_id="ACA70527.1"
FT                   /translation="MRNSTISLVVLAALAIGGGVGYQLAKRGQVSTASPETLQKVLYWY
FT                   DPMYPQQHFPAPGKSPFMDMPLVPKYQESTAAEVSPAVQVSQGLQQNLGVRLATVAKGQ
FT                   LARTLQVSGVLTFDERDFSVLQARTGGYVERTYGRATGDVVAKGAPLADVLTPEWAGLQ
FT                   EEYLALQRSGDNELRAAARQRLLLAGMPADLINRIDRTGRVQNSVTLLAPTAGVLQALE
FT                   LRPGMTMTPGATLAKINGIANVWLEAAVPEAQAQGLQEGQAVQANLAAFPGEPVPGKLT
FT                   ALLADADLQSRTLRLRIELPNPGGRLRPGMTAQVSLHPSGQQDDSLLVPAEAIIRTGKR
FT                   DLVMVSEDGGRFRPVEVVLGQESAGQVVVLRGLQAGQRVVASGQFLLDSEASLKGIEAV
FT                   TAGDAPLAQPVQPALHQANGRIVQIEGNQLTIAHGPFVTLGMPGMTMTFPVADPRLIAG
FT                   LKVGERIRFGVRERDEGMVIEQITQQENQP"
FT   sig_peptide     23185..23262
FT                   /locus_tag="PputW619_0021"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.841 at
FT                   residue 26"
FT   gene            24648..27806
FT                   /locus_tag="PputW619_0022"
FT   CDS_pept        24648..27806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0022"
FT                   /product="heavy metal efflux pump, CzcA family"
FT                   /note="TIGRFAM: heavy metal efflux pump, CzcA family; PFAM:
FT                   acriflavin resistance protein; KEGG: pap:PSPA7_4015 heavy
FT                   metal efflux pump, CzcA family"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70528"
FT                   /db_xref="GOA:B1J3V4"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3V4"
FT                   /protein_id="ACA70528.1"
FT                   /translation="MIANLIRWSVGNRVLVLLATLFAVAWGVFSLRSLPIDALPDLSDV
FT                   QVIIRTSYPGQAPQIVENQVTYPLTTTMLSVPGAKTVRGFSAFGDSFVYVLFEDGTDLY
FT                   WARSRVLEYLSQVQSRLPASAKPVLGPDATGVGWIYQYALVDRSGTHDLAQLRSLQDWF
FT                   LRFELKTLPDVAEVATIGGMVKQYQVVLDPLRMASLGITQVEVSDAIAKANQETGGGVL
FT                   EQGEAEFMVRASGYLKSLDDFRAIPLRLAAKGIPVTLGDVATVQLGPEARRGIGELDGQ
FT                   GEAVGGVVILRSGKNAKDAIAHVKSKLESLEKSLPAGVELVTTYDRSQLIDRAVENLSQ
FT                   KLIEEFIVVALVCAAFLWHLRSSLVAIVSLPVGVLIALIVMRHQGINANIMSLGGIAIA
FT                   IGAMVDAAVVMIENAHKRVEAWHTWHPGKSLRGEDHWKVMTEAAVEVGPALFFSLMIIT
FT                   LSFIPVFTLQAQEGRLFAPLAFTKTYAMAAAAGLSVTLVPVLMGYWIRGRLPAEERNPL
FT                   NRTLIRLYRPALEIVLRRPKLTLAGALLILLSSVWPLSQLGGEFLPPLDEGDLLYMPTA
FT                   LPGLSAQKASELLQRTDRLIRTVPEVASVFGKAGRAESATDPAPLEMFETTVRLKPKDQ
FT                   WRAGMTTEKLIEELDRTVQVPGLTNIWIPPIRNRIDMLATGIKSPIGVKVAGSNLNEID
FT                   RVTLAIEKVAKTVPGVTSALAERLTGGRYIDLDIDRQFAARYGLNIADVQAIVAGAVGG
FT                   ENIGETVEGLARYPISVRYPREWRDSVDALRQLPIYTSQGGRITLGTVARVRIADGPPM
FT                   LKSENARPSGWVYIDVRRRDLSSVVADLRRLVDQQVKLDPGISLSYSGQFEYLERANAR
FT                   LAWVVPATLAIIFVLLYLTFGRLGEALLIMATLPFALTGGVWLLYMMGYNLSVATGVGF
FT                   IALAGVAAEFGVIMLIYLNNAWTERNGNGTQGQPALLDAIREGAVQRIRPKAMTVAVIV
FT                   AGLMPILWSSGTGSEVMSRIAVPMVGGMLTAPLLSLFVIPAAYWLVRRRGLAVHDNPQT
FT                   GVTR"
FT   sig_peptide     24648..24725
FT                   /locus_tag="PputW619_0022"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.699) with cleavage site probability 0.282 at
FT                   residue 26"
FT   gene            27803..28150
FT                   /locus_tag="PputW619_0023"
FT   CDS_pept        27803..28150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0023"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pap:PSPA7_4016 heavy metal efflux system
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70529"
FT                   /db_xref="InterPro:IPR021647"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3V5"
FT                   /protein_id="ACA70529.1"
FT                   /translation="MKKLLISAGLVFAVAAAVQAQDMYGTDMKNMPMEGNETQGSQAAP
FT                   TASAEGTIKALEPGKVTLAHGPVSALKWPAMTMGFSATEQQLKGLKVGDKVSFDFRMNG
FT                   GTATIVGIRKQ"
FT   sig_peptide     27803..27865
FT                   /locus_tag="PputW619_0023"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 21"
FT   gene            complement(28565..29224)
FT                   /locus_tag="PputW619_0024"
FT   CDS_pept        complement(28565..29224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0024"
FT                   /product="isoprenylcysteine carboxyl methyltransferase"
FT                   /note="KEGG: ajs:Ajs_1466 isoprenylcysteine carboxyl
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70530"
FT                   /db_xref="GOA:B1J3V6"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3V6"
FT                   /protein_id="ACA70530.1"
FT                   /translation="MNHGESAYGLWSLVFINSAIFIMFAFSFFKPATARDWRSFGAFSA
FT                   FIVALFVEMYGFPLTIYLLSGWLQARFPNLDLLSHESGHLWSTLLGDQGNPHFSVLHIA
FT                   SYLFLGFGFYLLSAAWNVLYHAQRRRSLATVGPYGWIRHPQYVAFVLILLGFLLQWPTL
FT                   LTLAMFPVLLVMYGRLAVSEEREMHKQFGAAYEAYTRVTPRFVPHLRERLGGGHRG"
FT   gene            complement(29221..29496)
FT                   /locus_tag="PputW619_0025"
FT   CDS_pept        complement(29221..29496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0025"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_1465 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70531"
FT                   /db_xref="GOA:B1J3V7"
FT                   /db_xref="InterPro:IPR021682"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3V7"
FT                   /protein_id="ACA70531.1"
FT                   /translation="MNPHFDENGSPHSFWRSRYAIGLVVIGGIAVYFLLTEHLAHVVGA
FT                   LPYLLLLACPLMHVFMHRGHGGHHHQGQSKPAPSDKADIHKPGDPS"
FT   gene            complement(29522..29977)
FT                   /locus_tag="PputW619_0026"
FT   CDS_pept        complement(29522..29977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0026"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_1464 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70532"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3V8"
FT                   /protein_id="ACA70532.1"
FT                   /translation="MNNVRNLLIGLCLAAASVGAMAQNTDEHSTHHPADAPSAAATEKT
FT                   PSQPMDKGQMAAMDQQMKAMQAMHEKMAAAKTPEARQALMAEHMALMKNGMAMMKSMEG
FT                   GMPEMGGMHGGMGGDMAARHQMMEKRMDMMESMMQMMMDRMPSAASK"
FT   sig_peptide     complement(29909..29977)
FT                   /locus_tag="PputW619_0026"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            complement(30116..31138)
FT                   /locus_tag="PputW619_0027"
FT   CDS_pept        complement(30116..31138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0027"
FT                   /product="40-residue YVTN family beta-propeller repeat
FT                   protein"
FT                   /note="TIGRFAM: 40-residue YVTN family beta-propeller
FT                   repeat protein; KEGG: net:Neut_0066 40-residue YVTN family
FT                   beta-propeller repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70533"
FT                   /db_xref="InterPro:IPR011045"
FT                   /db_xref="InterPro:IPR011964"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3V9"
FT                   /protein_id="ACA70533.1"
FT                   /translation="MMTAKRFSSMALGISLLIPLGLVMANPTGNVYTANERSASISQVN
FT                   LATGDVSTVALPIAPHNLQVSPDGSLLLVVGVAGHAGHSSGEKPGGQLLVFSTSALDRP
FT                   PFSFPAGDHPAHVVTDVTGLRAFVTDSAANQVRVFDLEQRIELPGIPTGRYPHGLRLSP
FT                   DGRTLYIANMKSDSVSLIDVVTLKETAQIPVGKGPVQVGFAPDGRLAFVSLSATNQLGI
FT                   IDTARRKVISKVDVGRTPIQMMATVDGRQVYVANQGSGQNPDDRVSIVDLQTRSSLGTV
FT                   TTGKGAHGVAISSDGAYVFVSNIEAGTVSVIDTSSRKVVATHKVGAGPNGISFEPPSAQ
FT                   "
FT   sig_peptide     complement(31061..31138)
FT                   /locus_tag="PputW619_0027"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 26"
FT   gene            complement(31404..31595)
FT                   /locus_tag="PputW619_0028"
FT   CDS_pept        complement(31404..31595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0028"
FT                   /product="Heavy metal transport/detoxification protein"
FT                   /note="PFAM: Heavy metal transport/detoxification protein;
FT                   KEGG: pmy:Pmen_2225 heavy metal transport/detoxification
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70534"
FT                   /db_xref="GOA:B1J3W0"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3W0"
FT                   /protein_id="ACA70534.1"
FT                   /translation="MEVSGMGCGSCVNKITKAIQAADGDAKVIVDRAAGTVSVQSNIEA
FT                   ERVGALVQALGYPTKVSR"
FT   gene            complement(31942..34329)
FT                   /locus_tag="PputW619_0029"
FT   CDS_pept        complement(31942..34329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0029"
FT                   /product="copper-translocating P-type ATPase"
FT                   /note="KEGG: pmy:Pmen_2229 copper-translocating P-type
FT                   ATPase; TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; copper-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; YHS domain
FT                   protein; E1-E2 ATPase-associated domain protein; SMART:
FT                   TRASH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70535"
FT                   /db_xref="GOA:B1J3W1"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR007029"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR011017"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3W1"
FT                   /protein_id="ACA70535.1"
FT                   /translation="MHTESCQHDHDHDHDHDHSHPHEQPDGSQRDLVCGMTVPPDSRYF
FT                   ELYEGRTYRFCSEKCLTKFRAAPVHYLSPPQDQEHAGHLHSAAPQPSNAADAEYTCPMH
FT                   PQIRQRGPGSCPICGMALEPVIPELEEDENPELKDFSRRFWWTLPLTVIVTVLAMTAHQ
FT                   LQLLHGATQNWVELILATPVTLWAGWPFFVRGVASIRNRSPNMWTLIGLGTAAAYLYSV
FT                   AATVFPQVFPTTFMQDGRIGVYFEAAAVIISLTLLGQMLELKARSQTSAAIKSLLGLAP
FT                   KTARRIGADGQEEDIPLTHVHTGDHLRVRPGEKVPVDGVVLEGESAIDESMLTGEPVPV
FT                   MKKAGDALIGATLNTHGSLVMAAQKVGAETVLSQIVQMVARAQRSKAPMQRMADTVAGY
FT                   FVMGVILVALVTLFGWGLFGPEPGWVFGLINAVAVLIIACPCALGLATPMSIMVATGKA
FT                   ASSGVLFRDASAIENLCKIDTLIVDKTGTLTEGRPVFHSVVGTGQFMPPEVLRLAASLD
FT                   QGSEHPLAHAIVDHARAHGHSLSKPEAFESGSGIGVRGQVNGKRLQLGNTTLMEEAGLD
FT                   TSPLRDRAEQLRLEGMSIMYLAVDGVLAGLLAVSDPVKPTSKEAVTRLQAEDVKVIMAT
FT                   GDGLTTARAVAKQLGIEEVHGEVKPEDKEQLVALLQGDKRRVAMAGDGINDAPALARAD
FT                   VGIAMGTGTDVAMNSSQLTLVKGDLMGILRARTLSVATVKNMRQNLGFAFFYNAMGIPL
FT                   AAGLFYPLTGHLLSPMIAALAMSVSSASVVFNALRLKRVVTD"
FT   gene            34741..34947
FT                   /locus_tag="PputW619_0030"
FT   CDS_pept        34741..34947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0030"
FT                   /product="putative transcriptional regulator"
FT                   /note="KEGG: pap:PSPA7_3842 probable transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70536"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3W2"
FT                   /protein_id="ACA70536.1"
FT                   /translation="MLILLLHQWLPFDNALAALYPGEGVPKPLEEYDAGSRWGTPSMLS
FT                   CLDGLYLLDPFYQACQEGLPSGL"
FT   gene            35679..36488
FT                   /locus_tag="PputW619_0031"
FT   CDS_pept        35679..36488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0031"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rso:RSc1705 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70537"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3W3"
FT                   /protein_id="ACA70537.1"
FT                   /translation="MQFLSRDLTSYLARMDFFKDIDVEGVDLSGVGRRNDRSTSLVEIT
FT                   KISEHHQAEAAASRLARAITGRLTQSDPDAPVDEHTGRNEFDSYRGPLEYSLKELLENS
FT                   LTHARREGRGDAAVWLTCQFYPKLNLVRMAIVDNGCGFLATLRNHPELHDRTHLHAIEA
FT                   ALKPRVSCNRGAMAQILGSENQGIGLTTTAKIADAAGGGLIIVSGNGIHDTKRRQSQEL
FT                   HDALWNGVSIAFSCTRELLPTISISDLLPKDDAGQVDDDLDLDLNFR"
FT   gene            complement(36672..36977)
FT                   /locus_tag="PputW619_0032"
FT   CDS_pept        complement(36672..36977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0032"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70538"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3W4"
FT                   /protein_id="ACA70538.1"
FT                   /translation="MPGTNEKALNIEGLKFNADPSRGHFLQLSNSIMDHKFNDSFDIVG
FT                   AVFKGKARYHLATLLQNQRPDQLVDEGLSDIVPSEIYDNALTTAERAFDFGTVGDR"
FT   gene            complement(37235..38023)
FT                   /locus_tag="PputW619_0033"
FT   CDS_pept        complement(37235..38023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0033"
FT                   /product="Silent information regulator protein Sir2"
FT                   /note="PFAM: Silent information regulator protein Sir2;
FT                   thiamine pyrophosphate protein central region; KEGG:
FT                   pst:PSPTO_4675 transcriptional regulator, Sir2 family"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70539"
FT                   /db_xref="GOA:B1J3W5"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR027546"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3W5"
FT                   /protein_id="ACA70539.1"
FT                   /translation="MSNLQRAAEALRRSKRVVFFTGAGISADSGIPTFRDKLTGLWAKH
FT                   DPQRLETADAFRKNPALVWSWYLWRRQQVGQAKPNLAHLSIPRIADAGWNVSVVTQNID
FT                   DLHERAGSSSVIHLHGRLMDVKCFGCHRPAELSPDQLAVPPAGQMIEPPRCTRCNGRLR
FT                   PGVVWFRENLPEDAWRSAVRLVEACDLLISVGTSGVVMPAAGIPDMALAAGATVIHVNL
FT                   DDVGMDGAEEIMLVGPAGVVLPALLQAAGVAGPLQLDGFT"
FT   gene            38230..38886
FT                   /locus_tag="PputW619_0034"
FT   CDS_pept        38230..38886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0034"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eba:ebA2473 hypothetical gene"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70540"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3W6"
FT                   /protein_id="ACA70540.1"
FT                   /translation="MTTPFAHIQTRHEPSTALNKSKVALVATLSIEANSDRTIDAYLGG
FT                   LQMYNDLFEWRLDEYPQEALDLIIDCFLPAESVPQSILKSGVSAGLIRSRVFQSGDWIS
FT                   GKQWLQLASTSTPGGGVDPDQLLADGQIFSLRPGKVDFFPAYALDGSNGYQPISSLCDV
FT                   LSVLSTRMDEWSMAAWFQSENSSLGGIAPKALLSSAPEWVLAAAKKKPRGRRVIR"
FT   gene            39299..39607
FT                   /locus_tag="PputW619_0035"
FT   CDS_pept        39299..39607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0035"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: asa:ASA_P4G008 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70541"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3W7"
FT                   /protein_id="ACA70541.1"
FT                   /translation="MMKITGRVETEAVVDVSCDVCGSSTRLENGSLQYGVLQAHWGFGA
FT                   LHDGERYEVHLCEPCFFQTIAYLKQERRTANMFEGDPQQPEDDFGLASRDDFFRDGH"
FT   gene            complement(39630..40172)
FT                   /locus_tag="PputW619_0036"
FT   CDS_pept        complement(39630..40172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0036"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpt:Bpet0213 transposition protein,
FT                   TnsC-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70542"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3W8"
FT                   /protein_id="ACA70542.1"
FT                   /translation="MRVSGGRIRSGKDEFAAELYRSTFGLKRLVVQLLKLAYIECRVAG
FT                   RNRIEIDDLHKAYRSSAYTTSSKEVEELQLLAISKGNQGGHLDLRCPFDLPVEYKSNVV
FT                   SFNRTDRDQRVQTRVFDSSATETERTLLRQITQPDENAPVKAPRRKPLPKATDEDLALA
FT                   FHRYVDSQSPSSPKKPK"
FT   gene            complement(40313..41848)
FT                   /locus_tag="PputW619_0037"
FT   CDS_pept        complement(40313..41848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0037"
FT                   /product="transposase IS66"
FT                   /note="PFAM: transposase IS66; KEGG: pau:PA14_59580
FT                   putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70543"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3W9"
FT                   /protein_id="ACA70543.1"
FT                   /translation="MTFSPNLDQMTPEQLRALAAQALQLQSQVEAMSRKIQNDEILIEQ
FT                   FKFEIALLKRHKFAKRSEQISPAQSSLLDDLLDTDLEAIEAELKQLLPDAPQAEPRQSP
FT                   KRAPLPPQFPRTVIRHEPENTQCVCGCQLQRIGEDVSEKLDYTPGVFTVEQHVRGKWAC
FT                   RQCETLIQAPVPAQVIDKGIPTTGLLAHVMVAKFADHLPLYRQEKIFGRAGLAIARSTL
FT                   AQWVGQTGVRLQPLVDALREAVLNQGVIHADETPVQMLAPGEKKTHRAYVWAYSTTPFS
FT                   GLNAVVYDFSPSRAGEHARNFLGDWNGKLVCDDFAGYKAGFEQGITEIGCMAHARRKFF
FT                   DLHVANKSQLAEQALHSISGLYEVERQARDMSDEERWRIRQELAVPILKTLHDWMLAQR
FT                   DLVPNGSATAKALDYSLKRWVALTRYLDDGAVPIDNNQVENQIRPWALGRSNWLFAGSL
FT                   RSGKRAAAIMSLIQSARMNGHDPYAYLKDVLTRLPTQRASEIGQLLPHQWVPA"
FT   gene            complement(41912..42247)
FT                   /locus_tag="PputW619_0038"
FT   CDS_pept        complement(41912..42247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0038"
FT                   /product="IS66 Orf2 family protein"
FT                   /note="PFAM: IS66 Orf2 family protein; KEGG: pau:PA14_59570
FT                   putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70544"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3X0"
FT                   /protein_id="ACA70544.1"
FT                   /translation="MIRIDAIWLATEPMDMRAGTETALARVIAVFGAAKPHCAYLFANR
FT                   QANRMKVLVHDGVGVWLAARRLNQGKFHWPGIRHGCEVELDSEQLQALVLGLPWQRVGA
FT                   GGVISML"
FT   gene            complement(42244..42564)
FT                   /locus_tag="PputW619_0039"
FT   CDS_pept        complement(42244..42564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0039"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   pau:PA14_59560 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70545"
FT                   /db_xref="GOA:B1J3X1"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3X1"
FT                   /protein_id="ACA70545.1"
FT                   /translation="MRQRSSYPKPFKAQVVQECLQPGATVSSVAINHGINANVIRKWLP
FT                   LYRDQPAAASLPAFVPLKAAPKRPVEASVIIELPVAGQVITVKWPASDPEGCAQFIRAF
FT                   AQ"
FT   gene            42765..43496
FT                   /locus_tag="PputW619_0040"
FT   CDS_pept        42765..43496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0040"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pap:PSPA7_4526 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70546"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3X2"
FT                   /protein_id="ACA70546.1"
FT                   /translation="MKNPFGKHATKSIRGIAPFDSEARNDCPYFKPRQHKKTERKTRFD
FT                   GVPRKILKLLIEQFDRVVYILEKETQLVLSENALRGMLQRYKGERGYLYTGATLRNVPW
FT                   IFAYMSDATRLFGQKVSGNAELVKAIAAEVPGAEISSTGRLESKKVPGSKAAYFDLKMS
FT                   FIRHRIVKDSEASGLVESMEFVVSQPRGGELEHIHKEVIKFDSAWFESLIRMPVDHPYR
FT                   RMDRVKMAREELGDLLELTQA"
FT   gene            complement(44291..44419)
FT                   /locus_tag="PputW619_0041"
FT   CDS_pept        complement(44291..44419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0041"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sbn:Sbal195_4409 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70547"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3X3"
FT                   /protein_id="ACA70547.1"
FT                   /translation="MSIKPGPKRTNEDGTPDKRQRVTPEKQKDHPDLKPHKHKKGE"
FT   gene            complement(44542..46239)
FT                   /locus_tag="PputW619_0042"
FT   CDS_pept        complement(44542..46239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0042"
FT                   /product="protein of unknown function DUF1705"
FT                   /note="PFAM: sulfatase; protein of unknown function
FT                   DUF1705; KEGG: pau:PA14_39020 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70548"
FT                   /db_xref="GOA:B1J3X4"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012549"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR040423"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3X4"
FT                   /protein_id="ACA70548.1"
FT                   /translation="MTPSKSIVHTLLSKWIFAIRNARQKGISTNLLIGLVTFWLLLFAN
FT                   AELWNVLWKLVFKTDEVNWQLAASLPVIVFAWVFTVLSLLSWGRLAKPILCLVLISASF
FT                   ASYFMNAYGIVIDYTMFTNVVETDVAEATELLNWKLGLWVAMVGVLPVYLIARVPLRRK
FT                   PWAKALVSRFIALSLALLTLSGIALSQYQSYASLLRNNREIRLILVPTNLFAAGHGYLK
FT                   RQLASPKTLTAIGTDAVVNRQGAARKPRLLVLAVGETARSANFSLNGYSRETNPELEKR
FT                   NVISFTNVSSCGTATAVSLPCMFLDVGKAQYKDGLAKSREGLLDVLQRAGISVMWTDNN
FT                   SGCKGVCDRVPNHKAASHADSQLCTSEECKDGVLLTEMQDFIKRQEGDAVLVLHYKGSH
FT                   GPAYYKRYPSQFKKFAPVCETNELDKCKQEEVVNAYDNSILYTDYVTANLIDILAANTK
FT                   FDTALMYVSDHGESLGEGGLYLHGLPYAMAPDEQTKVPLVLWMSDSLAKSEKVNVGCLK
FT                   AQTTSPLSHDNLFHTVLGMMNVQTSSYRSALDFTAPCKPFVGGSYSGL"
FT   sig_peptide     complement(46099..46239)
FT                   /locus_tag="PputW619_0042"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.923) with cleavage site probability 0.823 at
FT                   residue 47"
FT   gene            47123..48028
FT                   /locus_tag="PputW619_0043"
FT   CDS_pept        47123..48028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0043"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG:
FT                   pfl:PFL_5222 cobalt/cadmium/zinc transporter, CDF family"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70549"
FT                   /db_xref="GOA:B1J3X5"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3X5"
FT                   /protein_id="ACA70549.1"
FT                   /translation="MGSNHDHGSAAVREGHQKKLIMALGLTGSFMIAEVIGAWITGSLA
FT                   LLSDASHMFTDTAALAISLIALQIAKRPADQKRTFGYARLEILASTFNAVLLFLVAMYI
FT                   LYEAYQRFFMPAEIATGAMMWIAIAGLIINLISMRLLASASNESLNVKGAYLEVWSDML
FT                   GSLGVIIAALIIRFTGWTWVDTIVAVAIGLWVLPRTWQLLRESLGILMEGVPRGLDVTA
FT                   IEATILGVDGVTDVHDLHVWAVSSGSNVMTSHVVVRDSADGDAVLAAVVDAVSDAFEIH
FT                   HCTIQIERAAFHESVPSPSH"
FT   gene            48186..48536
FT                   /locus_tag="PputW619_0044"
FT   CDS_pept        48186..48536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0044"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mms:mma_3055 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70550"
FT                   /db_xref="GOA:B1J3X6"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3X6"
FT                   /protein_id="ACA70550.1"
FT                   /translation="MAWIITKYLLTAGIVILVSELAKRSDKLGGLVAALPLVTVVTLVW
FT                   LYLENQSMEKISNHAWYTFWYVLPTLPMFIAFPLLLPKLGFWPTLISSILITMASFGGF
FT                   AILLRRFGIELL"
FT   gene            complement(48569..48895)
FT                   /locus_tag="PputW619_0045"
FT   CDS_pept        complement(48569..48895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0045"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: psb:Psyr_4809 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70551"
FT                   /db_xref="InterPro:IPR021245"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3X7"
FT                   /protein_id="ACA70551.1"
FT                   /translation="MNTTVSAIAVFLLFTSLTANAQSGMEINKRIERTAREATADYAQR
FT                   VKKPMPQLEDYAYGMDLDVGKLVYVSPSVRYCGNVRSMMTYEDSKGELHMVRYLVKGEC
FT                   VNSR"
FT   sig_peptide     complement(48830..48895)
FT                   /locus_tag="PputW619_0045"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 22"
FT   gene            49585..50259
FT                   /locus_tag="PputW619_0046"
FT   CDS_pept        49585..50259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0046"
FT                   /product="two component heavy metal response
FT                   transcriptional regulator, winged helix family"
FT                   /note="TIGRFAM: heavy metal response regulator; PFAM:
FT                   response regulator receiver; transcriptional regulator
FT                   domain protein; KEGG: pmy:Pmen_1174 two component heavy
FT                   metal response transcriptional regulator, winged helix
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70552"
FT                   /db_xref="GOA:B1J3X8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR006291"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3X8"
FT                   /protein_id="ACA70552.1"
FT                   /translation="MRVLVVEDEIKTAEYLQQGLSESGYVVDIVHNGVDALHLFNTNVY
FT                   SLVLLDVNLPGIDGWDLLETIRKTSRVRIIMLTARGRINDKLKGLDGGADDYLVKPFEF
FT                   PELLARIRSLQRRGDELVEKSSLKIADLELDSVRHRVFRGGTRIDLTTKEFALLHLLMS
FT                   RTGEALTRSQIISLVWDMNFDCDTNVIDVAIRRLRSKIDDPFETKLIHTLRGVGYVFEE
FT                   RA"
FT   gene            50256..51674
FT                   /locus_tag="PputW619_0047"
FT   CDS_pept        50256..51674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0047"
FT                   /product="heavy metal sensor signal transduction histidine
FT                   kinase"
FT                   /note="TIGRFAM: heavy metal sensor kinase; PFAM:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   HAMP region domain protein; histidine kinase A domain
FT                   protein; KEGG: pfl:PFL_3148 heavy metal sensor histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70553"
FT                   /db_xref="GOA:B1J3X9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006290"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3X9"
FT                   /protein_id="ACA70553.1"
FT                   /translation="MRPFSLAAKLGLKVGLMSAALLLLFATFGYLMVGKALERNARADL
FT                   EVKMAGMAHNLSTIPDISGVNADAHQLVDLVMGHNNLYVSIFDTSQNQTPLLSIGSKQV
FT                   NLEVHKFQPAAQPKEHEWRDTQDRPLLSASRIMRLGDGTEVSVYMTMDQSSSEALLDAL
FT                   LTWALMMSPVILALILAIGWWTVRRGLLPLTKFLKIASKISTESLDHRLPTDGMPAELK
FT                   MLADGINIMLARLDDGVQQLSQFSDDLAHELRAPLSNLMGKAQVALTRERSLSEYREVL
FT                   ESCTEELDRMSRMVSDMLFLAQVSHPASMVEFESVSLVDEVQRVCELFSISAEEGEIQL
FT                   QISGSDDVVRGNRLMVQRAVSNLVSNAIRYCPRGRTVYVKVQHSASGTTLSVGNPGRGI
FT                   AKEHHAHLFERFYRVDKSRARSEGGTGLGLAIVQSIMSLHQGSASVEVTEENFTWFHLH
FT                   FPEAQQMQPAMTAA"
FT   sig_peptide     50256..50357
FT                   /locus_tag="PputW619_0047"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.951) with cleavage site probability 0.406 at
FT                   residue 34"
FT   gene            complement(51732..52319)
FT                   /locus_tag="PputW619_0048"
FT   CDS_pept        complement(51732..52319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0048"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70554"
FT                   /db_xref="GOA:B1J3Y0"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3Y0"
FT                   /protein_id="ACA70554.1"
FT                   /translation="MNDIEPWAVAIGDFRRCTEKLTVQLDELTSQTRTSSAVLERSNEL
FT                   VEQVDAVGRQIQEEVRKAEKAWSNAEEVALRAAASAYSAACRGVDTAIQPLISELTAAT
FT                   KAADASIQELKRAPVLAKRYVMVVATAFFILALICVYSTMRLIDAAGSVSAQEKVNAQY
FT                   FSHLWKNANPDEQKIIKSVILRSPMDPVVLRH"
FT   gene            52586..52807
FT                   /locus_tag="PputW619_0049"
FT   CDS_pept        52586..52807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0049"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70555"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3Y1"
FT                   /protein_id="ACA70555.1"
FT                   /translation="MKFVKSIAIGSLLLGLMGTAYAEGGFERTKQFNENFRTEQARLWS
FT                   DDSSDQNKQQVAQEQKKESKDGKEQADN"
FT   sig_peptide     52586..52654
FT                   /locus_tag="PputW619_0049"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            complement(52890..54344)
FT                   /locus_tag="PputW619_0050"
FT   CDS_pept        complement(52890..54344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0050"
FT                   /product="glycosyl transferase family 39"
FT                   /note="PFAM: glycosyl transferase family 39; KEGG:
FT                   pap:PSPA7_5537 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70556"
FT                   /db_xref="GOA:B1J414"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="UniProtKB/TrEMBL:B1J414"
FT                   /protein_id="ACA70556.1"
FT                   /translation="MLNLKNERTLWWVLGSILLLRLVGLGIYPLMDTSEARYAEMARKM
FT                   VELNDWITPMFDYGVPFWGKPPLSFWTQAASMTVFGVNEFAARFPAWLLHLASCFIIIK
FT                   LGTQQISRNAGIWAAIIFSSTTLGLVSSGVVLTDPVLSFSILLASYGFWRWMKCASKAD
FT                   AYLMFAGLGLGLLAKGPLTLVLMGAPAFAWFVIYKEWGRVLRLPWISGLVLMFGISVPW
FT                   YVAAEMKTPGFMEYFFVGEHWSRYVVSNWAGDLYGSAHAKPYGSIWIQLGLSLLPWALF
FT                   LPLLIRKRGSMQRFKAYLWLWALATPVFFTFAGNILWTYLLPALPAWALLLSARVSEVG
FT                   PKTTWAAAASALVLPIIGAGIIYAGVLEERPQNQRDVVQAWLNVQSAHSAPLIYPGRRS
FT                   YSSEFYSSGKSENIKDPAKWPRDGSFYLSRRLRDSKDGLPADLACTSITEANASQLLLC
FT                   HWKRPAQGAEGLAGESNAETPRKNEG"
FT   gene            complement(54338..55321)
FT                   /locus_tag="PputW619_0051"
FT   CDS_pept        complement(54338..55321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0051"
FT                   /product="Ribonuclease III"
FT                   /EC_number="3.1.26.3"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   vha:VIBHAR_02791 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70557"
FT                   /db_xref="GOA:B1J415"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B1J415"
FT                   /protein_id="ACA70557.1"
FT                   /translation="MQTLHRFPERPDPLLTIVVPCFQEEETIPEFHQRITRVVKRLPVS
FT                   CEILYVDDGSNDRTADILRHYQDGSSVRCLSLSRNFGKEAALSAGIDHARGSALIFIDV
FT                   DLQDPPELIAAMVDYWQRGYDVVNMQRNLRIGDSWFKRMSARAYYWVMQRLVEKVDMPA
FT                   DVSDFRLIGPAPLAALRALDERSRILKGMIGWVGFRTIELPYNRTVRHAGSTKWNAAGL
FT                   FNLAIESIVSFSRKPLRIFSLISFGLFVSSICYMLASLVAGSFDIHHLIVGMASFMCVG
FT                   VAMVGEYLGVTLAEVKRRPLYFLKHSNKADPVSLHPSMASIEGKKC"
FT   gene            complement(55287..55706)
FT                   /locus_tag="PputW619_0052"
FT   CDS_pept        complement(55287..55706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0052"
FT                   /product="GtrA family protein"
FT                   /note="PFAM: GtrA family protein; KEGG: sde:Sde_0136
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70558"
FT                   /db_xref="GOA:B1J416"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:B1J416"
FT                   /protein_id="ACA70558.1"
FT                   /translation="MENQTPPLTTLLIRYLGIGFIATGVHYAVFLLLVTTEFVTPLLAS
FT                   ICGGMVGAIASFIGNRALCFVADGSRKFQPVRFALVALTTNFGNGVGMWFLIKSNLSPL
FT                   ISQVVVTLSLTALGFIAHRFWTFNHADITSLSRAP"
FT   gene            55964..56932
FT                   /locus_tag="PputW619_0053"
FT   CDS_pept        55964..56932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0053"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: pfl:PFL_2828 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70559"
FT                   /db_xref="GOA:B1J417"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1J417"
FT                   /protein_id="ACA70559.1"
FT                   /translation="MVTQNETYTSSVVPYSPDILDDLPIDDQLAVEFFATARCASFKQA
FT                   ARGLNVPVVGLRKRLEKLEEHIGAPVFVYKHNKLALTRTGERVSHYLCQLFGPDGLGKS
FT                   GEKEVPRLTIAITEPVLNDIVNRDLVAYVRDHAEMQLEIHSECTTQMLSECEVDVGIAL
FT                   VSPDDKGALDRHPTYRFERLGRIGHALFISSRYSRSVTLPVESLDLHNFMLVVPWDEEI
FT                   LAGSRKWASIMAEHQGGTTRVKSYNLSRGLVVGGACIGVLPDYSRKLERNILPVPGFLD
FT                   DLEEKDVYLVIKTKLVRNPQVLEIRRLIKKSFFDKKDWLVR"
FT   gene            57143..58450
FT                   /locus_tag="PputW619_0054"
FT   CDS_pept        57143..58450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0054"
FT                   /product="phosphate-selective porin O and P"
FT                   /note="PFAM: phosphate-selective porin O and P; KEGG:
FT                   pau:PA14_21620 phosphate-specific outer membrane porin OprP
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70560"
FT                   /db_xref="InterPro:IPR010870"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:B1J418"
FT                   /protein_id="ACA70560.1"
FT                   /translation="MIRSSNMREKLLAAAIIGTFSSQAFSGTVTTDGADIVLKTKGGLE
FT                   VSTSDKEFSFKLGGRVQADYGRFDGVFTKNGDTADAGYFRRAYLELGGVLYRDWKYQLN
FT                   YDLSRNTGNDSDGYFDEASLTYTGFKPVQLRFGRFYTDFGLEKATSSKWTTAMERNLSY
FT                   DLADWINDNAGMGVQATSTIADMAYVSGSVFSETNNNSDGDSTKRYNVRGVFAPLHSDG
FT                   NVLHVGAQYAYRDLKNSAVDTRIRSRLGVRGVDTNGGGDAGTNGNRMLFGGAAAQDGLW
FT                   KDDSVWGLEGAWATGPFSVQAEYLRRKLKADQANNDMKASGYYAQMAYTLTGEPRIYKL
FT                   DGAKFDTIKPENKELGAWEVFYRFDDIKVEDGNLVTAADQSNERKAKSHTVGVNWYVNE
FT                   AVKVSANYINVRTDNNENTVGDDSGNAIVTRLQYVF"
FT   sig_peptide     57143..57223
FT                   /locus_tag="PputW619_0054"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.978 at
FT                   residue 27"
FT   gene            58470..58604
FT                   /locus_tag="PputW619_0055"
FT   CDS_pept        58470..58604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0055"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70561"
FT                   /db_xref="UniProtKB/TrEMBL:B1J419"
FT                   /protein_id="ACA70561.1"
FT                   /translation="MRKPEALNVLPAFLFLEVIKHGAPSSYLLSLTDDRSCQSSANLM"
FT   gene            58749..59774
FT                   /locus_tag="PputW619_0056"
FT   CDS_pept        58749..59774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0056"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70562"
FT                   /db_xref="UniProtKB/TrEMBL:B1J420"
FT                   /protein_id="ACA70562.1"
FT                   /translation="MSAKKLLQPLAAQLHASFSASGRPYSHLHLHQLFHAAIGSVAPQV
FT                   AIQDKLPIQVCRDNETRQYNLYAAVERAKTCLGLTDLQAVGVAEEVIEVLRTAGIGVNQ
FT                   VRLLLDPSFSSKTRKKAFKALCKNLDLNELGDRFVPKTATLAIAAGIAPPPKMSWKDRF
FT                   ALAANSPMRGPSELISMVNRDECYLWVFPPTDHHATAPATHDRFFGEKTHPSAEMGMGF
FT                   SIIDSGWTRPKYPLSRQSQETFIQYSLSAPMWSWRAQSDTWRLGNILRSRILDGAPWHN
FT                   EPLSDVLPSGLKSLPRIYGCETCRTLFIENHSDYPDVPTQCQCGEASSTGDQNESSALN
FT                   S"
FT   gene            59902..60126
FT                   /locus_tag="PputW619_0057"
FT   CDS_pept        59902..60126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0057"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70563"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3Z6"
FT                   /protein_id="ACA70563.1"
FT                   /translation="MQKSKNKQDTLAAINALVEIAYDQGFADGHGVGNQVGFVAGVMSL
FT                   KAALACGLRHGSPECGKALESLKRIGIDE"
FT   gene            complement(60219..62216)
FT                   /locus_tag="PputW619_0058"
FT   CDS_pept        complement(60219..62216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0058"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; cadmium-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; E1-E2
FT                   ATPase-associated domain protein; KEGG: mes:Meso_4435 heavy
FT                   metal translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70564"
FT                   /db_xref="GOA:B1J3Z7"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3Z7"
FT                   /protein_id="ACA70564.1"
FT                   /translation="MKSLLERPDDQAGHEGHSHEHGGIFGMNTELIFALICGALLGAGA
FT                   LAGKLGLIDRLPLILYVSAYVFGGWFTTKEAVTNIRQKRFEIDSLMLLAAVGAASIGAW
FT                   AEGALLLFLFSLGHSLESYAMGRAKKAIEALSKLAPATAIVRRANGTVEMPVELLVPGD
FT                   VVIVRPNDRLPADGFVVVGSSSINQAPVTGESVPVDKQPVPDAELARSKPDAVDAASKV
FT                   FAGTINGETLIEVEVTRRSTESTLARVIKMVSEAEVRKSPTQRFTDRFQRIFVPLVLLL
FT                   VVGLLFAGIFLDEPFRDSFYRAMAVLVAASPCALAIATPSAILSGIARAARGGVLIKGG
FT                   APLEELGSLNAMAFDKTGTLTEGRPRITDVIPIGGTQIEDLLNVAIAVESMSDHPLAAA
FT                   IVRDGEEMIGTRRRFQAKNMSNMIGRGVRAELDGQFVWIGKVEMFGTNGIPALSKAALE
FT                   AAERLRQSGRTTMVVRRADKDLGAIGLLDTPREGAKEALQKLREMGIERMVMISGDHNR
FT                   VAEAVAKQVGLDEAWGDLMPEDKVKAIKNLRLSAKVAMVGDGVNDAPAMASSSVGIAMG
FT                   AAGSDVALETADIALMADDIRQLPFAVGLSRHTRSIIHQNLFVSLGIVAILVPSTIMGL
FT                   SIGAAVAIHEGSTLLVVFNALRLLAYRRST"
FT   gene            complement(62419..62742)
FT                   /locus_tag="PputW619_0059"
FT   CDS_pept        complement(62419..62742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0059"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: psp:PSPPH_4839 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70565"
FT                   /db_xref="InterPro:IPR021245"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3Z8"
FT                   /protein_id="ACA70565.1"
FT                   /translation="MKKLIIAAALVVFSVASQANTFSESKQLQYTKEHQTAVAKYAEKN
FT                   GKPMPEIQDYKYGMKIDVAKFVRQSQDPRTCQVYPRLMTFEDSQGTLKTVRYSMYSQCI
FT                   NNK"
FT   sig_peptide     complement(62683..62742)
FT                   /locus_tag="PputW619_0059"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.984 at
FT                   residue 20"
FT   gene            complement(62905..66066)
FT                   /locus_tag="PputW619_0060"
FT   CDS_pept        complement(62905..66066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0060"
FT                   /product="heavy metal efflux pump, CzcA family"
FT                   /note="TIGRFAM: heavy metal efflux pump, CzcA family; PFAM:
FT                   acriflavin resistance protein; KEGG: pen:PSEEN2024 RND
FT                   divalent metal cation efflux transporter CzcA"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70566"
FT                   /db_xref="GOA:B1J3Z9"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3Z9"
FT                   /protein_id="ACA70566.1"
FT                   /translation="MFERIIRFAIEQRIVVMIAVLIMAGIGIYSYQKLPIDAVPDITNV
FT                   QVQINTAAPGYSPLETEQRITFPVETAMAGLPGLQQTRSLSRSGLSQVTVIFKDGTDIF
FT                   FARQLINERLQVAKEQLPEGVEAVMGPVSTGLGEIFLWTVEAEDGAVKEDGTPYTPTDL
FT                   RVIQDWIIKPQLRNVPGVAEINTIGGYAKQFLVAPDPKRLATYKLTLNDLVAALESNNA
FT                   NVGAGYIERNGEQLLIRAPGQVGNIEDIANIVITSVDGAPIRISSVADVSIGKELRTGA
FT                   ATENGREVVLGTVFMLIGENSRTVSQAVAAKLADINRTLPKGVVAVTVYDRTNLVEKAI
FT                   ATVKKNLVEGAILVIAILFLFLGNIRAALITAMVIPLSMLFTFTGMFNNKVSANLMSLG
FT                   ALDFGIIVDGAVVIVENAIRRLAHAQHKHGRMLTKTERFHEVFAAAREARRPLIFGQLI
FT                   IMVVYLPIFALTGVEGKMFHPMAFTVVMALLGAMVLSVTFVPAAIAMFVTGKVKEEEGV
FT                   VMRTARLRYEPVLQWVLGHRNIAFSAAVALVVLSGLLASRMGSEFIPSLSEGDFAMQAM
FT                   RVPGTSLTQSVEMQQRLEKAVIAQVPEVERMFARSGTAEIASDPMPPNASDAYIMLKPQ
FT                   DQWPNPKKPRDELIAEVQKAAAGVPGSNYELSQPIQLRFNELISGVRSDVAVKVFGDDM
FT                   DVLNNTANKIAAALKAVPGSSEVKVEQTSGLPVLTINIDREKAARYGLNIADVQNSIAI
FT                   AVGGRQAGTLYEGDRRFDMVVRLPETVRTDVAGMSSLLIPVPANAAQGANQIGFIPLSQ
FT                   VANLDLQLGPNQISRENGKRLVIVSANVRGRDLGSFVEEATASLDKKVQIPAGYWTTWG
FT                   GQFEQLQSAAKRLQIVVPVALLLVMTLLFLMFNNLKDGMLVFTGIPFALTGGVVALWLR
FT                   DIPLSISAGVGFIALSGVAVLNGLVMIAFIRGLREEGRTLRQAVDEGALTRLRPVLMTA
FT                   LVASLGFIPMALATGTGAEVQRPLATVVIGGILSSTALTLLVLPALYHWAHRKDEDGDE
FT                   AEVVS"
FT   gene            complement(66091..67341)
FT                   /locus_tag="PputW619_0061"
FT   CDS_pept        complement(66091..67341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0061"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   pen:PSEEN2023 cobalt-zinc-cadmium resistance protein CzcB"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70567"
FT                   /db_xref="GOA:B1J400"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B1J400"
FT                   /protein_id="ACA70567.1"
FT                   /translation="MDNKRKIALAVAAVAALGFGSLAWNNSSGQQAASTAEHGANDGHG
FT                   DEKKAASAAKEEGDEGHGEEGHSEEGGEEEGKLTLSAEQIKAAGVALEAAAPRDLGTVV
FT                   SFPGEIRFDEDRTAHVVPRVPGVVEAVQANLGETVKKGQVLAVIASQQISDLRSEQQAA
FT                   QRRVELARVTFEREKQLWQDKISAEQDYLQARQALQEAEISLANAKQKVGAIGASVNSV
FT                   GGNRYELRAPFDAVVVEKHLTVGEVVSEATNAFILSDLNQVWATFAVPPTDLGKVTTGR
FT                   AVKVSSPDMNVEVEGKVGYVGSLLGEQNRAATVRVTLTNPNGAWRPGLFVNIAVTSQTD
FT                   RVAVAVPEHAVQTVEDKPSVFVRTPDGFDTRPVKLGRRDNGYVEIIDGIEAGAQVATSG
FT                   SFTLKSELGKASAEHGH"
FT   sig_peptide     complement(67270..67341)
FT                   /locus_tag="PputW619_0061"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.600 at
FT                   residue 24"
FT   gene            complement(67410..68681)
FT                   /locus_tag="PputW619_0062"
FT   CDS_pept        complement(67410..68681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0062"
FT                   /product="outer membrane efflux protein"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   pen:PSEEN2022 cobalt-zinc-cadmium resistance protein CzcC"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70568"
FT                   /db_xref="GOA:B1J401"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:B1J401"
FT                   /protein_id="ACA70568.1"
FT                   /translation="MPRYNRNVLPKTPVSPWKIAALCAVISGLMAPAALAQSISLPQAL
FT                   STAMDANPDLAAARQEIGIADGARKQAGLIPNPTISYDVEDTRRNTSQTTVSLSQTLEL
FT                   GGKRGARVDVATYGQTAAQLELDRRVNGLRADVVQAFYAALRAQTGLDLAKQSLELTER
FT                   GLRIVDGRVRAGKSSPVEATRAQVQLAEAQLQVRRAETEKATAYQQLAQITGSSVTVFD
FT                   RLESPTLSPGLPPRTEDLLAKLDQTAEMRQAVVQIDKSDASLGSEKAQRIPNLTVSVGS
FT                   QYDRSVRERVNTVGLSMPLPLFDRNQGNILSASRRADQARDQRNAVELRLRTETQTALN
FT                   QWSTAMQEVESYDKTILPSAQQAVETATRGFEMGKFGFIEVLDAQRTLIVARGQYLESL
FT                   AAATNARAQVERVYGEVGSTAGTR"
FT   sig_peptide     complement(68571..68681)
FT                   /locus_tag="PputW619_0062"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 37"
FT   gene            69085..70428
FT                   /locus_tag="PputW619_0063"
FT   CDS_pept        69085..70428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0063"
FT                   /product="outer membrane porin"
FT                   /note="PFAM: outer membrane porin; KEGG: pen:PSEEN2340
FT                   porin, OprD family"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70569"
FT                   /db_xref="GOA:B1J402"
FT                   /db_xref="InterPro:IPR005318"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:B1J402"
FT                   /protein_id="ACA70569.1"
FT                   /translation="MKIKVPLYLAAVSALSGSYAISAQAEDKPEGFIEGSSLTVLNRNF
FT                   YFNRDNRDSTAPTYNSGKGNTNGYSEAWAHAIISKFNSGFTQGTVGFGVDAFAMIGLKL
FT                   DTGDGRNGGRSSFDVLPVDNKGEARDEYTKVGGAAKVRLFDTIVKVGDVFPSTPVVASG
FT                   DSRLLPESFRGVTVENTSIQGLTLQGGRLHAMSQPVSSNLNDNFVTFYGGPVNSPWIGY
FT                   GGGDYSINDNWTVSVYASQLKDVWNQYYAGTSVVYPLSDDLALIGGFNYYKAVDEGKKR
FT                   LGEFDNNIWSAKVGVRYGAHTLALSHQRNNGDDDFDYLRQSDSIFVDNSIQYSDFNSPK
FT                   ERSWMLRYDLNFTSYGIPGLTFMTRYARGSGADYSNANQFYMRTDDNGNPLDNQKRWER
FT                   DVEVKYVVQTGPAKDLSFRLRQATTRATAFESDLDETRVIIEYPLSIL"
FT   sig_peptide     69085..69162
FT                   /locus_tag="PputW619_0063"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.988 at
FT                   residue 26"
FT   gene            70917..71591
FT                   /locus_tag="PputW619_0064"
FT   CDS_pept        70917..71591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0064"
FT                   /product="two component heavy metal response
FT                   transcriptional regulator, winged helix family"
FT                   /note="TIGRFAM: heavy metal response regulator; PFAM:
FT                   response regulator receiver; transcriptional regulator
FT                   domain protein; KEGG: pfl:PFL_5221 DNA-binding heavy metal
FT                   response regulator, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70570"
FT                   /db_xref="GOA:B1J403"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR006291"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B1J403"
FT                   /protein_id="ACA70570.1"
FT                   /translation="MRILVIEDEVKTAEYVRQGLTECGYVVDCVHTGSDGLFLAKQHEY
FT                   ELIILDINLPEMDGWQVLELLRRKNCPSRIMMLTARSRLADKVRGLENGADDYLIKPFE
FT                   FPELLARVRALMRRSDHPASVEVIRVADLELDQSRHRAFRDGQRIDLTTKEFALLHYLM
FT                   RNTGVVLSRTQIISQVWDMNFDCDTNVVEVSIRRLRAKIDDPFETKLIHTLRGVGYVLE
FT                   KR"
FT   gene            71709..72032
FT                   /locus_tag="PputW619_0065"
FT   CDS_pept        71709..72032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0065"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: yen:YE1651 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70571"
FT                   /db_xref="UniProtKB/TrEMBL:B1J404"
FT                   /protein_id="ACA70571.1"
FT                   /translation="MRYSIDYQQVSQGQSDASIDACPADIVFNSDHGLALIPCVGDVIN
FT                   LPSTAVKEGVCGIVRSRIFNYLRGPEELYCHVNILVEEADINFESLISEYMRNQSRARS
FT                   PSS"
FT   gene            complement(72134..72661)
FT                   /locus_tag="PputW619_0066"
FT   CDS_pept        complement(72134..72661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0066"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70572"
FT                   /db_xref="GOA:B1J405"
FT                   /db_xref="UniProtKB/TrEMBL:B1J405"
FT                   /protein_id="ACA70572.1"
FT                   /translation="MSIQGLKRYFGNKIHAVIMMAPLKREMIRLGICTLMAIILNIILY
FT                   TGVEVDGTIKPWAETPIKLFASSMLFAFMIKAFLPVLGWTILKAMLLSANNAFSGILSF
FT                   LGNQFTGVMYCTGIIMGSITIKLYMVSGVLDSEFAYLSAIVFASGVLYFYVLQCAIQKT
FT                   MSPALRTPAVPR"
FT   gene            complement(72851..74317)
FT                   /locus_tag="PputW619_0067"
FT   CDS_pept        complement(72851..74317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0067"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nwi:Nwi_0260 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70573"
FT                   /db_xref="UniProtKB/TrEMBL:B1J406"
FT                   /protein_id="ACA70573.1"
FT                   /translation="MPSPAGTLRGIDGMHFDGCRDQRMKEIAAPMFDLIALSLPRGLGF
FT                   GDSPPVGAWLSEDGISCAALTRNIHAGSFGIVTLRRRVDSVWVLLSHSERTTGESEARA
FT                   SISHFLYTQAHPLPLPSGERRRAPLSRMGKRTPSVVFKSLFDPSRRIGAWALNQLYLAL
FT                   PSPDRNWVPDCQTENFHTRLWEAHLLAIFREQGLLVTQPKESPDFHIENRLGDEAWVEA
FT                   VTANPEERYEHFGASPVPPPADRHERFLGAAAERFARTIQNKLDKRYESLPHVEGKPLI
FT                   LALADFHAPSSMLWSRESLISYLYGFAVHSSAHRGTHLITVEEETSLLSGRPNGLFTLM
FT                   ENAHLSAVIFTNACTVPKLSRVPISGGAHLDGYRYLRFGEFFDRSPGASRGIPFLLDVA
FT                   SSDYGQLWPQYGYEPWSAEVEVFHNPMALYPVPNELIPEVTHWREVNGRVECESFFDVS
FT                   ILRSRTLVLSANAKVPSLDELLTAASPPEL"
FT   gene            complement(74330..74779)
FT                   /locus_tag="PputW619_0068"
FT   CDS_pept        complement(74330..74779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0068"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70574"
FT                   /db_xref="UniProtKB/TrEMBL:B1J407"
FT                   /protein_id="ACA70574.1"
FT                   /translation="MDYADQLLSNLIVRSSMANPNLLALFRDEVLLTGPESSLPSNLSQ
FT                   FWLEELQSHLERYFDGLNSDSDAEEKDLDISLPLAAIIHILFAKNGGEEISESSEKLYE
FT                   YFQDYRLELALEEITRKTHVAAEAATIETIFTNRDVLVEQGPLLQ"
FT   gene            complement(75471..75896)
FT                   /locus_tag="PputW619_0069"
FT   CDS_pept        complement(75471..75896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0069"
FT                   /product="integral membrane protein-like protein"
FT                   /note="KEGG: bxe:Bxe_B1530 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70575"
FT                   /db_xref="InterPro:IPR024572"
FT                   /db_xref="UniProtKB/TrEMBL:B1J408"
FT                   /protein_id="ACA70575.1"
FT                   /translation="MKKTLSVLCATLMLSVPLASFAQPGPPQGHDGDRSHQGQGHPQQS
FT                   KQPGHPQQHGKPGNGQAQSYRNPNFRPQPGMPVPHQQWKRGHVVDPHYRNDRYWVTDWR
FT                   ARHLSPPPRDHRWLYVNGDYVLVTIASGVIVNILSGY"
FT   sig_peptide     complement(75828..75896)
FT                   /locus_tag="PputW619_0069"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            complement(76031..77335)
FT                   /locus_tag="PputW619_0070"
FT   CDS_pept        complement(76031..77335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0070"
FT                   /product="putative sigma54 specific transcriptional
FT                   regulator"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; ATPase associated with
FT                   various cellular activities AAA_5; PAS fold-4 domain
FT                   protein; SMART: AAA ATPase; KEGG: pen:PSEEN0005 sigma-54
FT                   dependent transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70576"
FT                   /db_xref="GOA:B1J409"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B1J409"
FT                   /protein_id="ACA70576.1"
FT                   /translation="MPESHPLILALVSYLEHDALPTIVLDTDYNILAANAAYRRQFGRD
FT                   DRAPLGEKCHRVSHHYAVPCDQAGEHCPMRKAWGSKLPERVLHIHHTPRGPEHVDVELR
FT                   PILDEQGRVVAFVERLTTVTLASAQPQQQGLVGRAPAFKTALASLQRAAPAQIPVLLQG
FT                   ESGTGKELFARAIHMGSPRANGPLVVVDCTGLTESLFESELFGYEKGAFTGANQRKIGL
FT                   AEAAHGGTLFLDEIGEVPLAMQVKLLRLIESGSFRPVGSLRTVHADFRLVSATHKPLKQ
FT                   MVAEGTFREDLYYRISGFPIRLPALRERVEDLPLLAQSLLQRMAGKPAASLTDAALQRL
FT                   ALHTFPGNIRELRNILERARLFADDGLIRPEHLPEDVGPQIATGANKARARSDLSDLAQ
FT                   ALEQFQGPRSELARHLGMSERTLYRRLKALGLNPA"
FT   gene            77559..78443
FT                   /locus_tag="PputW619_0071"
FT   CDS_pept        77559..78443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0071"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   pen:PSEEN0007 metallo-beta-lactamase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70577"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B1J410"
FT                   /protein_id="ACA70577.1"
FT                   /translation="MIIGNNLQVEAFFDDATSTISYLVLDRETNQCALIDSVLDYDPKS
FT                   GRTCTESADRLIDRVQSLGAKVQWILETHVHADHLSAAAYLKEKLGGHTAIGAEITKVQ
FT                   KVFGDLFNAEPGFARDGSQFDVLLMDEEGFRIGNLHARSLHTPGHTPACMSYLVEDAGE
FT                   KALFVGDTLFMPDYGTARCDFPGADARTLYQSIRRLLAFPDQTQLFMCHDYLPGGRDMR
FT                   YVTTVAEQRASNIHVHQGIDEDSFVAMREARDKTLEMPVLILPSVQVNMRSGHFPQPES
FT                   NGVSYLKIPLNKL"
FT   gene            78483..79754
FT                   /locus_tag="PputW619_0072"
FT   CDS_pept        78483..79754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0072"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase; KEGG:
FT                   pen:PSEEN0008 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70578"
FT                   /db_xref="GOA:B1J411"
FT                   /db_xref="InterPro:IPR015904"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B1J411"
FT                   /protein_id="ACA70578.1"
FT                   /translation="MPALLSPAHSDHHKVVIVGAGAAGIATAASLISRDPSLDIAVVDP
FT                   ADVHYYQPGWTMVGAGVFNAPSTARTMASTIPRGVRWIKARVQGFDPLGQLVMLEDGRT
FT                   ISYEQLVVCPGLKLDWAAIDGLSDTLGRNGVTSNYRYDLAPYTWELVQNLKQGRALFTQ
FT                   PPMPIKCAGAPQKALYLSCDHWLRQGRLGDIKACFFNAGAVLFGVPDYVPALMAYIDKY
FT                   GVDLNYNHCLAAVDGPNKRATFLRTFADGSTETHTEAFDMLHVVPPQVAPDFIRQSPLA
FT                   DAAGWVDVDPHTLRHRQFANVHALGDVASTSNAKTAAAARKQAPVVANNVLVALGRLAN
FT                   LAQYDGYGSCPLTVERGKIVLAEFTYGGKVAPSFPRWLLDGRQPTRLAWLLKARVLPPL
FT                   YWQGMLKGREWLARPQPVAAEAAR"
FT   gene            79751..80569
FT                   /locus_tag="PputW619_0073"
FT   CDS_pept        79751..80569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0073"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   pen:PSEEN0009 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70579"
FT                   /db_xref="GOA:B1J412"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:B1J412"
FT                   /protein_id="ACA70579.1"
FT                   /translation="MIEHQLLGAGLGAIIGAVLALTGAGGGILAVPLLVFGLGLSMVEA
FT                   APIGLLAVGLAAAVGAILGLRQGLVRYRAALFIALIGIAAAPFGLMLAHRLPDTPLALV
FT                   FAGVLVYACLRMWRKAASELRGETNEAHRFIEPCVLNPLQGRLRWTLPCARALAMTGAL
FT                   SGLLSGLLGVGGGFVIIPALNRYTNLRMKSIVSTSLAVIALVSTGSVVSASLAGVMHWQ
FT                   VGAPFAVGAVLGLLLARPLAARLAGPRLQQLFSVAGFGAALLLAGKALLG"
FT   sig_peptide     79751..79813
FT                   /locus_tag="PputW619_0073"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.936) with cleavage site probability 0.693 at
FT                   residue 21"
FT   gene            complement(80558..81445)
FT                   /locus_tag="PputW619_0074"
FT   CDS_pept        complement(80558..81445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0074"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: pen:PSEEN0010 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70580"
FT                   /db_xref="GOA:B1J413"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1J413"
FT                   /protein_id="ACA70580.1"
FT                   /translation="MFDWNDLRFFLELQRSGRLLSAAKRLNTTHSTVARHIESIEKSLG
FT                   TPLFVQHAQGYELTPSGQALLKHAEAMENVALLAQEEITQAITPLGKIRLGVTEGIGIM
FT                   FFTPRMNALFDRYPGLEVELVAVPRFVSILNREAEISIHLERPSADLLITRKLTDYRLA
FT                   LYASQAYLDRAPPLRNREDLARHSWIGYVDDLLFSQELLFLNSFCRAPNVAFRSTSVIA
FT                   QQTAARAGLGIAVLPNYMARHDPTLVRILPSETIQRSYWICTRRELHKSVRLRVVWDYL
FT                   LALCAQEQAELLAE"
FT   gene            81572..83218
FT                   /locus_tag="PputW619_0075"
FT   CDS_pept        81572..83218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0075"
FT                   /product="glucose-methanol-choline oxidoreductase"
FT                   /note="PFAM: glucose-methanol-choline oxidoreductase; GMC
FT                   oxidoreductase; KEGG: pen:PSEEN0012 oxidoreductase, GMC
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70581"
FT                   /db_xref="GOA:B1J421"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B1J421"
FT                   /protein_id="ACA70581.1"
FT                   /translation="MPSADSVFDYVIVGAGPAGCLLANRLSADPSCRVLLLEAGGRDNY
FT                   PWIHIPVGYLYCIGNPRTDWCFKTAAQIGLGGRSLGYPRGKVLGGCSSINGMIYMRGQA
FT                   ADYDHWAEQGNDGWAWKDVLPLFKASENHFAGGSDHHGATGEWRVERQRYSWPILDAFR
FT                   DAAEQSGIAKVDDFNTGDNQGCGYFQVNQRSGVRWNASKAFLRPVHNRSNLTVLTGVQV
FT                   DQVLLNNTRARAVRAFWQGAWHEFAARREIILCAGAVGSPGILQRSGIGPRTLLETLGI
FT                   GVRHDMPGVGGNLQDHLQLRLIYQIRNTRTLNQMANSLWGKMGMGLRYLYDRSGPLAMA
FT                   PSQLGAFVRSSPEQLTANLQYHVQPLSLERFGEPLHRFPAFTASVCNLRPASRGRIDIR
FT                   SSDMNSAPLIDPNYLSDPQDLRVAADAIRITRRIVQAPALAAFDPQEYLPGPALQTEED
FT                   LFEAAGKIGTTIFHPVGTCRMGSGPLDVVDNQLRVRGIPGLRVADASIMPQITSGNTCS
FT                   PTLMIAEKAAQLILKGAATQTYLNEDALPTP"
FT   gene            83316..84935
FT                   /locus_tag="PputW619_0076"
FT   CDS_pept        83316..84935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0076"
FT                   /product="General substrate transporter"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: pen:PSEEN0013 major
FT                   facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70582"
FT                   /db_xref="GOA:B1J422"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B1J422"
FT                   /protein_id="ACA70582.1"
FT                   /translation="MSDYIQEQGATASSPSRREERKIIFASSLGTVFEWYDFFLYGALA
FT                   AVISKQFFAGVNDTTAFIFALMAFAAGFLVRPFGALVFGRLGDMIGRKYTFLITIVLMG
FT                   LSTFAVGLLPTYASIGIAAPIILVVLRMLQGLALGGEYGGAATYVAEHAPPGKRGFHTG
FT                   FIQSTATLGLLLSLLVVLGSRYITGDQFETWGWRLPFLLSIVLLGISTWIRMSMHESPA
FT                   FVKMKAQGKVSKSPIRESFTSWPNLKVVLTALFSINAGQAVTFYTAQFYVLFFMTQMLK
FT                   MDPAQANTLLIISVVIGAPFFVFFGWLSDRIGRKPILMLGLLLATVLYFPLFKALSHYA
FT                   NPQIDAASRQAPIVVTADPQGCTFQFDPVGKARFDSPCDKVKTFLVKQGLPYSSVNVAG
FT                   SQVVVNIGDKTINGFDETAMRTAIEQAGYPAKADPSQVNQVMVVVLIVAMILIATMTYG
FT                   PLAAVMVELFPTRIRYTSMSLPYHIGNGWFGGFLPTVSFALVVYTGDIFYGLWYPVLVT
FT                   GISLVVGIFCLKETRDVDIDKV"
FT   gene            complement(85113..85883)
FT                   /locus_tag="PputW619_0077"
FT   CDS_pept        complement(85113..85883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0077"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; KEGG:
FT                   pen:PSEEN0014 N-acylhomoserine lactone synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70583"
FT                   /db_xref="GOA:B1J423"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:B1J423"
FT                   /protein_id="ACA70583.1"
FT                   /translation="MSILQAIRIFLFYLLLGTSSLLWCSLSFFIAPFLPFHKRYRFINV
FT                   YWCRFAVLLARVILGIHYKVTGAENVPKEPCVILSNHQSTWETFFLSAYFSPLSQVLKR
FT                   ELLYVPFFGWAMAMLRPIAINRDNPKEALRQVASKGDELLKQKVWVLIFPEGTRVPFGT
FT                   VGKFSRGGTALAVNAGLPVLPIAHNAGKYWPKSGWGKRSGTIEVVIGEPMYANGTGPRA
FT                   IAELNDRAAAWNETTQRRMGSLPPVDEKPHERIA"
FT   gene            complement(85944..86471)
FT                   /locus_tag="PputW619_0078"
FT   CDS_pept        complement(85944..86471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0078"
FT                   /product="histidinol-phosphate phosphatase family protein"
FT                   /note="TIGRFAM: histidinol-phosphate phosphatase family
FT                   protein; hydrolase, HAD-superfamily, subfamily IIIA; KEGG:
FT                   pen:PSEEN0015 histidinol-phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70584"
FT                   /db_xref="GOA:B1J424"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B1J424"
FT                   /protein_id="ACA70584.1"
FT                   /translation="MKLLILDRDGVINQDSDAYIKSLEEWIPIPGSIEAIAQLSKAGWT
FT                   VAVATNQSGIARGYYSLATLEAMHARLRTLVAEQGGEVGYIVYCPHGPDEGCDCRKPKP
FT                   GMLRAIADHYQADLRGVWFVGDSKGDLEAALAVGAQPVLVKTGKGERTLEKGVAQTTLI
FT                   FDDLAAIARELI"
FT   gene            complement(86475..88526)
FT                   /locus_tag="PputW619_0079"
FT   CDS_pept        complement(86475..88526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0079"
FT                   /product="glycyl-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="KEGG: pen:PSEEN0016 glycyl-tRNA synthetase, beta
FT                   chain; TIGRFAM: glycyl-tRNA synthetase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70585"
FT                   /db_xref="GOA:B1J425"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1J425"
FT                   /protein_id="ACA70585.1"
FT                   /translation="MSAQDFLVELGTEELPPKALATLGDAFLAGIEKGLQAAGLNYTGK
FT                   QVYAAPRRLAVLIRQLDVQQPDRSINIDGPPLQAAFKDGEPTQAALGFAKKCGVELSEI
FT                   DQSGAKLRFSQHIPGKATASLLPTIVEDSLNDLPIPKRMRWAASREEFVRPTQWLVMLL
FT                   GDQVVDCTILSQQAGRESRGHRFHHPQNVVITTPANYVEDLRKAYVLADFAERRELIAK
FT                   RTTELAMQQEGTAIVPPALLDEVTALVEWPVPLVCSFEERFLEVPQEALITTMQDNQKY
FT                   FCLLDSEGKLLPRFITVANVESRDPKQIVSGNEKVVRPRLTDAEFFFKQDKKQPLETFN
FT                   ERLKNVVFQAQLGTVYDKAERVSRLAAYIAPLIGGDAQRAGRAGLLSKCDLATEMVGEF
FT                   PEMQGVAGYYYALNDGEPQDVALALNEQYMPRGAGAELPQTLTGAAVAIADKLDTLVGI
FT                   FGIGMLPTGSKDPYALRRAALGVLRILIEKQLDLDLTPAVEFAVKQFGAKVKAAGLAEQ
FT                   VLEFIFDRLRARYEDEGIDVATYLSVRALKPGSALDFDQRVQAVQAFRKLPEAEALAAV
FT                   NKRVSNLLSKAEGAIAEQVEPKYFDNANEFSLYSAIQQADQAVQPMAAARQYSESLARL
FT                   AALRDPVDAFFEAVMVNAEDAKVRANRYALLSRLRGLFLGVADISLLG"
FT   gene            complement(88523..89470)
FT                   /locus_tag="PputW619_0080"
FT   CDS_pept        complement(88523..89470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0080"
FT                   /product="glycyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="KEGG: pen:PSEEN0017 glycyl-tRNA synthetase, alpha
FT                   chain; TIGRFAM: glycyl-tRNA synthetase, alpha subunit;
FT                   PFAM: glycyl-tRNA synthetase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70586"
FT                   /db_xref="GOA:B1J426"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1J426"
FT                   /protein_id="ACA70586.1"
FT                   /translation="MSQPTPAVRTFQDLILALQNYWAAQGCVVLQPYDMEVGAGTFHTA
FT                   TFLRAVGPETWNAAYVQPSRRPADGRYGENPNRLQHYYQFQVVLKPNPANFQELYLGSL
FT                   KAIGLDPLVHDIRFVEDNWESPTLGAWGLGWEIWLNGMEVTQFTYFQQVGGIECYPVTG
FT                   EITYGLERLAMYIQGVDSVYDLVWADGPFGKVTYGDVFHQNEVEQSTYNFEHANVEKLF
FT                   ELFDFYESEANRLIKLDLPLPTYEMVLKASHTFNLLDARRAISVTERQRYILRVRTLAR
FT                   DVAQSYLQARARLGFPMATPELRDEVLAKLEAAQ"
FT   gene            89554..90105
FT                   /locus_tag="PputW619_0081"
FT   CDS_pept        89554..90105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0081"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /EC_number="3.2.2.20"
FT                   /note="KEGG: pen:PSEEN0018 3-methyl-adenine DNA glycosylase
FT                   I, constitutive; TIGRFAM: DNA-3-methyladenine glycosylase
FT                   I; PFAM: methyladenine glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70587"
FT                   /db_xref="GOA:B1J427"
FT                   /db_xref="InterPro:IPR004597"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:B1J427"
FT                   /protein_id="ACA70587.1"
FT                   /translation="MPRCFWCTDDPLYQAYHDQEWGTPQRDPALLFEMLLLEGFQAGLS
FT                   WITVLRKRERYREVLHGFDPVKLSQMSDERIEELMLDAGIIRNRLKLKAVRRNAQAWLA
FT                   VDNPAEWLWSFVGGEPKINHFSARSEVPAVTDEAKAMSKALQKAGFTFVGPTICYAFMQ
FT                   ATGMVMDHTTDCDRYAALLR"
FT   gene            90147..91034
FT                   /locus_tag="PputW619_0082"
FT   CDS_pept        90147..91034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0082"
FT                   /product="lipid A biosynthesis acyltransferase"
FT                   /note="PFAM: lipid A biosynthesis acyltransferase; KEGG:
FT                   pen:PSEEN0019 lipid A biosynthesis lauroyl acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70588"
FT                   /db_xref="GOA:B1J428"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:B1J428"
FT                   /protein_id="ACA70588.1"
FT                   /translation="MEKFKGALMVGVLRLFAKLPWGAVQRVGAGIGWLMWKVPNGSRNV
FT                   VRINLAKCFPEMDPVEREQLVGRALRDIGKSFVESACAWIWPPQRSLELVKEVHGLEVL
FT                   EQALASGKGVVGITSHLGNWEVLNHFYCNQCKPIIFYRPPKLKAVDDLLREQRVQMGNR
FT                   VAPSTKEGILSVIKEVRRGGQVGIPADPEPAESAGVFVPFLGTQALTSKFVPNMLAGGK
FT                   AVGVFLHALRLPDGSGFKVFLEAAPEEMYSTDVNVSAAAMSKVVERYVREYPSQYMWSM
FT                   KRFKKRPPGEARWY"
FT   gene            complement(91151..91459)
FT                   /locus_tag="PputW619_0083"
FT   CDS_pept        complement(91151..91459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0083"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: pen:PSEEN0021
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70589"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B1J429"
FT                   /protein_id="ACA70589.1"
FT                   /translation="MRESLEKMLAKGVDNPLLRFGLGKAWLDEGNGAEAAVHLARCVEQ
FT                   DPKYSAAWKLLGKAYQLQGDLTAARKAWEDGIVAAQAHGDKQAEKEMAVFLKKLNKA"
FT   gene            complement(91471..92844)
FT                   /locus_tag="PputW619_0084"
FT   CDS_pept        complement(91471..92844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0084"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; TrkA-C domain protein;
FT                   KEGG: pen:PSEEN0022 potassium transport protein,
FT                   NAD(P)-binding (trk family)"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70590"
FT                   /db_xref="GOA:B1J430"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:B1J430"
FT                   /protein_id="ACA70590.1"
FT                   /translation="MKIIILGAGQVGGTLAEHLASEANDITVVDTDGDRLRDLGDRLDI
FT                   RTVQGRGSLPTVLRQAGADDADMLVAVTNSDETNMVACQVAYSLFHTPTKIARVRESAY
FT                   LTREELFDNDHIPVDVLISPEQVVTNYIKRLIEHPGSLQVIDFAEGKAQLVAVKAYYGG
FT                   PLVGQQLRQIRAHMPNVDTRVAAIFRRDRPITPRGDTVIEADDEVFFIAAKKDIRAVMG
FT                   ELRRIDETNKRVVIAGGGQIGERLAEAIESRYQVKIIEMSAARCRHLSDTLESTVVLQG
FT                   SASDKDLMLEENIADADIFLALTNDDEANIMSSLLAKRLGAGKVMTIINNPAYVDLVQG
FT                   GEIDIAISPQLATIGTLLAHVRRGDIVSVHSLRRGAAEAIEAVAHGDSKSSKVIGKAIE
FT                   DIALPPGTTIGAIIRDEQVLIAHDDTVIESGDHVILFVVDKKHIRDVEKLFHVGLSFF"
FT   gene            complement(92867..94177)
FT                   /locus_tag="PputW619_0085"
FT   CDS_pept        complement(92867..94177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0085"
FT                   /product="sun protein"
FT                   /note="TIGRFAM: sun protein; PFAM: Fmu (Sun) domain
FT                   protein; NusB/RsmB/TIM44; KEGG: pen:PSEEN0023 ribosomal RNA
FT                   small subunit methyltransferase B (rRNA
FT                   (cytosine-C(5)-)-methyltransferase) (16S rRNA m5C967
FT                   methyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70591"
FT                   /db_xref="GOA:B1J431"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:B1J431"
FT                   /protein_id="ACA70591.1"
FT                   /translation="MNPRLAAARALAAVLSGKASLNSSLPAQLDKVDERDRGLTQDLAF
FT                   GTARWQPRLDLLAAQLLQKPFKAADADVQALLLIGLYQLFYTRIPAHAAIGETVGCADK
FT                   LKKPWAKGLLNAVLRRAQREGEALLAGMERDPVVRTAHPRWLQKALKAFWPEQWEAICA
FT                   ANNAHPPMILRVNRRHHSRDAYLALLTETGVGASACQFSRDGIVLTEACDVRSLPGFAE
FT                   GWVSVQDEAAQLSADLLELAPGQRVLDACCAPGGKTCHLLEAEAGLGHLVAIDLEAKRL
FT                   TRVRENLERLQLDAELIACDARDTASWWDGKPFQRILLDAPCSATGVIRRHPDIKLTRQ
FT                   ADDIPALAALQGELLDALWPTLEVGGMLLYATCSSLPTENTEVIGAFLARTPGARELDL
FT                   ATEAGIRQPHGRQLLAQEGGHDGFYYAKLIKIAASRG"
FT   sig_peptide     complement(94112..94177)
FT                   /locus_tag="PputW619_0085"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.884) with cleavage site probability 0.547 at
FT                   residue 22"
FT   gene            complement(94174..95106)
FT                   /locus_tag="PputW619_0086"
FT   CDS_pept        complement(94174..95106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0086"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /note="TIGRFAM: methionyl-tRNA formyltransferase; PFAM:
FT                   formyl transferase domain protein; KEGG: pen:PSEEN0024
FT                   methionyl-tRNA formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70592"
FT                   /db_xref="GOA:B1J432"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1J432"
FT                   /protein_id="ACA70592.1"
FT                   /translation="MRIVFAGTPEFAAEHLKALLDSPYEIVAVYTQPDRPAGRGQKLMP
FT                   SAVKALAVAHDIPVFQPPTLRNEDAQAELAALKPDLMVVVAYGLILPQVVLDIPRLGCI
FT                   NSHASLLPRWRGAAPIQRAVEAGDAESGVTVMRMEAGLDTGPMLLKVVTPISADDTGGS
FT                   LHDRLAAMGPAAVVQAIAGLADGSLQGEVQDDALATYAHKLNKDEARIDWSRPAVELER
FT                   LIRAFNPWPVCHSTLDGESVKVLAAKLSTGEGAPGEILSASKDGLVVACGDQALSLTRL
FT                   QLPGGKALAFTDLFNSRREKFATGKVLGQ"
FT   gene            complement(95166..95672)
FT                   /locus_tag="PputW619_0087"
FT   CDS_pept        complement(95166..95672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0087"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="KEGG: pen:PSEEN0025 peptide deformylase 1; TIGRFAM:
FT                   peptide deformylase; PFAM: formylmethionine deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70593"
FT                   /db_xref="GOA:B1J433"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:B1J433"
FT                   /protein_id="ACA70593.1"
FT                   /translation="MAILNILEFPDPRLRTIAKPVTEFDDALRQLIDDMFETMYEAPGI
FT                   GLAATQVNVHKQIVVMDLSEDRSEPRVFINPSVEELTHDMGQYQEGCLSVPGFYENVDR
FT                   PLRVRVKAQDRDGKPFELEAEGLLAVCVQHEFDHLNGKLFVDYLSQLKRDRIKKKLEKQ
FT                   HRQQA"
FT   gene            95879..96976
FT                   /locus_tag="PputW619_0088"
FT   CDS_pept        95879..96976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0088"
FT                   /product="DNA protecting protein DprA"
FT                   /note="TIGRFAM: DNA protecting protein DprA; PFAM: SMF
FT                   family protein; KEGG: pen:PSEEN0026 smf protein, DNA
FT                   processing chain A"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70594"
FT                   /db_xref="GOA:B1J434"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:B1J434"
FT                   /protein_id="ACA70594.1"
FT                   /translation="MPFHHSSLCPPAELEARLRLHRLPETGLRRFHTLLQAFGSASSAL
FT                   SAPAGAWRALGIAQATIDARRSAEVRDGALAAMAWIEHPGQHLLMWDSPGYPALLGEID
FT                   DAPPLLFVAGDPALLERPQLAIVGSRRASPPALDTAKAFSRYLSQAGFTITSGLALGID
FT                   GAAHRAALQAGGGTIGVLGTGLQKLYPQRHRDLAKAMIDSGSALVSEYPLDAGPLPGNF
FT                   PRRNRIISGLSLGVLVVEASLASGSLITARLAAEQGREVYAVPGSIHHPGAKGCHQLIR
FT                   DGALLVESVGQILESLQGWQNLPPAVVDKPSHPLLALLHAAPQTSEALAACSELPLAQV
FT                   LAQLTELELEGRVTNEAGRWFARAG"
FT   gene            97015..97572
FT                   /locus_tag="PputW619_0089"
FT   CDS_pept        97015..97572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0089"
FT                   /product="SUA5/yciO/yrdC domain"
FT                   /note="PFAM: SUA5/yciO/yrdC domain; KEGG: pen:PSEEN0027
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70595"
FT                   /db_xref="GOA:B1J499"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR023535"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1J499"
FT                   /protein_id="ACA70595.1"
FT                   /translation="MVSSWRVQQAAREIRAGAVIAYPTEAVWGLGCDPWNEDAVYRLLA
FT                   LKSRPVDKGLILVADNIRQFDFLFEDFPEDWIDRMGSTWPGPNTWLVPHQDLLPEWVTG
FT                   QHDTVALRVSDHPQVRELCALVGPLISTSCNPGGRPAAKSRLRVEQYFHGDLDMVLGGA
FT                   LGGRKNPSVIRNLATGEIVRPG"
FT   gene            97956..98258
FT                   /locus_tag="PputW619_0090"
FT   CDS_pept        97956..98258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0090"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN0028 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70596"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4A0"
FT                   /protein_id="ACA70596.1"
FT                   /translation="MIKKLVPDPPLPCTSTRPFGRCDAGHSALFTVNPDISAADALVHV
FT                   ALYLRCAYETGYKTLDYLREEGRGMYWSNLHAIEMAEGLVEAMLDGIESAPAQQR"
FT   gene            complement(98366..99343)
FT                   /locus_tag="PputW619_0091"
FT   CDS_pept        complement(98366..99343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0091"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   pen:PSEEN0029 quinone oxidoreductase, NADPH-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70597"
FT                   /db_xref="GOA:B1J4A1"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4A1"
FT                   /protein_id="ACA70597.1"
FT                   /translation="MAKRIQFSQHGGPEVLQLVEFDPAPPGAQQVRVRNHAIGLNFIDT
FT                   YFRSGLYAPPALPSCLGTEGAGVVEAVGEGVTRLKVGDRVAYGGGPLGAYSEVHTLPEA
FT                   NLVKLPDNISFEQAAAVMLKGLTVQYLLKQTYAVQPGDVILFHAAAGGVGSLACQWAKA
FT                   LGAKLIGTVSSAEKAERAKALGAWETIDYSREDVAKRVLELTDGKKCPVVYDGVGADTW
FT                   LTSLDCLQPRGLMVSFGNASGAVSGVNLGILAQKGSLYVTRPTLASYANNAENTQAMAD
FT                   DLFAVIASGKVVVDIQQRYPLSEAAKAQSELSARRTVGSTVLLP"
FT   gene            99478..100389
FT                   /locus_tag="PputW619_0092"
FT   CDS_pept        99478..100389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0092"
FT                   /product="Coproporphyrinogen oxidase"
FT                   /EC_number="1.3.3.3"
FT                   /note="PFAM: coproporphyrinogen III oxidase; KEGG:
FT                   pen:PSEEN0030 coproporphyrinogen III oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70598"
FT                   /db_xref="GOA:B1J4A2"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1J4A2"
FT                   /protein_id="ACA70598.1"
FT                   /translation="MTSRTEAVKAYLLDLQDRICSALETEDGGARFVEDAWVREAGGGG
FT                   RTRVIGDGKLIEKGGVNFSHVFGSGLPPSASAHRPELAGRGFEALGVSLVIHPHNPHVP
FT                   TSHANVRFFIAEKEGEEAVWWFGGGFDLTPYYGNEEDCIHWHRVAEQACAPFGADVYPR
FT                   YKAWCDRYFHIKHRGEPRGIGGLFFDDLNEWGFDTCFAFIRAIGDAYVDAYLPIVQRRK
FT                   DTPYTAEQREFQEYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPQVRWGYDWKA
FT                   APGSEEARLTEYFLQDRDWLAH"
FT   gene            100415..101239
FT                   /locus_tag="PputW619_0093"
FT   CDS_pept        100415..101239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0093"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /note="TIGRFAM: shikimate 5-dehydrogenase; PFAM:
FT                   Shikimate/quinate 5-dehydrogenase; Shikimate dehydrogenase
FT                   substrate binding domain protein; KEGG: pen:PSEEN0031
FT                   shikimate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70599"
FT                   /db_xref="GOA:B1J4A3"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4A3"
FT                   /protein_id="ACA70599.1"
FT                   /translation="MDQYVVFGNPIGHSKSPLIHRLFAEQTGQDLEYATLLAPLDEFSD
FT                   CARGFFKQGRGANVTVPFKEEAYRLCDSLTPRAQRAGAVNTLSKLADGSLRGDNTDGAG
FT                   LVRDLTVNAGVELTGKRILILGAGGAVRGVLEPILAHDPQSLVIANRTLEKAEQLAREF
FT                   DEMGPVMASGFAWLQEPVDVIINATSASLSGELPPIADSLVEAGRTVCYDMMYGKEPTP
FT                   FCQWASKLGAAKVLDGLGMLAEQAAEAFFIWRGVRPETAPVLAELRRQLARG"
FT   gene            complement(101331..102896)
FT                   /locus_tag="PputW619_0094"
FT   CDS_pept        complement(101331..102896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0094"
FT                   /product="sulphate transporter"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; Xanthine/uracil/vitamin C permease;
FT                   sulphate transporter; KEGG: pen:PSEEN0032 sulfate
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70600"
FT                   /db_xref="GOA:B1J4A4"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4A4"
FT                   /protein_id="ACA70600.1"
FT                   /translation="MPRLNHLLPFLTWLPRQSGRSLREDLLVGLSGAILALPQSIAYAL
FT                   IAGLPAEYGLYAAIVPVLVACLWGSSWYLICGPTAAISIVLYASISPLAVAGSADYVTL
FT                   VLLLTFLAGIFQLLLGLLRFGALVNFVSHSVVLGFTLGAAIVIALGQLPNLLGMDLPSQ
FT                   ATAFKTVQDLASHAGEVDLPSLILGLGTVLVGMAFKLWRPRWPSLLISLIVISLVAWLL
FT                   PGFFGHVPRVPAFTGQLPPVSPLPLLDVELMLRLLPSAVAVGMLGLVTSLSIARSLSAR
FT                   SEQLIDADQEIRAQGMSNIVGSFFSGYLSSGSFTRSGLSYDAGARSPMAGVFSALWVAL
FT                   FAVTGAGLIAHLPIPAMAGSILLICWGLVDHRGIRALFRVSRSEFLVMALTAAATLLLE
FT                   LQTAIYAGVLASLFFYLKRTSRPRVQQSREGQADVLRVGGSIFFGAAHYLQVRLQRCQG
FT                   PHVVIDARQVNFIDYSGVDMLHREARRLRRAGGSLTLLRARPQVVEELQKLEGVELCPI
FT                   QFAE"
FT   gene            complement(103050..103973)
FT                   /locus_tag="PputW619_0095"
FT   CDS_pept        complement(103050..103973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0095"
FT                   /product="choline ABC transporter, periplasmic binding
FT                   protein"
FT                   /note="TIGRFAM: choline ABC transporter, periplasmic
FT                   binding protein; PFAM: Substrate-binding region of ABC-type
FT                   glycine betaine transport system; KEGG: pen:PSEEN0033
FT                   glycine betaine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70601"
FT                   /db_xref="GOA:B1J4A5"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR017783"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4A5"
FT                   /protein_id="ACA70601.1"
FT                   /translation="MQKFSTIVFALALSLGTATAHAENAQCSTVRMADPGWSDIATTNA
FT                   IARLLLESLGYQVKIDSLAVPIIYGGLKDGKVDAFLGNWMPAHQGFHDKFVANGDVHQL
FT                   SRNLEGTEFTLAVPDYVWDAGVKSFADLQQHADQFDKKLYGIGSGAPANLSLKEIIDKN
FT                   EFDLGQWKLVESSEQAMLAQVDRAVKKNQYITFLGWTPHPMNVKLKMHYLTGGEKWFGS
FT                   KGEVYTLTRKGYPQACPNPAKLLGNLTFTLDMENSIMAEVVDKKISFDEAAKAWVKAHP
FT                   DLLQKWLDGVTTSSGGDAKEAVNAKL"
FT   sig_peptide     complement(103905..103973)
FT                   /locus_tag="PputW619_0095"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 23"
FT   gene            complement(103988..105505)
FT                   /locus_tag="PputW619_0096"
FT   CDS_pept        complement(103988..105505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0096"
FT                   /product="choline-sulfatase"
FT                   /note="TIGRFAM: choline-sulfatase; PFAM: sulfatase; KEGG:
FT                   pen:PSEEN0034 choline sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70602"
FT                   /db_xref="GOA:B1J4A6"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017785"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="InterPro:IPR025863"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4A6"
FT                   /protein_id="ACA70602.1"
FT                   /translation="MTQPNILFIMADQMAAPILPIYGPSPIQMPHLSRLADQAVVFDSA
FT                   YCNSPLCAPSRFTLVSGQLPSRIGAYDNAADFPADIPTYAHYLRRLGYRTALSGKMHFC
FT                   GPDQLHGYEERLTSDIYPADYGWAVNWDAPDKRASWYHNMSSVLQAGPCVRTNQLDFDE
FT                   EVVFKARQYLYDHVRENDGRPFCLTVSMTHPHDPYTIPKRYWDRYEGVDIPMPRTEFGQ
FT                   HELDPHSQRLLKVYDLWNKPLPVDKIRDARRAYFGACSYIDDNIGQLLQTLEECNLADD
FT                   TLVVFSGDHGDMLGERGLWYKMHWFEMSARVPLLVHAPKRFAPTRVSASVSTCDLLPTL
FT                   VELAGGTVDKSLHLDGQSLLGHLQGQGGHDQVIGEYMAEGTVGPLMMIRRGSYKFVYSE
FT                   DDPCLLYDLSRDPHERENLTGSPDHQALLQAFVDEARQRWDIPGLRQQVLASQRRRRLV
FT                   AEALAIGKLKSWDHQPLVDASQQYMRNHIDLDDLERKARYPQPAPLD"
FT   gene            105615..106514
FT                   /locus_tag="PputW619_0097"
FT   CDS_pept        105615..106514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0097"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="TIGRFAM: choline sulfate-utilization transcription
FT                   factor; PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: pen:PSEEN0035 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70603"
FT                   /db_xref="GOA:B1J4A7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR017786"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4A7"
FT                   /protein_id="ACA70603.1"
FT                   /translation="MFDHLADLSLDALRVFEAAARLRGFTAAALELGTTQPAVSQQVKR
FT                   LEARLGTRLFDRIYRGIALTDAGQLLFEQVHQGLQAMDDGIAQASGRGQREVLQVATDF
FT                   AFAAFWLMPRLQRFHDAYPQVDVSLVTGERSQGMLRPDIDVAVLFGDGRFHQGESRWLF
FT                   DEEVFPVCSPRLTHGKPLSAAALQRLPLLHLRGEQASRWFDWAGVFRGFGVQSPPPPGQ
FT                   LRFDNYTLLVQAAIAGQGVAIGWRHLVDGLVEQGLLCRPLEGSLRSARGYYVVLPPRKR
FT                   RGALIERFVDWLEDERSQ"
FT   gene            complement(106608..107156)
FT                   /locus_tag="PputW619_0098"
FT   CDS_pept        complement(106608..107156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0098"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pfo:Pfl_0028 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70604"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4A8"
FT                   /protein_id="ACA70604.1"
FT                   /translation="MKNAETPVFKLVLFGAESSLGSALMVELLSRQHEVTAVVDDLNRH
FT                   APRPGLHFKIGGLGDADQAEQGAAGGSAVIALLSALASGDLAAQGRMSEALVAGLSRTT
FT                   IRRVLLVGDFDVLDAPGKYTEAERECVDQVVDALQRSPLHWTLINAPQALMDLERMAAG
FT                   MADMLELDLHRGEHLNFVT"
FT   gene            107210..107542
FT                   /locus_tag="PputW619_0099"
FT   CDS_pept        107210..107542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0099"
FT                   /product="Dopa 45-dioxygenase"
FT                   /note="PFAM: Dopa 45-dioxygenase; KEGG: pen:PSEEN0036
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70605"
FT                   /db_xref="GOA:B1J4A9"
FT                   /db_xref="InterPro:IPR014980"
FT                   /db_xref="InterPro:IPR023389"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4A9"
FT                   /protein_id="ACA70605.1"
FT                   /translation="MQRIKGYHAHVYYDASTIEQARELCEEAARLFPVTMGRMHEKPVG
FT                   PHPDWSCQLAFGPEVLGVVLPWLALYRKGLVVFLHPLTGDELADHRDHAIWMGALRPLK
FT                   LSVFGG"
FT   gene            complement(107591..108400)
FT                   /locus_tag="PputW619_0100"
FT   CDS_pept        complement(107591..108400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0100"
FT                   /product="tryptophan synthase, alpha subunit"
FT                   /EC_number="4.2.1.20"
FT                   /note="KEGG: pen:PSEEN0037 tryptophan synthase alpha
FT                   subunit; TIGRFAM: tryptophan synthase, alpha subunit; PFAM:
FT                   tryptophan synthase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70606"
FT                   /db_xref="GOA:B1J4B0"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1J4B0"
FT                   /protein_id="ACA70606.1"
FT                   /translation="MSRLEQRFAELKAEGRSALVTFVTAGDPGYDASLQILKGLPAAGA
FT                   DVIELGMPFTDPMADGVAIQLATLRALEAGQNLAKTLQMVREFRVDNQATPIVLMGYYN
FT                   PIHRFGVEKFVAEAKEAGVDGLIIVDLPPEHDAELATPAQAAGIDFIRLTTPTTDDARL
FT                   PRVLERSSGFVYYVSVAGVTGAGSATTEHVTEAIARLRRHTDLPISVGFGIRTPEQAAA
FT                   IARLADGVVVGSALVDKIAQAKDADQAVADVLSLCSALAEGVRGARR"
FT   gene            complement(108397..109614)
FT                   /locus_tag="PputW619_0101"
FT   CDS_pept        complement(108397..109614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0101"
FT                   /product="tryptophan synthase, beta subunit"
FT                   /note="TIGRFAM: tryptophan synthase, beta subunit; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   KEGG: pen:PSEEN0038 tryptophan synthase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70607"
FT                   /db_xref="GOA:B1J4B1"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1J4B1"
FT                   /protein_id="ACA70607.1"
FT                   /translation="MTQSQYRPGPDANGLFGSFGGRYVAETLMPLVLDLAREYEAAKAD
FT                   PKFLEELAYFQRDYIGRPNPLYFAERLTEHCGGAKIFFKREELNHTGAHKVNNCIGQVL
FT                   LAKRMGKKRLIAETGAGMHGVATATVAARFGLPCVIYMGATDIERQQANVFRMKLLGAE
FT                   IVPVTAGTGTLKDAMNEALRDWVTNVDDTFYLIGTVAGPHPYPAMVRDFQSIIGKETRA
FT                   QLQEKEGRLPDSLIACVGGGSNAMGLFHEFLEDESVKIIGVEAGGHGVNTGKHAASLNG
FT                   GVPGVLHGNRTYLLQDDDGQITDAHSISAGLDYPGIGPEHAYLHEVKRVEYVSITDDEA
FT                   LDAFHATCRLEGIIPALETSHALAEAIKRAPNLPKDHLMVICLSGRGDKDMQTVMNHMA
FT                   AQEKQA"
FT   gene            109725..110621
FT                   /locus_tag="PputW619_0102"
FT   CDS_pept        109725..110621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0102"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: pen:PSEEN0039 transcriptional
FT                   regulator TrpI"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70608"
FT                   /db_xref="GOA:B1J4B2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037418"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4B2"
FT                   /protein_id="ACA70608.1"
FT                   /translation="MAHDLPPLNALRAFESTARLNSVSQAAEALHVTHGAVSRQIKVLE
FT                   EHLGVALFVKDGRGIKLTDAGVRLRDASGEAFDRLRSVCAELSRDVSEAPFVLGCSGSL
FT                   LARWFIPRLGRLKADLPELRLHLSAGEGDLDPRRPGLDALLVYAEPPWPADMQVHVLAE
FT                   ERIGPVLSPHFTGFERLRSAPTVALLDEALLHTTSRPQAWPTWAGQQGLDPAALQYGQA
FT                   FEHLYYLLEAAVAGLGVAIAPQPLVADDLRAGRLSAPWGFSPTAAALALWVPRRAADGR
FT                   AEQLAQWLRRELERQAG"
FT   gene            complement(110618..110941)
FT                   /locus_tag="PputW619_0103"
FT   CDS_pept        complement(110618..110941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0103"
FT                   /product="protein of unknown function DUF883 ElaB"
FT                   /note="PFAM: protein of unknown function DUF883 ElaB; KEGG:
FT                   pen:PSEEN0040 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70609"
FT                   /db_xref="GOA:B1J4B3"
FT                   /db_xref="InterPro:IPR010279"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4B3"
FT                   /protein_id="ACA70609.1"
FT                   /translation="MHRNSLRKTSLESMEAEIESLLKSLESLKHDASEESQKSVKAIRS
FT                   NAESALKHSRSLLSDAYEEVKTRTRQTGIATRDYAQEHPVTTAGVAIGALGLLAAYLLY
FT                   RRN"
FT   gene            111092..111307
FT                   /locus_tag="PputW619_0104"
FT   CDS_pept        111092..111307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0104"
FT                   /product="protein of unknown function DUF1458"
FT                   /note="PFAM: protein of unknown function DUF1458; KEGG:
FT                   pen:PSEEN0041 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70610"
FT                   /db_xref="InterPro:IPR009923"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036694"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4B4"
FT                   /protein_id="ACA70610.1"
FT                   /translation="MTDHHTYKKIELVGSSTTSIEDAINNALAEAAKSIKHLEWFEVVD
FT                   TRGHIEGNKVAHFQVTLKVGFRIANS"
FT   gene            111410..111631
FT                   /locus_tag="PputW619_0105"
FT   CDS_pept        111410..111631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0105"
FT                   /product="protein of unknown function DUF1161"
FT                   /note="PFAM: protein of unknown function DUF1161; KEGG:
FT                   pen:PSEEN0042 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70611"
FT                   /db_xref="InterPro:IPR010595"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4B5"
FT                   /protein_id="ACA70611.1"
FT                   /translation="MKKLILAVGLMTLAGGALAAGKPCEELKAEIAAKLDAKGVKGYTL
FT                   EIVSKGDPAGKVVGSCEGGSKEIVYRRG"
FT   sig_peptide     111410..111469
FT                   /locus_tag="PputW619_0105"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 20"
FT   gene            complement(111729..112733)
FT                   /locus_tag="PputW619_0106"
FT   CDS_pept        complement(111729..112733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0106"
FT                   /product="luciferase family protein"
FT                   /note="PFAM: luciferase family protein; KEGG: pen:PSEEN0043
FT                   luciferase-like monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70612"
FT                   /db_xref="GOA:B1J4B6"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019949"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4B6"
FT                   /protein_id="ACA70612.1"
FT                   /translation="MTQLRDLKISTLDLVPVRADSGPAQALRNSLDLAQHVERFGYNRF
FT                   WVAEHHNMDGIASSATSVLIGYLAGGTSTIRVGSGGVMLPNHAPLVIAEQFGTLASLYP
FT                   GRIDLGLGRAPGSDQMTARALRRERSGSADDFPDDVEELSRYLGPRTDDQKVIAVPGHD
FT                   TEVPMWLLGSSLFSAQLAGMRGMPYAFASHFAPRYMHEAIRIYRDHFKPSTTLDKPYVM
FT                   LGIPMVVAETDDKAEFLATSVYQRILALIRGQSLMQRKPVPSMDGLWLPHERDAVGSFL
FT                   GLAMIGNPQKVKAKVEVLLEQTGADELIFTCDLYEHEDRIRSYELLAQALKSE"
FT   gene            112888..113313
FT                   /locus_tag="PputW619_0107"
FT   CDS_pept        112888..113313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0107"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: pap:PSPA7_0059
FT                   osmotically inducible protein OsmC"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70613"
FT                   /db_xref="GOA:B1J4B7"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019904"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4B7"
FT                   /protein_id="ACA70613.1"
FT                   /translation="MKKTASAIWQGGLKDGKGVISTESGALKQNPYGFNTRFEGSPGTN
FT                   PEELIGAAHAGCFSMALSMMLGEAGLTPDRIDTIAEVTLEKQPDGFAITAVHLVLKAKV
FT                   PGASEAQFLDIANKAKAGCPVSKVLNAKISLDATLVG"
FT   gene            113387..113617
FT                   /locus_tag="PputW619_0108"
FT   CDS_pept        113387..113617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0108"
FT                   /product="protein of unknown function DUF1161"
FT                   /note="PFAM: protein of unknown function DUF1161; KEGG:
FT                   pen:PSEEN0044 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70614"
FT                   /db_xref="InterPro:IPR010595"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4B8"
FT                   /protein_id="ACA70614.1"
FT                   /translation="MIRVAIAVLASLLATSALAAVKPCEELKAEIEAKIQAQGVPSYTL
FT                   EIVPNSEVKDQNMIVGSCDGGTKKIIYQKNG"
FT   sig_peptide     113387..113446
FT                   /locus_tag="PputW619_0108"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 20"
FT   gene            complement(113657..114070)
FT                   /locus_tag="PputW619_0109"
FT   CDS_pept        complement(113657..114070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0109"
FT                   /product="lipoprotein"
FT                   /note="KEGG: pen:PSEEN0045 lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70615"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4B9"
FT                   /protein_id="ACA70615.1"
FT                   /translation="MRQPMMLMALSALGACASPLPPVDPKQAWVDLYTITPGRVIMADK
FT                   LDGKRLEDGRYFQVTPGKHELVVRFDYEIYGGGMMSQPRDRTCYLTVRFDDFKAGERYR
FT                   LEARAPVMEPQVLLYDASRTVVVNEPSNVFCIP"
FT   sig_peptide     complement(114017..114070)
FT                   /locus_tag="PputW619_0109"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.995 at
FT                   residue 18"
FT   gene            complement(114126..114539)
FT                   /locus_tag="PputW619_0110"
FT   CDS_pept        complement(114126..114539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0110"
FT                   /product="lipoprotein"
FT                   /note="KEGG: pen:PSEEN0046 lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70616"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4C0"
FT                   /protein_id="ACA70616.1"
FT                   /translation="MRALFVAGSMLLMSACSTLPDPDPNQAWIDLTPHDETSLHAVQVD
FT                   ERDWADTRYFEVQPGSHELTVRYQFPVTPSNIGPVGEPLWRDCQLNLTFKDFNAGQRYQ
FT                   LQAGSIGFRPWIKLYDHQQKLVSQGLPAGCQRT"
FT   sig_peptide     complement(114483..114539)
FT                   /locus_tag="PputW619_0110"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.715) with cleavage site probability 0.609 at
FT                   residue 19"
FT   gene            114606..115697
FT                   /locus_tag="PputW619_0111"
FT   CDS_pept        114606..115697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0111"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN0047 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70617"
FT                   /db_xref="InterPro:IPR014553"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4C1"
FT                   /protein_id="ACA70617.1"
FT                   /translation="MVWFFLLRRSGPGPLDRVFSTLVPVLGAFLLSGCSSLSYYGQLAD
FT                   GQWQLLRARQPVERVLADPASSPQLRARLQHAEQARLFASKRLGLPDNGSYRVYADLGR
FT                   PYVVWNVFATPELSLQPVTHCFPIAGCVAYRGYYQQGAARGAAAVMRQAGMDVYVSGVE
FT                   AYSTLGWFDDPILSSMVGWGDERLAALIFHELAHQRLYVQDDTEFNESFATFVEQEGTR
FT                   QWRAARGLEATQGEQSLQRDQFIRLILASRERLQALYAGPLDDAHKRAAKQAEFERLRR
FT                   DYRQVRDSQWAGDKRYDAWMYGPMSNAKLLPFGLYDQWVPAFAVVFREAGGDWVRFYQK
FT                   VEALGRLPAEQRKAVLARLVASQ"
FT   gene            complement(115753..116427)
FT                   /locus_tag="PputW619_0112"
FT   CDS_pept        complement(115753..116427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0112"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; HAD-superfamily hydrolase, subfamily IA, variant
FT                   1; PFAM: Haloacid dehalogenase domain protein hydrolase;
FT                   KEGG: pen:PSEEN0048 hydrolase, HAD family"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70618"
FT                   /db_xref="GOA:B1J4J4"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4J4"
FT                   /protein_id="ACA70618.1"
FT                   /translation="MNLTTETTMHQQNILFDLDGTLTDPRLGITRSIQYALAKLGIDEP
FT                   DLARLEHFIGPPLLQAFMQFYRFDEAKAWEAVNFYRERFRVTGLYENLVFEGVPELLQA
FT                   LNGQGRTLYIATSKPWEFAREIARHFAFDHHFKVIYGSELDGTRTNKVELIRHLLDEEG
FT                   LDPAQTLMIGDRKHDLIGARSNGLQAVAVGYGFGSEEELKAHTPEFHYATLAEMHQAFI
FT                   KA"
FT   gene            complement(116424..116972)
FT                   /locus_tag="PputW619_0113"
FT   CDS_pept        complement(116424..116972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0113"
FT                   /product="transferase"
FT                   /note="KEGG: pen:PSEEN0049 transferase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70619"
FT                   /db_xref="GOA:B1J4J5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4J5"
FT                   /protein_id="ACA70619.1"
FT                   /translation="MAIRSFQQHTPKVGPRAFVDRSAVVLGDVEIGEDSSVWPLTVIRG
FT                   DMHRISIGARTSVQDASVLHITHAGPFNPDGFPLIIGDDVTIGHKVMLHGCTLGNRILV
FT                   GMGSTIMDGAIVEDEVIIGAGSLVPPGKRLESGYLYVGSPVKQARPLTDKERAFFPYSA
FT                   GNYVKLKDQHLAEGYDRPE"
FT   gene            117039..119126
FT                   /locus_tag="PputW619_0114"
FT   CDS_pept        117039..119126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0114"
FT                   /product="Oligopeptidase A"
FT                   /EC_number="3.4.24.70"
FT                   /note="PFAM: peptidase M3A and M3B thimet/oligopeptidase F;
FT                   KEGG: pen:PSEEN0050 oligopeptidase A"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70620"
FT                   /db_xref="GOA:B1J4J6"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4J6"
FT                   /protein_id="ACA70620.1"
FT                   /translation="MGQCFFCQGSQTVSANNPLLQSYDLPPFSAIRAEHVLPAIEEILA
FT                   DNRKAIAQILEKQGKNPTWAGLVLAMDELNDRLGAAWSPVSHLNAVCNSKELREAYESC
FT                   LPVLSAYSTELGQNRALFEAYEALANSPEAAGFDVAQKTILEHALRDFRLSGIDLPPAQ
FT                   QQRYAQVQSKLSELGSRFSNQLLDATQAWTKHVTDEAALAGLTDSAKAQMAAAAQAKGL
FT                   DGWLITLEFPSYYAVMTYASDRALREELYAAYCTRASDQGPNAGQFDNGPVMREILDLR
FT                   QELAGLLGYKNYAELSLATKMAESSDQVLSFLRDLAKRSKPFAAQDLEQLKAYAAEQGC
FT                   PELASWDAGYFGEKLREQRYSVSQETLRAYFPIDKVLSGLFSIVQRLYGIEIAELKGFD
FT                   SWHPDVRLFEIKENGQHVGRFFFDLYARANKRGGAWMDGARDRRRTAGGELQSPVANLV
FT                   CNFTPAAPGKPALLTHDEVTTLFHEFGHGLHHLLTRIEHAGVSGINGVAWDAVELPSQF
FT                   MENWCWEPEGLALISGHYETGAALPQDLLDKMLAAKNFQSGMMMVRQLEFSLFDFELHA
FT                   SHGDGRSVLQVLEGVRDEVTVMRPPAYNRFPNSFAHIFAGGYAAGYYSYKWAEVLSADA
FT                   FSRFEEEGVLNAETGRAFREAILARGGSREPMVLFVDFRGREPSIDALLRHCGLSEDAA
FT                   A"
FT   gene            119123..119404
FT                   /locus_tag="PputW619_0115"
FT   CDS_pept        119123..119404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0115"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   pen:PSEEN0051 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70621"
FT                   /db_xref="InterPro:IPR012658"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4J7"
FT                   /protein_id="ACA70621.1"
FT                   /translation="MSEVAVNKTKKRFIAGAVCPACSEPDKLMMWSEDDVPHRECVACG
FT                   FTDTLNEQGLSVPKELGTRVNHLAPKAAPAKVQTVQFFPNPKLKKPAD"
FT   gene            119503..121497
FT                   /locus_tag="PputW619_0116"
FT   CDS_pept        119503..121497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0116"
FT                   /product="peptidase M3A and M3B thimet/oligopeptidase F"
FT                   /note="PFAM: peptidase M3A and M3B thimet/oligopeptidase F;
FT                   KEGG: pfo:Pfl_0088 oligopeptidase A"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70622"
FT                   /db_xref="GOA:B1J4J8"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4J8"
FT                   /protein_id="ACA70622.1"
FT                   /translation="MNNPLLPGSNSPIDFPSITLENMAAAFDHVLSAHEQGIARIIERQ
FT                   QAQPTWDDLVLAVDELDAQLSGTLFAVIPFVGRDQDWAESILGFYGRTVARSEQKFTDS
FT                   KLHALYERLARSAIGVNLAAMKRATLRRHLDRFATSGAALDDDDKARLAGLQAQIGTLR
FT                   EAFVRNIDRPGLLIEDERELIGLSQRLRDELAVRASEAGLQGWLVACESAPTEAVLRQA
FT                   KHRPLRERLYRAFHTRGVNTGLQEDNGTRLQRLAELLDEKARLLGFASHLELSLNCKSA
FT                   GSVSAVRGFLQTLAASVQPAMQRWRESLGQKALVTGLTRVQPWDVIHLQALSEHAQPSE
FT                   VFREHFPLSAVVTALTRLAQQLFKLELRPARMPVWDGSVQTFEVWQDHAHIGLFYLDAV
FT                   QHAGKQADAVFTTYVRNRRVDAEGIYHAAVVVVNVDIPAALGASEPLLDHLALRKLYHE
FT                   FGHALHHLLVRTSNNVMSNVSELGTDGMELFGKLMERWVWDAGYLASIAVPDQSGGRLS
FT                   KAGAAEYLNQFKQEGVEEIGRDLSLALFDMDLHGTPYDGRTLEQRLDDARERCGYWPLA
FT                   DFEHPAHAFDHLVSGYDAGYYAYLWADVHAFDLFTRFETNGLLDRATGHALQQALFEPG
FT                   ASRPLREGLEAFLGRAPSHAPYLSWHGLA"
FT   gene            121563..122621
FT                   /locus_tag="PputW619_0117"
FT   CDS_pept        121563..122621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0117"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: pen:PSEEN0052 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70623"
FT                   /db_xref="GOA:B1J4J9"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR040086"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4J9"
FT                   /protein_id="ACA70623.1"
FT                   /translation="MNSPAPQKGRGTAHNPHNRFAPSHSVAEDDGWYVEVPLTQGTEVR
FT                   VETAKTIISRNTSPDLPFDRSINPYRGCEHGCIYCYARPSHAYWDLSPGLDFETKLIAK
FT                   TNAAEVLAEQLSKPGYVCAPINLGANTDPYQPIEREHLLTRRLLEVLLRFRHPVTIVTK
FT                   GSLVLRDLDLLAEMASQRLVRVMISLTTLDDDLKRVLEPRAASPKARLRAIRVLREAGV
FT                   PVGVLCSPMIPMINDSELEHLLEAAKEAGAQNAAYMMLRLPMEVAPLFEQWLQDHYPQR
FT                   ASHVLSLIRQSRGGELYDSRFGARMRGEGIFAELLAQRFAKAMRKLGLEGREAQMLDCS
FT                   AFCPPGGQMALF"
FT   gene            122893..123612
FT                   /locus_tag="PputW619_0118"
FT   CDS_pept        122893..123612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0118"
FT                   /product="Carbonate dehydratase"
FT                   /EC_number="4.2.1.1"
FT                   /note="PFAM: carbonic anhydrase; KEGG: pen:PSEEN0053
FT                   carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70624"
FT                   /db_xref="GOA:B1J4K0"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4K0"
FT                   /protein_id="ACA70624.1"
FT                   /translation="MPVKDPSKVVPQAPAESADAALKHIVDGFLRFHHDVFPEQQELFK
FT                   KLATAQTPRAMFITCADSRIVPELITQSSPGDLFVTRNVGNVVPPYGQMNGGVSSAIEY
FT                   AVSALGVHHIIICGHSDCGAMRAVLNPQSLAKMPTVSAWLRHAEVARTVVENNCSCGSE
FT                   HETMQVLTRENVIAQLHHLRTHPSVASRLAAGELYIHGWVYDIETSRIEAYDAASDSFM
FT                   PLAAGEPVPCATPRGRY"
FT   gene            123805..125331
FT                   /locus_tag="PputW619_0119"
FT   CDS_pept        123805..125331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0119"
FT                   /product="sulphate transporter"
FT                   /note="PFAM: Xanthine/uracil/vitamin C permease; sulphate
FT                   transporter; KEGG: pen:PSEEN0054 sulfate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70625"
FT                   /db_xref="GOA:B1J4K1"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4K1"
FT                   /protein_id="ACA70625.1"
FT                   /translation="MNITQLKAALPRELLASVVVFLVALPLCMGIAIASGMPPAKGLIT
FT                   GIIGGIVVGFLAGSPLQVSGPAAGLAVLVYELVRQHGVAMLGPILLLAGLLQLLAGRLR
FT                   LGCWFRVTAPAVVYGMLAGIGVLIVLSQVHVMFDTAPQPSGLQNLIGFPATVASALPFE
FT                   SAGSGWQAGLLGLGTIAVMWGWERLRPQRLRFVPGALLGVAGMTLLSMWLALPVNRVQV
FT                   PADLSEAIDWLRPEDLLQMADPTLLVAAFALAFIASAETLLSAAAVDRMHSGQRSDFDR
FT                   ELSAQGIGNMLCGVLGALPMTGVIVRSSANVQAGAQTRASAILHGLWLLAFVVVLSSVL
FT                   QQIPVASLAGVLVYTGIKLVDFKAFRGLGRYGRMPMFTYAATALAIIFTDLLTGVLLGF
FT                   ALTLLKLALKAARLKINLLSLDRPGHMELRLTGAATFLKVPALTQVLETVPPGTQLHVP
FT                   LANLSYIDHSVLELLEDWGRTQRSGGSRLIIEPRGLKRRIEGGLRTAAEC"
FT   sig_peptide     123805..123909
FT                   /locus_tag="PputW619_0119"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.909 at
FT                   residue 35"
FT   gene            complement(125334..126422)
FT                   /locus_tag="PputW619_0120"
FT   CDS_pept        complement(125334..126422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0120"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI3666 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70626"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4K2"
FT                   /protein_id="ACA70626.1"
FT                   /translation="MSIKWNRLYTDLLRGSRSTLWGNWALNPVIKPGAVGIIDPASGDF
FT                   TLVNEALPTVQISNVQQGRRWAISSKDVSRRETKANVSGTVIDPATGAQVKPDLTLEWN
FT                   FGKEESIASEFALHGEQRLSDLALIHDQYDWLYAQAEKVGMASDGRIAEGFGVVTSVIL
FT                   ANSGVNAGAKSKNAKFSLSGSASGLNTLLGENGISGKGGATFISTRDTASVESHTLPAQ
FT                   DGQVATIPLPVAYSFASFGPDRMIIPIWVRKVGSLQLHVDSKATSATTYITKVSVAYDL
FT                   PGERRTTIGPITIPGGLSHNFTIALGARNLDFSAEFVNLGDNQTLKRHWATPLSQWVGG
FT                   SRTINLYGTWPGSPSIRVVEED"
FT   gene            complement(126539..127180)
FT                   /locus_tag="PputW619_0121"
FT   CDS_pept        complement(126539..127180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0121"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN0055 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70627"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4K3"
FT                   /protein_id="ACA70627.1"
FT                   /translation="MNIAAVREQISQAHDHERHTGQLKERLELQLPHLHPSIQLPEQDA
FT                   QGTLARFVSAYIDQVPELLEAAHAVALEAGIESQIKPVLKIAEAYFLQPPSVMQGHVGL
FT                   DCLLDEAYLAHRLVEEVNDLYIRHFQQPLIPFDTTMANLIAHQLIGETFANQLDEVVHH
FT                   SVDEMLNEESFATESVEAYRETLSSPKTGEAWKRWPCLSRQLGVELGQPA"
FT   gene            127550..128677
FT                   /locus_tag="PputW619_0122"
FT   CDS_pept        127550..128677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0122"
FT                   /product="cytochrome c oxidase, subunit II"
FT                   /note="TIGRFAM: cytochrome c oxidase, subunit II; PFAM:
FT                   cytochrome c oxidase subunit II; cytochrome c class I;
FT                   cytochrome C oxidase subunit II transmembrane region; KEGG:
FT                   pen:PSEEN0056 cytochrome c oxidase, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70628"
FT                   /db_xref="GOA:B1J4K4"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4K4"
FT                   /protein_id="ACA70628.1"
FT                   /translation="MMRHPPVWMGLLLWLVLGQANAAWTVNMAPGATEVSNAVFDLHMT
FT                   IFWICVIIGVVVFGAMFWSMVIHRRSTGQQAAHFHEHTWVEILWTVVPLLILVAMAIPA
FT                   TKTLIDIYDASESDIDIQVTGYQWKWHYKYLGQDVEFFSNLATPADQIQNKAPKDEHYL
FT                   LEVDQPLVLPVGAKVRFLVTAADVIHSWWVPAFAVKRDAIPGFVNEAWTRVEKPGIYRG
FT                   QCTELCGKDHGFMPVVVEVKSKADYDTWLGERKAEAAKLKELTSKEWTLEELVARGDKV
FT                   YHTTCVACHQAEGQGLPPMFPALKGSKIATGPKDAHLNIVFHGKPGTSMAAFGKQLSEV
FT                   DIAAVVTYERNAWGNDKGDMVTPKDVLALKQAQAQ"
FT   sig_peptide     127550..127618
FT                   /locus_tag="PputW619_0122"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.993 at
FT                   residue 23"
FT   gene            128721..130310
FT                   /locus_tag="PputW619_0123"
FT   CDS_pept        128721..130310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0123"
FT                   /product="cytochrome c oxidase, subunit I"
FT                   /EC_number="1.9.3.1"
FT                   /note="KEGG: pen:PSEEN0057 cytochrome c oxidase, subunit I;
FT                   TIGRFAM: cytochrome c oxidase, subunit I; PFAM: cytochrome
FT                   c oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70629"
FT                   /db_xref="GOA:B1J4K5"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033944"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4K5"
FT                   /protein_id="ACA70629.1"
FT                   /translation="MSAVIDDHAHGHEHAHGPAKGLMRWVLTTNHKDIGTMYLWFSFIM
FT                   FLLGGSFAMVIRAELFQPGLQIVEPAFFNQMTTMHGLIMVFGAVMPAFVGLANWMIPLM
FT                   IGAPDMALPRMNNFSFWLLPAAFLMLVSTLFSPGGGPNFGWTFYAPLSTTYAPASVTFF
FT                   IFAIHLMGISSIMGAINVIATILNLRAPGMTLMKMPLFVWTWLITAFLLIAVMPVLAGV
FT                   VTMMLMDIHFGTSFFSAAGGGDPVLFQHVFWFFGHPEVYIMILPAFGAVSSIIPAFSRK
FT                   PLFGYTSMVYATGAIAFLSFIVWAHHMFVVGIPVVGELFFMYATMLIAVPTGVKVFNWV
FT                   STMWEGSLTFETPMLFAIAFVILFTIGGFSGLMLAIAPADFQYHDTYFVVAHFHYVLVP
FT                   GAIFGIFASAYYWLPKWTGHMYDETLGKLHFWLSFIGMNLAFFPMHFVGLAGMPRRIPD
FT                   YNLQFADFNMVSSVGAFMFGATQIFFLFIVIKCIRGGAPAPAKPWDGAEGLEWSVPSPA
FT                   PYHTFQTPPDVK"
FT   gene            130321..130887
FT                   /locus_tag="PputW619_0124"
FT   CDS_pept        130321..130887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0124"
FT                   /product="cytochrome c oxidase assembly protein CtaG/Cox11"
FT                   /note="PFAM: cytochrome c oxidase assembly protein
FT                   CtaG/Cox11; KEGG: pen:PSEEN0058 cytochrome c oxidase
FT                   assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70630"
FT                   /db_xref="GOA:B1J4K6"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4K6"
FT                   /protein_id="ACA70630.1"
FT                   /translation="MTGQPLKRLVLRLLMLTVVMFAFGFALVPIYDVMCRAFGINGKTG
FT                   GQYEGSQVSDPTRSVRVQFMSTNAGDMVWDFYATADQLAVNPGAVNQMIFVAHNTTDRP
FT                   MSAQAVPSITPAEAAAYFHKTECFCFTQQVLQPGERIEMPVRFIVDRDLPTSVKHLTLA
FT                   YTLFDITARHPPVAHVAPQDVQGAR"
FT   sig_peptide     130321..130401
FT                   /locus_tag="PputW619_0124"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.885) with cleavage site probability 0.543 at
FT                   residue 27"
FT   gene            130904..131791
FT                   /locus_tag="PputW619_0125"
FT   CDS_pept        130904..131791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0125"
FT                   /product="cytochrome c oxidase subunit III"
FT                   /note="PFAM: cytochrome c oxidase subunit III; KEGG:
FT                   pen:PSEEN0059 cytochrome c oxidase, subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70631"
FT                   /db_xref="GOA:B1J4K7"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4K7"
FT                   /protein_id="ACA70631.1"
FT                   /translation="MASHEHYYVPAQSKWPIIATIGMFITVYGLGTWFNDLKAGHPDSH
FT                   GPLIFFVGALLLAYMLFGWFGAVVKESHAGLYSAQLDRSFRWGMSWFIFSEVMFFLAFF
FT                   GALFYVRVLAGPWLGGEGDKGVAHMLWPSFEFTWPLLNTPDPKLFPPPKDVIDPWHLPL
FT                   INTILLVSSSVTITIAHHALRRDHRGALKLWMAITILLGLSFIALQAYEYFEAYTKLGL
FT                   TLGSGIYGATFFMLTGFHGAHVTLGTIILIVMFVRILRGHFNPDKHFGFEAASWYWHFV
FT                   DVVWVGLFIFVYVL"
FT   gene            complement(131927..132130)
FT                   /locus_tag="PputW619_0126"
FT   CDS_pept        complement(131927..132130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0126"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN0060 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70632"
FT                   /db_xref="GOA:B1J4K8"
FT                   /db_xref="InterPro:IPR021313"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4K8"
FT                   /protein_id="ACA70632.1"
FT                   /translation="MLKAAIVMMLLATIASLFSGLVFLVKDDENSTRLLKALTVRVTLA
FT                   CLTIALVAYGLISGQLVSHAPF"
FT   sig_peptide     complement(132056..132130)
FT                   /locus_tag="PputW619_0126"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.685 at
FT                   residue 25"
FT   gene            132158..132922
FT                   /locus_tag="PputW619_0127"
FT   CDS_pept        132158..132922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0127"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN0061 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70633"
FT                   /db_xref="GOA:B1J4K9"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4K9"
FT                   /protein_id="ACA70633.1"
FT                   /translation="MDKYSEAPVRPFRPGWVPTLVVLALLPGLIALGCWQLGRADEKRA
FT                   LLANHAERSVDAPLSAAQLQLSNDTAFRRVHLYGRFDAEHSVLLDNRMRDGQAGVELLQ
FT                   PFLDQPSGLWLLVNRGWLPWPDRRVPVPFDTPAQALALDASVYVAPGSTFQLHPDPVGG
FT                   QWPHLLTAVNPAQLWQQLQREGFAHELRLQPGPAAYRLDWPVVAMGPEKHLGYAVQWFA
FT                   LATALVLLYLYFGWHNKKENRNGRHHHSTGHA"
FT   gene            132888..133472
FT                   /locus_tag="PputW619_0128"
FT   CDS_pept        132888..133472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0128"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN0062 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70634"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4L0"
FT                   /protein_id="ACA70634.1"
FT                   /translation="MAATTTPLDMPERRKPRARGRLQLILILLVVLGPMILATSMYKLK
FT                   FWVPEGRSYHGTMIGNGQSRSEIGIAGEDARWQLLVSAPESCAEDCQRLVYLARQIQIG
FT                   LGRDASRASHALAAAQPLSADYQDLLGREYPQLQRYPLDTQRYLQKVGNPAPQLWIVDP
FT                   HGNLVLRYDGKVSGKHVLDDLRHLLKLSNIG"
FT   gene            133483..134556
FT                   /locus_tag="PputW619_0129"
FT   CDS_pept        133483..134556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0129"
FT                   /product="cytochrome oxidase assembly"
FT                   /note="PFAM: cytochrome oxidase assembly; KEGG:
FT                   pen:PSEEN0063 cytochrome oxidase assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70635"
FT                   /db_xref="GOA:B1J4L1"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4L1"
FT                   /protein_id="ACA70635.1"
FT                   /translation="MARPGFRLAVFATLLALLVVLLGAYTRLTHAGLGCPDWPGCYGFI
FT                   SVPKTDAQLAHAELHFPEHPVEVAKGWAEMVHRYFAGTLALVIALLAFQAVRRHSRDGQ
FT                   PYRLPVLLLGVVLAQAAFGMWTVTLKLWPQVVTAHLLGGFTTLALLFLLSLRLSRAFAP
FT                   LPKLPLSLRRIAALALLVVIGQIALGGWVSSNYAAVACTDLPTCHGQWWPAADFSNGFH
FT                   LTQHVGPNYLGGQLDSDARTAIHISHRLGALLVTGVLLMLSWKLHRCGLPGLGRLVLLV
FT                   LALQVGLGISNVLLHLPLAVAVAHNAGGALLLLSMVLVNYRIRVVDKVRVGQGWRLTPV
FT                   TGVGAAHHLRTDSWRRF"
FT   sig_peptide     133483..133578
FT                   /locus_tag="PputW619_0129"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.979) with cleavage site probability 0.596 at
FT                   residue 32"
FT   gene            134541..135434
FT                   /locus_tag="PputW619_0130"
FT   CDS_pept        134541..135434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0130"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /note="TIGRFAM: protoheme IX farnesyltransferase; PFAM:
FT                   UbiA prenyltransferase; KEGG: pen:PSEEN0064 protoheme IX
FT                   farnesyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70636"
FT                   /db_xref="GOA:B1J467"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1J467"
FT                   /protein_id="ACA70636.1"
FT                   /translation="MATLLSAQRAGWRDYLELTKPKVVVLMLITSLVGMFLATRAGVPW
FT                   SVLLFGNLGIALCAGGAAAVNHVLDRRIDALMARTHKRPLAEGRVAPLPALLFALALAL
FT                   LGMALLLMFTNALTAWLTLASLLGYAVLYTGFLKRATPQNIVIGGLAGAAPPLLGWVAV
FT                   SGHVSAEPLLLVLIIFAWTPPHFWALAIHRKEEYAKADIPMLPVTHGERYTKLHILLYT
FT                   LILLAVTLLPYAIHMSGPLYLVCALALGLRFLQWAWVLYRGSRPHAAIGTFKYSIGYLF
FT                   ALFIALLVDHYLLLNL"
FT   gene            135431..136063
FT                   /locus_tag="PputW619_0131"
FT   CDS_pept        135431..136063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0131"
FT                   /product="electron transport protein SCO1/SenC"
FT                   /note="PFAM: electron transport protein SCO1/SenC; KEGG:
FT                   pen:PSEEN0065 electron transport protein, Sco1/SenC family"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70637"
FT                   /db_xref="GOA:B1J468"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B1J468"
FT                   /protein_id="ACA70637.1"
FT                   /translation="MTRTQKTVFILVALVALIMGLTVNKVLNGSDQPNPTELIDAGIIL
FT                   LPQSRTVADVTMTNQDGQPVQLDDLKGKWSLLFFGYTYCPDICPTTLAQLRQVKSELSK
FT                   EAADRLQVVLVSVDPNRDTPNQLKQYLGYFDKDFVGVAGSIEDTQKLANALSIPFIPAD
FT                   TSKPGYTVDHSGNLAIVGPDGRQRGFIRAPFNNQKLVAQLPGLVKRD"
FT   sig_peptide     135431..135508
FT                   /locus_tag="PputW619_0131"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.393 at
FT                   residue 26"
FT   gene            complement(136161..137264)
FT                   /locus_tag="PputW619_0132"
FT   CDS_pept        complement(136161..137264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0132"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: pen:PSEEN5489 ABC transporter, periplasmic
FT                   polyamine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70638"
FT                   /db_xref="GOA:B1J469"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B1J469"
FT                   /protein_id="ACA70638.1"
FT                   /translation="MVRLKCLLAPLIATTLFTGAFQAQAEQRTLRVYNWFDYITPQTLT
FT                   GFQKDSGVKLVYDIFDTNEALEAKLLTGNSGYDVVVPSNVFLAKQIEAGVFQPLDRSKL
FT                   PNWQHLDPALMKLIEANDPGNKFAVPYMYGTVLIGFNPDKVKAVLGDTAPVDSWDLLFK
FT                   EENIAKLKQCGVALLDSPSEILPLALQYLGLDPNSSKPDDYKQAEALLQKIRPYITYFH
FT                   SSKYMADIANGDICVAVGYSGSFSQAANRARDAKNGVVVDMRLPKEGAPIWFDMLAIPK
FT                   GAANPEDAHTFINYLLRPEVIAPISDFVGYPNPNKDATEKVSPAIRNNPNLYPTAEAMA
FT                   KLYTLKPLTREAERARTRAWTRIKSGT"
FT   sig_peptide     complement(137187..137264)
FT                   /locus_tag="PputW619_0132"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 26"
FT   gene            complement(137264..138307)
FT                   /locus_tag="PputW619_0133"
FT   CDS_pept        complement(137264..138307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0133"
FT                   /product="histone deacetylase superfamily"
FT                   /note="PFAM: histone deacetylase superfamily; KEGG:
FT                   pen:PSEEN5488 acetylpolyamine aminohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70639"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:B1J470"
FT                   /protein_id="ACA70639.1"
FT                   /translation="MLTIYSDDHRLHHGRCELIDGKLMPCFEMPSRADHVLEQVKKRNL
FT                   GDVQGPTDFGRAPLQRIHSADYLDFFEGAWARWAALGQEGDLLPFTWPARTLRQVKPTG
FT                   LHGELGYYSFDAGAPITAGTWQAAYSAAQVALTAQAAIEQGAHAAFALCRPPGHHAAAE
FT                   VMGGYCYLNNAAIAAQAFLDQGRARVAILDVDYHHGNGTQDIFYQRDDVFFASIHGDPQ
FT                   DEFPFFLGYADETGAGAGEGCNINYPLPAGSDWAAWSAALEDACERIADYDADVLVISL
FT                   GVDTFKDDPISQFKLDSPDYLKMGKRIAQLGKPTLFVMEGGYAVEEIGINAVNVLEGFQ
FT                   LAQPGAR"
FT   gene            complement(138419..139411)
FT                   /locus_tag="PputW619_0134"
FT   CDS_pept        complement(138419..139411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0134"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: pen:PSEEN5487 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70640"
FT                   /db_xref="GOA:B1J471"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:B1J471"
FT                   /protein_id="ACA70640.1"
FT                   /translation="MLHSHLTTLNAVSLILNLFQEQGCEAAALLAGSGIGPADLGHADA
FT                   RITTQQELQVCANAVARREDIGLELGRRMHVSCYGMLGYALLSSATLGDALRLALQYPA
FT                   LLGTVFRLRLIDDGQRIWLSADEYRDLPALAAFNAEFCLVSLKVICDDLLGRPLPLFGA
FT                   RFGHARPAYHKRYSSAFPCPLGFDAHDNAFAFERRWLDTPLPLADPITHKAMSERCRRL
FT                   NLEFTGRQAWLGRIRQLLLQQLDAAPGLEGLAQQMNCSSRTLRRHLQALGSSYQQLLDE
FT                   LRFEQAKQLLADDQMPIYRIAERLGFSETASFRHAFQRWSGVAPSHFRG"
FT   gene            complement(139568..141025)
FT                   /locus_tag="PputW619_0135"
FT   CDS_pept        complement(139568..141025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0135"
FT                   /product="aspartate ammonia-lyase"
FT                   /note="TIGRFAM: aspartate ammonia-lyase; PFAM: fumarate
FT                   lyase; KEGG: pen:PSEEN5482 aspartate ammonia-lyase
FT                   (aspartase)"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70641"
FT                   /db_xref="GOA:B1J472"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004708"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:B1J472"
FT                   /protein_id="ACA70641.1"
FT                   /translation="MCRVKIEMISIMSSAASFRVEKDLLGTLEVPADAYYGIQTLRAAN
FT                   NFHLSGVPLSHYPKLVVALAMVKQAAADANRELGHLSDAKHAAISEACARLIRGDFHDQ
FT                   FVVDMIQGGAGTSTNMNANEVIANVALEAMGHQKGEYQYLHPNNDVNMAQSTNDAYPTA
FT                   IRLGLLLGHDALLASLDSLIQAFAAKGKEFDHVLKMGRTQLQDAVPMTLGQEFRAFATT
FT                   MTEDLQRLRSLAPELLTEINLGGTAIGTGINADPGYQALAVQRLATISGQPLVPAADLI
FT                   EATSDMGAFVLFSGMLKRTAVKLSKICNDLRLLSSGPRTGINEINLPARQPGSSIMPGK
FT                   VNPVIPEAVNQVAFAIMGNDLALTVAAEGGQLQLNVMEPLIAYKIFDSIRLLQRAMDML
FT                   REHCIVGITANEQRCRELVEHSIGLVTALNPYIGYENATRIARVALETGRGVLELVREE
FT                   QLLDEVMLNDILRPENMIAPRLVPLKA"
FT   gene            141175..142092
FT                   /locus_tag="PputW619_0136"
FT   CDS_pept        141175..142092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0136"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: pen:PSEEN5481 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70642"
FT                   /db_xref="GOA:B1J473"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1J473"
FT                   /protein_id="ACA70642.1"
FT                   /translation="MNLESKWLEDFSALAATRSFSQAAERRFVTQPAFSRRIRSLEAAL
FT                   GLTLVNRSRTPIELTAAGQLFLVTARTVVDQLSEVLRHLHHLEGGQGEVIQVAAAHSLA
FT                   SGFFPRWVAQLRNDGLNIATRLVATNVGDAVHALREGGCDLMLAFYDPDAALQMDAEIF
FT                   PSLHMGTTEMLPVCAVGADGKPMFDLEGDASVPLLAYSAGAFLGRSVSLLLRQRNLRYT
FT                   TVYETAMADSLKSMALEGMGVAWVPRLSMRGELERGELVICGGAQWHVPLEIRLYRCAL
FT                   VRKANVRLLWRKLESAGAQGEGSA"
FT   gene            complement(142084..142704)
FT                   /locus_tag="PputW619_0137"
FT   CDS_pept        complement(142084..142704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0137"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pst:PSPTO_5497 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70643"
FT                   /db_xref="GOA:B1J435"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:B1J435"
FT                   /protein_id="ACA70643.1"
FT                   /translation="MPKTLTLFFSLLLSLQLPCAVAAKSLVVTVYLHDELTSISDEQLH
FT                   NDYFQHWIDEMRSFTAHPTELILRRNVPGITDIDYQGLPSSQILEAFTQGVLELTSNHP
FT                   FSLMNKHLLMTRNSYDHSGLNYNAGLAYFKQNTAIASLAAYSSAAHEIGHLLSATHEDA
FT                   ELKFNGWVCETYTHPRIPARSNCYQYSDKNRANIADYLKYNSR"
FT   sig_peptide     complement(142636..142704)
FT                   /locus_tag="PputW619_0137"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.562 at
FT                   residue 23"
FT   gene            142974..143465
FT                   /locus_tag="PputW619_0138"
FT   CDS_pept        142974..143465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0138"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="KEGG: pen:PSEEN5480 phosphoribosylaminoimidazole
FT                   carboxylase, mutase subunit; TIGRFAM:
FT                   phosphoribosylaminoimidazole carboxylase, catalytic
FT                   subunit; PFAM:
FT                   1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR)
FT                   carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70644"
FT                   /db_xref="GOA:B1J436"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:B1J436"
FT                   /protein_id="ACA70644.1"
FT                   /translation="MSALVGVIMGSKSDWSTLSHTADMLEKLGIPYEVKVVSAHRTPDL
FT                   LFQYAEEAEERGIEVIIAGAGGAAHLPGMCAAKTHLPVLGVPVQSSMLSGVDSLLSIVQ
FT                   MPAGVPVATLAIGRAGAVNAALLSASILGAKYPQYHAALKQFRTEQTDTVLDNPDPRQA
FT                   "
FT   gene            143476..144558
FT                   /locus_tag="PputW619_0139"
FT   CDS_pept        143476..144558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0139"
FT                   /product="phosphoribosylaminoimidazole carboxylase, ATPase
FT                   subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="KEGG: pen:PSEEN5479 phosphoribosylaminoimidazole
FT                   carboxylase ATPase subunit; TIGRFAM:
FT                   phosphoribosylaminoimidazole carboxylase, ATPase subunit;
FT                   PFAM: ATP-dependent carboxylate-amine ligase domain protein
FT                   ATP-grasp"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70645"
FT                   /db_xref="GOA:B1J437"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:B1J437"
FT                   /protein_id="ACA70645.1"
FT                   /translation="MKIGVIGGGQLGRMLALAGTPLGMNFAFLDPAPDACAAPLGEHLR
FT                   ADYGDQDHLRQLADEVDLVTFEFESVPAETVAFLSQFVPVYPSAEALRIARDRLFEKSM
FT                   FRDLGIPTPAFADILSQADLDAAVASIGLPAVLKTRTLGYDGKGQKVLRTPEDVVGTFA
FT                   ELGSVPCLLEGFVPFTGEVSLVAVRARDGETRFYPLVHNTHESGILRLSVASQAHPLQA
FT                   LAEDYVGRVLKQLDYVGVMAFEFFEVDGGLKANEIAPRVHNSGHWTIEGAECSQFENHL
FT                   RAVAGLPLGSTAKVGESAMLNFIGEVPAVDKVIAIDDCHLHHYGKAFKAGRKVGHATLR
FT                   CQDMATLERKIAEVEALIGN"
FT   gene            144667..144912
FT                   /locus_tag="PputW619_0140"
FT   CDS_pept        144667..144912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0140"
FT                   /product="Transglycosylase-associated protein"
FT                   /note="PFAM: Transglycosylase-associated protein; KEGG:
FT                   pen:PSEEN5478 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70646"
FT                   /db_xref="GOA:B1J438"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:B1J438"
FT                   /protein_id="ACA70646.1"
FT                   /translation="MGIIGTIFIGLIVGLLARFIKPGDDSMGWIMTILLGIAGSLIATY
FT                   GGQALGIYQAGQAAGFFGALVGAIVLLVIFGFIKKR"
FT   gene            144961..145494
FT                   /locus_tag="PputW619_0141"
FT   CDS_pept        144961..145494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0141"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN5477 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70647"
FT                   /db_xref="InterPro:IPR021727"
FT                   /db_xref="UniProtKB/TrEMBL:B1J439"
FT                   /protein_id="ACA70647.1"
FT                   /translation="MRAFFLIPMLLASTLAHAELPETDWLELMPKSDQKALEQMPEIDH
FT                   NSPEAMGTFTDKGGLKQSKGLPAVMYSTKTVAAMNGKEIRLGGYPVPLESDAKGNSTLF
FT                   FLVPYPGACIHVPPPPPNQLVLVRYPKGLKIDDIYTPLWVSGTLKVEKVSNDLADAAYA
FT                   LEAGKVRVVEDADL"
FT   sig_peptide     144961..145017
FT                   /locus_tag="PputW619_0141"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 19"
FT   gene            complement(145581..146477)
FT                   /locus_tag="PputW619_0142"
FT   CDS_pept        complement(145581..146477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0142"
FT                   /product="Aldose 1-epimerase"
FT                   /note="PFAM: Aldose 1-epimerase; KEGG: pen:PSEEN5476 aldose
FT                   1-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70648"
FT                   /db_xref="GOA:B1J440"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR025532"
FT                   /db_xref="UniProtKB/TrEMBL:B1J440"
FT                   /protein_id="ACA70648.1"
FT                   /translation="MATFQVVTEQHGELNCWRITSDRAELLIAQQGAQILSYQHIGEPP
FT                   LLWLSDQAMFRQGKSVRAGVPVCWPWFGNLQRNPESVQGMYRGTQAPAHGLARTRDWQL
FT                   LGIEEAASALRIEFELPEAQGDLPEWPHDVELKLLIVMGDALELTLTSRNRGNTPVTIS
FT                   QALHSYFAVSDVRQARVEGVDGLGYIETLADWEQRQQQGALTFTGETDRIYLNTPAQLG
FT                   IVDPHWNRRITLSSSGSRSAVIWNPWTDRAQELPDMADDGWQRMLCIETANVWDDVVEL
FT                   KPGAFHSLQVAIGSEAL"
FT   gene            complement(146549..146947)
FT                   /locus_tag="PputW619_0143"
FT   CDS_pept        complement(146549..146947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0143"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   pfo:Pfl_5617 thioesterase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70649"
FT                   /db_xref="GOA:B1J441"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:B1J441"
FT                   /protein_id="ACA70649.1"
FT                   /translation="MIELEQEDPIPQGDLALQITALPRETNGFGDIFGGWLVAQMDLAG
FT                   TAMASRVAGGRVATVAIDRMAFLVPVAVGAQLSFYTQTLEIGRSSIQMMVEVWSDDPLS
FT                   SEWRKVTEAVFVFVAIDGSGRTRSVPRR"
FT   gene            147305..148594
FT                   /locus_tag="PputW619_0144"
FT   CDS_pept        147305..148594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0144"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: pen:PSEEN5474 permease
FT                   (MFS superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70650"
FT                   /db_xref="GOA:B1J442"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B1J442"
FT                   /protein_id="ACA70650.1"
FT                   /translation="MTSVPSSIEQPSRPLTRSDYKTLSLSALGGALEFYDFIIFVFFAT
FT                   VVGKLFFPADMPEWLRLMQTFGIFAAGYLARPLGGIIMAHFGDLLGRKKMFTLSIFMMA
FT                   LPTLIMGLLPTYAQIGMWAPILLLLMRVIQGAAIGGEVPGAWVFVSEHVPARNTGYACG
FT                   TLTAGLTAGILLGSLVATLINTVYSVEEVADYAWRIPFLLGGVFGLFSVYLRRWLHETP
FT                   VFAEMQQRKALAEELPLRAVLRDHRGPIILSMLLTWMLSAGIVVVILMTPALLQSIYHI
FT                   SPTDSLKANSLAIVLLSLGCIGSGSLADRFGAGRVFVIGSLLLLVTSWTFYHSLPTHPQ
FT                   LLFPLYAITGLCVGVIGAVPYVMVKAFPAAVRFSGLSFSYNVAYAIFGGLTPMVVTALL
FT                   KVSPMAPAYYVAGLCAVGLVVGLYLLSKKR"
FT   gene            148760..149758
FT                   /locus_tag="PputW619_0145"
FT   CDS_pept        148760..149758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0145"
FT                   /product="phosphate binding protein"
FT                   /note="TIGRFAM: phosphate binding protein; KEGG:
FT                   pen:PSEEN5473 phosphate ABC transporter, periplasmic
FT                   phosphate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70651"
FT                   /db_xref="GOA:B1J443"
FT                   /db_xref="InterPro:IPR011862"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:B1J443"
FT                   /protein_id="ACA70651.1"
FT                   /translation="MKLKRLMAALTFAAAGVATANAVAAVDPAIPTYTKTTGVSGNLSS
FT                   VGSDTLANLMTLWAEAYKKEYPNVNIQIQAAGSSTAPPALTEGTANLGPMSRKMKDVEL
FT                   QAFEQKYGYKPTAIPVAVDALAVFVHKDNPIKGLTMAQVDAIFSSTRLCGAKADVKTWG
FT                   DLGVTGDLANKPVQLFGRNSVSGTYGYFKEEALCKGDFKPNVNEQPGSASVVQSISSSL
FT                   NGIGYSGIGYKTASVKTVGLAKKEGGEFIEDNEANALNGTYPLSRFLYVYVNKAPNKPL
FT                   APLEAEFVKLVLSQAGQQVVVKDGYIPLPAKVVDKTLADLGLSHAGNVAKK"
FT   sig_peptide     148760..148834
FT                   /locus_tag="PputW619_0145"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.813 at
FT                   residue 25"
FT   gene            149897..152185
FT                   /locus_tag="PputW619_0146"
FT   CDS_pept        149897..152185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0146"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: pen:PSEEN5472 phosphate ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70652"
FT                   /db_xref="GOA:B1J444"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B1J444"
FT                   /protein_id="ACA70652.1"
FT                   /translation="MNDLANSTMTQKSPPERIDFNTPELQRKRRMRALKDRLTRWYVLV
FT                   GGLAVLAAITLIFFYLAYVVLPLFQGAELTSKKALEPTWLQQDAGKPLMIALEEQNLVG
FT                   MRVSDKGQALFFDTKTGNELNRVDLPLPAGTQVSSISTDQPGSPLVVLGLSNGQALVFH
FT                   HTYKITYPDNKKTITPGIDYPYGPEPFVLDEQGRALEHVSVNVNGDTLMLAGSTGAHLQ
FT                   VVELTRTENLMTEEVTTEQNRIELPQMTEVVKNIFIDPRQQWLYVINGRATADVFSLRD
FT                   KSLNGRYKLSESADTEITATAQLVGGISLIIGDSKGGLAQWFMARDPDGESRFKQIRTF
FT                   QMGKAPIVQIDAEERRKGFIALDAEGKLGVFHSTAHRTLLVEPAAEGPGILALSPRANR
FT                   ILIEEGGKLLPLNLKNPHPEISFSALWGKVWYENYDEPKYVWQSTASNTDFEPKLSLSP
FT                   LTFGTLKAAFYAMILAAPLAIAAAIYTAYFMAPGMRRKVKPVIELMEAMPTVILGFFAG
FT                   LFLAPYLEGHLPGVFSLFLLMPFGILLAGFTWSRLPESIRLRVPDGWEAAILIPVILFT
FT                   GWFALTMSPYLETWFFGGDMRLWITNDLGITYDQRNALVVGIAMGFAVIPNIYSIAEDA
FT                   VFSVPRSLTLGSLALGATPWQTLTRVVILTASPGIFSALMIGMGRAVGETMIVLMATGN
FT                   TPVMEMNLFEGMRTLAANVAVEMPESEVGGSHYRVLFLAALVLLMFTFIMNTLAELIRQ
FT                   RLRKKYSSL"
FT   gene            152203..153873
FT                   /locus_tag="PputW619_0147"
FT   CDS_pept        152203..153873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0147"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstA"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstA; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: pen:PSEEN5471
FT                   phosphate ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70653"
FT                   /db_xref="GOA:B1J445"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B1J445"
FT                   /protein_id="ACA70653.1"
FT                   /translation="MKKDSLKGWFKSGAPGVWISGGAVAMAVIMTVGLLAVIAVRGLGH
FT                   FWPADLVQATYKVPGQGDHVIVGEVVQKEEVPRVRLKGAGLPVPDEGPEFMTRELIKVG
FT                   NRDLNGSDFTWVVGEWLVDEQRPVDLIALERREWGNFYGYLVSVKEQGRVVAEGAGAWN
FT                   ELQARLKRANQLNSELQQLEKKDIGAINHGLERLRLQGRKLELEGKLDATAQADIDAER
FT                   AELNSRYKAIEDRLSSLHQAFSRDSLVARDGNGREVEINLSKVVHAIQPNAMSGFTKMG
FT                   TYFAKVWEFLSDDPREANTEGGIFPAIFGTVMMTLIMAVIVTPFGVLAAVYLREYAKQG
FT                   PVTRLIRIAVNNLAGVPAIVYGVFGLGFFVYVLGGSIDRLFFPESLPAPTLGTPGLLWA
FT                   SLTLALLAVPVVIVATEEGLARIPRTVREGSLALGATKAETLWKIVLPMASPAMMTGMI
FT                   LAVARAAGEVAPLMLVGVVKLAPSLPLDGNYPYLHLDQKIMHLGFHIYDVGFQSPNVEA
FT                   ARPLVYATALLLVMVIATLNLSAVWIRNHLREKYKALDH"
FT   sig_peptide     152203..152286
FT                   /locus_tag="PputW619_0147"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.934) with cleavage site probability 0.702 at
FT                   residue 28"
FT   gene            153976..154809
FT                   /locus_tag="PputW619_0148"
FT   CDS_pept        153976..154809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0148"
FT                   /product="phosphate ABC transporter, ATPase subunit"
FT                   /note="KEGG: pen:PSEEN5470 phosphate ABC transporter,
FT                   ATP-binding protein; TIGRFAM: phosphate ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70654"
FT                   /db_xref="GOA:B1J446"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1J446"
FT                   /protein_id="ACA70654.1"
FT                   /translation="MQQESHTHGIDMAALGRDKQSLRLAEETVAIEVPGLSLYYGDKQA
FT                   LFDVSMNIPKQRVTAFIGPSGCGKSTLLRTFNRMNDLVDGCRVEGAINLYGNNIYRKGE
FT                   DVAELRRRVGMVFQKPNPFPKTIYENVVYGLRIQGINKKRVLDEAVEWALKGAALWEEV
FT                   KDRLHDSALGLSGGQQQRLVIARTIAVEPEVLLLDEPCSALDPISTLKVEELIYELKSK
FT                   YTIVIVTHNMQQAARVSDYTAFMYMGKLVEFGDTDTLFTNPAKKQTEDYITGRYG"
FT   gene            154941..155711
FT                   /locus_tag="PputW619_0149"
FT   CDS_pept        154941..155711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0149"
FT                   /product="phosphate uptake regulator, PhoU"
FT                   /note="TIGRFAM: phosphate transport system regulatory
FT                   protein PhoU; PFAM: PhoU family protein; KEGG:
FT                   pen:PSEEN5469 transcriptional repressor for high affinity
FT                   phosphate uptake"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70655"
FT                   /db_xref="GOA:B1J447"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:B1J447"
FT                   /protein_id="ACA70655.1"
FT                   /translation="MINKESLTHHISQQFNAELEEVRSHLLAMGGLVEKQVNDAVTALI
FT                   EADSGLAQQVREVDEQINQMERNIDEECVRILARRQPAASDLRLIISISKSVIDLERIG
FT                   DESTKIARRAIQLCEEGESPRGYVEVRHIGDQVRNMVRDALDAFARFDADLALSVAQYD
FT                   KTIDREYKTALRELVTYMMEDPRSISRVLSVIWALRSLERIGDHARNISELVIYLVRGT
FT                   DVRHMGLKRMKAEVQGTAGDEAEIANVPAEPDDK"
FT   gene            155877..156779
FT                   /locus_tag="PputW619_0150"
FT   CDS_pept        155877..156779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0150"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   pen:PSEEN5468 response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70656"
FT                   /db_xref="GOA:B1J448"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B1J448"
FT                   /protein_id="ACA70656.1"
FT                   /translation="MSKVNVLVVDDAPFIRDLVRKCLRNAFPGMVIEDAVNGRKAMTML
FT                   GKETFDLVLCDWEMPEMSGLELLTWCRQQPEMKNLQFIMVTSRGDKENVIQAIQAGVSD
FT                   FVGKPFTNEQLLTKVKKALTKIGKLESLVAGGQARVNSAFANDSLSALTGGKPEAVKAP
FT                   PAAAVPAKPLINAPKPQTAAAAAAQTGRGQGQLRLSSGTQPCVIKALSLKEALLVVRRS
FT                   AVLPQVLEGAVLDLEQGESAEVARLNGYLHAIAALEPKPESDWLQLTFKFVDQDAQKLD
FT                   YLSRLIARGTTQKHFTPGA"
FT   gene            157005..157907
FT                   /locus_tag="PputW619_0151"
FT   CDS_pept        157005..157907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0151"
FT                   /product="peptidase M23B"
FT                   /note="PFAM: peptidase M23B; KEGG: pen:PSEEN5467 peptidase,
FT                   M23/M37 family"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70657"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:B1J449"
FT                   /protein_id="ACA70657.1"
FT                   /translation="MPAAARLLLFCALLTASASSLGMTIYKTTDNFGVASYSERPSPGA
FT                   KALELREPMFEQLEGQVRLQTEPFPGGVRFLVRNELYVPMQVELRVDQLANAFGGNGPR
FT                   IVRAVVGPRSTKVLSSVLAAPGGPLRYASKFQYAMGDPGQRSQAYRYPFPWKGGPFRLT
FT                   QGPNGRFSHYGPKGRHAMDIAMPEGTPIIAARGGMVVKIENNQSGRGTNPSGNFVRILH
FT                   PDGTMGVYLHLMRGSVVVAEGQQVALGQALAKSGNTGNSTGPHLHFVVQRNVGLALESI
FT                   PFQFDRPIGGLPNFTAGNP"
FT   sig_peptide     157005..157073
FT                   /locus_tag="PputW619_0151"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.949 at
FT                   residue 23"
FT   gene            complement(157941..159281)
FT                   /locus_tag="PputW619_0152"
FT   CDS_pept        complement(157941..159281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0152"
FT                   /product="protein of unknown function DUF21"
FT                   /note="PFAM: CBS domain containing protein; protein of
FT                   unknown function DUF21; transporter-associated region;
FT                   KEGG: pen:PSEEN5466 metal ion transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70658"
FT                   /db_xref="GOA:B1J450"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B1J450"
FT                   /protein_id="ACA70658.1"
FT                   /translation="MDPSPGISLTSLFADFGMILFALFLVLLNGFFVAAEFAMVKLRST
FT                   RVESIAEQHGWRGSILRKVHNQLDAYLSACQLGITLASLGLGWVGEPAFAHLLEPLLAY
FT                   LGVDTPELIKGVSFFVAFFVISYLHIVVGELAPKSWAIRKPELLSLWTAVPLYLFYWLM
FT                   YPAIYLLNASANTILRFAGQGEPGPHHEHHYSREELKLILHSSRGQDPSDQGMRVLASA
FT                   VEMGELEVVDWANSREDMVSIDAHAPLKEILALVRRHKFSRYPLYDAEREEFTGLLHIK
FT                   DLLLELAELEHLPETVDLEDLARPLERVSRHMPLSQLLEQFRKGGAHFVLVEEADGKVI
FT                   GYLTMEDVLEVLVGDIQDEHRKTERGILAYQPGKLLVRGDTPLFKVERLLGIDLDHIEA
FT                   ETLAGLIYETLKRVPEEEEVLEVEGLRIIIKKMKGPKIVLAKVLKLD"
FT   gene            complement(159398..160705)
FT                   /locus_tag="PputW619_0153"
FT   CDS_pept        complement(159398..160705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0153"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: pen:PSEEN5465 phosphate regulon sensor protein
FT                   PhoR; TIGRFAM: phosphate regulon sensor kinase PhoR; PFAM:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; PAS fold domain protein; SMART: PAS
FT                   domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70659"
FT                   /db_xref="GOA:B1J451"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR014310"
FT                   /db_xref="InterPro:IPR021766"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B1J451"
FT                   /protein_id="ACA70659.1"
FT                   /translation="MNQNWHATLIRHLLLLITVCLIGGLVSGFYGWSLAIGLGFYLGWT
FT                   LKQLLRLHDWLRNHQPDEAPPDGYGLWGEVFDSIYHLQRRDQRVRGRLQAVIDRVQEST
FT                   AALRDAVIMLDSDGNLEWWNRAAETLLGFKTPQDGGQPVTNLVRHPRFKEYFESQNFAE
FT                   PLEIPSPINDRMRVQLHLTRYGNNEHLMLVRDVTRIHQLEQMRKDFVANVSHELRTPLT
FT                   VIAGYLETLLDNVEDVNPRWNRALQQMSQQGSRMQTLLNDLLLLAKLEATDYPSDNQPV
FT                   AVDTLLGAIMNDAQALSGPRNQRITLEAAPGLRLKGSESELRSAFSNLVFNAVKYTRDE
FT                   GNIRIRWWADDQGAHLSVQDSGVGIDAKHLPRLTERFYRVDSSRASNTGGTGLGLAIVK
FT                   HVLMRHRGRLEISSVPGHGSTFTCHFAPAQLANGDA"
FT   gene            complement(160842..161531)
FT                   /locus_tag="PputW619_0154"
FT   CDS_pept        complement(160842..161531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0154"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="TIGRFAM: phosphate regulon transcriptional
FT                   regulatory protein PhoB; PFAM: response regulator receiver;
FT                   transcriptional regulator domain protein; KEGG:
FT                   pen:PSEEN5464 phosphate regulon transcriptional regulatory
FT                   protein PhoB"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70660"
FT                   /db_xref="GOA:B1J452"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011879"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B1J452"
FT                   /protein_id="ACA70660.1"
FT                   /translation="MVGRNILIVDDEAPIREMIAVALEMAGYDCLEAENSQQAHAIIVD
FT                   RKPDLILLDWMLPGTSGIELARRLKRDELTGDIPIIMLTAKGEEDNKIQGLEVGADDYI
FT                   TKPFSPRELVARLKAVLRRAGPSDSEAPIEVGGLLLDPISHRVTIDGKPAEMGPTEYRL
FT                   LQFFMTHQERAYTRGQLLDQVWGGNVYVEERTVDVHIRRLRKALGEAYENLVQTVRGTG
FT                   YRFSTKS"
FT   gene            161706..162077
FT                   /locus_tag="PputW619_0155"
FT   CDS_pept        161706..162077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0155"
FT                   /product="Secreted repeat of unknown function"
FT                   /note="PFAM: Secreted repeat of unknown function; KEGG:
FT                   pen:PSEEN5463 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70661"
FT                   /db_xref="InterPro:IPR005297"
FT                   /db_xref="InterPro:IPR014558"
FT                   /db_xref="UniProtKB/TrEMBL:B1J453"
FT                   /protein_id="ACA70661.1"
FT                   /translation="MTRHTLSWMALCAAMALPGVASAHHAMEKDGMWVDHAGMTLYTFD
FT                   KDAGGKSMCNGECAANWPPLLVKADDEPAKDKWSVVMRDDGKKQWAYDGKPLYTFVKDK
FT                   KAGDMTGDGLKDVWHVAKP"
FT   sig_peptide     161706..161777
FT                   /locus_tag="PputW619_0155"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.981 at
FT                   residue 24"
FT   gene            complement(162150..163040)
FT                   /locus_tag="PputW619_0156"
FT   CDS_pept        complement(162150..163040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0156"
FT                   /product="4-hydroxybenzoate polyprenyl transferase"
FT                   /note="TIGRFAM: 4-hydroxybenzoate polyprenyl transferase;
FT                   PFAM: UbiA prenyltransferase; KEGG: pen:PSEEN5462
FT                   4-hydroxybenzoate octaprenyltransferase (4-HB
FT                   polyprenyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70662"
FT                   /db_xref="GOA:B1J454"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1J454"
FT                   /protein_id="ACA70662.1"
FT                   /translation="MYLQLLKSLNRVHPRAWDFIQLSRMDRPIGIYLLLWPTLTAVWIA
FT                   GLGSPTLANVLIFGLGVVLMRAAGCCINDFADRKVDGHVKRTADRPLASGRVKPREALA
FT                   LFGILVAVSFLLVLCTNSKTVWLSFGAVALAFCYPFMKRYTYYPQVVLGAAYSWGIPMA
FT                   FTAAGGELPASAWLLYIANLLWTVGYDTYYAMVDRDDDLKIGVKSTAILFGESDRMIIL
FT                   TLQMLSLGCLLLAGSRFELGGWFHLGLLGAALCFAWEYWSTRKLDRESCFKAFLHNHWA
FT                   GLLVFMGVVLDYALR"
FT   gene            complement(163040..163597)
FT                   /locus_tag="PputW619_0157"
FT   CDS_pept        complement(163040..163597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0157"
FT                   /product="Chorismate lyase"
FT                   /note="PFAM: Chorismate lyase; KEGG: pen:PSEEN5461
FT                   chorismate-pyruvate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70663"
FT                   /db_xref="GOA:B1J455"
FT                   /db_xref="InterPro:IPR007440"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/TrEMBL:B1J455"
FT                   /protein_id="ACA70663.1"
FT                   /translation="MSYESPQAAAVAWLAYPQLAVDTDQPALDWLFDEGSLTRRLTRLS
FT                   HDHFSVTPLFEGWQALRDDECLALGIAPGAEGWVREVYLRGHGQPWVFARSVASRSALE
FT                   RGGLHLETLGSRSLGELLFCDQAFIRHPIEVCTYPQQWLPVEAAHAGLWGRRSRFERDG
FT                   LDLLVAEVFLPALWQAAKEENC"
FT   gene            163729..163896
FT                   /locus_tag="PputW619_0158"
FT   CDS_pept        163729..163896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0158"
FT                   /product="Rubredoxin-type Fe(Cys)4 protein"
FT                   /note="PFAM: Rubredoxin-type Fe(Cys)4 protein; KEGG:
FT                   pen:PSEEN5460 rubredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70664"
FT                   /db_xref="GOA:B1J456"
FT                   /db_xref="InterPro:IPR018527"
FT                   /db_xref="InterPro:IPR024922"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR024935"
FT                   /db_xref="UniProtKB/TrEMBL:B1J456"
FT                   /protein_id="ACA70664.1"
FT                   /translation="MKKWQCIVCGLIYDEAQGWPDDGIAPGTRWEDVPQDWLCPDCGVG
FT                   KSDFEMIAIG"
FT   gene            163931..165079
FT                   /locus_tag="PputW619_0159"
FT   CDS_pept        163931..165079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0159"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: pen:PSEEN5459 rubredoxin-NAD(+)
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70665"
FT                   /db_xref="GOA:B1J457"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041364"
FT                   /db_xref="UniProtKB/TrEMBL:B1J457"
FT                   /protein_id="ACA70665.1"
FT                   /translation="MTSPVVIIGTGLAGYNLAREFRKLDGETPLLLITADDGRSYSKPM
FT                   LSTGFAKQKDADGLCMAEPGAMAEQLKAVIRTHTRISGIDPGHKRLWIGEEAVEYRDLV
FT                   LAWGAQTVQVPVEGDGADHVFPVNDLEDYARLRAAAAGKQRVLILGAGLIGCEFANDMR
FT                   LGGFEVDVVAPCEQVMPTLLHPAAAAAVQSGLQGLGVRFHLGPVLTRLQRVSEGLEAHL
FT                   SDGSVIACDLVVSAIGLRPRTDLAAAAGLQTNRGVVVDRQLRTSHGNIFALGDCAEVEG
FT                   INLLYVMPLMACARALAQTLTGNPTQVSYGPMPITVKTPACPLVVSPLPPGREGNWQVQ
FT                   GQGSDLKVLCHAADGQLLGYALTGSAVTEKLALNRQLPALMA"
FT   gene            165268..165567
FT                   /locus_tag="PputW619_0160"
FT   CDS_pept        165268..165567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0160"
FT                   /product="histone family protein DNA-binding protein"
FT                   /note="PFAM: histone family protein DNA-binding protein;
FT                   KEGG: pen:PSEEN5458 DNA-binding protein HU-alpha"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70666"
FT                   /db_xref="GOA:B1J458"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:B1J458"
FT                   /protein_id="ACA70666.1"
FT                   /translation="MRKPELAAVIAEKADLTKEKANQVLNAILDSITGALDKDTVTLVG
FT                   FGTFEKRHRGARTGKNPQTGEPVKIKASNTVAFKPGKNLRESVNVPAKPAKKAK"
FT   gene            165714..166091
FT                   /locus_tag="PputW619_0161"
FT   CDS_pept        165714..166091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0161"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN5457 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70667"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="UniProtKB/TrEMBL:B1J459"
FT                   /protein_id="ACA70667.1"
FT                   /translation="MKFRFLLWALGLLMARASRNNPAFQQQLKDKDLVFQMQTLDGKVA
FT                   RHFIVNGERISSKGGAHPQPAFAIAFKDAAYGFATMQAGNKQLAFMQGIQDKSIQIKGN
FT                   PALVMWFQGLMKYLKPKKKKG"
FT   sig_peptide     165714..165776
FT                   /locus_tag="PputW619_0161"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.984) with cleavage site probability 0.554 at
FT                   residue 21"
FT   gene            complement(166124..167527)
FT                   /locus_tag="PputW619_0162"
FT   CDS_pept        complement(166124..167527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0162"
FT                   /product="putative signal transduction protein"
FT                   /note="PFAM: Metal-dependent hydrolase HDOD; KEGG:
FT                   pen:PSEEN5456 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70668"
FT                   /db_xref="GOA:B1J460"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="InterPro:IPR014627"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:B1J460"
FT                   /protein_id="ACA70668.1"
FT                   /translation="MTEAALDTATPHAPSVIRLLLEKLGVAYREVPEHTQLPAASRVQA
FT                   ILLDDEIGALMVLFPQSKLLDLNRLEELTGRKLKAVPVQRLKQMLDKHHLKALPAIPAL
FT                   TSSPCLYEGKLLDAERLLIQSGEAGLLLEIQRDDFKRMMQKASAGTFGQPVREIRPNLD
FT                   RPDDDSREITLAVQAFTARRIQKRLEETIEIPPLADTAQKIIKLRVDPNASIDDITGVV
FT                   ETDPALAAQVVSWAASPYYASPGKIRSVEDAIVRVLGFDLVINLALGLALGKTLSLPKD
FT                   HPQQATPYWQQSIYTAAIIEGLTRAMPRAERPEAGLTYLAGLLHNFGYLLLAHVFPPHF
FT                   SLICRHLEVNPHLCHTYVEQHLLGISREQIGAWLMKLWDMPEELSTALRFQHDPAYDGE
FT                   YSAYPNLVCLATRLLRCRGIGSGPQEAIPDELLERLGVTREKAEDVVNKVLEAESLLRE
FT                   LASQFNAPH"
FT   gene            complement(167606..169684)
FT                   /locus_tag="PputW619_0163"
FT   CDS_pept        complement(167606..169684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0163"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /note="KEGG: pen:PSEEN5455 ATP-dependent DNA helicase;
FT                   TIGRFAM: ATP-dependent DNA helicase RecG; PFAM: helicase
FT                   domain protein; nucleic acid binding OB-fold
FT                   tRNA/helicase-type; DEAD/DEAH box helicase domain protein;
FT                   SMART: DEAD-like helicases"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70669"
FT                   /db_xref="GOA:B1J461"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:B1J461"
FT                   /protein_id="ACA70669.1"
FT                   /translation="MTELSKVSVTALKGVGEAMAQKLAKVGLENLQDVLFHLPLRYQDR
FT                   TRVVPIGALRPGQDAVIEGVVSGADVTMGKRRSLVVRLGDGSGVLSLRFYHFSNAQKEG
FT                   LKRGTHLRCYGEARPGASGLEIYHPEYRALNGDEPPPPVEQTLTPIYPSTEGLTQQRLR
FT                   LLCQQSLDMLGPRSLPDWLPDELARDYHLAPLDDAIRYLHNPPADADLDELAEGQHWAQ
FT                   HRLAFEELLTHQLSQQRLRESLRSLRAPVLPKAKRLQLQYLANLGFKPTGAQQRVADEI
FT                   AYDLSQAEPMMRLVQGDVGAGKTVVAALAALQALEAGYQVALMAPTEILAEQHYITFKR
FT                   WLEPLGLEVAWLAGKLKGKARASALEQIANGAPMVVGTHALFQEEVQFKHLALAIIDEQ
FT                   HRFGVQQRLALRKKGVAGELCPHQLIMTATPIPRTLAMSAYADLDTSVLDELPPGRTPV
FT                   NTVLVADSRRFEVVERVRAACAEGRQAYWVCTLIEESEELTCQAAESTYEELGSALGEL
FT                   RVGLIHGRMKPAEKAAVMAEFKQGDLQLLVATTVIEVGVDVPNASLMIIENPERLGLAQ
FT                   LHQLRGRVGRGSAVSHCVLLYHPPLSQIGRERLGIMRETNDGFVIAEKDLELRGPGEML
FT                   GTRQTGLLQFKVADLMRDADLLPAVRDAAQALIARWPEHVSPLLDRWLRHGQQYGQV"
FT   gene            complement(169688..170614)
FT                   /locus_tag="PputW619_0164"
FT   CDS_pept        complement(169688..170614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0164"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: pen:PSEEN5454 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70670"
FT                   /db_xref="GOA:B1J462"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1J462"
FT                   /protein_id="ACA70670.1"
FT                   /translation="MTLTELRYIVTLAQEQHFGHAAERCHVSQPTLSVGVKKLEDELGV
FT                   LIFERSKSAVRLTPVGESIVAQAQKVLEQAQGIRELAQAGKNQLTAPLKVGAIYTVGPY
FT                   LFPHLIPQLHRVAPQMPLYIEENFTHVLREKLRNGELDAVIIALPFNEADVLTLPLYDE
FT                   PFCALMPADHPWTAKKTIDTAMLNDKSLLLLGEGHCFRDQVLEACPTLNKGGEGAKHTT
FT                   VESSSLETIRHMVASGLGVSILPLSAVHSHHYAPGVIEVRPLTAPAPFRTVAIAWRASF
FT                   PRPKAIEILADSIRLCSVAKPAVEQPA"
FT   gene            complement(170709..171443)
FT                   /locus_tag="PputW619_0165"
FT   CDS_pept        complement(170709..171443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0165"
FT                   /product="TonB family protein"
FT                   /note="TIGRFAM: TonB family protein; KEGG: pen:PSEEN5453
FT                   ferric siderophore transport system, periplasmic binding
FT                   protein TonB"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70671"
FT                   /db_xref="GOA:B1J463"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:B1J463"
FT                   /protein_id="ACA70671.1"
FT                   /translation="MTKTRHNLARYSGSLALVLGVHAVAVLLTLNWSVPQAVELPPAAM
FT                   MVELAPLPEPAPPPPPKAAPQPPAPVEEPPLPKVAEAPKPKIAIAKPPKPKPKPQPPKP
FT                   EKKPEPPKDEPPAKEQVVDTPPTNTPPQKSAAPAPSIAANSKALPTWQSDLLRHLAKYK
FT                   RYPEDARRRGLQGINRLRFVVDAEGKVVSYSMAGGSGSAALDRATLEMIRRAGKVPKPP
FT                   AELLNNGTIEVVAPFVYSLDRR"
FT   sig_peptide     complement(171366..171443)
FT                   /locus_tag="PputW619_0165"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.981) with cleavage site probability 0.479 at
FT                   residue 26"
FT   gene            complement(171440..171868)
FT                   /locus_tag="PputW619_0166"
FT   CDS_pept        complement(171440..171868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0166"
FT                   /product="TonB system transport protein ExbD"
FT                   /note="TIGRFAM: TonB system transport protein ExbD; PFAM:
FT                   Biopolymer transport protein ExbD/TolR; KEGG: pen:PSEEN5452
FT                   solvent/drug/ferric siderophore transport system, inner
FT                   membrane protein ExbD"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70672"
FT                   /db_xref="GOA:B1J464"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="InterPro:IPR014170"
FT                   /db_xref="UniProtKB/TrEMBL:B1J464"
FT                   /protein_id="ACA70672.1"
FT                   /translation="MGLHLNEGGDDLAENHEINVTPFIDVMLVLLIIFMVAAPLATVDI
FT                   KVDLPASTAKPAPRPEKPVFVSVKADQKLYVGDDQVPAPSQLGPMLDAKTKGDKETTIF
FT                   FQADKGVDYGDLMEVMNNMRAAGYLKVGLVGLETAAKK"
FT   gene            complement(171872..172843)
FT                   /locus_tag="PputW619_0167"
FT   CDS_pept        complement(171872..172843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0167"
FT                   /product="tonB-system energizer ExbB"
FT                   /note="TIGRFAM: tonB-system energizer ExbB; PFAM:
FT                   MotA/TolQ/ExbB proton channel; KEGG: pen:PSEEN5451
FT                   solvent/drug/ferric siderophore transport protein ExbB"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70673"
FT                   /db_xref="GOA:B1J465"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR014164"
FT                   /db_xref="UniProtKB/TrEMBL:B1J465"
FT                   /protein_id="ACA70673.1"
FT                   /translation="MTRTHTSASPTPSRAWRAIAALMFSLVLAPVAMADEPNTNVSTPA
FT                   AASAPATPAAEGQAPAGDAQVATPVDAPAAAAPSTEAVVENTSLGMAHDLSPWGMYKNA
FT                   DVVVKAVMIGLAIASIITWTIWIAKGFELMGAKRRLRGEIAQLKKSASLKEASEVSNKE
FT                   GTLAHTLVHDALEEMRLSANAREKEGIKERVSFRLERLVHASGRNMSSGTGVLATIGST
FT                   APFVGLFGTVWGIMNSFIGIAKTQTTNLAVVAPGIAEALLATALGLVAAIPAVVIYNVF
FT                   ARSIAGYKAQVSDASAQVLLLVSRDLDHQGGERVAPHMVKVG"
FT   sig_peptide     complement(172739..172843)
FT                   /locus_tag="PputW619_0167"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 35"
FT   gene            173035..173892
FT                   /locus_tag="PputW619_0168"
FT   CDS_pept        173035..173892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0168"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   dTDP-4-dehydrorhamnose reductase; Male sterility domain;
FT                   KEGG: pen:PSEEN5450 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70674"
FT                   /db_xref="GOA:B1J466"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1J466"
FT                   /protein_id="ACA70674.1"
FT                   /translation="MSDRSVLIVGCGDVGGRLARQLLARGWQVSGLRRSVEHLPQRVVP
FT                   IAADLSDSGMPQAWPQHSPDYLVYCVAASQHDEAGYQSAYVEGLRHVLGWLAERGQRPR
FT                   RLLFVSSSSVFAQKDGEWIDETAPTEPQGYSGRVMLEAERLALASGMPASIVRLTGIYG
FT                   PGREWLLSQVRQGYRVATEPPLYGNRIHAEDAASLLAFLLQADADGVALDDCYIGVDDD
FT                   PAPLADVVGWLRAYMGVTEWSDEQRVRRTGSKRCSNARVRALGWVPEYPSYKEGYAAIL
FT                   KGEG"
FT   gene            complement(173967..174692)
FT                   /locus_tag="PputW619_0169"
FT   CDS_pept        complement(173967..174692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0169"
FT                   /product="lipoprotein"
FT                   /note="KEGG: pen:PSEEN5449 lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70675"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4N0"
FT                   /protein_id="ACA70675.1"
FT                   /translation="MRQALPLALAALLLSGCASHKPEDFNGTWINQDAINAAVKGGSLR
FT                   QALNEHGPIFEWKLDVASQQASYSNGFEAADGQLSATDKQWQANFPGGQTEQLALDGAE
FT                   LKATDTSGAERSFVRATQPGNAPLGSSFEKALYQAYLGGDWKIVEGQGKGGVVRFADNG
FT                   GVTGLPGPDRYALCLAGDCASMGGSNDSLWLERNQRGAPFIFKRDGDKLEIFQALNRAQ
FT                   PDEIPQLAAGTRQWVLEKD"
FT   sig_peptide     complement(174633..174692)
FT                   /locus_tag="PputW619_0169"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.833) with cleavage site probability 0.503 at
FT                   residue 20"
FT   gene            complement(174748..175128)
FT                   /locus_tag="PputW619_0170"
FT   CDS_pept        complement(174748..175128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0170"
FT                   /product="endoribonuclease L-PSP"
FT                   /note="TIGRFAM: endoribonuclease L-PSP; PFAM:
FT                   Endoribonuclease L-PSP; KEGG: pen:PSEEN5448
FT                   endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70676"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4N1"
FT                   /protein_id="ACA70676.1"
FT                   /translation="MSKTVINSDKAPAAIGTYSQAIKAGNTVYMSGQIPLDPNTMELVE
FT                   GFEAQTVQVFENLKAVAEAAGGSFKDIVKLNIFLTDLSHFAKVNEVMGRYFEQPYPARA
FT                   AIGVAALPKGAQVEMDAILVID"
FT   gene            complement(175152..177260)
FT                   /locus_tag="PputW619_0171"
FT   CDS_pept        complement(175152..177260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0171"
FT                   /product="(p)ppGpp synthetase I, SpoT/RelA"
FT                   /EC_number="2.7.6.5"
FT                   /note="KEGG: pen:PSEEN5447 guanosine-3',5'-bis(diphosphate)
FT                   3'-pyrophosphohydrolase; TIGRFAM: RelA/SpoT family protein;
FT                   PFAM: amino acid-binding ACT domain protein; TGS domain
FT                   protein; metal-dependent phosphohydrolase HD sub domain;
FT                   RelA/SpoT domain protein; SMART: metal-dependent
FT                   phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70677"
FT                   /db_xref="GOA:B1J4N2"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4N2"
FT                   /protein_id="ACA70677.1"
FT                   /translation="MPGIEALAERLSTYLGPEQVNLVRRAYFYAEQAHDGQRRRSGEPY
FT                   VTHPLAVASILADMHMDHQSLMAAMLHDVIEDTGIAKEALSQQFGETVAELVDGVSKLT
FT                   QMNFETKAEAQAENFQKMAMAMARDIRVILVKLADRLHNMRTLEVLSGEKRRRIAKETL
FT                   EIYAPIANRLGMHTVRVEFEDLGFKAMHPMRSSLIHRAVKSARGNRKEIVAKIEHSLAN
FT                   CLAADGIQGEVSGRQKHLYGIYKKMRGKRRAFTEIMDVYAFRIIVDKVDTCYRVLGAVH
FT                   NLYKPLPGRFKDYIAIPKANGYQSLHTTLFGMHGVPIEIQIRTREMEEMANNGIAAHWL
FT                   YKSNDDEQPKGNHARARQWVKGILELQQRAGNSLEFIESVKIDLFPDEVYVFTPKGRIM
FT                   ELPKGSTAVDFAYAVHTDVGNSCIACRINRRLAPLSEPLQSGSTVEIVSAPGARPNPAW
FT                   LNFVVTGKARTHIRHALKQQRRSESINLGERLLNKVLTGFDSSLEQIPQERINAILAEY
FT                   RLELIEDLLEDIGLGNRMAYVVARRLLSAEGEPLPAPEGPLAIRGTEGLVLSYAKCCTP
FT                   IPGDPIVGHLSAGKGMVVHLENCRNISEIRHNPEKCVQLSWAKDITGEFNVELRVELEH
FT                   QRGLIALLASSVNAADGNIEKISMDERDGRISVVQLVVSVHDRVHLARVIKKLRTLTGV
FT                   VRITRMRA"
FT   gene            complement(177320..177583)
FT                   /locus_tag="PputW619_0172"
FT   CDS_pept        complement(177320..177583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0172"
FT                   /product="DNA-directed RNA polymerase, omega subunit"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, omega subunit;
FT                   PFAM: RNA polymerase Rpb6; KEGG: pen:PSEEN5446 DNA-directed
FT                   RNA polymerase, omega subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70678"
FT                   /db_xref="GOA:B1J4N3"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1J4N3"
FT                   /protein_id="ACA70678.1"
FT                   /translation="MARVTVEDCLEHVDNRFELVMLSTKRARQLATGGKEPRVAWENDK
FT                   PTVVALREIAEGIVTNEFIAAEEIVTEDPVFAAFEDESNEAV"
FT   gene            complement(177787..178659)
FT                   /locus_tag="PputW619_0173"
FT   CDS_pept        complement(177787..178659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0173"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: pen:PSEEN5445 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70679"
FT                   /db_xref="GOA:B1J4N4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4N4"
FT                   /protein_id="ACA70679.1"
FT                   /translation="MQYQITHADLSLVLALERGRSLAKAAELLKVDVSTVFRSIRRLES
FT                   ALGTALFVKSRKGYLPTDTAQALAEQAERAEQALDAARIAMTSGEQVVSGTVRLTCTEA
FT                   VMHSLLLPALAEFMPNYPALSLEMGTSNTFANLSRRDADIALRLTNTPPEHLVGRCLGS
FT                   TSYVICGQPQWRERLSESHNSVPWIAPDDSMQDHPTVVWRNQQYPGLSPRYQCSSMSTI
FT                   AQLVSTGLGVAALPDYMVHALPGVEALSGPLAACDTQLWLLTRPDCRALRSVQTLFEEL
FT                   TPRLRGAML"
FT   gene            178865..180247
FT                   /locus_tag="PputW619_0174"
FT   CDS_pept        178865..180247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0174"
FT                   /product="Glutamate--putrescine ligase"
FT                   /EC_number="6.3.1.11"
FT                   /note="PFAM: glutamine synthetase catalytic region; KEGG:
FT                   pen:PSEEN5444 glutamine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70680"
FT                   /db_xref="GOA:B1J4N5"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4N5"
FT                   /protein_id="ACA70680.1"
FT                   /translation="MTSVTPCASSSSEMKDFLQAHPDTQYVDLLISDMNGVVRGKRIER
FT                   SSLHKVYEKGINLPASLFALDINGSTVESTGLGLDIGDADRICYPIPGTLCNEPWQKRP
FT                   TAQLLMTMHELEGEPFFADPREVLRQVVSKFDDLGLDICAAFELEFYLIDQDNLNGRPQ
FT                   PPRSPTSGKRPQSTQVYLIDDLDEYVDCLQDMLEAAKEQGLPADAIVKESAPAQFEVNL
FT                   HHVADPLKACDYAILLKRLVKNVAYDHEMDTTFMAKPYPGQAGNGLHVHISLLDKKTGK
FT                   NIFAHEDPLHSDALRHAIGGVLETMPASMAFLCPNVNSYRRFGAQFYVPNAPSWGLDNR
FT                   TVAVRVPTDSSENVRIEHRVAGADANPYLMLAAILAGIHHGLTSKVEPGAPIEGNSYEQ
FT                   LEQSLPNNLRDALRALDDSEVLNQYISPDYIDIFVACKESELAEFEVSISDLEYNWYLH
FT                   TV"
FT   gene            180252..181001
FT                   /locus_tag="PputW619_0175"
FT   CDS_pept        180252..181001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0175"
FT                   /product="peptidase C26"
FT                   /note="PFAM: peptidase C26; KEGG: pen:PSEEN5443 glutamine
FT                   amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70681"
FT                   /db_xref="GOA:B1J4N6"
FT                   /db_xref="InterPro:IPR011697"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4N6"
FT                   /protein_id="ACA70681.1"
FT                   /translation="MSAFAVPLIGVSACRQQVGKNSSHTVGDKYVEAAGFAGLPLILPA
FT                   RDGGSDTQALLARLDGILFTGSPSNVEPHHYNGAPSAEGTRHDLARDRLTLPLLQAAIA
FT                   AGVPVFCICRGFQELNVALGGSLHQRVHELPGYLDHREPEDAPLEVQYGPRHPVGITPG
FT                   GVFERLGLAAQFEVNSLHSQGIDRLAPGLRVEAQAPDGLIEAVSMPDAPGFVLGVQWHP
FT                   EWRFAENPVSRRLFQAFREACIAHAAR"
FT   gene            181116..182654
FT                   /locus_tag="PputW619_0176"
FT   CDS_pept        181116..182654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0176"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   pen:PSEEN5442 amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70682"
FT                   /db_xref="GOA:B1J4N7"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4N7"
FT                   /protein_id="ACA70682.1"
FT                   /translation="MSNYTEAGRPPDVADSGSTQRSKGLAKGRLGLLASVVLGISTIAP
FT                   VYTLTGALGPTVREVGEHLPAVFIVGFLPMLLVALGYRELNAAEPDSGTSFTWSARAFG
FT                   PMIGWIGGWGLVVATTIVLSNLAGVAVDFFYLFLAQITGNQALAALADNLLINITTCCV
FT                   FIAMAVWICCRGMATTMTVQYGLVALQLLVLIGFAFAAFSETTAPAPLEFDLAWFNPFG
FT                   VESFSAFAAGLSLSIFIFWGWDVCLTVSEESIGSDEVPGKAATWTVLLILGLYLLTAIA
FT                   TLQFAGISEQGLGLNNPRIQENVFAHLAGPVMGPLAILMSIAVLASTAASLQSTFVSPA
FT                   RTLLAMGYYGAVPERFAKVCPRSQTPRYATICAGVAAGLFYVTMRTLSENVLADTITAL
FT                   GMMICFYYSLTAFACVWYFRHSLFDSLRHFCMRGLCPLLGGVILSVIFVRTAIDSASPD
FT                   FGSGSHVAGVGLVFVIAAIISALGIVLMMLSRMRAPAYFLGATLRQQATLQLQE"
FT   gene            complement(182745..183365)
FT                   /locus_tag="PputW619_0177"
FT   CDS_pept        complement(182745..183365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0177"
FT                   /product="Guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /note="KEGG: pen:PSEEN5441 guanylate kinase; PFAM:
FT                   guanylate kinase; SMART: guanylate kinase/L-type calcium
FT                   channel region"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70683"
FT                   /db_xref="GOA:B1J4L2"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4L2"
FT                   /protein_id="ACA70683.1"
FT                   /translation="MNHSSGTLYIVSAPSGAGKTSLVNALIKDDQRVSVSVSHTTRGKR
FT                   PGEEHGVNYHFVSHEEFKALIDKNDFLEHAEVFGNFYGTSRSTLQQVLDRGDDLILEID
FT                   WQGARQVRELMPGARSIFILPPNLEALRQRLDGRGQDSDEIIAGRMKEAVSEMQHYDEY
FT                   EYVIINDDFDVALEELKAVFRSNRLLLSKQQERHGALLKQLIG"
FT   gene            complement(183379..184242)
FT                   /locus_tag="PputW619_0178"
FT   CDS_pept        complement(183379..184242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0178"
FT                   /product="YicC domain protein"
FT                   /note="PFAM: YicC domain protein; domain of unknown
FT                   function DUF1732; KEGG: pen:PSEEN5440 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70684"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4L3"
FT                   /protein_id="ACA70684.1"
FT                   /translation="MVHSMTAFARVERAGSQGTLVWELRSVNHRYLEPHLRLPDALRDL
FT                   EGAVREGLRQGLSRGKVECTLRLHEDSNGKPLKVDRERAAQLVAAAEEVAGLIKQPAPL
FT                   NPLEVLSWPGVLVADASDPQALNAEAVALFDEALAELKAGRLREGQELARLINERLDSM
FT                   ATEVTTLRALVPQMLAAQRQKIIDRFGDLKAELDPQRLEQEMVLLAQKSDVAEELDRLS
FT                   THVTEVRRVLKSGGAAGRRLDFLMQELNREANTLGSKAFDPRSTQAAVNLKVLIEQMRE
FT                   QVQNIE"
FT   gene            184470..185192
FT                   /locus_tag="PputW619_0179"
FT   CDS_pept        184470..185192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0179"
FT                   /product="ribonuclease PH"
FT                   /EC_number="2.7.7.56"
FT                   /note="KEGG: pen:PSEEN5439 ribonuclease PH (RNase PH), tRNA
FT                   nucleotidyltransferase; TIGRFAM: ribonuclease PH; PFAM: 3'
FT                   exoribonuclease; Exoribonuclease, phosphorolytic domain 2"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70685"
FT                   /db_xref="GOA:B1J4L4"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1J4L4"
FT                   /protein_id="ACA70685.1"
FT                   /translation="MKRPSGRAADQLRSIRITRNYTKHAEGSVLVEFGDTKVICTVSVE
FT                   NGVPRFLKGQGQGWLTAEYGMLPRSTGERNQREASRGKQGGRTLEIQRLIGRSLRAALD
FT                   MSKLGDITLYVDCDVIQADGGTRTASITGAMVALVDALAVIKKRGGLKAGNPLKHMIAA
FT                   VSVGMYQGEAVLDLDYLEDSAAETDLNVVMTSAGGFIEVQGTAEGAPFQPEDFNAMLAL
FT                   AQKGMNEIFELQQVALAD"
FT   gene            complement(185254..186033)
FT                   /locus_tag="PputW619_0180"
FT   CDS_pept        complement(185254..186033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0180"
FT                   /product="exodeoxyribonuclease III Xth"
FT                   /note="TIGRFAM: exodeoxyribonuclease III Xth; PFAM:
FT                   Endonuclease/exonuclease/phosphatase; KEGG: pen:PSEEN5437
FT                   catabolite repression control protein Crc"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70686"
FT                   /db_xref="GOA:B1J4L5"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4L5"
FT                   /protein_id="ACA70686.1"
FT                   /translation="MRIISVNVNGIQAAAERGLLSWLQAQNADVICLQDTRASAFELDD
FT                   PAFQLDGYFLYACDAEVPAQGGVALYSRMQPKAVITGLGFETADRYGRYLQADFDKVSI
FT                   ASLLLPSGMNGDDDLNQKFKLMDDFAKYLDKQRRKRREYIYCGSFYVAQQKLDIKNWRD
FT                   SQQSPGFLPPERAWMDAITGDMGYVDALREVSREGDQYSWWPDNEQAEMLNLGYRFDYQ
FT                   ILTPGLRRFVRNARLPRQPRFSQHAPLIVDYDWTLTI"
FT   gene            186114..186755
FT                   /locus_tag="PputW619_0181"
FT   CDS_pept        186114..186755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0181"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="KEGG: pen:PSEEN5436 orotate
FT                   phosphoribosyltransferase; TIGRFAM: orotate
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70687"
FT                   /db_xref="GOA:B1J4L6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1J4L6"
FT                   /protein_id="ACA70687.1"
FT                   /translation="MQPYQRDFIRFAIDRGVLRFGEFTLKSGRTSPYFFNAGLFNTGSA
FT                   LAQLGRCYAAAIVDSKIPFDVLFGPAYKGIPLAAATAVALAEQHQLDVPWCFNRKEAKD
FT                   HGEGGSLVGAPLAGDVLIIDDVITAGTAIREVMQIINAQQAKAAGVLIALNREERGNGE
FT                   LSAIQEVERDFGIPVVSIVSLTQVLEFLADDPQLKQHLPAVEAYRAQYGI"
FT   gene            complement(186836..187741)
FT                   /locus_tag="PputW619_0182"
FT   CDS_pept        complement(186836..187741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0182"
FT                   /product="acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="KEGG: pen:PSEEN5435 acetylglutamate kinase; TIGRFAM:
FT                   acetylglutamate kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70688"
FT                   /db_xref="GOA:B1J4L7"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1J4L7"
FT                   /protein_id="ACA70688.1"
FT                   /translation="MTLDRDAASHVAEVLSEALPYIRRFVGKTLVIKYGGNAMESEELK
FT                   TGFARDIVLMKAVGINPVVVHGGGPQIGDLLKRLSIESHFIDGMRVTDAATMDVVEMVL
FT                   GGQVNKDIVNLINRHGGSAIGLTGKDAELIRAKKLTVSRQTPEMTQPEIIDIGHVGEVV
FT                   SVNTDLLNMLVKGDFIPVIAPIGVGANGESYNINADLVAGKVAEALKAEKLMLLTNIAG
FT                   LMDKQGQVLTGLTTEQVNELIADGTIYGGMLPKIKCALEAVQGGVNSSHIIDGRVPNAV
FT                   LLEIFTDSGVGTLITNRKPR"
FT   gene            complement(187772..189169)
FT                   /locus_tag="PputW619_0183"
FT   CDS_pept        complement(187772..189169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0183"
FT                   /product="Phosphomannomutase"
FT                   /EC_number="5.4.2.8"
FT                   /note="PFAM: phosphoglucomutase/phosphomannomutase;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain III; KEGG: pen:PSEEN5434 phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70689"
FT                   /db_xref="GOA:B1J4L8"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4L8"
FT                   /protein_id="ACA70689.1"
FT                   /translation="MNDMAHLVPALPDSIFRAYDIRGVVGKTLHAETAYWIGRAIGAQT
FT                   LAQGEPQISVGRDGRLSGPMLVEQLIKGLADAGCQVSDVGLVPTPALYFAANVLAGKSG
FT                   VMLTGSHNPSDYNGFKIVIAGDTLANEQIQALLTRLKTNDLTRGEGSVEKVGILERYFQ
FT                   QIVADVKLAKKLKVVVDCGNGAAGVIAPQLIEALGCEVIPLFCEVDGNFPNHHPDPGKP
FT                   ENLEDLIAKVKETGADIGLAFDGDGDRVGVVTNTGSIVYPDRLLMLFAQDVLARNPGAE
FT                   IIFDVKCTRRLTPLIEQHGGRALMWKTGHSLIKKKMKQTGSLLAGEMSGHIFIKERWYG
FT                   FDDGIYSAARLLEILSKADQDAESLFAAFPNDISTPEINIDVTDEGKFSIIDALQRDAD
FT                   WGQACLTTIDGVRVDYAQGWGLVRASNTTPVLVLRFEAESDAELQRIKDVFRAQLLRVA
FT                   PELQLPF"
FT   gene            complement(189281..189736)
FT                   /locus_tag="PputW619_0184"
FT   CDS_pept        complement(189281..189736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0184"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase
FT                   Dut"
FT                   /EC_number="3.6.1.23"
FT                   /note="KEGG: pen:PSEEN5433 deoxyuridine 5'-triphosphate
FT                   nucleotidohydrolase; TIGRFAM: deoxyuridine 5'-triphosphate
FT                   nucleotidohydrolase Dut; PFAM: deoxyUTP pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70690"
FT                   /db_xref="GOA:B1J4L9"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1J4L9"
FT                   /protein_id="ACA70690.1"
FT                   /translation="MHALQAKILDPRLGSEFPLPQYATPGSAGLDLRALLKEDTVLEPG
FT                   QTLLIPTGLSIYIGDPGLAAMILPRSGLGHKHGIVLGNLVGLIDSDYQGELMVSCWNRG
FT                   NTPFTIAVGERIAQLVLVPVVQAHFEVVEAFDESQRGTGGFGHSGSH"
FT   gene            complement(189742..190953)
FT                   /locus_tag="PputW619_0185"
FT   CDS_pept        complement(189742..190953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0185"
FT                   /product="phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase"
FT                   /EC_number="4.1.1.36"
FT                   /EC_number="6.3.2.5"
FT                   /note="KEGG: pen:PSEEN5432 phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase;
FT                   TIGRFAM: phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase; PFAM:
FT                   flavoprotein; DNA/pantothenate metabolism flavoprotein
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70691"
FT                   /db_xref="GOA:B1J4M0"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4M0"
FT                   /protein_id="ACA70691.1"
FT                   /translation="MQRLYRKRIVLGVGGGIAAYKSAELIRRLLEHGAQVRVVMTRGGA
FT                   EFITPLTLQALSGHPVHMDLLDPAAEAAMGHIELAKWADLVLIAPATADLMARMAQGMA
FT                   DDLLTTLVLATDATVAVAPAMNQAMWRDPATQANLDLLKTRGIQVFGPASGSQACGDVG
FT                   LGRMLEATDLAWCAAESFKRQALTGKHVLITAGPTQENIDPVRYITNHSSGKMGFALAE
FT                   AAAEAGARVTLVTGPVHLQTPDRVNRIDVVSARDMLAACEAAMPCDLFIASAAVADYRP
FT                   EVVATQKLKKDPTTGDGMLLQMVRNPDILATIAGRTDRPFSVGFAAETEHLLDYATRKL
FT                   KDKNLDLIVANDVANPSIGFNSEENALTVIDRQQHQTLFAQTSKGKIARQLVAFIAERL
FT                   NQVQ"
FT   gene            191084..191764
FT                   /locus_tag="PputW619_0186"
FT   CDS_pept        191084..191764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0186"
FT                   /product="DNA repair protein RadC"
FT                   /note="PFAM: DNA repair protein RadC; KEGG: pen:PSEEN5431
FT                   DNA repair protein RadC"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70692"
FT                   /db_xref="GOA:B1J4M1"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1J4M1"
FT                   /protein_id="ACA70692.1"
FT                   /translation="MKISEWPAEERPREKLMQRGVGSLSDAELLAVFLGSGVRGRNVVE
FT                   LARGLLVKFGGLRQLLEADRDAFVGELGLGPVRYGQLQALLEIGRRNLATSIERDCALE
FT                   SPSAVRRYLKAMLRHEPSEVFGCLFLDSKHRPLAFEILFRGTIDRASIYPREVVRRSLM
FT                   HNAAALILCHNHPSGNSEPSQDDVHMTLALKRGLALIDVRVLDHIIVGDGEPLSMVEQG
FT                   WIVA"
FT   gene            complement(191835..193424)
FT                   /locus_tag="PputW619_0187"
FT   CDS_pept        complement(191835..193424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0187"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: pen:PSEEN5430 periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70693"
FT                   /db_xref="GOA:B1J4M2"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4M2"
FT                   /protein_id="ACA70693.1"
FT                   /translation="MRAAALSLMLTSLFAAGIAQAAPLSVCSEASPEGFDVVQYNSLTT
FT                   TNASADVLMNRLVEFDAGQGKVIPSLAQSWTVSADGLVYDFKLREGVKFHSTPYFKPTR
FT                   ALDADDVLFSFQRMLYPAHAWHKTAPGGYPHAQSLQLGSLIKSIEAPEPNSVRFTLTHA
FT                   DATFLATLSMGFASIYSAEYADKLLKAGTPQKLNSQPIGTGPFVFQRYQKDAVVRYRAN
FT                   PDYFDGKPAVDPLIFAITTDANVRLQKLKRGECQVALSPKPLDVTEAGKDGNLKVATTP
FT                   AFMTAFVAINSEHPPLDKPEVRQAINLAFDKQAYLKAVFEGTATAANGPYPPNTWSYAK
FT                   DLPGYPLDLKRAKALLSKAGYPEGLSTTIWTRPSGSLLNPNPSLGAQMLQADLAKIGIK
FT                   AEIRVIEWGELIRRAKAGEHDLLFMGWAGDNGDPDNFLSPQFSCAAVKSGTNFARFCDS
FT                   RLDQLISAGRTTNDQSVRSRLYQQAQTLIQQQALWVPLAHPMAAALLREGVEGYQVSPF
FT                   GRLDFSKVSVKR"
FT   sig_peptide     complement(193359..193424)
FT                   /locus_tag="PputW619_0187"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            193785..194021
FT                   /locus_tag="PputW619_0188"
FT   CDS_pept        193785..194021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0188"
FT                   /product="ribosomal protein L28"
FT                   /note="PFAM: ribosomal protein L28; KEGG: psa:PST_0107 50S
FT                   ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70694"
FT                   /db_xref="GOA:B1J4M3"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1J4M3"
FT                   /protein_id="ACA70694.1"
FT                   /translation="MSRVCQVTGKGPVTGNNISHANNKTRRRFLPNLQHHRFWVESENR
FT                   FVRLRVSAKGMRVIDKRGIDVVLAELRARGEKF"
FT   gene            194032..194187
FT                   /locus_tag="PputW619_0189"
FT   CDS_pept        194032..194187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0189"
FT                   /product="ribosomal protein L33"
FT                   /note="PFAM: ribosomal protein L33; KEGG: pen:PSEEN5426 50S
FT                   ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70695"
FT                   /db_xref="GOA:B1J4M4"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4M4"
FT                   /protein_id="ACA70695.1"
FT                   /translation="MRELIRLVSSAGTGHFYTTDKNKRTTPDKIEIKKYDPVVRKHVVY
FT                   KEAKIK"
FT   gene            complement(194310..194510)
FT                   /locus_tag="PputW619_0190"
FT   CDS_pept        complement(194310..194510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70696"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4M5"
FT                   /protein_id="ACA70696.1"
FT                   /translation="MTTDILSPARHVIGSQYVESVKPYILELTGLMTAAGPRDITTMDI
FT                   RSDRVLINVDTAGTIEGLRIS"
FT   gene            complement(194607..194966)
FT                   /locus_tag="PputW619_0191"
FT   CDS_pept        complement(194607..194966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0191"
FT                   /product="protein of unknown function DUF861 cupin_3"
FT                   /note="PFAM: protein of unknown function DUF861 cupin_3;
FT                   KEGG: pen:PSEEN5425 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70697"
FT                   /db_xref="InterPro:IPR008579"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4M6"
FT                   /protein_id="ACA70697.1"
FT                   /translation="MNIASIIDFAQVLTEAERYRPAAEKILKGEPDQAVYNHYSSPCGQ
FT                   FAAGVWEGEVGQWTVNYTEHEYCEIVQGVSVLRDSDGGAKTLRAGDRFVIPAGFKGTWE
FT                   VLEPCRKIYVMFEQK"
FT   gene            195163..196656
FT                   /locus_tag="PputW619_0192"
FT   CDS_pept        195163..196656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0192"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: pen:PSEEN5424
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70698"
FT                   /db_xref="GOA:B1J4M7"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4M7"
FT                   /protein_id="ACA70698.1"
FT                   /translation="MTTLTRADWEQRAQQLKIEGRAFINGEYTDAASGETFDCLSPVDG
FT                   RFLAKVASCDLADANRAVENARATFNSGVWSQLAPAKRKAKLIRFADLLRKNVEELALL
FT                   ETLDMGKPIGDSSSIDVPGAANAIHWTAEAIDKVYDEVAPTPNDQLGLVTREAVGVVGA
FT                   IVPWNFPLLMACWKIAPALATGNSLVLKPSEKSPLTAIRIAQLAIEAGIPAGVLNVLPG
FT                   YGHTVGKALALHMDVDTLVFTGSTKIAKQLMVYAGESNMKRIWLEAGGKSPNIVFADAP
FT                   DLQAAAEAAASAIAFNQGEVCTAGSRLLVERSIKDKFLPMVVEALKGWKPGNPLDPQTT
FT                   VGALVDTQQMNTVLSYIDAGHKDGAKLLAGGKRTLEETGGTYVEPTIFDGVTNAMKIAQ
FT                   EEIFGPVLSVIAFDTAEEAIAIANDTPYGLAAGIWTSDISKAHKTARAVRAGSVWVNQY
FT                   DGGDMTAPFGGFKQSGNGRDKSLHALEKYTELKATWIKL"
FT   gene            196759..197898
FT                   /locus_tag="PputW619_0193"
FT   CDS_pept        196759..197898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0193"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   pen:PSEEN5423 major facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70699"
FT                   /db_xref="GOA:B1J4M8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4M8"
FT                   /protein_id="ACA70699.1"
FT                   /translation="MRWGSYFAVLASVLSVGLALGVSMPLVSLRLEAWGYGSFAIGVMA
FT                   AMPALGVLLGASLASRLAGWVGVPAAMRLCLWGGALSIGLLAVLPSYPLWLALRLLIGM
FT                   SLTVVFILGESWINQLVVEQWRGRLVALYGSSYALSQLAGPLVLGFLGSDDDFGFWAAT
FT                   GLLLLSPLLLLGRGGAPSTEACSVTFSDLFAFCRRLPVIAWAIALFASFEAMILTLLPV
FT                   YCLQQGFSTELALFMVSTVVVGDAVLQLPIGALADHMSRRALFTACAVTLLCSSLAIPL
FT                   LLHTPMIWPLWVLFGASAGGLFTLSLILIGERYRDDALVRANAHVAQLWGIGCLLGPLL
FT                   AGAGSQWLSGHALPLLMAVGAAGLVVLTRRRGAFEPAAA"
FT   sig_peptide     196759..196824
FT                   /locus_tag="PputW619_0193"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.971) with cleavage site probability 0.798 at
FT                   residue 22"
FT   gene            complement(197908..199464)
FT                   /locus_tag="PputW619_0194"
FT   CDS_pept        complement(197908..199464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0194"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /note="PFAM: phospholipase D/Transphosphatidylase; KEGG:
FT                   pen:PSEEN5422 phospholipase D/transphosphatidylase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70700"
FT                   /db_xref="GOA:B1J4M9"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4M9"
FT                   /protein_id="ACA70700.1"
FT                   /translation="MRLQRALPLLLVLVLLGLAGCASVGTPREISQALPAKDSAFGRSV
FT                   MRQAAPYEGRSGFRLLPNSNEAFRARAELIRNAQASIDLQYYIVHDGLSTRALVHELLR
FT                   AADRGVRVRILLDDTTSDGLDTIMGTLDAHPNIQIRVFNPLHLGRSTGVTRAVGRLFNL
FT                   SRQHRRMHNKLFLVDNSMAIVGGRNLGDEYFDAEPNLNFTDIDMLGVGPVAEQLGHSFD
FT                   QYWNSALSRPVTDFLWQLPDAADLRASRHRLEVSLAEARVQRKALYDRLMAYQSEPRLD
FT                   VWRNELIWAHSQALWDAPSKVLADDEPDPHLLMSQQLAPDLANVHHELILVSAYFVPGE
FT                   PGLLYLTGRADAGMSVKLLTNSLEATDVPAVHGGYAPYRRALLEHGVQLFELRRQPGDP
FT                   SAGRLSFHGGSDSSLHSKAIVFDRRKTFIGSFNFDPRSVLWNTEVGVLVDSPELAEYTR
FT                   ELAVQGMAPALSYQVRLENDKLAWVTEDNGQLHTLTAEPGGLWRRFNAWISKAVGLEKM
FT                   L"
FT   sig_peptide     complement(199390..199464)
FT                   /locus_tag="PputW619_0194"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.798 at
FT                   residue 25"
FT   gene            complement(199525..200955)
FT                   /locus_tag="PputW619_0195"
FT   CDS_pept        complement(199525..200955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0195"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain"
FT                   /note="PFAM: regulatory protein GntR HTH; aminotransferase
FT                   class I and II; KEGG: pen:PSEEN5421 transcriptional
FT                   regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70701"
FT                   /db_xref="GOA:B1J4N8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4N8"
FT                   /protein_id="ACA70701.1"
FT                   /translation="MTLYLNLAELLGTRIEQGLYRPGQRLPSVRALSVEHGVSLSTVQQ
FT                   AYRLLEDNGMVSPRPKSGYFVNDHRRLAALPAVSRPAQRPVDISQWEQVLELVRSTPRQ
FT                   DVIQLGRGMPDIDSPSLKPLLRSLAQLSRRQDMPGLYYDNIHGNLALREQVARLMLDSG
FT                   CRLGPADLVVTTGCHEALSCSIRAVCQPGDIVAVDSPSFHGAMQTLKGLGMKALEIPTD
FT                   PITGISLEALELALEQWPIKLIQITPSCNNPLGYIMPEARKKALLNLAQRYDVAILEDD
FT                   VYGDLAYTYPRPRTLKSFDDDGRVLLCSSFSKTLAPGLRIGWVAPGRYLERVLHMKYIS
FT                   TGSTATQPQLAIADFIASGHYHPHVRRMRSQYQRGRDLMSDWVNRYFPPGTRVSRPQGG
FT                   FMLWVELPEHFDTLRLNRALLEQGVQVAVGSIFSASGKFRHCLRMNFAARPTPPIEDAV
FT                   RKVGETALRLLDQSNADG"
FT   gene            201134..201364
FT                   /locus_tag="PputW619_0196"
FT   CDS_pept        201134..201364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0196"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN5420 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70702"
FT                   /db_xref="InterPro:IPR009506"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4N9"
FT                   /protein_id="ACA70702.1"
FT                   /translation="MGGMSDVRLQLLAREMEAGQQARVFNAPQGMGRWGLMLHRWHTRR
FT                   ALLQLTDEQLRDVGLSWEQALIEGRKPFWKD"
FT   gene            complement(201406..202698)
FT                   /locus_tag="PputW619_0197"
FT   CDS_pept        complement(201406..202698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0197"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   pen:PSEEN5419 oxidoreductase; D-amino acid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70703"
FT                   /db_xref="GOA:B1J4P0"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4P0"
FT                   /protein_id="ACA70703.1"
FT                   /translation="MIHSAQHAASYYAASSAPHPDHPFLQGEHSADVCIVGGGYSGLNT
FT                   AIELAERGLSVILLEARKLGWGASGRNGGQLIRGVGHGLEQFRAVIGEEGVRSMKLMGL
FT                   EAVDIVRERVERHAIACDLTWGYCDLANKPGELQGFAEDAEELRSLGYRHELRLVHKDD
FT                   IHSVVGSDCYVGGLIDMGSGHLHPLNLALGEAAVASRLGVQLYEQSEVSRIEYGPEVKV
FT                   HTGQGRVRAKTLVLCCNAYHNGLNRELGGKVLPAGSYIIATEPLGEERARQLLPQNMAV
FT                   CDQRVALDYYRLSADHRLLFGGACHYSGRDPQDIAAYMRPKMLKVFPQLADVRIDYQWG
FT                   GMIGIGANRLPQIGRLASQPNVYYAQAYSGHGLNATHLAARLLGEAISGQQSGRFDLFA
FT                   KVPHITFPGGKHLRSPLLALGMLWHRLKELT"
FT   gene            202831..203184
FT                   /locus_tag="PputW619_0198"
FT   CDS_pept        202831..203184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0198"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="PFAM: protein of unknown function UPF0153; KEGG:
FT                   pen:PSEEN5418 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70704"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="InterPro:IPR016928"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4P1"
FT                   /protein_id="ACA70704.1"
FT                   /translation="MSCNRHKIQFLRELIPSFECEPGCHDCCGPVTTSAEEMARLPRKS
FT                   QAEQDAALQRLDCVHLGPNGCTVYEERPMICRLFGTTPRMACPRGRGPEQMIEPQAEQL
FT                   VHRFIATTRQVLV"
FT   gene            complement(203187..203675)
FT                   /locus_tag="PputW619_0199"
FT   CDS_pept        complement(203187..203675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0199"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; KEGG:
FT                   pen:PSEEN5417 leucine-responsive regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70705"
FT                   /db_xref="GOA:B1J4P2"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4P2"
FT                   /protein_id="ACA70705.1"
FT                   /translation="MRTQHQSKRELDKIDRNILRILQNDGRISFTELGEKVGLSTTPCT
FT                   ERVRRLEREGIIMGYNARLNPQHLKGSLLVFVEISLDYKSGDTFEEFRRAVLKLPHVLE
FT                   CHLVSGDFDYLVKARISEMASYRKLLGDILLKLPHVRESKSYIVMEEVKESLCLPIPD"
FT   gene            203829..205130
FT                   /locus_tag="PputW619_0200"
FT   CDS_pept        203829..205130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0200"
FT                   /product="D-amino-acid dehydrogenase"
FT                   /EC_number="1.4.99.6"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   pen:PSEEN5416 D-amino acid dehydrogenase, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70706"
FT                   /db_xref="GOA:B1J4P3"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR023080"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1J4P3"
FT                   /protein_id="ACA70706.1"
FT                   /translation="MRVLVLGSGVIGTASAYYLARQGFEVTVVDRQPAVAMETSFANAG
FT                   QISPGYASPWAAPGVPLKAIKWLLERHAPLAIKLTGDVDQYLWMAQMLRNCTASRYAVN
FT                   KERMVRLSEYSRDCLDELRAETGIAYESRTLGTTQLFRTQAQLDAAAKDIAVLEQSGVP
FT                   YELLDRDGIARVEPALAGVKDILAGALRLPNDQTGDCQLFTTKLAEMALKLGVEFRFGQ
FT                   DIQRLDFAGDRINGVWVDGKLETADRYVLALGSYSPQMLKPLGIKAPVYPLKGYSLTVP
FT                   ITNADMAPTSTILDETYKVAITRFDNRIRVGGMAEIAGFDLSLNPRRRETLEMIVNDLY
FT                   PRGGDLSQASFWTGLRPATPDGTPIVGATAFRNLFLNTGHGTLGWTMACGSGRLLADLI
FT                   ARKKPQISAEGLDISRYGKTREVAKQGHTAPVHQ"
FT   gene            205252..206325
FT                   /locus_tag="PputW619_0201"
FT   CDS_pept        205252..206325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0201"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="KEGG: pen:PSEEN5415 alanine racemase 2, PLP-binding,
FT                   catabolic; TIGRFAM: alanine racemase; PFAM: alanine
FT                   racemase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70707"
FT                   /db_xref="GOA:B1J4P4"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4P4"
FT                   /protein_id="ACA70707.1"
FT                   /translation="MRPARALIDLQALRHNYRLARELTGAKALAVIKADAYGHGAVRCA
FT                   LALEAEADGFAVACIEEALELRAAGIKAPMLLLEGFFEASELSLIAEHDLWCVVHSLWQ
FT                   LEAIEKTPVHKPLTLWLKLDSGMHRVGLHPKDYHEAYQRLLASGKVARIVLMSHFARAD
FT                   ELDADATEQQIAVFEAARQGLAAECSLRNSPGVLAWPHAPSDWVRPGIMLYGATPFEVA
FT                   QAQAERLQPVMTLQSRVISVRELPAGEPVGYGAKFISPRPTRVGVVAMGYADGYPRQAP
FT                   TGTPVMVAGKRSQLIGRVSMDMLCIDLTDVPEATIGSPVELWGKHVLASEVAMHAGTIP
FT                   YQIFCNLKRVPLDYFGE"
FT   gene            206436..206984
FT                   /locus_tag="PputW619_0202"
FT   CDS_pept        206436..206984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0202"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; Cupin 2
FT                   conserved barrel domain protein; KEGG: pen:PSEEN5414
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70708"
FT                   /db_xref="GOA:B1J4P5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4P5"
FT                   /protein_id="ACA70708.1"
FT                   /translation="MDVGERLQAIRKLKGLSQRELAKRAGVTNSTISMIEKNSVSPSIS
FT                   SLRKVLSGIPMSMVEFFSVELEAESHAQIVYKAHELIDISDGAVTMKLVGKSHPNRAIA
FT                   FLTEVYPPGADTGAEMLTHDGEETGILLEGRLELVVGTETFVLEEGDSYYFESTRPHRF
FT                   RNPFDEPARLISAATPSNF"
FT   gene            207121..207543
FT                   /locus_tag="PputW619_0203"
FT   CDS_pept        207121..207543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0203"
FT                   /product="cytochrome c5"
FT                   /note="KEGG: pfo:Pfl_5522 cytochrome c5"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70709"
FT                   /db_xref="GOA:B1J4P6"
FT                   /db_xref="InterPro:IPR002323"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4P6"
FT                   /protein_id="ACA70709.1"
FT                   /translation="MNQIKKMLAVPAAVFALWAMSATAATNDDIAKRLEPVGQVCVQGQ
FT                   ECKGMEVAASAGGGGAKTPDEIIAKHCNACHGSGLLGAPKIGDTAAWKERADHQGGLDG
FT                   ILAKAITGINAMPPKGTCADCSDDDLKAAIQKMSGL"
FT   sig_peptide     207121..207195
FT                   /locus_tag="PputW619_0203"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.989 at
FT                   residue 25"
FT   gene            207662..209521
FT                   /locus_tag="PputW619_0204"
FT   CDS_pept        207662..209521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0204"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN5412 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70710"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR038460"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4P7"
FT                   /protein_id="ACA70710.1"
FT                   /translation="MHLCSIDQAVEQVLSRLPAHIHMGLPLGLGKPNAFVNALYARVRD
FT                   LPERRLTIYTALSLGRPPLGDGLQRRFLEPFIERVFADYQELTYLADLRNDQLPPNIRV
FT                   EQFFMQPGGLLHSDCAQQEYVSSNYSHAARDINAKGLNLIAQLVAATPERPVHLSLACN
FT                   PDITLDLLPMIAKRREAGETILMLGQVHAELPYMPGDSELGMEAFDLLIDQVEQSRLFS
FT                   TPNMPVTTQDHCIGLHASTLVRDGGTLQIGIGAMGDAVAAALLARQGDNSGYRALMGEL
FT                   DVGPWQTLIEREGGLDAFGQGLYGCSEMFVNGLLALAEAGVVRRPADEQGVLVHGGFFL
FT                   GPQAFYQRLREMPLEQRAQFAMTRISFINELYGQEELKRRQRRDARFINTVFTMTLLGA
FT                   GVADQLEDGRVLSGVGGQYNFVAQGHALEGGRSILLLRSWREAGGEVSSNLLWAYGHCT
FT                   IPRHLRDIVVTEYGIADLRGQTDSEVIARLLAISDSRFQGDLIEQAKQAGKLAKDFQLD
FT                   ARFTDNTPERLEQIRARHSRLFPEYPLGTDFTAEERDLLRALSWLKSKFRLSEVLELGK
FT                   AALDAPGPEGYAAQLARMQLDEPRGLKEELYQRLLLAGLAATR"
FT   gene            complement(209636..210208)
FT                   /locus_tag="PputW619_0205"
FT   CDS_pept        complement(209636..210208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0205"
FT                   /product="xanthine phosphoribosyltransferase"
FT                   /note="TIGRFAM: xanthine phosphoribosyltransferase; PFAM:
FT                   phosphoribosyltransferase; KEGG: pen:PSEEN5411 xanthine
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70711"
FT                   /db_xref="GOA:B1J4P8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR010079"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4P8"
FT                   /protein_id="ACA70711.1"
FT                   /translation="MEALQQKIRDEGIVLSDQVLKVDAFLNHQIDPALMQLIGDEFARL
FT                   YADAGVTKIVTIEASGIAPAVMTGLKLGVPVIFARKHQSLTLTENLLTASVYSFTKQTE
FT                   NTVAISPRHLNSSDRVLVIDDFLANGKASQALISIIKQAGATVAGLGIVIEKSFQGGRA
FT                   ELDGQGYRVESLARVKSLEGGVVSFIE"
FT   gene            complement(210272..212281)
FT                   /locus_tag="PputW619_0206"
FT   CDS_pept        complement(210272..212281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0206"
FT                   /product="ATP-dependent DNA helicase Rep"
FT                   /note="TIGRFAM: ATP-dependent DNA helicase Rep; PFAM:
FT                   UvrD/REP helicase; KEGG: pen:PSEEN5410 ATP-dependent DNA
FT                   helicase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70712"
FT                   /db_xref="GOA:B1J4P9"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005752"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4P9"
FT                   /protein_id="ACA70712.1"
FT                   /translation="MSRLNPRQQEARDYVGGPLLVLAGAGSGKTSVITRKIAHLIQNCG
FT                   IRAQYIVAMTFTNKAAREMKERVATLLRPGEGRGLTVCTFHNLGLNIIRKEHDKLGYKP
FT                   GFSIFDESDIKALLSDIMQKEYSGDDGIDEIKNMIGAWKNDLILPAEALEKARNPREQT
FT                   AAIVYTHYQRTLKAFNAVDFDDLILQPVKLFQEHPEVLERWQNRVRYLLVDEYQDTNAS
FT                   QYLLVKMLIGMRNQFTVVGDDDQSIYAWRGARPENLMLLKEDYPSLKIVMLEQNYRSTS
FT                   RILRCANVLIANNPHAFEKQLWSEMGVGDEIRVIRCKNEEAEAERVAMEILTLHLRTNR
FT                   PYSDFAILYRGNYQAKLIELKLQHHQVPYRLSGGNSFFGRQEVKDLMAYLRLLVNPDDD
FT                   NAYLRVINVPRREIGSTTLEKLGNYATERGVSMYAASEELGLGEHLDARYTERLQRFKH
FT                   WLDGVRHKVALEDPIAALHEMIRDIDYENWIRQQTASDKAAEFRISNVWFLVEALKNTL
FT                   EKDEEGDMTIEDAIGKLVLRDMLERQQEEEENAEGVQMMTLHASKGLEFPYVFIMGMEE
FT                   EILPHRSSIEADTIEEERRLAYVGITRARQTLAFTFAAKRKQYGEIIDCTPSRFLDELP
FT                   PDDLAWEGLDDAPVEVKAARGNNALADIRAMLKR"
FT   gene            212579..214243
FT                   /locus_tag="PputW619_0207"
FT   CDS_pept        212579..214243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0207"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; KEGG: pen:PSEEN5409
FT                   diguanylate cyclase (GGDEF domain)"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70713"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4Q0"
FT                   /protein_id="ACA70713.1"
FT                   /translation="MSTPVEPLRLLLLADEPEWAALLRECLLPLNGAAVLLTAPNWAAV
FT                   DSLFSQDRQAVILATQALQPAPGRCELPTILLLDDEPVAPPTGVSDWLVRSQLNADALR
FT                   RSLRHVRERGVLVATLQRLAEQDPLTGIANRQGFQALLTARLAENDGRGVALGHLDLDN
FT                   FRHVNDALGHQGGDRLILQVVSRLKQQLEAGDQLARLGSDEFALLIDTRRDTGRAERIA
FT                   ERIVEALAEPYWIDGESLLLGCSLGLAHARAQSGADPLMWHAHIAMRQAKSSQGCTFHV
FT                   FNERINRNARSLADLEGELRRALRRDELELHYQPRLNLADGSIVGLEALVRWRHAERGL
FT                   LPPSEFVPLAEQSGLIVPLGYWVISRALRDMQALRESGLAPLHMAVNLSFRQFQDSQLL
FT                   ATLSRLIIEHGVDARWLEFELTETAVMRRNELVRQTMDALGRLGVRFSLDDFGTGFSSF
FT                   VHLNSLPITLLKVDRSFVAEMEMREENRKLVHAMINLAHNLNLEVVAEGVESPEQMALL
FT                   REFGCDQVQGFLVSKPLPVDELVEYLSGSVPPQVVSL"
FT   gene            complement(214320..215708)
FT                   /locus_tag="PputW619_0208"
FT   CDS_pept        complement(214320..215708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0208"
FT                   /product="MATE efflux family protein"
FT                   /note="TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE; KEGG: pen:PSEEN5408
FT                   MATE efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70714"
FT                   /db_xref="GOA:B1J4Q1"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4Q1"
FT                   /protein_id="ACA70714.1"
FT                   /translation="MHVAPTTELKALLRLAGPLVASQLAHMLMVLTDTLMMARISPQAL
FT                   AGGGLGAASYSFVSIFCLGVIAAVGTLVAIRKGANDIEGATRLAQNGLWLAWGLALVAA
FT                   LALWNLKPVLLLFGQQPENVAAATEFLTLLPLALPGYLTFMALRGFTSALGRSTPVMVI
FT                   SLVGTVLNYLFNVALIEGMFGLPKLGLMGIGLVTAVVSMGMAIALALYIRWHPAYAAYP
FT                   LRKGLSRPSLPALRELWRLGLPIGGTYMVEVGLFAFAALCMGVLGSTELAAHQIALQIV
FT                   STAFMVPTGLSYAVTMRVGLYYGAGNLLAARSAGRVGISFGALIMFAFAALFWLRPEML
FT                   VSLFIDGNDPAFAAIYQLAVSLLMVAAWFELFDGVQTIAMGSIRGLKDAKTTFLIGLCC
FT                   YWLVGAPSAWLLTFNLGGGAVGVWWGLALGLACASVALTLAFEWRMKRMLGKAGVTAKA
FT                   VIPA"
FT   gene            215859..216785
FT                   /locus_tag="PputW619_0209"
FT   CDS_pept        215859..216785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0209"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: pen:PSEEN5407 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70715"
FT                   /db_xref="GOA:B1J4Q2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4Q2"
FT                   /protein_id="ACA70715.1"
FT                   /translation="MSRQLPALYALRAFEAAARLSSFTRAGQELSITQSAVSRHIRTLE
FT                   EHFACRLFIRSGRSLQLTEAARVLLPGVREGFAALERACDTLRGEDDILRMKAPSTLTM
FT                   RWLLARLSQFRHLQPGNEVQLTSAWMDVDHVDFNQEPFDCAVLLSDGVFPPDWEVRRLF
FT                   SELLIPVGAPELLNEGPLDERRLAGIELLHPTPDKRDWREWLERMGLADTVSLKGGQVF
FT                   DTLELGMIAAARGYGISMGDLLMVAEDVAHGRLSLPWPTAVPSGMDYYLVWPRTRPGGE
FT                   RLRRLSVFLQEEAAAVNLPAVQILPAI"
FT   gene            217004..218902
FT                   /locus_tag="PputW619_0210"
FT   CDS_pept        217004..218902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0210"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: pen:PSEEN5406
FT                   methyl-accepting chemotaxis transducer"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70716"
FT                   /db_xref="GOA:B1J4Q3"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033462"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4Q3"
FT                   /protein_id="ACA70716.1"
FT                   /translation="MSQPRARIASQLGIALAIVLALVITGSTLFALRSLDDANLITRQE
FT                   HLASEARLLADQLETFHGSLKDNTQRLSGLFERRFASGLSLHAGETVQVAGQATPALYL
FT                   GDHLLNNDFQQVDEFQQMTAGVATLFVRSGDDFVRISTNLKKQDGSRAIGTQLDRQHPA
FT                   YAKLMAGQTYVGRALLFERNYMTRYVPVTDGSGRVIAVLFVGFDYTDAQNAQFANLKRF
FT                   RIGDTGSLALRDEQGKWLVPPANADQPLYSASAPFAEGPWTVVASMPLEEIRAVTWDVG
FT                   LRLAIGSLLAMLLAVAATLWLLRRKLRPLDDLVRQAEALGAGDLSARLAVTSHDEIGQL
FT                   ARSFNKMGEALATMVEHIRGASEQVSSRARSLSGLSAGACEGMDQQSGEITSMAGAVEE
FT                   FSATSMNIADNMAGTERMARDNAQQTRIGRSAMDEASSSLRQIAEALGGTATVMDTLGA
FT                   RSQEIGGIVGVITAIAEQTNLLALNAAIEAARAGEQGRGFAVVADEVRGLAARTRQATD
FT                   EISGMIASIQQQTGHAISTLEQGNQLMQEGLARNDKVAESLARIDEQSRVAGEQFTVIS
FT                   TATQEQSSTATVLSRNLQSIAQANSEQRDVANELAFTAKELEGLAAQLRQEVDRFR"
FT   sig_peptide     217004..217099
FT                   /locus_tag="PputW619_0210"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.865) with cleavage site probability 0.792 at
FT                   residue 32"
FT   gene            complement(218990..220384)
FT                   /locus_tag="PputW619_0211"
FT   CDS_pept        complement(218990..220384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0211"
FT                   /product="protein of unknown function DUF1338"
FT                   /note="PFAM: protein of unknown function DUF1338; KEGG:
FT                   pen:PSEEN5405 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70717"
FT                   /db_xref="InterPro:IPR009770"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4Q4"
FT                   /protein_id="ACA70717.1"
FT                   /translation="MPAHDFVSPDSIRAQFSAAMSLMYKQEVPLYGTLLELVSEINQQV
FT                   MAQQPEVAQALRWTGEVERLGQERHGAIRVGTAQELATIARLFAVMGMQPVGYYDLSSA
FT                   GVPVHSTAFRAVHEQALHISPFRVFTSLLRLELIDNPALRELAETLLAKRKIFTARALE
FT                   LITQCERDGGLNAADAEEFVQQALHTFRWHQDATVTAEQYQQLHDQHRLIADVVAFKGP
FT                   HINHLTPRTLDIDAIQLGMPAKGIPPKAVVEGPPTRRHPILLRQTSFKALQEKVAFSDQ
FT                   HGSEGSHTARFGEIEQRGAALTPKGRQLYDKLLDATRAALGGAPAEANAERYMALLKEQ
FT                   FAEFPDDLAQMREQGLAYFRYFATEKGLAAREQADRPTTLEGLIEAGHVHFEALVYEDF
FT                   LPVSAAGIFQSNLGDDAQAEYGSNANREAFEAALGLPVQDELALYAQSEKRSLQACAQA
FT                   LNLRLG"
FT   gene            complement(220576..221466)
FT                   /locus_tag="PputW619_0212"
FT   CDS_pept        complement(220576..221466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0212"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: pen:PSEEN5404 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70718"
FT                   /db_xref="GOA:B1J4Q5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4Q5"
FT                   /protein_id="ACA70718.1"
FT                   /translation="MSKRLVPSMTALQCFEAAARHLSFTRAAEELHLTQSAVSKQVAQL
FT                   EEMLRHHLFLRIRRRLQLTPAGSLYLAEVNKILTQVDMSSRYVLTYGEQTEILKVATQP
FT                   SFGVRWLIPHLKGFGKRHTNIHLDIRNEMEPFALLQGSADVVFFYGQGTWPGATCVELF
FT                   REEVVPVCAPELLAGRTLGDAAELADLVLLQSTSRPEAWHEWFLELGLQSVSAYHGPRF
FT                   DTFYMALSAAQAGCGVALVPRYLAAKELSEGSLVIPWNHAMNSAGAHYLAYAEHAAEVP
FT                   KVRALVEWIHEQLQA"
FT   gene            221602..223092
FT                   /locus_tag="PputW619_0213"
FT   CDS_pept        221602..223092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0213"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: pen:PSEEN5402
FT                   probable aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70719"
FT                   /db_xref="GOA:B1J4Q6"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4Q6"
FT                   /protein_id="ACA70719.1"
FT                   /translation="MVAGLLERLGVAATAYTQGDYPVHTPIDGSQIASVKLLGKAETIA
FT                   CIDQAQSAFEAWRSVPAPRRGELVRLFGEVLREHKADLGELVSIEAGKITQEGLGEVQE
FT                   MIDICDFAVGLSRQLYGLTIASERPGHHMRESWHPLGVVGVISAFNFPVAVWAWNTALA
FT                   LVAGNSVVWKPSEKTPLTALACQALFEKALKAFGDAPAGLAQLVIGGREAGEALVDDPR
FT                   VPLVSATGSTRMGREVGPRVAARFGRSILELGGNNAMILAPSADLDLAVRGILFSAVGT
FT                   AGQRCTTLRRLIVHRSIKDEVVARIKAAYGKVRIGDPRKDNLVGPLIDKLSFDAMQGAL
FT                   AKARDEGGQVFGGERQLADQFPNAYYVSPAIAEMPAQSDVVRHETFAPILYVLAYDDFE
FT                   EALRLNNEVPQGLSSCIFTTDIREAERFQSASGSDCGIANVNIGTSGAEIGGAFGGEKE
FT                   TGGGRESGSDAWKGYMRRQTNTVNYSRELPLAQGIVFD"
FT   gene            223233..224519
FT                   /locus_tag="PputW619_0214"
FT   CDS_pept        223233..224519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0214"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   pen:PSEEN5401 oxidoreductase, FAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70720"
FT                   /db_xref="GOA:B1J4Q7"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4Q7"
FT                   /protein_id="ACA70720.1"
FT                   /translation="MSELRQQCLWEHVSQPTVAAQALAGEHKADVCVIGGGITGLSAAI
FT                   HLLEQGKSVILLEAWKIGHGGSGRNVGLVNAGTWIRPDDVEATLGQKQGSRLNKVLGEA
FT                   PREVFAMIERLGIDCQAQHKGTLHMAHNATGIADLEARHEQWRRRGADVELLTGAQCQE
FT                   YCGTDKISAALLDRRAGTINPMGYTQGLAAAVARLGGKLFQQSAVEGLERDGDAWRVKT
FT                   ARGSVRADKVVISTGAYTEGDWSNLQKQFFRGYYYQVASKPLHGAAADKVLPHGQGSWD
FT                   TRTVLSSIRRDDQGRLLLGSLGRVDNKPAWFVRSWADRIQSHYYPELGKVEWEMHWTGC
FT                   IDFTPDHLMRLFEPAPGLVAVTGYNGRGNTTGTVIGRAFAEFLLKGEADSLPIPFSPMT
FT                   GVSAPSLRTAFYESGFSLYHAGQCLRVVL"
FT   gene            complement(224681..224923)
FT                   /locus_tag="PputW619_0215"
FT   CDS_pept        complement(224681..224923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0215"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pen:PSEEN5400 small-conductance
FT                   mechanosensitive channel"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70721"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4Q8"
FT                   /protein_id="ACA70721.1"
FT                   /translation="MKPPRWRRWNKKPAALSPTVVARPRCATGPGEVLGIEGIIGEVQT
FT                   ALTKLQRFRRQSRESLLLQKPTLIKKGGFLSWLHR"
FT   sig_peptide     complement(224840..224923)
FT                   /locus_tag="PputW619_0215"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.924) with cleavage site probability 0.890 at
FT                   residue 28"
FT   gene            complement(225019..225642)
FT                   /locus_tag="PputW619_0216"
FT   CDS_pept        complement(225019..225642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0216"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hch:HCH_04153 permease of the major
FT                   facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70722"
FT                   /db_xref="GOA:B1J4Q9"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4Q9"
FT                   /protein_id="ACA70722.1"
FT                   /translation="MNKPENPAHSPHASRRTESTQLNIMSISKLLIMGCLSLGFYFTYW
FT                   NYRHWLLIRGQHGFRLIPLLCTIFGGFTLYWLMKNIVARSREANVTVEGTALSITLMWW
FT                   LPSLAIMGWGLWISELYIGSLPLSVAYLTPIMLVFTNLLFSTIALIQIQQAANACGGEP
FT                   LGLQNSTITWANVLWVIISWVPIAAISGYVVAFDPLMYFMKYLS"
FT   gene            complement(226029..227426)
FT                   /locus_tag="PputW619_0217"
FT   CDS_pept        complement(226029..227426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0217"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pfo:Pfl_5213 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70723"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4R0"
FT                   /protein_id="ACA70723.1"
FT                   /translation="MSRIKMNGRGQALEGDRTTTGATCLASIGSFRVGGRRVLREGDVT
FT                   TPCPVCDKSGTIVEGMPGFVVAGRLAAMDGARVACDCPDGCRVIAPLGDSSPSKPTSVA
FT                   RSAEASPTPHEADSLPTRFRRNVASSPVDTLEPGFFIVPRCMTYQEVLVELGAPQANLP
FT                   RSLLERLNPTYQQGFKAGELFIIGDGLSRPVCTREELHAMSAAKQAREALASLTPEEAD
FT                   FMMKHQAEIAGLLSEVSLSVGVSEAMMAKTLDDIGLTLRKIEALHQQQFAKYGHLHSSE
FT                   FFAERMKLLKQLNTHLKATFLNKRLNLGNYERLRRDLGISSKSLTHHWSKAGAPGQIPG
FT                   YSTHLDKLASISKYLKAGGRVGIGIGGVGSVVKISDVCRAGDARACEKVKVTEAGNFSG
FT                   GLAGGWAGGKAAARVAATVCWMAGSPTRTLICGLAITGTGAYIGSTEGMRTGENMGDLI
FT                   FETFQDD"
FT   gene            227732..228361
FT                   /locus_tag="PputW619_0218"
FT   CDS_pept        227732..228361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0218"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG: pen:PSEEN5397
FT                   isochorismatase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70724"
FT                   /db_xref="GOA:B1J4R1"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4R1"
FT                   /protein_id="ACA70724.1"
FT                   /translation="MTNFKYNRLNKDDAAVLLVDHQAGLLSLVRDIEPDAFKNNVLALA
FT                   DLAKFFNLPTILTTSFEQGPNGPLVPELKALFPDAPYIARPGQINAWDNEDFVKAVKAT
FT                   GKKQLIIAGVVTEVCVAFPALSALEEEFEVFVVTDASGTFNAMTRDAAHDRMSQAGAQL
FT                   MTWFGVACELHRDWRNDVEGLAALCSNHIPDYRNLMTSYNAFNAGK"
FT   gene            228477..229043
FT                   /locus_tag="PputW619_0219"
FT   CDS_pept        228477..229043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0219"
FT                   /product="Antibiotic biosynthesis monooxygenase"
FT                   /note="PFAM: Antibiotic biosynthesis monooxygenase; KEGG:
FT                   pen:PSEEN5396 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70725"
FT                   /db_xref="GOA:B1J4R2"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR038762"
FT                   /db_xref="UniProtKB/TrEMBL:B1J4R2"
FT                   /protein_id="ACA70725.1"
FT                   /translation="MNTALQDNRNVVTLVIQHKVRAQALASYEAWLKRTVSTARRQPGH
FT                   LDVNVIRPDDGGLHFTTVVRFADASLLQAWVNSSERQTLVNEVLPLLEGGDHTQVHEDP
FT                   EFWFTPPSTTSAQPPRWKQALLTYLVICPMTMIIPQLLAPFFARFPQLGGVITGNLIVN
FT                   LFVILPVVFFIMPWVTRRCANWLRS"
FT   gene            229082..229900
FT                   /locus_tag="PputW619_0220"
FT   CDS_pept        229082..229900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0220"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: pen:PSEEN5395
FT                   hydrolase, alpha/beta fold family"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70726"
FT                   /db_xref="GOA:B1J1D3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B1J1D3"
FT                   /protein_id="ACA70726.1"
FT                   /translation="MTTLVTRDGTSIYYKDWGSGKPVLFSHGWPLDADMWDSQMEYLAS
FT                   RGYRAIAFDRRGFGRSSQPWNGYDYDTFADDIAQLIEHLDLRDVTLVGFSMGGGDVSRY
FT                   IARHGSERVAGLVLLGAVTPVFGKRDDNPDGVDTSVFDGIKAGLRADRAQFIADFATPF
FT                   YGLNHGQQVSQGVQTQTLNIALMASIKGTLDCVSAFSETDFRPDMAKIDVPTLVIHGDD
FT                   DQIVPFETTGKRAAELIRGAELKVYSGAPHGFAVTHAQQLNEDLLAFLSR"
FT   gene            230135..232117
FT                   /locus_tag="PputW619_0221"
FT   CDS_pept        230135..232117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0221"
FT                   /product="Amidohydrolase 3"
FT                   /note="PFAM: Amidohydrolase 3; KEGG: pen:PSEEN5394 puttaive
FT                   metal-dependent hydrolase; amidohydrolase family"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70727"
FT                   /db_xref="GOA:B1J1D4"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="InterPro:IPR033932"
FT                   /db_xref="UniProtKB/TrEMBL:B1J1D4"
FT                   /protein_id="ACA70727.1"
FT                   /translation="MSQDPNDKTRRQFLATSTVLGAAGALWSALPFTGAAGSAHASIQG
FT                   GSMTADLILFNGKLHTVDREKPTATAVAIKDGRFIAVGNDAEAMAHKGAATQIIDLKQR
FT                   TVIPGLNDSHLHLIRGGLNYNLELRWEGVPSVADALRMLKDQAARTPTPQWVRVVGGWN
FT                   EFQFAEKRMPTLEEINQAAPDTPVFLLHLYDRALLNRAALKAVGYSKDTPNPPGGEIQR
FT                   DKFGNPTGMLIARPNAMILYATLAKGPKLPLEYQVNSTRQFMRELNRLGLTSAIDAGGG
FT                   YQNFPDDYSVIQELADNNQLTVRIAYNLFTQKPKEELDDFRKWTSSVKLHSGTDFLRHN
FT                   GAGEMLVFSAADFEDFLEPRPDLPQTMEEELEPVVRHLVEQRWPFRLHATYNESITRML
FT                   DVFEKVNRDIPFNGLPWFFDHAETITPQNIERVRALGGGIAIQDRMAFQGEYFVDRYGA
FT                   KAAEQTPPIKRMLEMGVPVGAGTDATRVSSYNPWTSLYWLVSGKTVGGMELYPEGLSRD
FT                   TALQLFTQGSAWFSSEQGKKGQIKVGQLADLAALSLDFFSVDEEAIKGIESVLTIVDGK
FT                   VVYGAGEFDRLGPPQVPVLPEWSPVAKVPGHWRVGTPSLAAAVHQCSGPCGVHAHSHEK
FT                   ARHSSVPVNDFQGFWGALGCSCFAF"
FT   sig_peptide     230135..230260
FT                   /locus_tag="PputW619_0221"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 42"
FT   gene            complement(232277..232549)
FT                   /locus_tag="PputW619_0222"
FT   CDS_pept        complement(232277..232549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0222"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN5347 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70728"
FT                   /db_xref="InterPro:IPR021427"
FT                   /db_xref="UniProtKB/TrEMBL:B1J1D5"
FT                   /protein_id="ACA70728.1"
FT                   /translation="MADEPKVLTTVGVATFLDVGNPPVDLLRVQPGIPIDDAYEQVSVL
FT                   LSYIKHLVREGDMEDDHKLLSAADYLSLLAKALMDDIEIAKNRQR"
FT   gene            complement(232554..232823)
FT                   /locus_tag="PputW619_0223"
FT   CDS_pept        complement(232554..232823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0223"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN0406 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70729"
FT                   /db_xref="UniProtKB/TrEMBL:B1J1D6"
FT                   /protein_id="ACA70729.1"
FT                   /translation="MKKIVPDPPSRKPVTTPFFTVQSDMYPPDALAHASELLRGVIETI
FT                   DEHCRARAGEPGLNMLSNAMHASEIAHSLVEHVHARLFCQRTEE"
FT   gene            complement(233186..234448)
FT                   /locus_tag="PputW619_0224"
FT   CDS_pept        complement(233186..234448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0224"
FT                   /product="outer membrane porin"
FT                   /note="PFAM: outer membrane porin; KEGG: pfo:Pfl_2708 outer
FT                   membrane porin"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70730"
FT                   /db_xref="GOA:B1J1D7"
FT                   /db_xref="InterPro:IPR005318"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:B1J1D7"
FT                   /protein_id="ACA70730.1"
FT                   /translation="MIRATHGPGRALLATLALCPALSQAEDPGWSLLSRNYFLHSDFRS
FT                   PSGSGQNYRQEWAQGFIGEIRSGFTEGPVGVGIDAHGFLGLKLDGGRGHAGTGLLPRDS
FT                   DGRAASDYSSAGAALKFRLGNTQLRYGELMVETPVFDTGDKRLHPEYATGWLLENTDLP
FT                   DWHLQAGRFTAFNNQDNSSTHDDFSGYGATTQGRAISLAGATFAPDGPFGGALYAGQLQ
FT                   DTWRQAYLNLNLAEGNWRLDGNLYQTRDTGNASAGAIDTLAYSLSGKYRFGAQAVTLAY
FT                   QKIEGDTPFDFVGGDSIYLANSIKYADFNGPGERSWQLRYDLNFATLSVPGLSLMARYV
FT                   SGSAIDGTHAPAGGAYTGQQGQGGRHWERDIDLKYVVQSGAAKDLSLSFSHVSHRANEA
FT                   QAGDDIDRIYLIIEYPLKGSF"
FT   sig_peptide     complement(234371..234448)
FT                   /locus_tag="PputW619_0224"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 26"
FT   gene            complement(234567..235478)
FT                   /locus_tag="PputW619_0225"
FT   CDS_pept        complement(234567..235478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0225"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: pen:PSEEN5393 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70731"
FT                   /db_xref="GOA:B1J1E2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1J1E2"
FT                   /protein_id="ACA70731.1"
FT                   /translation="MEDLNSLYYFTQVVEHGGFAPAGRALDMPKSKLSRRIADLEDRLG
FT                   VRLLHRTSRHCSLTEIGQAYYNRCLAMRVEAEGAAEIIERNRSEPRGLVRISCPTTLLN
FT                   SWVGPMLTRYMLKYPQVELFIESTNRRVDLLHEGFDVALRVRFPPLENTDMVMKVLSNS
FT                   TQCLVGHPQYLEHLPKGFNPQLLGTLPSVHWGSAQREYQWELFQGEDMSRSIVIPHTPR
FT                   MVTDDLFALRHFVVAGVGIAHLPRVAVREDLAEGRLVELLPQWHPRCGIVHAIFPSRRG
FT                   LLPSVRSLIDHLAEEFAISDMA"
FT   gene            complement(235595..237382)
FT                   /locus_tag="PputW619_0226"
FT   CDS_pept        complement(235595..237382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0226"
FT                   /product="potassium efflux system protein"
FT                   /note="TIGRFAM: potassium efflux system protein; PFAM:
FT                   TrkA-N domain protein; sodium/hydrogen exchanger; KEGG:
FT                   pen:PSEEN5389 glutathione-regulated potassium-proton
FT                   antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70732"
FT                   /db_xref="GOA:B1J1E3"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B1J1E3"
FT                   /protein_id="ACA70732.1"
FT                   /translation="MPHEGSLLQTAVIFLLAAVLAVPLAKRLQLGAVIGYLLAGVAIGP
FT                   QALGLIRDTESVAHISELGVVLLLFIIGLELSPKRLWLMRKSVFGVGTAQVLLTGALIG
FT                   AIALFGFGQSLSAAIVVGLGLALSSTALGLQSLAENKQLNAPHGRLAFAILLFQDIAAI
FT                   PLIALVPLLAASGPETSHGDSLQHGLNVFASIAVVIVGGRYLLRPVFRIVARTGLPEVS
FT                   TATALLVVIGTAWLMEEAGISMALGAFLAGLLLADSEYRHELESQIEPFKGLLLGLFFM
FT                   SVGMGANLSLLLEMPLVLLGLTLLLVTVKLVLLIGVGRLAGGLNSASALRLGMVLAAGG
FT                   EFAFVVFKLGKDQGLFDTQTYDLLLMTITLSMAITPLLMLGCARALKHTQPAREVPEQY
FT                   KAIDAGTPRVVIVGMGRMGQIVSRILRAQKIPFVALETSVDAIEMTRMFEQAPVFYGDP
FT                   QRPEVLHAAKVGEAEYFVITTDDPEVTTRTAERVKRLYPHLKVLARARNRQHVHKLVDV
FT                   GAEPIRETFYSSLEMTRRALVGLGLSSEQAADRIDRFAQHDEEVLEAQGQVRDDRAKVM
FT                   QTAKEARVELERLFDSDAD"
FT   gene            complement(237545..238519)
FT                   /locus_tag="PputW619_0227"
FT   CDS_pept        complement(237545..238519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0227"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; ThiJ/PfpI domain protein; KEGG: pfo:Pfl_1956
FT                   transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70733"
FT                   /db_xref="GOA:B1J1E4"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B1J1E4"
FT                   /protein_id="ACA70733.1"
FT                   /translation="MQENPAHRTVVMVLFNDVLLLDVTGPMDAFAIANRFLPEDRRYRL
FT                   ITVAESQSAIRGSCGLKVMADLRLEDLPGNVDLLLVPGGPGAYDVALPRLERWLGHAVH
FT                   SAKRFGAICTGVFLLGRAGLLGGYRCTTHWNYVERLARAFPEAKVETEQIYVVDRGLIT
FT                   SGGITAGIDLALAVVAEDHGKALALEVAKVLLVARHRQGGQTPYSPLLAAVPRDGSVTA
FT                   RVQAYVVDHIDQAFTVQKMADLVAMSGRNFARTFQREVGITPLQYLQNARIDQARKLLE
FT                   GSDRPLKVVAAQCGFGSDRHMRKVFCERIGMTPAQYRAQFGGI"
FT   gene            238698..239069
FT                   /locus_tag="PputW619_0228"
FT   CDS_pept        238698..239069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0228"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: pfo:Pfl_1960 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70734"
FT                   /db_xref="GOA:B1J1E5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:B1J1E5"
FT                   /protein_id="ACA70734.1"
FT                   /translation="MNPGTPEDNPHSPGALTPARLRQAKELMLRSSLSIIEIAGVCNLT
FT                   RSHFSRAFKVNTGLSPQAWRLLARMEKAKRLLATEAPITHVSLECGFCDQAHFTRAFSR
FT                   LVGQPPKAWRQAARIDAHP"
FT   gene            239143..239769
FT                   /locus_tag="PputW619_0229"
FT   CDS_pept        239143..239769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0229"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG: pfo:Pfl_2298
FT                   isochorismatase hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70735"
FT                   /db_xref="GOA:B1J1E6"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:B1J1E6"
FT                   /protein_id="ACA70735.1"
FT                   /translation="MSQPDYKRLNKDDAVVLLVDHQTGLISLVQDFSPNEFKNNVLALG
FT                   DLAKFFGLPTILTTSFEQGPNGPLVPELKEMFPDAPYIARPGQINAWDNEDFVKAIKAT
FT                   GRKQLIIAGVVTDVCVAFPTLSALAEGFEVFVVTDASGTFNQTVQQAAWVRMTEAGAQM
FT                   MNWFSVACELHRDWRNDIEGLGNLLSQRIPNYRNLMNSYAALSAR"
FT   gene            complement(239829..244886)
FT                   /locus_tag="PputW619_0230"
FT   CDS_pept        complement(239829..244886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0230"
FT                   /product="ATP-binding region ATPase domain protein"
FT                   /note="PFAM: GAF domain protein; ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein; SMART:
FT                   serine/threonine protein kinase; KEGG: rme:Rmet_5309
FT                   ATP-binding region, ATPase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70736"
FT                   /db_xref="GOA:B1J1E7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:B1J1E7"
FT                   /protein_id="ACA70736.1"
FT                   /translation="MLDERLVQRPVDYAQSIDDGWLSRCDITQLDQEGDLTYFRLHDPV
FT                   TRLAWLAVRAPVEAPAACQRLERDYRLHLDPEWAVLPSAFLRSAEGPLLVYPAGRSIAD
FT                   LIAQGPAALAPFLRVAVNAARALAQAHEHNVLHGALQPEHICIGQALRVRLGCFRADTQ
FT                   VQGSPQQMAIGNWSYLAPEQLCAHGTSRDQRSDIYALGAILYQLLLGELPLSGRDTLHW
FT                   RQLHAGVQPRAANEVDARVPLALSDILAKALAKEPEARYQSARALAIDLDHCQRQWAAS
FT                   QAIEGFEPGSADGIAPSRERLYGRDAEQKVIALLMKALRRDSTPQALFVSGATGMGKSR
FT                   LVETALKAGADGYWAIGKCNSLEQAVPYAPWIEILQSLATQLLAKNSQDLETLRREILR
FT                   RLKGRGRLLGKLAPDLNLIIGPLPELPEKPTRSALQKELRAIVEFLHVFSRPGHPLALF
FT                   LDDMQWADDGTQHLLAELFAKPPGNLLLIFARRNDAHPSSNAFTPAAAVRSTTLNLRPL
FT                   TVSAVTELIGERYHVQPEAALEVAQLVHDKTAGNPFFINQILTAMVEDGLFTFDTQAMR
FT                   WSWSLDAVARHRYADNVADLMVQRMARLPAVQRDVLRIASAVGNRCDERLLERILALPA
FT                   GLPAESLKALTAAGFLLPGQRGLGFAHDRVQDAAYELTPMRERAQLHARIAQAMQLTWQ
FT                   DDLQDAVFDIANQLQRASPKAFETNDCEAFLPLLHEAALRARDSGAVDQAAAYLHTADH
FT                   VLRVSATPSAHAEHAFSIACMAAECDMQLSRMPQAEARLADCQNRARTALDQARVCRLQ
FT                   ARLHTLRCDYQAAISAAVYGLELLGITLDRGSNQAQVEASFAHVQALIERKGRHCLESL
FT                   PRCNAQEVTVAVGLLATLSSSFFVQDDICFLHLAKLMELSLSQGVAPGSTYGLAWYGVM
FT                   IAERFGAYHDGHACCLAALKLIERHGFEADLTSALLALDQVSAWTAPMEFARRTALEAI
FT                   DSGRLSGDLAMSCYASNHLVSDSLFMGRYLPEVADEVAQGLATVRRYSYSDIEHILLAQ
FT                   QAFVADLCGNAFSGSTAGVKSRTTLFFKHLFSGMSAFYLGNIKQAIHSLACAGEHAWAA
FT                   PAHINLADYHLFHGLALGSPEAPGSLASKLAALQAVRVRFASWANFNPVTFRNKLLLIE
FT                   GVIAKLNGDGMAAIRCFDQAQIAATAAGFIHEQALAHEQLAEVCIPNGLISGANLHLRI
FT                   ARDCFHIWGATGKVRQLETLHPFLRTQPVQETHRSSSQARLDLEAGIEAARALSEEVLL
FT                   EGLIETLMGHLTQHSGADHGALLIVSGAEFQMAALAYIDDVGLHVRMDNCQKFLTQAPL
FT                   SIINATMRTKKPLVLNDALSECPEAFRQELQARNARSVLCLPLVIQGVLIGLVYLENRL
FT                   VPNLFGGQRLAMLEILASQAAVSLQTAKFYTRLAEDNQTRAQMEAELRRSRAQLASSAH
FT                   QQVMNELSASIAHEISQPLLGIASNAAASLRWLKRETPDLKEAIAGLEDIRNDSERAAN
FT                   IVRALRSLAKQTPMQLKTVKLDELILEVVRLTSGDAGKCKVDVQTRLHAAVSVMADPVQ
FT                   LQQLVFNLITNALEALAGYRSDGRLQISSEVLADKVEICVDDNGPGIAPEERDQVFGAF
FT                   YTTKSGGLGMGLAICNSVVQAHGGQLQAQVSALGGCRIRLTIPVQQV"
FT   gene            245128..246120
FT                   /locus_tag="PputW619_0231"
FT   CDS_pept        245128..246120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0231"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; response regulator
FT                   receiver; transcriptional regulator domain protein;
FT                   sigma-70 region 4 domain protein; Sigma-70 region 4 type 2;
FT                   KEGG: rpa:RPA2109 two-component transcriptional regulator,
FT                   LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70737"
FT                   /db_xref="GOA:B1J1E8"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B1J1E8"
FT                   /protein_id="ACA70737.1"
FT                   /translation="MIRLGNAQVSLERREAFVDGKPVPLGGRAFEVLATLIKAKGRVVG
FT                   KDELFSEVWAGTVVEDNNLQVQISLLRKAFGAPGLIQTVPRRGYRLAVDVVLDLPCTAL
FT                   GRSPLKDAAEALVPLGDSASVPVLVVDDDPSVRKALARLFRSQDIAHRLYASAEELFEG
FT                   QVETPYACLLLDMNLPEASGLEVQDVLRRLDLPWPIIFMTGYGTIPLTVQAMRAGAVEF
FT                   LTKPFDEDQLLAVLDAARARALVQGRKWHQARQVKQKYQRLTQRERQVFSLVVDGLSHK
FT                   QIAKQIGTSEVTTKVHKKNIMNKMQSRSLVELVAMHHVIESRVEGQGPA"
FT   gene            246117..246491
FT                   /locus_tag="PputW619_0232"
FT   CDS_pept        246117..246491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0232"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   pfo:Pfl_2250 response regulator receiver domain protein
FT                   (CheY)"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70738"
FT                   /db_xref="GOA:B1J1E9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B1J1E9"
FT                   /protein_id="ACA70738.1"
FT                   /translation="MNSAVCIVDDDASVRKSLANLLRSAGVATLLFASGEELLASDLAP
FT                   MAGCVLLDLKMPVLSGLEVQREMARLGWRLPVICMSAHWDDLAVEASMRNGALACLGKP
FT                   FSEEVLLRVVEEALAALRHF"
FT   gene            complement(246695..248002)
FT                   /locus_tag="PputW619_0233"
FT   CDS_pept        complement(246695..248002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0233"
FT                   /product="Mn2+/Fe2+ transporter, NRAMP family"
FT                   /note="KEGG: psb:Psyr_2230 Mn2+/Fe2+ transporter, NRAMP
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70739"
FT                   /db_xref="GOA:B1J1F0"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:B1J1F0"
FT                   /protein_id="ACA70739.1"
FT                   /translation="MSSIHSAEGSAATPSQGRVTRLIKLLGPGIIAVLSWLGAGDLITS
FT                   SVAGANYGYAMMWVLAVSLLLRYLIVNIIARFQLCNNQGMTILQGYAQLHPVFAWFMLA
FT                   YALLMGHLMNAYMIKGAGEALAMLLRIDYPLLCSMAVVLAVWMLVGRNIYAMIEGVMKV
FT                   LLAVMTLAFLALAVMSGPDVAGIVKGTIGFSIPADEGVHGALLVAVSVIGAVAGSVANF
FT                   VHPYVMRQKGWVGPQHKRIQRNDLLFAVFVGIVINLAIWIVGAEILRPNGIEVKTLGDL
FT                   GKALEIFFGPIGWYIFFIGVFATLFASISGKTTAFPMLITDAFQHVQPQRRERYGKEFH
FT                   KDPMHKWFMLFILVTPLIWSIPGMPDFVTLTIGVSALNIIGLPVISLGLLIMSNQKSLL
FT                   SKEYRNNLFENIALAFATGLALWVAFQLGVDLLGLG"
FT   gene            complement(248222..248482)
FT                   /locus_tag="PputW619_0234"
FT   CDS_pept        complement(248222..248482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0234"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN5386 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70740"
FT                   /db_xref="InterPro:IPR021245"
FT                   /db_xref="UniProtKB/TrEMBL:B1J1F1"
FT                   /protein_id="ACA70740.1"
FT                   /translation="MTLRTVFALTLATLALGTSAGAFAQSTEATPYHYGMNLDIAEVIS
FT                   LAPSATSQGQASTATMTYRDSTGQVRSIRYYQPDDAQGNQN"
FT   sig_peptide     complement(248408..248482)
FT                   /locus_tag="PputW619_0234"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 25"
FT   gene            complement(248622..250112)
FT                   /locus_tag="PputW619_0235"
FT   CDS_pept        complement(248622..250112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0235"
FT                   /product="Mg chelatase, subunit ChlI"
FT                   /note="KEGG: pen:PSEEN5385 magnesium chelatase subunit D;
FT                   TIGRFAM: Mg chelatase, subunit ChlI; PFAM: magnesium
FT                   chelatase ChlI subunit; ATPase associated with various
FT                   cellular activities AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70741"
FT                   /db_xref="GOA:B1J1D2"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1J1D2"
FT                   /protein_id="ACA70741.1"
FT                   /translation="MSLALVHSRAQVGVQAPAVSVETHLANGLPHLTLVGLPETTVKES
FT                   KDRVRSAIVNSGLNYPQRRITQNLAPADLPKDGGRYDLAIALGILAADGQVPVATLTDI
FT                   ECLGELALSGKLRPVQGVLPAALAAREAGRALVVPRENAEEASLAGGLVVYAVGHLLEL
FT                   VAHLNGQVPLPPFAANGLLLHSRPYPDLSEVQGQVAAKRALLLAASGAHNLLFTGPPGT
FT                   GKTLLASRLPGLLPPLDEHEALEVAAIQSVSGHKPLDSWPQRPFRHPHHSASGPALVGG
FT                   SSRPQPGEITLAHHGVLFLDELPEFERRVLEVLREPLESGEIVIARARDKVRFPARFQL
FT                   VAAMNPCPCGYLGDPTGRCRCSTEQIQRYRNKLSGPLLDRIDLHLTVARETTTLNNQPC
FT                   GETSADVAARVAEAREVQHRRQGCANAFLDLEGLRRHCELCAADQAWLESACERLTLSL
FT                   RAAHRLLKVARTLADLEGASTIARAHLAEALQYRPGSH"
FT   gene            250367..252394
FT                   /locus_tag="PputW619_0236"
FT   CDS_pept        250367..252394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0236"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN5383 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70742"
FT                   /db_xref="InterPro:IPR025115"
FT                   /db_xref="UniProtKB/TrEMBL:B1J1D8"
FT                   /protein_id="ACA70742.1"
FT                   /translation="MQTLTRIRQQIHEQVKAKEFAELNHFFDTLQAQWRQARPGECPAY
FT                   LEAVQGHMLVDWDVEGSKALTQRLKAWIDACPKAYHPQVAMGFHCFNRACRIRGTAAAN
FT                   EVSAARWLAAEQACEMAAAHFLRAIERCAQPVAAAIGMLQISAHFREPGWLVELFQGRT
FT                   ACFRPSAHADVEVQEAAAPLLVKYGLAPLVELPQVLPSCLTHRLLAEQEPARDYWLRHA
FT                   LNWFPGCFEVVEAYASYLTPRWGGSYEAIDAVASGPLCRGWPETLRNAIRWLALEDQFR
FT                   LPSADQVQQVAAWQRLFEPWMQRELRPKERATLMARRGAFRRFSLKDYPGAMHDFVASV
FT                   ALYPDQGFVPAIGEPFYSFVCLVVTHGVQDDAQSLRIAIERLSENRRQAAACALRSVGH
FT                   QFGLWGFRQCAEQARTWLNAAVKRQCGREGLGFDVLEVARLLWAAKYYEAAYFLYRQCA
FT                   ECKLPDAAAALYALHCGRLEGTPEHYIDSGAAAHWLLCAAQAGSQMAKYDLACQRMRND
FT                   QNLSERSAMLAVRRLLLDCLGNEALDAQARLQLAILQRQFGDPRERAEAVAYLLDLVHY
FT                   VDCAIAGRASAELGLAWMHGHGTRKPSRFAAIEWANRAVALQPGDSVIEGIQARIRNSH
FT                   NLFRTLFTVCGATLFRGDLHASELPPKPSSQAPGRLRAPA"
FT   gene            complement(252411..252674)
FT                   /locus_tag="PputW619_0237"
FT   CDS_pept        complement(252411..252674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0237"
FT                   /product="protein of unknown function DUF526"
FT                   /note="PFAM: protein of unknown function DUF526; KEGG:
FT                   pen:PSEEN5377 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70743"
FT                   /db_xref="InterPro:IPR007475"
FT                   /db_xref="UniProtKB/TrEMBL:B1J1D9"
FT                   /protein_id="ACA70743.1"
FT                   /translation="MLAPKALLDALSDQASRLFSGDTAQPRAELESQFKVLMQGAFSKL
FT                   DLVSREEFDSQMVVLARTRARLEALEKQVAELEARMAPAAQD"
FT   gene            253038..253376
FT                   /locus_tag="PputW619_0238"
FT   CDS_pept        253038..253376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0238"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   pen:PSEEN5376 nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70744"
FT                   /db_xref="GOA:B1J1E0"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:B1J1E0"
FT                   /protein_id="ACA70744.1"
FT                   /translation="MKLVTAIIKPFKLDDVRESLSEIGVQGITVTEVKGFGRQKGHTEL
FT                   YRGAEYVVDFLPKVKIDVAIDDKDLDRVIEAITKAANTGKIGDGKIFVVNLEQAIRIRT
FT                   GETDTDAI"
FT   gene            253424..254758
FT                   /locus_tag="PputW619_0239"
FT   CDS_pept        253424..254758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0239"
FT                   /product="ammonium transporter"
FT                   /note="TIGRFAM: ammonium transporter; PFAM: Rh family
FT                   protein/ammonium transporter; KEGG: pen:PSEEN5375 ammonium
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70745"
FT                   /db_xref="GOA:B1J1E1"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:B1J1E1"
FT                   /protein_id="ACA70745.1"
FT                   /translation="MTLRKIAGLGALLSLVMPGIALAEEAAAPVLNSGDTAWMLTATAL
FT                   VLFMTIPGLALFYGGMVRSKNVLSVMMQCFAITGLMSILWVVYGYSMAFDTTGMEKGVL
FT                   NFNSFVGGFSKAFLSGVTPDGLTSAAALFPEAVFITFQMTFAIITPALIVGAFAERMKF
FT                   SAMLVFMGIWFTLVYAPIAHMVWSGDGALMWDWGVLDFAGGTVVHINAGIAGLVCCLVL
FT                   GKRKGYPTTPMAPHNLGYTLMGAAMLWIGWFGFNAGSAAAANGTAGMAMLVTQIATAAA
FT                   ALGWMFAEWIGHGKPSALGIASGVVAGLVAITPAAGTVGPMGALVIGLVSGVLCYFCAT
FT                   TLKRKLGYDDSLDAFGVHGIGGIIGAILTGVFAAPALGGFGAVTDIGAQVWIQAKGVIF
FT                   TVVYTAIVTYVILKVLDVVMGLRVNEEEESVGLDLAQHNERGYNL"
FT   sig_peptide     253424..253495
FT                   /locus_tag="PputW619_0239"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            255188..255517
FT                   /locus_tag="PputW619_0240"
FT   CDS_pept        255188..255517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0240"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN5374 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70746"
FT                   /db_xref="UniProtKB/TrEMBL:B1J1U2"
FT                   /protein_id="ACA70746.1"
FT                   /translation="MSDDDLENDDLEVGDEDEADDGLEAAADDGAEDAGDDDSSPAPVA
FT                   KGKSKAAVSVDEMPSMEAKQKERDALAKAMEEFLSRGGKVQEVEANVVADPPKKPDNKY
FT                   GSRPI"
FT   gene            complement(255598..256293)
FT                   /locus_tag="PputW619_0241"
FT   CDS_pept        complement(255598..256293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0241"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; HAD-superfamily hydrolase, subfamily IA, variant
FT                   1; PFAM: Haloacid dehalogenase domain protein hydrolase;
FT                   KEGG: pen:PSEEN5369 haloacid dehalogenase-like hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70747"
FT                   /db_xref="GOA:B1J1V7"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B1J1V7"
FT                   /protein_id="ACA70747.1"
FT                   /translation="MSIKLITFDLDDTLWDTAPVIASAEVVLRDWLQANAPILGGVPVE
FT                   HLFAIRERLVQAEPGLKHRISALRRRVLFHALEEVGYSEKHAQELANEGFEVFLHARHQ
FT                   VEVFPEVQPVLEILRHHYTLGVVTNGNADVRRLGLADYFRFALCAEDLGIGKPDPAPFI
FT                   EALKRGEVEASAAVHVGDHPGDDIGGAQRAGLRAVWFNPQGKAWLGEAAPDAEIQRLSQ
FT                   LPDILARWR"
FT   gene            complement(256290..257189)
FT                   /locus_tag="PputW619_0242"
FT   CDS_pept        complement(256290..257189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0242"
FT                   /product="tyrosine recombinase XerC"
FT                   /note="TIGRFAM: tyrosine recombinase XerC; PFAM: integrase
FT                   family protein; integrase domain protein SAM domain
FT                   protein; KEGG: pen:PSEEN5368 site-specific tyrosine
FT                   recombinase, integrase family"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70748"
FT                   /db_xref="GOA:B1J1V8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011931"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1J1V8"
FT                   /protein_id="ACA70748.1"
FT                   /translation="MERQLEAYCAHLRNERQVSEHTLLAYRRDLEKVIEYCNTQGIAGW
FT                   GALQIQQLRQLIARQHHQGQSSRSLARLLSAVRGLYRYLNREGLCQHDPASGLSAPKGE
FT                   RRLPKVLDTDRALQLLDGGVDDDFIARRDQAILELFYSSGLRLSELTNLDLEHLDLAAG
FT                   LVQVLGKGGKARVLPVGRKAREAMQQWLRLRGIGGPRDGAVFISRQGNRLGPRAIQMRV
FT                   KAAGERELGQHLHPHMLRHSFASHVLESSQDLRAVQEMLGHADISTTQIYTHLDFQHLA
FT                   AVYDSAHPRAKRSKGTDS"
FT   gene            complement(257189..257899)
FT                   /locus_tag="PputW619_0243"
FT   CDS_pept        complement(257189..257899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0243"
FT                   /product="protein of unknown function DUF484"
FT                   /note="PFAM: protein of unknown function DUF484; KEGG:
FT                   pen:PSEEN5367 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70749"
FT                   /db_xref="InterPro:IPR007435"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:B1J1V9"
FT                   /protein_id="ACA70749.1"
FT                   /translation="MTDQPKVVPQQSSELDAEAVVAYLRAHPTFFAEHDELLVEQRIPH
FT                   QRGDSVSLVERQLKLLRDRNIEMRHRLSQLMDVARDNDRLFEKTRRLILDLLDAGSLEE
FT                   VVMAVEDSLRQEFQVPFVSLILFGDHAAPVGRWVSNAEAQQAIGGLLGGGKTVSGNLRE
FT                   HELAFLFGEEQHHEVGSSAVAALEYQGLHGVLAIGSRDPQHYKSSVGTLFLGYIAEVLG
FT                   RVVPRVTQPLRPVR"
FT   gene            complement(257913..258743)
FT                   /locus_tag="PputW619_0244"
FT   CDS_pept        complement(257913..258743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0244"
FT                   /product="Diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /note="PFAM: diaminopimelate epimerase; KEGG: pen:PSEEN5366
FT                   diaminopimelate epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70750"
FT                   /db_xref="GOA:B1J1W0"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1J1W0"
FT                   /protein_id="ACA70750.1"
FT                   /translation="MLLRFTKMHGLGNDFMVLDLVSQHAHIQPKHAKQWGDRHTGIGFD
FT                   QLLIVEAPNNPEVDFRYRIFNADGSEVEQCGNGARCFARFVLDKRLTAKKRIRVETKGG
FT                   IIELDVQNDGQVCVDMGPPRFIPAEIPFVADEQALNYPLEVDGELHSIAAVSMGNPHAV
FT                   LRVDDIRTAPVHGLGPKIENHPRFPQRVNAGFLQVIDRHRANLRVWERGAGETQACGTG
FT                   ACAAAVAAISQGWMDSPVSLDLPGGRLNIEWAGPGTSVLMTGPAVRVYEGQVRL"
FT   gene            complement(258748..259995)
FT                   /locus_tag="PputW619_0245"
FT   CDS_pept        complement(258748..259995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0245"
FT                   /product="diaminopimelate decarboxylase"
FT                   /note="TIGRFAM: diaminopimelate decarboxylase; PFAM:
FT                   Orn/DAP/Arg decarboxylase 2; KEGG: pen:PSEEN5365
FT                   diaminopimelate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70751"
FT                   /db_xref="GOA:B1J1W1"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:B1J1W1"
FT                   /protein_id="ACA70751.1"
FT                   /translation="MNAFNYRDGGLFAEGVALSAIAERFGTPTYVYSRAHIEAQYRSYT
FT                   DALQGVEHLVCFAVKANSNLGVLNVLARMGAGFDIVSGGELERVLAAGGRADRVVFSGV
FT                   GKTREDMRRALEVGVHCFNVESTDELERLQVVAAEMGKVAPVSLRVNPDVDAGTHPYIS
FT                   TGLKENKFGIAIADAEAIYVRAAQLPNLEVVGVDCHIGSQLTTVEPFLDALDRLLDLVD
FT                   RLADCGIHLRHLDLGGGVGVRYRDEEPPLVADYIKAIRERVGDRDLALVFEPGRYIVAN
FT                   AGALLTRVEYLKHTEHKDFAIIDAAMNDLIRPALYQAWMGVSAVTPREGEGRAYDLVGP
FT                   ICETGDFLAKDRQLNLAEGDLLAVQSAGAYGFVMSSNYNTRGRCAEILVDGDQAFEVRR
FT                   RETIAELYAGESLLPE"
FT   gene            complement(260005..260208)
FT                   /locus_tag="PputW619_0246"
FT   CDS_pept        complement(260005..260208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0246"
FT                   /product="lipoprotein Lppl"
FT                   /note="KEGG: pen:PSEEN5364 lipoprotein Lppl"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70752"
FT                   /db_xref="InterPro:IPR032831"
FT                   /db_xref="UniProtKB/TrEMBL:B1J1W2"
FT                   /protein_id="ACA70752.1"
FT                   /translation="MKRLISSLAALVAVACLVSACGQKGPLYLPEDGKDGKGSQKSHQH
FT                   QHAQPVQPQDEQPIEPEQTPEQ"
FT   sig_peptide     complement(260146..260208)
FT                   /locus_tag="PputW619_0246"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.698 at
FT                   residue 21"
FT   gene            260461..260793
FT                   /locus_tag="PputW619_0247"
FT   CDS_pept        260461..260793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0247"
FT                   /product="iron donor protein CyaY"
FT                   /note="TIGRFAM: iron donor protein CyaY; PFAM: Frataxin
FT                   family protein; KEGG: pen:PSEEN5363 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70753"
FT                   /db_xref="GOA:B1J1U3"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR020895"
FT                   /db_xref="InterPro:IPR036524"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1J1U3"
FT                   /protein_id="ACA70753.1"
FT                   /translation="MSLSEARFHDLVDATQQALEDLFDESGLDLDMENSAGVLTIKFDN
FT                   GSQLIFSRQEPLRQLWLADRSGGFHFDYDEESGKWVCEKSEELLGEMLERIVWERAGEK
FT                   LDFDEI"
FT   gene            260795..261007
FT                   /locus_tag="PputW619_0248"
FT   CDS_pept        260795..261007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0248"
FT                   /product="protein of unknown function DUF1289"
FT                   /note="PFAM: protein of unknown function DUF1289; KEGG:
FT                   pen:PSEEN5362 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70754"
FT                   /db_xref="InterPro:IPR010710"
FT                   /db_xref="UniProtKB/TrEMBL:B1J1U4"
FT                   /protein_id="ACA70754.1"
FT                   /translation="MSAQARPAKPLYSNVSPAVPSPCISVCRLDEQRVCTGCHRHVEHI
FT                   REWRSADDERRRQICREADALRAQA"
FT   gene            261142..261552
FT                   /locus_tag="PputW619_0249"
FT   CDS_pept        261142..261552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0249"
FT                   /product="GreA/GreB family elongation factor"
FT                   /note="KEGG: pen:PSEEN5361 regulator of nucleoside
FT                   diphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70755"
FT                   /db_xref="GOA:B1J1U5"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR029462"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:B1J1U5"
FT                   /protein_id="ACA70755.1"
FT                   /translation="MSTKPSLILTRLDVQRLERLIDSLDESTPGVLALQDELDRAEQVV
FT                   GHEEVPAGVVTMNSRVHCREEASGKDYHLTLVYPKDAGGEGKVSILAPIGCALLGLSVG
FT                   EQIDWPAPGGKTLKLKLLAVEYQPEAAGDFDL"
FT   gene            complement(261557..264421)
FT                   /locus_tag="PputW619_0250"
FT   CDS_pept        complement(261557..264421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0250"
FT                   /product="putative adenylate cyclase"
FT                   /EC_number="4.6.1.1"
FT                   /note="PFAM: adenylate cyclase class-I; KEGG: pen:PSEEN5359
FT                   adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70756"
FT                   /db_xref="GOA:B1J1U6"
FT                   /db_xref="InterPro:IPR000274"
FT                   /db_xref="InterPro:IPR024685"
FT                   /db_xref="UniProtKB/TrEMBL:B1J1U6"
FT                   /protein_id="ACA70756.1"
FT                   /translation="MTHPHEIRPDIDEGIDRKVLAKLRARFLQLNTGRLQRAMDGLSTR
FT                   QQQVLTLLPLLFHVNHPLLPGYVSGSTPAGVSGFEPDANLVAEGQRLARSFTYKTRLGN
FT                   PNRPIHGLFLMGSLGTLAQAEQSDIDLWVCHAPGLGDSQLDELRRKCQLLETWAASLGA
FT                   EAHCFLIDPQSFAQGQRDSQLSSDDCGTTQHYLLLDEFYRTAIWLAGRTPLWWLVPVYE
FT                   ERNYSSYTETLLSKRFIRSTDALDLGNLAHIPAGEYVGAGLWQLFKGIDSPYKSLLKLL
FT                   LTEVYASEHPAVRCLSLDYKQAVFANHLDLDALDPYVMVYRRIERYLQARGETRRLELA
FT                   RRSLYLKVNKKLSGLDRARSNGWQRRLLKRLADEWGWDERQLALLDSRSQWKVRQVAVE
FT                   RSELVAELNHSYRFLSQFAQNNNASSRADQRDLNVLGRRLYAAFERRAGKIEVINPGIA
FT                   PDLAEDTLTLVQSPNRKEPGSHHWGLYNGSLSVHEWEHFSPIKRCRELIELLTWAHRNG
FT                   VIDNTTRLALHPGVSDLNEFELFNLLGSLQQSIPLPLETVSEVRLLQPSVANEILLLVN
FT                   VGVDPLQHHRDLNILMTTERTDSLSYAGVRENLVLTLDQITLNSWNEVLVQRYDGEHAL
FT                   MRCLRDFLNSLGQRSHRPSVRVRCFCHNRAQAISQRVEEIFDTVQLLLDQGRNHRYLLQ
FT                   VAQHTHVLELLPGQVSLTTLAEHEAVLDCLGEERSTYSPLYLDANALQDHDLPLVLEHG
FT                   RPGCIQVFYRLLEGWADLYVLDEYNALWQQRLPLHDENHLLLPLQRFLRSMVMRHDARV
FT                   PLDNLQQAPLQTHYAQLLPSGPGKARSIEPRSTPNDLNDQPYYEVQAILQAGTGDDMHV
FT                   TLYCNQQEFSELDHGDELYTVVARQILSQRRSAGHYRCYITDLDLSELLDDERGSTVLY
FT                   LRYKRELEQALNDGLAQLQATLEP"
FT   gene            complement(264568..264813)
FT                   /locus_tag="PputW619_0251"
FT   CDS_pept        complement(264568..264813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0251"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   pen:PSEEN5358 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70757"
FT                   /db_xref="InterPro:IPR013468"
FT                   /db_xref="InterPro:IPR020948"
FT                   /db_xref="UniProtKB/TrEMBL:B1J1U7"
FT                   /protein_id="ACA70757.1"
FT                   /translation="MSFTPELIAELEVLALFNLDSSQEGIKIHANASPALVAAARRLHE
FT                   KQLTDQPDGGYLTSLGHDAVESVQLLLNILKSPQPA"
FT   gene            complement(264883..265182)
FT                   /locus_tag="PputW619_0252"
FT   CDS_pept        complement(264883..265182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0252"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN5357 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70758"
FT                   /db_xref="UniProtKB/TrEMBL:B1J1U8"
FT                   /protein_id="ACA70758.1"
FT                   /translation="MSEPTDIDNDDEAFAEATLTQAIENQIESGEPPAAKATFNKLSLV
FT                   GYEREDILNLMAHVLAIEIDNMLDEDRPFNTEWYETALRALPELPPEADQGEAE"
FT   gene            265330..265992
FT                   /locus_tag="PputW619_0253"
FT   CDS_pept        265330..265992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0253"
FT                   /product="Glutathione S-transferase domain"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   pen:PSEEN5356 glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70759"
FT                   /db_xref="GOA:B1J1U9"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:B1J1U9"
FT                   /protein_id="ACA70759.1"
FT                   /translation="MLKLHGFSVSNYYNMVKLALLEKGLPFEEVTFYGGQTAQALEISP
FT                   RGKVPVLQTEHGSLSETGVILDYIEQTQPGKALLPADPFEQAKVRELLKEIELYIELPA
FT                   RTCYAESFFGAAVEPLIKERARADLLAGFATLKRNGRFAPYVAGEQLTIADLMFCFSVD
FT                   LACAVGKKVLNVDFLADFPEARALLQKMHENPHMARIVADKEAAMPAFMEMIRSGKR"
FT   gene            complement(266124..267518)
FT                   /locus_tag="PputW619_0254"
FT   CDS_pept        complement(266124..267518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0254"
FT                   /product="argininosuccinate lyase"
FT                   /note="TIGRFAM: argininosuccinate lyase; PFAM: fumarate
FT                   lyase; KEGG: pen:PSEEN5355 argininosuccinate lyase
FT                   (arginosuccinase) (ASAL)"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70760"
FT                   /db_xref="GOA:B1J1V0"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1J1V0"
FT                   /protein_id="ACA70760.1"
FT                   /translation="MSTDKTNQSWGGRFSEPVDAFVARFTASVDFDKRLYRHDIMGSIA
FT                   HATMLAQVGVLSDAERDTIIDGLNTIQGEIEAGNFDWRVDLEDVHMNIEARLTDRIGIT
FT                   GKKLHTGRSRNDQVATDIRLWLRDEIDLILAEITRLQQGLLEQAEREAQTIMPGFTHLQ
FT                   TAQPVTFGHHLLAWFEMLSRDYERLVDCRKRTNRMPLGSAALAGTTYPIDRELTCKLLG
FT                   FEAVAGNSLDGVSDRDFAIEFCAAASVAMMHLSRFSEELVLWTSAQFQFVDLPDRFCTG
FT                   SSIMPQKKNPDVPELVRGKSGRVFGALTGLLTLMKGQPLAYNKDNQEDKEPLFDAADTL
FT                   RDSLRAFADMIPAIKPRHAIMREAALRGFSTATDLADYLVRRGLPFRDCHEIVGHAVKY
FT                   GVDTGKDLAEMSLDELRQFSDQIEQDVFAVLTLEGSVNARDHIGGTAPAQVLAAVVRGK
FT                   ALLASR"
FT   gene            267828..268571
FT                   /locus_tag="PputW619_0255"
FT   CDS_pept        267828..268571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0255"
FT                   /product="two component transcriptional regulator, LytTR
FT                   family"
FT                   /note="PFAM: response regulator receiver; LytTr DNA-binding
FT                   region; KEGG: pen:PSEEN5354 alginate biosynthesis
FT                   regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70761"
FT                   /db_xref="GOA:B1J1V1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B1J1V1"
FT                   /protein_id="ACA70761.1"
FT                   /translation="MNVLIVDDEPQARERLTRLFAELEGYTVLEPSATNGEEALALIES
FT                   LKPDVVLLDIGMPGLDGLQVAARLCEREAPPSVVFCTGDDEYGAEAFTDSTLSHVTKPI
FT                   HPHALRDALRKAEKPSRTQLAALTRPGSEGGGPRSHISARTRKGIELIPLPQVIYFIAD
FT                   HKYVTLRHEAGEVLLDEPLKALEDEFGERFVRIHRNALVARERIERLQRTPLGHFQLFL
FT                   KGLDGDALTVSRRHVAGVRKMMQTL"
FT   gene            268706..269647
FT                   /locus_tag="PputW619_0256"
FT   CDS_pept        268706..269647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0256"
FT                   /product="porphobilinogen deaminase"
FT                   /EC_number="2.5.1.61"
FT                   /note="KEGG: pen:PSEEN5353 porphobilinogen deaminase;
FT                   TIGRFAM: porphobilinogen deaminase; PFAM: Porphobilinogen
FT                   deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70762"
FT                   /db_xref="GOA:B1J1V2"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1J1V2"
FT                   /protein_id="ACA70762.1"
FT                   /translation="MSTREIRIATRKSALALWQAEYVKARLEQAHPGLLVTLVPMVSRG
FT                   DKLLDAPLAKIGGKGLFVKELETALLDNEADIAVHSMKDVPMDFPEGLGLYCICEREDP
FT                   RDAFVSNRFSSLDALPAGSIVGTSSLRRQAQLLARRPDLQIRFLRGNVNTRLAKLDAGE
FT                   YDAIILAAAGLIRLGFEERITASISVDDSLPAGGQGAVGIECRSADSEIHALLAPLHHT
FT                   DTADRVVAERALNKHLNGGCQVPIACYAVLEGEQLWLRGLVGQPSGGTLLMADARAPRA
FT                   SAETLGVQVAEDLLGQGAAAILKEVYGEAGHP"
FT   gene            269644..270411
FT                   /locus_tag="PputW619_0257"
FT   CDS_pept        269644..270411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0257"
FT                   /product="Uroporphyrinogen-III synthase"
FT                   /EC_number="4.2.1.75"
FT                   /note="PFAM: Uroporphyrinogen III synthase HEM4; KEGG:
FT                   pen:PSEEN5352 uroporphyrinogen III synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70763"
FT                   /db_xref="GOA:B1J1V3"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:B1J1V3"
FT                   /protein_id="ACA70763.1"
FT                   /translation="MSSWRLLLTRPEEDCAALAQTLATAGICSECLPLLAIEPVQLGAR
FT                   QRQQLAGLGQCQAMIVVSKPAARLLLAQLAHEGLQPPLAGWFTVGEATAAVLQSAGLTV
FT                   TYPAQGDDSEALLTLPALRGAMAGPAPRVLIVRGVGGRELLAERLAEQGASVDYLELYR
FT                   RCLPVYPAGTLVRRIEAERLNGVVVSSGQGLEHLQQLAAADWPRVARLPLFVPSPRVAE
FT                   QARAAGAQQIVDCRGASATALLAAVQRSAAPAS"
FT   gene            270457..271557
FT                   /locus_tag="PputW619_0258"
FT   CDS_pept        270457..271557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0258"
FT                   /product="protein of unknown function DUF513 hemX"
FT                   /note="PFAM: protein of unknown function DUF513 hemX; KEGG:
FT                   pen:PSEEN5351 uroporphyrin-III C-methyltransferase HemX"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70764"
FT                   /db_xref="GOA:B1J1V4"
FT                   /db_xref="InterPro:IPR007470"
FT                   /db_xref="UniProtKB/TrEMBL:B1J1V4"
FT                   /protein_id="ACA70764.1"
FT                   /translation="MSETVLSHNDQPSAQEPTQPVTPPPAKRSGTGLALLALLVGAAGV
FT                   AVGGWGVWQVRHLQGSELSQGQHLEALSQRAAALQQREQQISAQLASLPAASELEDRRR
FT                   LVAQLQGDQQRLSQRLETVLGESRKEWRLAEAEHLLRLATLRLSALQDITSAKALVEGA
FT                   DEILREQSDPGSFAAREQLARSLAMLNSTQQPDRSGLYLKLAAQRELVQQLNAQSPEFD
FT                   SDADALGALTADGDGTSRLAQWWAEISKYFQIDFNADDNVRPLLAGQSLNQLRLALSLT
FT                   IEQAQWAALNGDAKVYTQALDDARSVLVANFNADNPQSKAMLESLNALVEQPVSVVTPD
FT                   LSESLAAVQAYIQRRHLPAEGEGGKP"
FT   gene            271554..272792
FT                   /locus_tag="PputW619_0259"
FT   CDS_pept        271554..272792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0259"
FT                   /product="HemY domain protein"
FT                   /note="PFAM: HemY domain protein; KEGG: pen:PSEEN5350 HemY
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70765"
FT                   /db_xref="GOA:B1J1V5"
FT                   /db_xref="InterPro:IPR005254"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:B1J1V5"
FT                   /protein_id="ACA70765.1"
FT                   /translation="MKRVYLLAVLAIVIAAALGIAVAKHSGYVLISYGGFRYQSGLWAA
FT                   LAALVAVLALLWLLRYLVGLVLTSSGVVNPWSRRNRSRRIRIAIEQGQLDLAEGRWASA
FT                   QRHLHRAAEAERQPLLYYLGAARAANEQGRKEDRDNLLERALERQPQAELAVALTHAQL
FT                   QMDRGESDGALEALLAMQERHPHNSQVLRLLQRLYLERGDWSALIRLLPDLRKGKVLPP
FT                   EELAALEQRAWGQNLGLAATRGDDEQSARQSLERAWQQLTAAQRQEPRLVLAYAEQLRQ
FT                   VGAQGEAEQVLRAALKRDYESHLARLYGLVRGDDPARQLQTAEGWLKANPQDPSLLLTL
FT                   GRLSLQNRLWGKARDYLESSLRMERNPETCAELARLLAGLGETERSNQLFQEGLGLLDE
FT                   RLLALPLPEGVRA"
FT   sig_peptide     271554..271625
FT                   /locus_tag="PputW619_0259"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.890 at
FT                   residue 24"
FT   gene            273014..273520
FT                   /locus_tag="PputW619_0260"
FT   CDS_pept        273014..273520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0260"
FT                   /product="Disulphide bond formation protein DsbB"
FT                   /note="PFAM: Disulphide bond formation protein DsbB; KEGG:
FT                   pen:PSEEN0158 disulfide bond formation protein B1
FT                   (disulfide oxidoreductase 1)"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70766"
FT                   /db_xref="GOA:B1J1V6"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="UniProtKB/TrEMBL:B1J1V6"
FT                   /protein_id="ACA70766.1"
FT                   /translation="MLPARLRTFFLPACLASLAVLLASFYLESALGLVPCPLCFSQRFL
FT                   VGVYAMICLCAAIHAPGVAAMCRYARAALGCSVAGALLAARHVWLQGEIGTSHECPVPF
FT                   WQTLESSWREAARQLLLGGPDCSSLTWSFLDLTLPEWSLLAFLLLAMLPMACLLAYRFR
FT                   TLGKA"
FT   sig_peptide     273014..273103
FT                   /locus_tag="PputW619_0260"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.823 at
FT                   residue 30"
FT   gene            273752..274222
FT                   /locus_tag="PputW619_0261"
FT   CDS_pept        273752..274222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0261"
FT                   /product="regulator of RpoD, Rsd/AlgQ"
FT                   /note="PFAM: regulator of RNA polymerase sigma(70) subunit
FT                   Rsd/AlgQ; KEGG: pen:PSEEN0159 transcriptional regulator
FT                   AlgQ"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70767"
FT                   /db_xref="GOA:B1J3C1"
FT                   /db_xref="InterPro:IPR007448"
FT                   /db_xref="InterPro:IPR038309"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3C1"
FT                   /protein_id="ACA70767.1"
FT                   /translation="MLDSCQNAQERWGGVHKLIDTWLKEREELVQAFGALRDAKPAFAD
FT                   KDKSRDFCAVLVDYVSAWHFEVSEQLVTEAKAFGDQKALKLAEEINPRINDITQIALAF
FT                   NDHCEKGDCKDTERFADKLGKLGSLLHERFELEDCLIEVLHNAHKEEDAIEA"
FT   gene            complement(274232..274897)
FT                   /locus_tag="PputW619_0262"
FT   CDS_pept        complement(274232..274897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0262"
FT                   /product="peptidylprolyl isomerase FKBP-type"
FT                   /note="PFAM: peptidylprolyl isomerase FKBP-type; KEGG:
FT                   pen:PSEEN0160 peptidyl-prolyl cis-trans isomerase,
FT                   FKBP-type"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70768"
FT                   /db_xref="GOA:B1J3C2"
FT                   /db_xref="InterPro:IPR000774"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR036944"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3C2"
FT                   /protein_id="ACA70768.1"
FT                   /translation="MPRYLFIGLCLVAPIALAAPESAPASDHDVAYSLGASLGERLRQE
FT                   VPGLQLEALVEGLRQSYQNQPLKLDKARMQAILQQHEEQANNAAVQAEVEKLQAIEARF
FT                   MANERARAGVHELPEGVLYSELKSGIGAQPSPKGKVQVRYVGRLPDGTVFDQNQQPQWF
FT                   GLDSVIEGWQVALPHMKTGAKWRLVIPSAQAYGAEGAGDLIAPYTPLVFEIELLAVGG"
FT   sig_peptide     complement(274841..274897)
FT                   /locus_tag="PputW619_0262"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.998 at
FT                   residue 19"
FT   gene            275122..276126
FT                   /locus_tag="PputW619_0263"
FT   CDS_pept        275122..276126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0263"
FT                   /product="alginate regulatory protein AlgP"
FT                   /note="KEGG: pen:PSEEN0161 alginate regulatory protein
FT                   AlgP"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70769"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3C3"
FT                   /protein_id="ACA70769.1"
FT                   /translation="MSAKKKPVSTPLHLLQQLSGSLLEHLEDACSQALADAEKLLAKLE
FT                   KQRGKAQEKLHNGRLKLQDAAKAGKAKAQGKAQKAIGELESLLDSLKERQTQTRTYIQQ
FT                   LKRDAQESLKLAQGVGKVREAAGKALDQRAVAAKSAKPATAKAPARAAAKPAARPAAKA
FT                   AAKAPAKAAAAKAPSRAAAAKPAAAKAPAKVAAKPAAKPVAAKAAAAKAPSRAAAVKPA
FT                   ATKAPAKVAAAKPAAKPATSRGAAAKPAAAKAPAKTTAAKPAAKAAAKPAAKPAAKAPA
FT                   KPAAKPAAAKPAANKPAEPKPATPAVTNSAGPAIPAPSSAPASTSPQTPSSAS"
FT   gene            complement(276102..276584)
FT                   /locus_tag="PputW619_0264"
FT   CDS_pept        complement(276102..276584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0264"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   pen:PSEEN0162 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70770"
FT                   /db_xref="InterPro:IPR012659"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3D9"
FT                   /protein_id="ACA70770.1"
FT                   /translation="MYTDLWNYALALYARPGVEAACLSVQAEGGDVCLLLCASWLQTRG
FT                   VAVEAGRIDALRAIAEPWQTEVVTPLRSLRQKWRTTAQHDPHLEALREQVKGLELQAEK
FT                   RLLQRLEECARQWPTGSLEPADDWLARLAPDQVRGHDSLAQLRVAATGLQEAEDGV"
FT   gene            276635..278545
FT                   /locus_tag="PputW619_0265"
FT   CDS_pept        276635..278545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0265"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pen:PSEEN0163 ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70771"
FT                   /db_xref="GOA:B1J3E0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3E0"
FT                   /protein_id="ACA70771.1"
FT                   /translation="MIRLSNLTLQRGPQRLLEGAEMTLHAGHKAGLIGANGAGKSSLFA
FT                   LLRGELSPDGGDCQLPGDWRIAHMRQEVDTLDRLAVDYVLDGDARLRKVQAELTLAESA
FT                   HDGTALARLHSELESADGYTADARARKLLAGLGFTNEQMDRRVGDFSGGWRMRLNLAQA
FT                   LMCPSDLLLLDEPTNHLDLDAILWLEDWLKGYPGTLLLISHDRDFLDAVVDHVLHVEQR
FT                   KLNLYKGGYTAFERTRAERLAQQQQAYEKQQAQRAHMEKYIARFKAQATKARQAQSRIK
FT                   ALERMEELSAAHVDSPFDFVFRESQKISSPLLSLSEGCLGYGDKAILDKVKLQLVPGAR
FT                   IGLLGPNGAGKSTLIKNLAGELAPLSGRLVLGENLAVGYFAQHQLDSLDDKASPLLHLQ
FT                   RIAPAEREQTLRDFLGGFDFHGDRVDEPVVNFSGGEKARLALALIAWERPNLLLLDEPT
FT                   NHLDLEMRLALTMALQEFAGAVVVVSHDRHLLKSTTDDFLLVADGKVDTFDGDLDDYSR
FT                   WLVEYRQRSAPASNAPVNPDKTDKKAQRQAAAALRQQLAPHKKAADKLEAELNQVHAQL
FT                   AEIETALGDSGLYEVARKDELRDLLARQSKLKQREGELEEGWMQALETLESMQAELEAL
FT                   S"
FT   gene            278728..279360
FT                   /locus_tag="PputW619_0266"
FT   CDS_pept        278728..279360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0266"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   pen:PSEEN0165 transporter, LysE family"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70772"
FT                   /db_xref="GOA:B1J3E1"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3E1"
FT                   /protein_id="ACA70772.1"
FT                   /translation="MSMEVWLGFFAACWVISLSPGAGAIASMSSGLQYGFWRGYWNALG
FT                   LQIGLVVQIAIIAAGVGAILAASATAFTIIKWFGVAYLVYLAYKQWRALPMDMTDESAV
FT                   RPIGKPLSLVFRGFLVNVSNPKALVFMLAVLPQFINPHAPLLPQYVAITVTMVTVDMLV
FT                   MAGYTGLASRVLRLLRTPKQQKRLNRTFAGLFIGAATFLATLRRAPV"
FT   sig_peptide     278728..278802
FT                   /locus_tag="PputW619_0266"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.839) with cleavage site probability 0.450 at
FT                   residue 25"
FT   gene            complement(279391..280143)
FT                   /locus_tag="PputW619_0267"
FT   CDS_pept        complement(279391..280143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0267"
FT                   /product="band 7 protein"
FT                   /note="PFAM: band 7 protein; KEGG: pen:PSEEN0166
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70773"
FT                   /db_xref="GOA:B1J3E2"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3E2"
FT                   /protein_id="ACA70773.1"
FT                   /translation="MFMQLGFGALLMLLGVLLLSAFRILREYERGVVFQLGRFWQVKGP
FT                   GLILLIPVIQQMVRVDLRTVVLDVPPQDVITRDNVSVKVNAVLYFRVLDPQKAIIQVED
FT                   FLVATSQLAQTTLRAVLGKHELDELLAEREQLNLDIRQVLDAQTDAWGIKVANVEIKHV
FT                   DLNESMVRAIARQAEAERERRAKVIHAEGELQASEKLMQAAQMLSKEPGAMQLRYMQTL
FT                   GSIAGDKTSTIVFPMPLDLLKGMMDREK"
FT   sig_peptide     complement(280078..280143)
FT                   /locus_tag="PputW619_0267"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.806) with cleavage site probability 0.499 at
FT                   residue 22"
FT   gene            complement(280146..281495)
FT                   /locus_tag="PputW619_0268"
FT   CDS_pept        complement(280146..281495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0268"
FT                   /product="protein of unknown function DUF107"
FT                   /note="PFAM: protein of unknown function DUF107; KEGG:
FT                   pen:PSEEN0167 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70774"
FT                   /db_xref="GOA:B1J3E3"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3E3"
FT                   /protein_id="ACA70774.1"
FT                   /translation="MIARCWRWWLLVLMLGFAPGSQAAPGAIWVLSIDDAIGPASADYL
FT                   MRGLDQAREQGAQLVVIRMDTPGGLDSAMRQIIKVILASPVPVATFVAPGGARAASAGT
FT                   YILYASHVAAMAPGTNLGAATPVQVGSPTGAPKDDKAKNDTNEQALARKQVNDAAAYIR
FT                   GLAQLRGRNADWAEKAVREAVSLSASEAFKQKVIDHVANDLPDLLRQLDGKTLIAADQP
FT                   RQLQTRDASLVEHVPDWRTRLLAVITNPSVALILIMIGVYGLLFEFMNPGSGVGGVVGG
FT                   ICLLLALYALQLLPVSFAGVALVMLGIAFMIAEAFLPSFGVVGFGGIVAFVVGAVILID
FT                   TDAPGFGIPLGLIASLAMLSALLIGGVLGMALKARKRALVSGDAGLVGSLVTVTQVVAG
FT                   NPFCGAVMAQGEQWQVQCTTPLQLGQQVRVTARHGVMLEVSAAAPTAQGE"
FT   sig_peptide     complement(281424..281495)
FT                   /locus_tag="PputW619_0268"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            281592..282050
FT                   /locus_tag="PputW619_0269"
FT   CDS_pept        281592..282050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0269"
FT                   /product="YbaK/prolyl-tRNA synthetase associated region"
FT                   /note="PFAM: YbaK/prolyl-tRNA synthetase associated region;
FT                   KEGG: pen:PSEEN0168 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70775"
FT                   /db_xref="GOA:B1J3E4"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3E4"
FT                   /protein_id="ACA70775.1"
FT                   /translation="MRMAKTLQQRLDQANCDYDIIPHPHSATSLESARTAGVPAERVAK
FT                   SVMLDDRHGNYIMAVLPANRHLDMSKVRMSGAWQLTRESGLPSLFGDCERGAIPAMGDV
FT                   YQIKMLLDSSLTRQGDVYLEAGDHDHLIHMSMEQYLKLVPQAEVRELC"
FT   gene            282112..282354
FT                   /locus_tag="PputW619_0270"
FT   CDS_pept        282112..282354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0270"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN0169 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70776"
FT                   /db_xref="InterPro:IPR021250"
FT                   /db_xref="InterPro:IPR038086"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3C4"
FT                   /protein_id="ACA70776.1"
FT                   /translation="MEAPTHHFSELFKQLGLPDDPQSIDQFITSHSPLKNEIKLVDAPF
FT                   WSDSQRAFLKESIIEDSDWAVPFDQLNEALRRPRK"
FT   gene            282425..283063
FT                   /locus_tag="PputW619_0271"
FT   CDS_pept        282425..283063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0271"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN0170 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70777"
FT                   /db_xref="GOA:B1J3C5"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3C5"
FT                   /protein_id="ACA70777.1"
FT                   /translation="MKDPYAPGFWCTVTILGTLTAGYFYGIRHTHQMSQAVQFLYAAAA
FT                   VAAAVALLGLTWIAWQQLHLNKREVIQGRTLLTIWNTKVALRRVETVFDRYFWGSYWHS
FT                   GRTFEEVMGELKGTPLEQSLDALKRQCRALDREVHDHHHHWLANARDLSSVATAMARER
FT                   YQLDLCEPLSSGQGNTAVLNRDLEVLVYTWSARLRSFDHQLDELERAYH"
FT   gene            complement(283070..283507)
FT                   /locus_tag="PputW619_0272"
FT   CDS_pept        complement(283070..283507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0272"
FT                   /product="CBS domain containing protein"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   pen:PSEEN0171 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70778"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3C6"
FT                   /protein_id="ACA70778.1"
FT                   /translation="MKNVEQILKTKSQHQTVYTIGPDDSVLDALKMLAEKNVGALPVVE
FT                   NNQVVGIVSERDYARKLVLKGRSSAATPVREIMSAPVVTVEPKQNLEYCMNLMTNRHLR
FT                   HLPVVSNGELLGLLSIGDLVKETIAEQASLILQLEQYIRGE"
FT   gene            complement(283700..285430)
FT                   /locus_tag="PputW619_0273"
FT   CDS_pept        complement(283700..285430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0273"
FT                   /product="dipeptidase"
FT                   /note="KEGG: pen:PSEEN0172 dipeptidase; TIGRFAM:
FT                   dipeptidase; PFAM: peptidase M20"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70779"
FT                   /db_xref="GOA:B1J3C7"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010964"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3C7"
FT                   /protein_id="ACA70779.1"
FT                   /translation="MHLKKLTATTLLLASIGLFTQPAQANLTQQQSAAIVKAFDGTEPS
FT                   DFKQFLGKLKASEQAKADNLDGTLDTYLAGTPLNAEQQNQINRLLGLYTRIKYGKAATD
FT                   TLRELVAIPTFSVDGVPQHENPEFLKIAEKIKALAEGFGLTFRNIDNRVYEVSLGAGQE
FT                   VVGIHAHADVVPVNPDNWKLADGTRLDPFKVTLVGDRMYGRGTEDDKNGIVVALYALKV
FT                   AKDENLPLARQFKLLIDTTEETSGDAIPYYFERNPTPAYNLALDGGYPVVIAEKGYGTV
FT                   MASFSTRPGSGKGAEITHLTGGLATNQIPTTSVATLAADNPAQLATQLEKAGADFVKRN
FT                   GGDFSIDAKVDGKNVLLTVTGVSAHSSEPESGVNPVARMLVFINGLGAQVPLKHNHFTD
FT                   AARYAADNWGLDYLGKHLGIGFEDEFMGPLTTSLTFVGVDEKGLKLAVNLRIPKGKSLA
FT                   TIKDELADKLGNWTRQSHTSVAFDYSLDEPMYRNPEGEWVKALLDVATENLGMKHAFGT
FT                   SAGATSVHDLPNGVQFGLAMPDVKYTGHNDNEFKTVEQFMLDLQVVSEMVARIGQMPKL
FT                   "
FT   sig_peptide     complement(285353..285430)
FT                   /locus_tag="PputW619_0273"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 26"
FT   gene            complement(285592..285668)
FT                   /locus_tag="PputW619_R0001"
FT                   /note="tRNA-Arg6"
FT   tRNA            complement(285592..285668)
FT                   /locus_tag="PputW619_R0001"
FT                   /product="tRNA-Arg"
FT   gene            complement(285659..286021)
FT                   /locus_tag="PputW619_0274"
FT   CDS_pept        complement(285659..286021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0274"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pen:PSEEN5304 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70780"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3C8"
FT                   /protein_id="ACA70780.1"
FT                   /translation="MNPFERPLPRTDVWAASSNHRTVCYRLQAEAEPDTLCRVLNLFAL
FT                   QFLTPHSVQVSRQDDWLDIEIGIGGLSGHRAEVIAQKLRNLVCVAQVSLDQEKWTKIKA
FT                   MDATESDGYHACALHS"
FT   gene            286148..286618
FT                   /locus_tag="PputW619_0275"
FT   CDS_pept        286148..286618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0275"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; KEGG:
FT                   pen:PSEEN5303 transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70781"
FT                   /db_xref="GOA:B1J3C9"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3C9"
FT                   /protein_id="ACA70781.1"
FT                   /translation="MQSELDAYDRRILELLQEDASLSSAQIAERVGLSQSPCWRRIQRL
FT                   KDEGVIRGQVTLLDRKKVGLNTQIFAEVKLNAHGRSNFTEFTEAIRGFPEVLECYVLMG
FT                   SVDFLLRIVTQDIEAYERFFFEKLSNVPGIQEVNSIVALSEIKSTTSLPLMR"
FT   gene            complement(286713..288089)
FT                   /locus_tag="PputW619_0276"
FT   CDS_pept        complement(286713..288089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0276"
FT                   /product="adenylate cyclase"
FT                   /note="PFAM: adenylate cyclase; KEGG: pen:PSEEN5302
FT                   adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70782"
FT                   /db_xref="GOA:B1J3D0"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="InterPro:IPR039013"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3D0"
FT                   /protein_id="ACA70782.1"
FT                   /translation="MHKETELKLRASRDTLAALREHPLLKKRNKSGWQTRELLNQYFDT
FT                   PERDLSAARVALRLRRDGEVIIQTLKCRGQSVAGLSERNEYEWHLDKVKLDLKKLDATC
FT                   WPEQLAELDKKSIKPLFTTDFTREFAEIAWGRGKSKVVIEAALDQGFVIAGKRKEEICE
FT                   LELELREGAPEALLELAAELAASLPLMPCDISKAERGYRLLEPDSYELGLPSTELDAEM
FT                   PVDDAFAALAWQLLGSSQRLAEQYRHNGHWRLLQDWVQCLAELRALVASLGQAAPRAST
FT                   RDLRASLDALLEDWRPLVQAGNDDEDIRRAAPEQFLEELEDVRWGQFSLETSRWLLARA
FT                   WTAERKGRGERQGKAQLASWVAHLLGEEGRALKLPLYTQRPEDLAEQLPRIEQLLAWLH
FT                   HARHVLEAPQMDRLYGDLKKLLELAELPLAEEPGELLEARVEQARAIDQSRGWKHLLKA
FT                   "
FT   gene            288204..289346
FT                   /locus_tag="PputW619_0277"
FT   CDS_pept        288204..289346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0277"
FT                   /product="acetylornithine deacetylase (ArgE)"
FT                   /note="TIGRFAM: acetylornithine deacetylase (ArgE); PFAM:
FT                   peptidase M20; peptidase dimerisation domain protein; KEGG:
FT                   pen:PSEEN5301 acetylornithine deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70783"
FT                   /db_xref="GOA:B1J3D1"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010169"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3D1"
FT                   /protein_id="ACA70783.1"
FT                   /translation="MSLPTLKDQFAALIAAPSVSCTQPALDQSNRQVIDLLAGWLGDLG
FT                   FSCDIQQVSPGKFNLLASRGTGPGGLVLAGHSDTVPYDEQLWTSDPLKLTEVDGRWVGL
FT                   GSCDMKGFFALIIEAVIPLLEHDFKQPLLVLATCDEESSMSGARALAEAGQPLGRAAVI
FT                   GEPTGLRPIRMHKGILMDRIDILGRSGHSSDPSLGHSALEAMHAVMGELMGLRRQWQET
FT                   YRNPQFTVPTPTMNFGCIHGGDNPNRICGQCALEFDLRPLPGMDVEQLRAAIREKLRPV
FT                   AERHEVRIDYAPLFPEVPPFEQAADAELVQVAERLTGHRAEAVAFGTEAPYLQQLGCQT
FT                   IVLGPGDIACAHQPGEYLEMSRIEPTVRLLRDLIRHYCLN"
FT   gene            289472..290770
FT                   /locus_tag="PputW619_0278"
FT   CDS_pept        289472..290770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0278"
FT                   /product="amino-acid N-acetyltransferase"
FT                   /note="TIGRFAM: amino-acid N-acetyltransferase; PFAM:
FT                   GCN5-related N-acetyltransferase;
FT                   aspartate/glutamate/uridylate kinase; KEGG: pen:PSEEN5300
FT                   N-alpha-acetylglutamate synthase (amino-acid
FT                   acetyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70784"
FT                   /db_xref="GOA:B1J3D2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR010167"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR033719"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3D2"
FT                   /protein_id="ACA70784.1"
FT                   /translation="MPDYVNWLRHASPYINAHRDCTFVVMLPGDGVEHPNFGNIVHDLV
FT                   LLHSLGVRLVLVHGSRPQIESRLAARGLTPHYHHGLRITDAATLDCVIDAVGALRLAIE
FT                   ARLSMDIAASPMQGSRLRVACGNLVTARPIGVLEGVDYHHTGEVRRIDRKGISRLLDER
FT                   SIVLLSPLGYSPTGEIFNLACEDVATRAAIELGADKLLLFGAEPGLLDESGKLVRELRP
FT                   QQVAPHLARLGSDYQGELLDAAAEACKGGVARSHIVSYAEDGALLTELFTRGGGGTLVS
FT                   QEQFEVVREATIEDVGGLLELISPLEEQGILVRRSREVLEREIEQFSVVEREGMIIACA
FT                   ALYPIADSQAGELACLAVNPEYRHGGRGDELLERIESRARALGLNTLFVLTTRTAHWFR
FT                   ERGFAPSGVERLPSARASLYNYQRNSKIFEKSL"
FT   gene            complement(290834..292210)
FT                   /locus_tag="PputW619_0279"
FT   CDS_pept        complement(290834..292210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0279"
FT                   /product="Glutamate--putrescine ligase"
FT                   /EC_number="6.3.1.11"
FT                   /note="PFAM: glutamine synthetase catalytic region; KEGG:
FT                   pen:PSEEN5299 glutamine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70785"
FT                   /db_xref="GOA:B1J3D3"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3D3"
FT                   /protein_id="ACA70785.1"
FT                   /translation="MSVPPRAVQLNEANAFLKEHPEVLYVDLLIADMNGVVRGKRIERT
FT                   SLHKVYEKGINLPASLFALDINGSTVESTGLGLDIGDADRICYPIPDTLCNEPWQKRPT
FT                   AQLLMTMHELEGEPFFADPREVLRQVVSKFDDLGLTICAAFELEFYLIDQENVNGRPQP
FT                   PRSPISGKRPQSTQVYLIDDLDEYADCLQDILEGAKEQGIPADAIVKESAPAQFEVNLH
FT                   HVPDPLKACDYAVLLKRLIKNIAYDHEMDTTFMAKPYPGQAGNGLHVHISVLDKDGNNI
FT                   FTSEDPEQNAALRHAVGGVLETLPASMAFLCPNVNSYRRFGAQFYVPNAPSWGLDNRTV
FT                   ALRVPTGSPDAVRLEHRVAGADANPYLMMAAVLAGVHHGLTNKVEPGEPIEGNSYEQLE
FT                   QSLPNNLRDALRELDDSEILNKYIDPKYIDIFVACKESELEEFEHSISDLEYNWYLHTV
FT                   "
FT   gene            292785..294143
FT                   /locus_tag="PputW619_0280"
FT   CDS_pept        292785..294143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0280"
FT                   /product="Glutamate--putrescine ligase"
FT                   /EC_number="6.3.1.11"
FT                   /note="PFAM: glutamine synthetase catalytic region; KEGG:
FT                   pen:PSEEN5297 glutamine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70786"
FT                   /db_xref="GOA:B1J3D4"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3D4"
FT                   /protein_id="ACA70786.1"
FT                   /translation="MSNNLDQLTDWLKEHKITEVECLISDLTGITRGKISPTNKFIAEK
FT                   GMRLPESVLLQTVTGDYVDDDIYYELLDPADIDMICRPDENAVFLVPWAIEPTAQVIHD
FT                   TYDKKGNPVELSPRNVLKKVLQLYADKGWQPIVAPEMEFYLTKRSEDPDFPLQPPVGRS
FT                   GRPETGRQSFSIEAANEFDPLFEDVYDWCELQQLDLDTLIHEDGTAQMEINFRHGNALH
FT                   LADQILVFKRTMREAALKHNVAATFMAKPMTGEPGSAMHLHQSVVDSVTGKNIFSNEDG
FT                   SMSELFLHHIGGLQKFIPEALPLFAPNVNSFRRFLPDTSAPVNVEWGEENRTVGLRVPD
FT                   AGPQNRRVENRLPGADANPYLAIAASLLCGYIGMVEGIAASAPVQGRGYERRNLRLPLT
FT                   IEDALERMEVSRALTQYLGKKFITGYVATKRAEHENFKRVISSWEREFLLFAV"
FT   gene            294193..295554
FT                   /locus_tag="PputW619_0281"
FT   CDS_pept        294193..295554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0281"
FT                   /product="aminotransferase class-III"
FT                   /note="PFAM: aminotransferase class-III; KEGG:
FT                   pen:PSEEN5296 aminotransferase, class III"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70787"
FT                   /db_xref="GOA:B1J3D5"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3D5"
FT                   /protein_id="ACA70787.1"
FT                   /translation="MSVKNPQTRDWQTLSGEHHLAPFSDYKQLKEKGPRIITKAQGVHL
FT                   WDSEGHKILDGMAGLWCVAVGYGREELVQAAEKQMRELPYYNLFFQTAHPPALELAKAI
FT                   TDVAPEGMTHVFFTGSGSEGNDTVLRMVRHYWALKGKPQKQTIIGRINGYHGSTVAGAS
FT                   LGGMSGMHEQGGLPIPGIVHIPQPYWFGEGGDMSPDDFGVWAAEQLEKKILEVGEDNVA
FT                   AFIAEPIQGAGGVIIPPETYWPKVKEILAKYDILFVADEVICGFGRTGEWFGSDYYDLK
FT                   PDLMTIAKGLTSGYIPMGGVIVRDKVAKVLSEGGDFNHGFTYSGHPVAAAVGLENLRIL
FT                   REEKIVEKVRTEVAPYLQKRLRELQDHPLVGEVRGLGLLGAIELVKDKASRSRYEGKGV
FT                   GMVCRNFCFDNGLIMRAVGDTMIIAPPLVISHAEVDELVEKARKCLDLTLEAIR"
FT   gene            295725..296822
FT                   /locus_tag="PputW619_0282"
FT   CDS_pept        295725..296822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0282"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: pen:PSEEN5295 putrescine ABC transporter, periplasmic
FT                   putrescine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70788"
FT                   /db_xref="GOA:B1J3D6"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3D6"
FT                   /protein_id="ACA70788.1"
FT                   /translation="MKKMGKTLLAAALMGAMATAVQAEDKVLNVYNWSDYIAPDTIAKF
FT                   EKQTGIKVKYDVFDSNETLEAKLLAGKSGYDVVVPSNNFLAKQIKAGVYEELDRSKLPN
FT                   WKNLDEDLLKAVGDASDKGNKHAFPYMWGSIGIGYNPEKVKAALGVDKIDSWDVVFKPE
FT                   NIAKLKSCGVSFLDAPTEMLPAALHYLGLPSDSTKKEDLKAAEDLFLKIRPSITYFHSS
FT                   KYIGDMANGNICVAVGYSGDLEQSKARAHEAGDKVKVDYVIPKEGAGTFYDMVAIPKDA
FT                   EHKEAAYKFMDFLMQPEIMAEITNAVRFPNGNAAATPFVDKDITSDPSIYPPADVKKHL
FT                   YAIAAPEAAAQRLITRSWTKIKSGK"
FT   sig_peptide     295725..295796
FT                   /locus_tag="PputW619_0282"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 24"
FT   gene            296872..298077
FT                   /locus_tag="PputW619_0283"
FT   CDS_pept        296872..298077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0283"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: pen:PSEEN5294 putrescine ABC transporter, periplasmic
FT                   putrescine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70789"
FT                   /db_xref="GOA:B1J3D7"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3D7"
FT                   /protein_id="ACA70789.1"
FT                   /translation="MAIDDCGIVAAKVSCAPVLRAWQRCAVTKALIVRTTHLSISVLRK
FT                   ALMAGAGLTLACSVQAAPTVHFYNWSDYIGPTTLEDFEKATGIKPVQDVFDSNETLEGK
FT                   LLAGNTGYDVVVPSNHFLGKQIKAGAFQKLDKNLLPNYSNLDPALMKRLEKNDPGNQYA
FT                   VPYLWGTNGIGYNVDKVKAALGVDTIDSWAVLFEPENMKKLSQCGVAFLDSADEMLPAV
FT                   LNYMGLDPNSTNPKDYEKAEQKLLAVRPYVTYFHSSKYITDLANGDICVAAGFSGDVFQ
FT                   AKARAEEAEKGVNLAYAIPKEGGNLWFDVLAVPKDAKNVKEAHAFINYLLKPEVIAQVS
FT                   DYVGYANPNPKAGDLMDQAVRTDAAVYPPQEVLDKMFVNSELPPKVQRLMTRSWTKVKS
FT                   GK"
FT   gene            298138..299280
FT                   /locus_tag="PputW619_0284"
FT   CDS_pept        298138..299280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0284"
FT                   /product="spermidine/putrescine ABC transporter ATPase
FT                   subunit"
FT                   /note="KEGG: pen:PSEEN5293 puttaive putrescine ABC
FT                   transporter, ATP-binding protein; TIGRFAM:
FT                   spermidine/putrescine ABC transporter ATPase subunit; PFAM:
FT                   ABC transporter related; Transport-associated OB domain
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70790"
FT                   /db_xref="GOA:B1J3D8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3D8"
FT                   /protein_id="ACA70790.1"
FT                   /translation="MAVASGAYKKALEGGQQPKQVLVKIDRVTKKFDETVAVDDVSLEI
FT                   RKGEIFALLGGSGSGKSTLLRMLAGFERPTEGRIFLDGVDITDMPPYERPINMMFQSYA
FT                   LFPHMTVAQNIAFGLQQDRMPKAEIDARVAEMLKLVHMTQYAKRKPHQLSGGQRQRVAL
FT                   ARSLAKRPKLLLLDEPMGALDKKLRSQMQLELVEIIERVGVTCVMVTHDQEEAMTMAQR
FT                   IAIMHLGWIAQIGSPVDIYETPTSRLVCEFIGNVNLFEAEVIDDAEGHALIASPELERK
FT                   IYVGHGVSTSVEDKHITYALRPEKMLVTTEQPDFEHNWSRGKVHDIAYLGGHSVFYVEL
FT                   PSGKVVQSFVANAERQGTRPTWGDEVYVWWEDDSGVVLRS"
FT   gene            299277..300197
FT                   /locus_tag="PputW619_0285"
FT   CDS_pept        299277..300197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0285"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: pen:PSEEN5292 putrescine
FT                   ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70791"
FT                   /db_xref="GOA:B1J277"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B1J277"
FT                   /protein_id="ACA70791.1"
FT                   /translation="MKLRKLKRAFQRLIPEGRHLVIGVPFIWLFLFFMLPFFIVLKISF
FT                   AEADVAIPPYTEIYSYVEDKVQLVINLANYGLLTEDELYISAYLGSLKMAFISTVLCLL
FT                   IGYPMAYSIANARKETQTVLLLLIMMPTWTAILIRVYAWMGILSNNGLLNGFLMWTGLI
FT                   DQPLQILNTNLAVYIGVVYSYLPFMILPLFANLVKHDQSLLEAASDLGSSTFNSFWKIT
FT                   VPLSKNGIIAGCMLVFIPVVGEFVIPELLGGPETLMIGKVLWQEFFNNRDWPVASALAV
FT                   VMLAILIVPILLFNRSQAKEMEGRA"
FT   gene            300194..301087
FT                   /locus_tag="PputW619_0286"
FT   CDS_pept        300194..301087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0286"
FT                   /product="Ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: pen:PSEEN5291 putrescine
FT                   ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70792"
FT                   /db_xref="GOA:B1J278"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B1J278"
FT                   /protein_id="ACA70792.1"
FT                   /translation="MKRFSFSKLMLVLGLLFIYLPMLILVIYSFNASKLVTVWGGWSIK
FT                   WYVGLLDNTQLMGSVMRSLEIACYTAVAAVALGTLAAFVLTRVTRFKGRTLFGGLVTAP
FT                   LVMPEVITGLSLLLLFVAMAQMIGWPQERGVVTIWIAHTTFCAAYVAVVVSARLRELDL
FT                   SIEEAAMDLGAKPWKVFFLITIPMIAPSLAAGGMMSFALSLDDLVLASFVSGPGSTTLP
FT                   MEVFSAVRLGVKPEINAVASLILLSVSLVTFMVWYFSRRAEEHRRKAIQQAIEEGAAAS
FT                   VSQPQIKRPTAAAASA"
FT   sig_peptide     300194..300298
FT                   /locus_tag="PputW619_0286"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.963) with cleavage site probability 0.580 at
FT                   residue 35"
FT   gene            301295..302383
FT                   /locus_tag="PputW619_0287"
FT   CDS_pept        301295..302383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0287"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   pen:PSEEN5289 multidrug RND transporter, membrane fusion
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70793"
FT                   /db_xref="GOA:B1J279"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B1J279"
FT                   /protein_id="ACA70793.1"
FT                   /translation="MRVTRSLLVVGMGLLGLLAGCSKEEAPEVLPRVGVLQVQPTDFAA
FT                   RVTLTGDVQARVQTDLSFRVGGKIISRSVDVGDHVKANQVLARLDPKDLQNNVDSAKAE
FT                   VFAAQARVTQTSAAFVRQQKLLPKGYTSQSEYDSAEAALRSNQSALKAAQAQLANAQEQ
FT                   LSYTALVSEADGVITERQAEVGQVVQATMPIFSLARDGDRDAVFNVYESLLVAPPSDAG
FT                   VMVSLLDDPKVQAQGFVREITPTVSAQSGTVQVKVALRNVPAAMRLGSPVTATANAQGR
FT                   PSIELPWSALTKALHEPAVWVVGEGDKVELRKVQVTRYLTGKVVIAQGIKGGETVVVSG
FT                   GQLLHPGMQVEKIDAKGGGAAP"
FT   sig_peptide     301295..301369
FT                   /locus_tag="PputW619_0287"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.945) with cleavage site probability 0.489 at
FT                   residue 25"
FT   gene            302380..303447
FT                   /locus_tag="PputW619_0288"
FT   CDS_pept        302380..303447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0288"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   pen:PSEEN5288 multidrug RND transporter, membrane fusion
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70794"
FT                   /db_xref="GOA:B1J280"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B1J280"
FT                   /protein_id="ACA70794.1"
FT                   /translation="MNKVLLMCAACLLLMACGREEEQPEAVRPVLSTVVEAQAQSQLGR
FT                   FAGTIQARYESTLGFRVAGRIARRWLDVGAQVKPGDTLATLDPTDQQNQLRAAEGDLAR
FT                   VQAQWINAQANARRQQQLYDRGVGAQAQLDIAQTDLKTTGASLEQARSAVSQARDQLDY
FT                   STLRSDHTAVITAWQAEAGQTVTAGQAVVTLARPDIKEAVIDLPISIAEQLTKDLTFTV
FT                   ASQLDNSINTTATLRELEPQADAATRTRRARLTLASTPDAFHLGTAISVTLTSAITPRS
FT                   ELPLSALLERDGKTQVWVIDPQQKTVATRDVALLDRTGDSIVLASGVQPGERVVTAGVN
FT                   SLKPGQKVTFDEDAQ"
FT   sig_peptide     302380..302442
FT                   /locus_tag="PputW619_0288"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.416 at
FT                   residue 21"
FT   gene            303444..306509
FT                   /locus_tag="PputW619_0289"
FT   CDS_pept        303444..306509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0289"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   pen:PSEEN5287 Acr-type multidrug efflux transporter (RND
FT                   family)"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70795"
FT                   /db_xref="GOA:B1J281"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B1J281"
FT                   /protein_id="ACA70795.1"
FT                   /translation="MKGSFNLSEWALRHQSFVWYLMFVGLLMGIFSYFNLGREEDPSFT
FT                   IKTMVIQTRWPGATQDETLYQVTDRIEKKLEELDSLDYTKSYTRPGESTVYVYLRDTTK
FT                   AADIPQIWYQVRKKIQDIRGEFPQGIQGPGFNDEFGDVFGSIYAFTADGLTLRQLRDYV
FT                   EQARAEVREVPNIGKIELVGTQDEALYLKFSTRKLAALGIDQRQVMQALQQQNAVTPAG
FT                   VIEAGPERISVRTTGQFASEKDLQTVNLRINDRFFRLADIADIERGYVDPPSPMFRYNG
FT                   QTAIGLAIGMKAGGNIQVFGAALKKKMDSIVNDLPVGVGVHTVSDQAVVVKEAVGGFTS
FT                   ALFEAVVIVLAVSFVSLGVRAGLVVACSIPLVLAMVFVFMEYSGITMQRISLGALIIAL
FT                   GLLVDDAMITVEVMVTRLEMGDSKEQAATFAYTSTAFPMLTGTLVTVAGFVPIGLNASS
FT                   AGEYTYTLFAVIAVALIVSWVVAVFFAPVLGVHILKSDKLKGHEAEPGRVGRAFEGGLL
FT                   WCMRHRWLTIIGTILLFALSLFSMRFVQNQFFPSSDRPEILVDLNLPQNASIEETRKVV
FT                   DRLEAKIKDDPDMVRWSTYIGQGAIRFYLPLDQQLQNPYYAQLVIVSKGFEERAGMMAR
FT                   LQKLLHEEFVGIGTNVQSLEMGPPVGRPIQYRVSGKDIDQVRKHAIDLATMLNTNEHIG
FT                   EMIYDWNEPGKVLRIEIAQDKARQLGLSSEDVANVMNSIVSGAPVTEVNDNIYLVDVIA
FT                   RAVDSERGSPDTLQNLQIVTPSGTSIPLLAFATVRYELEQPLVWRRDRKPTITIKASVN
FT                   GEIQPTDLVAQLKPKIDEFASQLPVGYEVATGGTVEESSKAQGPIAKVIPLMLFLMATF
FT                   LMIQLHSVQKLFLVVSVAPLGLIGVVVALVPTGTPMGFVAILGILALAGIIIRNSVILV
FT                   TQIDEFEAQGYSPWDAVMEATNHRRRPILLTAAAASLGMIPIAREVFWGPMAYAMIGGI
FT                   ISATLLTLLFLPALYVAWYKIREPENSEKPAA"
FT   gene            306694..306876
FT                   /locus_tag="PputW619_0290"
FT   CDS_pept        306694..306876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0290"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pfo:Pfl_0193 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70796"
FT                   /db_xref="InterPro:IPR018743"
FT                   /db_xref="UniProtKB/TrEMBL:B1J282"
FT                   /protein_id="ACA70796.1"
FT                   /translation="MSASVRSIDGQDEATILREIQSALRDLRFGAVEITVHNAQVVQIE
FT                   RKEKFRLQQPGNKPG"
FT   gene            306925..307932
FT                   /locus_tag="PputW619_0291"
FT   CDS_pept        306925..307932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0291"
FT                   /product="sulfate ABC transporter, periplasmic
FT                   sulfate-binding protein"
FT                   /note="TIGRFAM: sulfate ABC transporter, periplasmic
FT                   sulfate-binding protein; PFAM: extracellular solute-binding
FT                   protein family 1; KEGG: pen:PSEEN5284 sulfate/thiosulfate
FT                   import ABC transporter, periplasmic sulfate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70797"
FT                   /db_xref="GOA:B1J283"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="InterPro:IPR034408"
FT                   /db_xref="UniProtKB/TrEMBL:B1J283"
FT                   /protein_id="ACA70797.1"
FT                   /translation="MSIRRYALAALASAVFAGSAIAKDYELLNVSYDPTRELYQQYNAE
FT                   FIKHWQQSHPDDKVKIQQSHGGSGKQGRAVIDGLRADVVTLALAGDIDEIAKLGKTLPE
FT                   DWQKRLPDASTPYTSTIVFLVRKGNPKGIKDWGDLIKKDVSVITPNPKTSGGARWNFLA
FT                   AWAYGLKQGGSEAEAKEYVQELFKHVPVLDTGARGSTITFVNNGQGDVLLAWENEAFLA
FT                   LKEDGGTDKFEIVVPSLSILAEPPVAVVDKNAQKKGNEQIAEEYLKHLYSPAGQRIAAE
FT                   NFYRPRDAKVAAEFGKQFPKLDLVTIDKDFGGWKTAQPKFFNDGGVFDQIYQAQ"
FT   sig_peptide     306925..306993
FT                   /locus_tag="PputW619_0291"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            308104..308922
FT                   /locus_tag="PputW619_0292"
FT   CDS_pept        308104..308922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0292"
FT                   /product="sulfate ABC transporter, inner membrane subunit
FT                   CysT"
FT                   /note="TIGRFAM: sulfate ABC transporter, inner membrane
FT                   subunit; sulfate ABC transporter, inner membrane subunit
FT                   CysT; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: pen:PSEEN5283
FT                   sulfate/thiosulfate import ABC transporter, membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70798"
FT                   /db_xref="GOA:B1J284"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011865"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B1J284"
FT                   /protein_id="ACA70798.1"
FT                   /translation="MSRRISPVIPGFGLTLGYTLVYLSLIVLIPLAAMFVHAAQLTWDQ
FT                   FWNIISAPRVIAALKLSFGTALFAAIINGVIGTLLAWVLVRYTFPGRKIIDAMIDLPFA
FT                   LPTAVAGIALTALYAPGGWVGQFATDLGFKIAYTPLGITLALTFVTLPFVVRTVQPVLA
FT                   DIPREVEEAAACLGAKPLQVFRHVLAPALLPAWLTGFALAFARGVGEYGSVIFIAGNMP
FT                   MKTEILPLLIMVKLDQYDYTGATAIGVLMLVVSFILLLLINLLQRRIETP"
FT   sig_peptide     308104..308220
FT                   /locus_tag="PputW619_0292"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.991 at
FT                   residue 39"
FT   gene            308934..309806
FT                   /locus_tag="PputW619_0293"
FT   CDS_pept        308934..309806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0293"
FT                   /product="sulfate ABC transporter, inner membrane subunit
FT                   CysW"
FT                   /note="TIGRFAM: sulfate ABC transporter, inner membrane
FT                   subunit; sulfate ABC transporter, inner membrane subunit
FT                   CysW; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: pen:PSEEN5282
FT                   sulfate/thiosulfate import ABC transporter, membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70799"
FT                   /db_xref="GOA:B1J285"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011866"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B1J285"
FT                   /protein_id="ACA70799.1"
FT                   /translation="MSSSSLSATAAANAARRGSATSRRILIGLGWLVFALFLLLPLVIV
FT                   VSQALKNGFGTFFEAIFEPDALSALKLTLLAVVISVPLNLVFGVSAAWCVSKYTFRGKS
FT                   ILVTLIDLPFSVSPVIAGLVYVLMFGAQGLFGPWLQDHDIQIVFALPGIVLATIFVTVP
FT                   FVARELIPLMQEQGTQEEEAARLLGANGWQMFWHVTLPNIKWGLIYGVVLCTARAMGEF
FT                   GAVSVVSGHIRGVTNTLPLHVEILYNEYNHVAAFSVASLLLILALFILLLKQWSENRIN
FT                   RLRHSAAEE"
FT   gene            309810..310799
FT                   /locus_tag="PputW619_0294"
FT   CDS_pept        309810..310799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0294"
FT                   /product="sulfate ABC transporter, ATPase subunit"
FT                   /note="KEGG: pen:PSEEN5281 sulfate/thiosulfate import ABC
FT                   transporter, ATP-binding protein; TIGRFAM: sulfate ABC
FT                   transporter, ATPase subunit; PFAM: ABC transporter related;
FT                   Transport-associated OB domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70800"
FT                   /db_xref="GOA:B1J286"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005666"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR014769"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR024765"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1J286"
FT                   /protein_id="ACA70800.1"
FT                   /translation="MSIEVRNVSKRFNSFQALDNINLDIHSGELVALLGPSGCGKTTLL
FT                   RIIAGLETPDDGNIVFHGEDVSGHDVRDRNVGFVFQHYALFRHMSVFDNVAFGLRMKPK
FT                   GERPSESKIAEKVHELLNMVQLDWLADRYPEQLSGGQRQRIALARALAVEPKVLLLDEP
FT                   FGALDAKVRKELRRWLARLHEDINLTSVFVTHDQEEAMEVADRIVVMNKGVIEQIGSPG
FT                   EVYEKPANDFVYHFLGDSNRLALSEGHHVLFRPHEVSLSRHETEGHHAAEVRDIRPLGA
FT                   TTRVTLKVEGQSELIEAEVVKDHDSLTGLARGETLFFRPKVWQKVADI"
FT   gene            311103..311897
FT                   /locus_tag="PputW619_0295"
FT   CDS_pept        311103..311897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0295"
FT                   /product="TonB family protein"
FT                   /note="TIGRFAM: TonB family protein; PFAM: Gram-negative
FT                   tonB protein; KEGG: pen:PSEEN5280 TonB-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70801"
FT                   /db_xref="GOA:B1J287"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:B1J287"
FT                   /protein_id="ACA70801.1"
FT                   /translation="MGNVHSAVRAYDQPRHPAPGDLVELGRTLRLPLGQLRLQRTPASG
FT                   LKRRDKLALALLVLAVHGAAAFWVSRAPTRELPVVPPQIPPMTIEFAAPAPPVVEPPPP
FT                   APAPPVVEPPPPVVDELAAKPKPKPKPAPKPLAKQPPKPQPKPVEAPPPAPTPVAAPST
FT                   PAPPAPAPVTPPSANAAYLKNPAPEYPQMAQRRGWEGTVLLRVEVLASGKPGHIQVQKS
FT                   SGRDALDAAALAAVKRWSFVPAKQGDVAQAGWVSVPIDFKLR"
FT   gene            311928..312647
FT                   /locus_tag="PputW619_0296"
FT   CDS_pept        311928..312647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0296"
FT                   /product="MotA/TolQ/ExbB proton channel"
FT                   /note="PFAM: MotA/TolQ/ExbB proton channel; KEGG:
FT                   pen:PSEEN5279 biopolymer transport protein ExbB"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70802"
FT                   /db_xref="GOA:B1J288"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:B1J288"
FT                   /protein_id="ACA70802.1"
FT                   /translation="MSLLASPLESVESAVIWLLVGFSVVTWGLALAKIVQFVRLKNQDK
FT                   RFHTQFWAASSLDAAAQVSHELPGPAARVAQSGYAAIAVGEAQTNDLSHAINHQDRLER
FT                   ALHQQIVRERRSLETGLAVVASIGSTSPFIGLFGTVWGIMEALKGISAAGSASLETVAG
FT                   PIGAALVATGVGIAVAVPAVLVYNYFLRRLKLTAAELDDFAHDFYSLAQKSAFRVLVHP
FT                   GVQKVQAGFTQPVKEAS"
FT   gene            312649..313050
FT                   /locus_tag="PputW619_0297"
FT   CDS_pept        312649..313050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0297"
FT                   /product="Biopolymer transport protein ExbD/TolR"
FT                   /note="PFAM: Biopolymer transport protein ExbD/TolR; KEGG:
FT                   pen:PSEEN5278 biopolymer transport protein ExbD/TolR"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70803"
FT                   /db_xref="GOA:B1J289"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:B1J289"
FT                   /protein_id="ACA70803.1"
FT                   /translation="MAFSTQDSDEVLSEINVTPLVDVMLVLLVVFIVTAPLLTNAIPIN
FT                   LPKTESVAPVEQKDPLVVSIDGAGKLFINKDEIQPDLLETNLKAARDKDANVRVQLQAD
FT                   DGVNYGEVARAMAAIERAGITKLAVITAR"
FT   gene            313275..313856
FT                   /locus_tag="PputW619_0298"
FT   CDS_pept        313275..313856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0298"
FT                   /product="protein of unknown function DUF1234"
FT                   /note="PFAM: protein of unknown function DUF1234; KEGG:
FT                   pen:PSEEN5264 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70804"
FT                   /db_xref="GOA:B1J290"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B1J290"
FT                   /protein_id="ACA70804.1"
FT                   /translation="MRNESIRYLIVSGWQGSPDNHWQSHWQRTLPNSARVEQHDWLTPQ
FT                   REDWVQALEQAVAAECAPVILIAHSLGCITVAHWAAQASPALLRRVRGALLVAPADVER
FT                   PTCAPALRNFAPIPTEALPFPSQVVSSDNDPAVSVPRALYLAQAWGAEAGLLSNAGHIN
FT                   VKSGHERWEQGFAYLYRLQSRVEQRALRRA"
FT   gene            313921..314751
FT                   /locus_tag="PputW619_0299"
FT   CDS_pept        313921..314751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0299"
FT                   /product="putative sigma54 specific transcriptional
FT                   regulator"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; SMART: AAA ATPase; KEGG: pen:PSEEN5263 sigma-54
FT                   dependent transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70805"
FT                   /db_xref="GOA:B1J291"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029995"
FT                   /db_xref="UniProtKB/TrEMBL:B1J291"
FT                   /protein_id="ACA70805.1"
FT                   /translation="MTLQHPFGQPLLTFPELDKSPLSIRAKALVFIDPRSQQLREDLER
FT                   LAPQPLPVLIRGETGTGKELLARQIHRASDRGGLFVSVNCAAISPTYADAELFGYSAGS
FT                   HGGTASSRAGWFGSANGGTLYLDEIADLPLAIQGKLLAALENREVTRVGAQQPQPVDVR
FT                   LVAATSIDLARVVKAGRFNERLYQYLHEGALELPPLRERCGDILPLAEYFVGIYCARLQ
FT                   RPVPLISEAAQQVLEAHTWPGNTRELENIIHFALLVNDSEEIQPEDLDLPNTPR"
FT   gene            314928..315713
FT                   /locus_tag="PputW619_0300"
FT   CDS_pept        314928..315713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0300"
FT                   /product="NLPA lipoprotein"
FT                   /note="PFAM: NLPA lipoprotein; KEGG: pen:PSEEN5262
FT                   lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70806"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:B1J292"
FT                   /protein_id="ACA70806.1"
FT                   /translation="MKKTLLTTALAAALSFSGLAAAAEKLVVAATPVPHAEILELIKPT
FT                   LAKEGVDLQIKVFTDYVQPNVQVDQKRLDANYFQTLPYLKSFNEGKGTHLETVIGVHVE
FT                   PFGGYSKKIKNLSELKDGATVAIPNEGSNSGRALILLQKAGLITLKDPKNALATPKDIA
FT                   ENPKNLKFKELESAMLARVLDQVDLDMINTNYALEAGLNPAKDALVIEGSDSPYVNFLV
FT                   ARPDNKNSEAIQKLAKALTSPEVKEFIAKKYSGAVLPAF"
FT   sig_peptide     314928..314996
FT                   /locus_tag="PputW619_0300"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.963 at
FT                   residue 23"
FT   gene            complement(315952..318315)
FT                   /locus_tag="PputW619_0301"
FT   CDS_pept        complement(315952..318315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0301"
FT                   /product="peptidase S45 penicillin amidase"
FT                   /note="PFAM: peptidase S45 penicillin amidase; KEGG:
FT                   pen:PSEEN5257 penicillin amidase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70807"
FT                   /db_xref="GOA:B1J293"
FT                   /db_xref="InterPro:IPR002692"
FT                   /db_xref="InterPro:IPR014395"
FT                   /db_xref="InterPro:IPR023343"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:B1J293"
FT                   /protein_id="ACA70807.1"
FT                   /translation="MKRSLTLLAVVVAVATGAGYWYVHGKLPQRDGEVAVAGLQAPVSV
FT                   RYDTRGVPHLQAQNEADLYRALGYVHAQDRLFQMEIMRRLARGELAEVLGDKLLPTDTL
FT                   FRSLRIRDQAALMVQRLDHQSPAWKALQAYLDGINAWQASHPKPMEFDLIGITPRPFTA
FT                   EDTLSIAGYLAYSFAAAFRTEPALTYIRDQLGPQYLKIFDLDWQPDGALGTPLATADWQ
FT                   GLEALARLSHEALGDAGIPQFEGSNAWAVAGGRTRSGKPLLAGDPHISFAVPAVWYEAE
FT                   LSAPGFNLYGYFQALNPFALLGHNRDFGWSLTMFQNDDVDLIAEKTNPTNSDQVMVQGQ
FT                   WRTLEKTEQRIAVKGEQPVSISLRRSPHGPIVNDVLGATAGTTPIAMWWAFLETENPIL
FT                   EGFYQLNRADSLAKMREAAAKVQAPGLNFVWASAGGDIGWWAAAQLPIRPDDVNPSFIL
FT                   DGASHQADKLGFYPFSVNPQQENPASGYIVSANYQPPAAVPIPGYYNLPDRGRQLERHL
FT                   ANPQVKWDTQNSQALQLDTANDYGPRTLAPLLATLRDIALGDEEKELVEQLAAWRGDHP
FT                   LDSTNATLFNQFLYQLAHAALHDELGDTWFPVLISTRTIDSALPRLAADAQSPWWNTRG
FT                   ANQRTDRTAIVRIAWQQTLEHLRETFGKDPASWQWGKAHTLTHNHPLGVKKPMNLLFNV
FT                   GPFAAPGTHEVPNNLSAKIGPAPWPVTYGPSTRRLIDFADAGQALTSNPVGQSGVPFDR
FT                   HYSDQAEGYIEGQYQRAQMGVIPARTTLRLVPAE"
FT   sig_peptide     complement(318262..318315)
FT                   /locus_tag="PputW619_0301"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.475 at
FT                   residue 18"
FT   gene            318402..318968
FT                   /locus_tag="PputW619_0302"
FT   CDS_pept        318402..318968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0302"
FT                   /product="transferase hexapeptide repeat containing
FT                   protein"
FT                   /note="PFAM: transferase hexapeptide repeat containing
FT                   protein; KEGG: pen:PSEEN5256 acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70808"
FT                   /db_xref="GOA:B1J294"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR024688"
FT                   /db_xref="UniProtKB/TrEMBL:B1J294"
FT                   /protein_id="ACA70808.1"
FT                   /translation="MSLSEKQKMLSGQLYHAGCPELQAEQIATKHWMQRYNTSFDLLNE
FT                   ARNGLLAEHFGHVGEGTVIRPPFYCDYGYNISVGRNTFMNFNCVILDVLPVRIGDDCQI
FT                   GPAVQIYTADHPLDPELRRTGLESGRPVTIGNNVWIGGAAIILPGVTIGDNAVVGAGSV
FT                   VTRDVPAGAVVVGNPARARQPAQGQ"
FT   gene            complement(318947..319516)
FT                   /locus_tag="PputW619_0303"
FT   CDS_pept        complement(318947..319516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0303"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN5255 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70809"
FT                   /db_xref="GOA:B1J295"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B1J295"
FT                   /protein_id="ACA70809.1"
FT                   /translation="MKNRTIKPIILAIALLSCAAVLWWAYDSFKSRYLRPFESQTTLFD
FT                   GTQLRLPAELAGPGPVRVVHFWDPTCPCNVGNQQHLGDLLSHFADKGVAFHVVQKPGSQ
FT                   GRLPANLTRLQPITHLPGSENLPASPAVAIWDRQGNLAYFGPYSEGAVCNASNSFIEPI
FT                   LKALLDGRHVTASNTLAVGCYCPWAG"
FT   sig_peptide     complement(319448..319516)
FT                   /locus_tag="PputW619_0303"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.550 at
FT                   residue 23"
FT   gene            319636..320562
FT                   /locus_tag="PputW619_0304"
FT   CDS_pept        319636..320562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0304"
FT                   /product="lipase"
FT                   /note="KEGG: pen:PSEEN5254 lipase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70810"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B1J296"
FT                   /protein_id="ACA70810.1"
FT                   /translation="MPAAFHPDRLRASLAPLGKRQPLSVQAQDYQRFYGLNLPAQSWLG
FT                   GFQAAGFELAGQVWLPSQPVATLFLLHGYYDHMGLYRHVIEWALQQGYAVISCDLPGHG
FT                   LSSGERASITDFALYQQVLDALFEQARSLALPCPWHLCGQSTGGAIAVDHLLHQGVQSP
FT                   VDGQVILLAPLVRPRAWLWSKLSYRVLRHFVNGIERRFSENSNDPTFLPFLEADPLQPR
FT                   RLPTAWVGALMAWVKRIEAAPCSARRPLIVQGEADGTVDWPYNLEVLKAKFAEPQILLL
FT                   PEARHHLANELPGIRQRYFDFINQRLG"
FT   gene            complement(320563..321315)
FT                   /locus_tag="PputW619_0305"
FT   CDS_pept        complement(320563..321315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0305"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN5253 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70811"
FT                   /db_xref="InterPro:IPR018637"
FT                   /db_xref="UniProtKB/TrEMBL:B1J297"
FT                   /protein_id="ACA70811.1"
FT                   /translation="MRRLFSLILLMICTMPVWADSLDQLYKAAGWPDQRAHFNDAVSAA
FT                   QQRYRNSLPPAVYQALVSNSNQRFQAAAMDRRAQAQLRSALPDPAPALAFFQSPLGRKI
FT                   VAAELLATRKDQLAKHAKGLPKIQASDNRLLIIGHLAQALPAREAGAEVSLAIAGVAAD
FT                   SLSSMIPGLFGGGQAQGLLDGQRQRLMNQIGEDLNNTLLYVYRDLSDAELEEFATFAES
FT                   PEGKAYYQAAVAAVRAGLAVGQNGANLK"
FT   sig_peptide     complement(321256..321315)
FT                   /locus_tag="PputW619_0305"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT   gene            321420..322061
FT                   /locus_tag="PputW619_0306"
FT   CDS_pept        321420..322061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0306"
FT                   /product="2OG-Fe(II) oxygenase"
FT                   /note="PFAM: 2OG-Fe(II) oxygenase; SMART: Prolyl
FT                   4-hydroxylase alpha subunit; KEGG: pen:PSEEN5252
FT                   oxidoreductase, 2OG-Fe(II) oxygenase family"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70812"
FT                   /db_xref="GOA:B1J298"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="UniProtKB/TrEMBL:B1J298"
FT                   /protein_id="ACA70812.1"
FT                   /translation="MDMMRAMHISPEHPMLAAVVDDLASHGWSQQALFLPAELVRALAA
FT                   ECRRRDAEGQLNPAGVGRGVAQEVREAIRGDQIQWVDPGQAEACDKYLEAMDQLRLAIN
FT                   QGLFLGLEEFECHFALYPPGAFYRRHLDRFRDDDRRMVSAVLYLNEDWQPQDGGQLRMF
FT                   LADAVEHDVQPVAGCLVVFLSGEVPHEVLPAGRERLSLTGWFRRRGNDPF"
FT   gene            322048..322551
FT                   /locus_tag="PputW619_0307"
FT   CDS_pept        322048..322551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0307"
FT                   /product="protein of unknown function DUF523"
FT                   /note="PFAM: protein of unknown function DUF523; KEGG:
FT                   pfo:Pfl_5390 protein of unknown function DUF523"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70813"
FT                   /db_xref="InterPro:IPR007553"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2A3"
FT                   /protein_id="ACA70813.1"
FT                   /translation="MTRSDPPKVLVSACLLGQPVRYDGRASGHPDLLQRWQAEGRVVPL
FT                   CPEVAGGLPTPRPPAEIPGGQGGEVLDGAAQVLTVNGEDVSAAFLAGAQQALALVRRHG
FT                   IRVAVLKAGSPSCGNRLTYDGTFAGVKVPGQGVTTALLRREGVLVFSELELEEAQRTLA
FT                   GLSA"
FT   gene            complement(322612..323100)
FT                   /locus_tag="PputW619_0308"
FT   CDS_pept        complement(322612..323100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0308"
FT                   /product="periplasmic binding protein from ABC-type
FT                   transporter"
FT                   /note="KEGG: pen:PSEEN5250 periplasmic binding protein from
FT                   ABC-type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70814"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2A4"
FT                   /protein_id="ACA70814.1"
FT                   /translation="MRSTMGVLLAVLITPLAQAELIDEIADRGELRIAVQADNSPYAFK
FT                   QNDHLTGFEIEFGQELAKQLDLRVEFIETPVAEILPGVESGKYDITVTPSDNAPKADTP
FT                   FDLSQPFGERKLVIPFQKDNPAFESAVNNALQRLKDSGRTAELEQKWFKGVPETATGQ"
FT   sig_peptide     complement(323041..323100)
FT                   /locus_tag="PputW619_0308"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 20"
FT   gene            323298..323774
FT                   /locus_tag="PputW619_0309"
FT   CDS_pept        323298..323774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0309"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN5249 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70815"
FT                   /db_xref="InterPro:IPR025512"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2A5"
FT                   /protein_id="ACA70815.1"
FT                   /translation="MNSLFSRAAVAGLLMGASVLVSAADALKSQEPPKDAKVFIVSPAD
FT                   GATVDKTFTVKFGIEGMGLKPAGDQTPHTGHHHLLVDVDKEPVADQPLPTSLMPEGGAA
FT                   LPAGPQVLHFGKAQTETTLTLTPGKHTLQLVLGDQYHVPFKPSVESKKITVEVK"
FT   sig_peptide     323298..323369
FT                   /locus_tag="PputW619_0309"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.980 at
FT                   residue 24"
FT   gene            complement(323904..325133)
FT                   /locus_tag="PputW619_0310"
FT   CDS_pept        complement(323904..325133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0310"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding"
FT                   /note="PFAM: amino acid-binding ACT domain protein;
FT                   D-isomer specific 2-hydroxyacid dehydrogenase catalytic
FT                   region; D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; KEGG: pen:PSEEN5248 D-3-phosphoglycerate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70816"
FT                   /db_xref="GOA:B1J2A6"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2A6"
FT                   /protein_id="ACA70816.1"
FT                   /translation="MSKTSLDKSKIRFLLLEGVHQNAVDTLKAAGYTNIEYLTGSLPEA
FT                   ELKEKIADAHFIGIRSRTQLTEEIFDCAKKLVAVGCFCIGTNQVDLDAARERGIAVFNA
FT                   PYSNTRSVAELVLAEAILLLRGIPEKNASCHRGGWIKSAANSFEIRGKKLGIVGYGSIG
FT                   TQLSVLAESLGMQVYFYDPLTKLPLGNAVQVTSLHELLGLADIVSLHVPELPSTQWMIG
FT                   EREIRAMKKGSILINAARGTVVELDHLAAAIKDKHLIGAAIDVFPVEPRSNDEEFESPL
FT                   RGLDNVILTPHIGGSTAEAQANIGLEVAEKLVKYSDNGTSVSSVNFPEVALPAHPGKHR
FT                   LLHIHENIPGVLSEINKVFAENGINISGQFLQTNEKVGYVVIDVDAEYSDLAQEKLQHV
FT                   KGTIRSRVLF"
FT   gene            325281..326702
FT                   /locus_tag="PputW619_0311"
FT   CDS_pept        325281..326702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0311"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   pen:PSEEN5247 FAD/FMN-containing dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70817"
FT                   /db_xref="GOA:B1J2A7"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2A7"
FT                   /protein_id="ACA70817.1"
FT                   /translation="MNKSRVPAMTHPAVIDELMTLVDPGKVLTDAVSLEAYGKDWTKHF
FT                   PPAPTAIVFPKSVEQVQAIVGWANRHQVALVPSGGRTGLSAGAVAANGEVVVAFDYMNQ
FT                   ILDFNAFDRTVVCQPGVITRQLQAFAEEQGLYYPVDFASSGSSQIGGNIGTNAGGIKVI
FT                   RYGMTRNWVAGLKVVTGKGELLELNKDLIKNATGYDLRQLFIGAEGTLGFVVEATMRLD
FT                   RAPRNLTAMVLGTPDFDSIMPVLHAFQGKLDLTAFEFFSDKGLAKIMARGDVPAPFATD
FT                   CPFYALLEFEASTEEVANDALATFEHCVEQGWVIDGVMSQSEAQLKNLWKLREYLSETI
FT                   SHWTPYKNDISVTVSKVPAFLRDIDAIVSQHYPDYEVVWYGHIGDGNLHLNILKPESMS
FT                   KDDFFASCTKVNKWVFEIVQRYNGSISAEHGVGMTKRDYLGYSRSPQEIACMKAIKAVF
FT                   DPNGIMNPGKIFAPE"
FT   gene            326727..327392
FT                   /locus_tag="PputW619_0312"
FT   CDS_pept        326727..327392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0312"
FT                   /product="fumarylacetoacetate (FAA) hydrolase"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   pen:PSEEN5246 fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70818"
FT                   /db_xref="GOA:B1J299"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:B1J299"
FT                   /protein_id="ACA70818.1"
FT                   /translation="MSYQHQYVDGTRIHFPLGKVVCVGRNYAEHAKELGNPIPTEPLLF
FT                   IKPGSCVVPLEGGFKIPTDRGSVHYEAEIAVLLGKPLSAHPSEEEVLDAISGFAPALDL
FT                   TLRDVQAKLKEKGMPWETCKSFDGACVLPPFVAAGTFEDLADIPVRLTINGDVRQDGNS
FT                   AMMLNPIVPIIQHMASHFSLLPGDVILTGTPAGVGPFEVGDELVLELPGVSRFESRVL"
FT   gene            327498..328418
FT                   /locus_tag="PputW619_0313"
FT   CDS_pept        327498..328418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0313"
FT                   /product="SdiA-regulated domain protein"
FT                   /note="PFAM: NHL repeat containing protein; SdiA-regulated
FT                   domain protein; KEGG: pen:PSEEN5245 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70819"
FT                   /db_xref="GOA:B1J2A0"
FT                   /db_xref="InterPro:IPR009722"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2A0"
FT                   /protein_id="ACA70819.1"
FT                   /translation="MALSSSASVSPKRRFYLRWPFGLAVAAVIGYGVAVAMHWDDRGRL
FT                   WVQEGFESSAERSESVWLPDYKVDIDAKPMPGMEDDEASDVAFNPHTRTLFVVMGKNPF
FT                   LVELSLDGDVLRQIPLQGWNNPEGVAVLEDGRLAITDERLHDLTVVKVDAQTKSLNHAD
FT                   FQSHDLGESVKSNKGFEAVAWDPMRQRLVIGEERPPKLYTWSTDGRSPLKGDKQPLASN
FT                   ELDLRNLSALSVDPRTGHLLVLSADSNMLLELDEQGQQVSFMTLLGGFNGLKDTIPRAE
FT                   GVAMDDQGNLYMVSEPALFYRFKKN"
FT   sig_peptide     327498..327608
FT                   /locus_tag="PputW619_0313"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.656) with cleavage site probability 0.583 at
FT                   residue 37"
FT   gene            328508..329419
FT                   /locus_tag="PputW619_0314"
FT   CDS_pept        328508..329419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0314"
FT                   /product="SdiA-regulated domain protein"
FT                   /note="PFAM: SdiA-regulated domain protein; KEGG:
FT                   pen:PSEEN5244 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70820"
FT                   /db_xref="InterPro:IPR009722"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2A1"
FT                   /protein_id="ACA70820.1"
FT                   /translation="MRRYVRLPLVLAVIGLLAVLLLGVAEQQFRLLERGWFNFKTWWQP
FT                   AEQSMGLDRYRVVTEAQPIDGLDDDVSALTYDPDRKTLFTVTNKRSELIELSLDGRILR
FT                   RVPLTGFGDPEAVEYVGPNSYVITDERQQRLIRVRLEDDTMFLDANDAEQLSLGIGLNG
FT                   NKGFEGLAYDSAGKRLFVAKERDPMVIYEIHGFPHENPEQPYAVHVVQDRKRDARLFVR
FT                   DLSSLQFDERSGHLLALSDESRLVLELDVKGKPLSTLSLRKGYQGLKQTVPQAEGIAMD
FT                   EAGTIYLVSEPNLFYVFKQPSD"
FT   sig_peptide     328508..328585
FT                   /locus_tag="PputW619_0314"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.981) with cleavage site probability 0.523 at
FT                   residue 26"
FT   gene            complement(329513..330187)
FT                   /locus_tag="PputW619_0315"
FT   CDS_pept        complement(329513..330187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0315"
FT                   /product="ribose 5-phosphate isomerase"
FT                   /EC_number="5.3.1.6"
FT                   /note="KEGG: pen:PSEEN5243 ribose 5-phosphate isomerase;
FT                   TIGRFAM: ribose 5-phosphate isomerase; PFAM: Ribose
FT                   5-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70821"
FT                   /db_xref="GOA:B1J2A2"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR020672"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1J2A2"
FT                   /protein_id="ACA70821.1"
FT                   /translation="MTQDQLKQAVAQAAVDFILPKLDEKSVVGVGTGSTANFFIDALAQ
FT                   HKTAFDGAVASSEATAQRLKGHGIPVYELNSVSELEFYVDGADESDAHLNLIKGGGAAL
FT                   TREKIVAAVAKTFICIADASKLVPVLGAFPLPVEVIPMARSHVARQLVKLGGDPVYREG
FT                   VVTDNGNVILDVYNLQITNPVELEAQINAIVGVVTNGLFAARPADLLLLGTPEGVKSLK
FT                   AE"
FT   gene            330321..331835
FT                   /locus_tag="PputW619_0316"
FT   CDS_pept        330321..331835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0316"
FT                   /product="threonine dehydratase, biosynthetic"
FT                   /note="TIGRFAM: threonine dehydratase, biosynthetic; PFAM:
FT                   Threonine dehydratase domain protein;
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   KEGG: pen:PSEEN5242 threonine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70822"
FT                   /db_xref="GOA:B1J2N7"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005787"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2N7"
FT                   /protein_id="ACA70822.1"
FT                   /translation="MLEQYVKKILTSRVYDVAVETPLHSAGQLSKRLGNQILLKREDLQ
FT                   PVFSFKIRGAYNKLAQLSPEELARGVVTASAGNHAQGLALAARELGIKATIVMPKTTPE
FT                   IKIEGVRSRGGKVVLHGDSFPEALAYSLKLVDEKGFVYIHPYDDPHTIAGQGTVAMEIL
FT                   RQHPGRLDAIFVPVGGGGLIAGIAAYVKYLRPEIKVIGVEPDDSNCLQAAMAAGERVVL
FT                   PQVGLFADGVAVAQIGQHTFDICRLHVDEVVTVSTDEICAAIKDIYDDTRSITEPAGAL
FT                   GVAGIKKYVELNGVTGQTLVAIDSGANVNFDRLRHVAERAELGEKREAIIAVTIPERPG
FT                   SFKAFCEAIGKRQITEFNYRKHTSDEAHIFVGVQTHPENDPRAALVQQLTEQGFPVTDL
FT                   TDNELAKMHIRHMVGGHSAGARDEIVLRFEFPERPGALFNFLNKLGGRWNISMFHYRNH
FT                   GAADGRVVAGLQVPEDERHLVPAALAKIGYPYWDETDNPAYRLFLG"
FT   gene            331874..332299
FT                   /locus_tag="PputW619_0317"
FT   CDS_pept        331874..332299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0317"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN5241 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70823"
FT                   /db_xref="GOA:B1J2N8"
FT                   /db_xref="InterPro:IPR018729"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2N8"
FT                   /protein_id="ACA70823.1"
FT                   /translation="MEHLTTLKALHLIATALLLLGALGLAIWTVHARRQGDAQVYGKLL
FT                   SRPLVFVWLVMGVSLLSMPFTGWWLVHLVGWPLGQTWVLASSVIYTLGAFAAWWLLVRL
FT                   NRLRKAEVVGLRFTLALAVFSGVCFLSIAGLMGAKPV"
FT   sig_peptide     331874..331972
FT                   /locus_tag="PputW619_0317"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.963) with cleavage site probability 0.765 at
FT                   residue 33"
FT   gene            complement(332401..333057)
FT                   /locus_tag="PputW619_0318"
FT   CDS_pept        complement(332401..333057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0318"
FT                   /product="HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IB
FT                   (PSPase-like); HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: pen:PSEEN5240 hydrolase, haloacid
FT                   dehalogenase-like family"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70824"
FT                   /db_xref="GOA:B1J2N9"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2N9"
FT                   /protein_id="ACA70824.1"
FT                   /translation="MRLALFDLDNTLLGGDSDHAWGDYLCERGILDPIAYKKRNDDFYQ
FT                   DYLNGTLDLQAYLAFSMEILAATEPAQLDQWHREFMHDCIEPIILPKALALLQQHREAG
FT                   DQLVIITATNRFVTAPIARRLGVRTLLATECETRDGRYTGRSTDIPCFREGKVTRLERW
FT                   MLENGFDLQDSYFYSDSMNDLPLLQRVSHAVAVDPDPNLQAEAQRRGWPVISLRD"
FT   gene            333199..333678
FT                   /locus_tag="PputW619_0319"
FT   CDS_pept        333199..333678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0319"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: pen:PSEEN5239
FT                   (di)nucleoside polyphosphate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70825"
FT                   /db_xref="GOA:B1J2P0"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR022927"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1J2P0"
FT                   /protein_id="ACA70825.1"
FT                   /translation="MIDPDGFRPNVGIILTNDAGQVLWARRINQDAWQFPQGGINPDET
FT                   PEDALYRELNEEVGLERDDVEILACTRGWLRYRLPQRLVRTHSQPLCIGQKQKWFLLRL
FT                   VSNEQRVRMDLTGKPEFDGWRWVSYWYPLGQVVTFKREVYRRALKELAPRLLTRD"
FT   gene            333701..335980
FT                   /locus_tag="PputW619_0320"
FT   CDS_pept        333701..335980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0320"
FT                   /product="PTSINtr with GAF domain, PtsP"
FT                   /note="TIGRFAM: phosphoenolpyruvate-protein
FT                   phosphotransferase; PFAM: PEP-utilizing protein; GAF domain
FT                   protein; PEP-utilising protein mobile region; PEP-utilising
FT                   protein domain protein; KEGG: pen:PSEEN5238
FT                   phosphoenolpyruvate-protein phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70826"
FT                   /db_xref="GOA:B1J2P1"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2P1"
FT                   /protein_id="ACA70826.1"
FT                   /translation="MLNTLRKIVQEVNSAKDLKTALGIIVLRVKEAMGSQVCSVYLLDP
FT                   ETNRFVLMASEGLNKRSIGKVSMAPNEGLVGLVGTREEPLNLENAADHPRYRYFAETGE
FT                   ERFASFLGAPIIHHRRVVGVLVIQQKERRQFDEGEEAFLVTMSAQLAGVIAHAEATGSI
FT                   RGLGRQGKGIQEARFVGVPGSPGAAVGRAVVMLPPADLEVVPDKTVEDIDAELKLFHNA
FT                   LEGVRADMRKLSAKLATQLRPEERALFDVYLMMLEDAALGGEVTDVIKTGQWAQGALRQ
FT                   VVGEHVNRFELMDDDYLRERASDVKDLGRRLLAYLQQARSQSLVYADNTILVSEELTPA
FT                   MLGEVPEGKLVGLVSVLGSGNSHVAILARAMGIPTVMGLVDLPYSKVDGIELIVDGYKG
FT                   EVFTNPSDVLRKQYSEVVEEERQLAQGLDALRELPCVTPDGHRMPLWVNTGLLADVARA
FT                   QQRGAEGVGLYRTEVPFMINQRFPSEKEQLAIYREQLAAFHPLPVTMRTLDIGGDKALS
FT                   YFPIKEENPFLGWRGIRVTLDHPEIFLVQTRAMLKASEGLNNLRILLPMISGIHELEEA
FT                   LHLIHRAWGEVRDEGTDVPMPPVGVMVEIPAAVYQTKELARQVDFLSVGSNDLTQYLLA
FT                   VDRNNPRVADLYDYLHPAVLQALNTVVRDAHGEGKPVSICGEMAGDPAAAVLLMAMGFD
FT                   SLSMNATNLPKVKWMLRQINMSKAKELLADALSHDNPQVIHSSLQLALKNLGLARMIGP
FT                   EANKTL"
FT   gene            complement(336095..336841)
FT                   /locus_tag="PputW619_0321"
FT   CDS_pept        complement(336095..336841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0321"
FT                   /product="protein of unknown function DUF833"
FT                   /note="PFAM: protein of unknown function DUF833; KEGG:
FT                   pen:PSEEN5237 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70827"
FT                   /db_xref="InterPro:IPR008551"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2P2"
FT                   /protein_id="ACA70827.1"
FT                   /translation="MCLIVFAWRPGHALPLIVAANRDEFYARPTQALAHWEDAPGVHAG
FT                   RDLEAGGTWLGVGPRGRFAALTNIRDPGQPLGSRSRGELVAAYLQGELGVEAYLDQVAS
FT                   RSKQYSGFNLLVGDGVRLGYLHAREAAPRLLAAGVYGLSNAGLDTPWPKLVKARDGLER
FT                   LLGSADPQRLMALLADGETAPEAELPETGVGVATEKLLSSVFIASQNYGTRASTVLIVD
FT                   DQGKRRLIERSFGPFGGHLGEVELWV"
FT   gene            336971..337753
FT                   /locus_tag="PputW619_0322"
FT   CDS_pept        336971..337753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0322"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   pen:PSEEN5236 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70828"
FT                   /db_xref="GOA:B1J2P3"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2P3"
FT                   /protein_id="ACA70828.1"
FT                   /translation="MEFALYLLLGACAGVLAGLFGVGGGIIIVPVLVFSFTLQGFDASV
FT                   LTHLAVGTSLATIVFTSINAVLEHHRRGAVQWPIFAWMTVGILLGAGVGAKTASLIQGP
FT                   LLQKIIGVFALIIAAQMALDLKPKASRGIPGKPALIGAGGVIGWASAIFGIGGGSLTVP
FT                   FLTWRSLPMQQAVATSSACGLPIAVASALSFMWLGWHDEHLPAHSVGFVYLPALVGIAV
FT                   TSMFFARFGARLAHKLSPRLLKRLFAALLFSVGLSFLI"
FT   sig_peptide     336971..337024
FT                   /locus_tag="PputW619_0322"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.629) with cleavage site probability 0.266 at
FT                   residue 18"
FT   gene            337770..338579
FT                   /locus_tag="PputW619_0323"
FT   CDS_pept        337770..338579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0323"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /note="PFAM: prolipoprotein diacylglyceryl transferase;
FT                   KEGG: pen:PSEEN5235 prolipoprotein diacylglyceryl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70829"
FT                   /db_xref="GOA:B1J2P4"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1J2P4"
FT                   /protein_id="ACA70829.1"
FT                   /translation="MLPYPQIDPVAVALGPLKIHWYGLMYLIGIGGAWLLASRRLNRFD
FT                   PTWSREKLSDLVFWLSMGVIVGGRLGYVLFYDLHAYLANPTLIFEVWKGGMSFHGGFIG
FT                   VMLAALWFGKRNNKSFFELMDFVAPLVPIGLGAGRIGNFINAELWGKATDVPWAMVFPP
FT                   FSDPAQLPRHPSQLYQFALEGVALFVILWLYSRKPRPTMAVSGMFALFYGIFRFIVEFV
FT                   RVPDAQLGYIAFGWLTMGQLLCVPMIVGGLFLIWLAYNRKPTAKPAV"
FT   gene            338628..339599
FT                   /locus_tag="PputW619_0324"
FT   CDS_pept        338628..339599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0324"
FT                   /product="Thymidylate synthase"
FT                   /EC_number="2.1.1.45"
FT                   /note="PFAM: thymidylate synthase; KEGG: pen:PSEEN5234
FT                   thymidylate synthase (Ts) (TSase)"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70830"
FT                   /db_xref="GOA:B1J2M6"
FT                   /db_xref="InterPro:IPR000398"
FT                   /db_xref="InterPro:IPR023451"
FT                   /db_xref="InterPro:IPR036926"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2M6"
FT                   /protein_id="ACA70830.1"
FT                   /translation="MKQYLDLVRDVIENGTLQENRTGIRTISLPGAMLRFDLQKGFPAI
FT                   TTRKLAFKSAIGEMVGFLRGVKNAGEFRELGCKVWDQNANENAQWLANPFRQGHDDLGE
FT                   IYGVQWRQWPGYKRIPLSNPAAIEMAEKAGFRRIAQDEEDGQAFVVLYKAIDQVRQCLD
FT                   TIANDPGSRRILFHGWNCAQLDEMALPPCHLLYQFHPNVQTREISLTLYIRSNDLGLGT
FT                   PFNLTEGAALLSLFGRLTGYTPRWFTYFIGDAHVYENHLDMLNEQLKREPLEAPKLVIS
FT                   DRVPAFAETGKYEPEWLEKIEPSDFSLEGYEHHAPMTAPMAV"
FT   gene            complement(339641..340084)
FT                   /locus_tag="PputW619_0325"
FT   CDS_pept        complement(339641..340084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0325"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="TIGRFAM: Cd(II)/Pb(II)-responsive transcriptional
FT                   regulator; PFAM: regulatory protein MerR; Transcription
FT                   regulator MerR DNA binding; KEGG: pen:PSEEN5233
FT                   transcriptional regulator CadR"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70831"
FT                   /db_xref="GOA:B1J2M7"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011791"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2M7"
FT                   /protein_id="ACA70831.1"
FT                   /translation="MKIGELAKATDCAVETIRYYEREQLLPEPARTDGNYRLYTQAHVE
FT                   RLTFIRNCRTLDMTLDEIRSLLRLRDSPAGSCGSVNALIDEHIEHVQARINGLVALQEQ
FT                   LVELRRRCSAQGEECAILQRLEVNGAVSVPDTEHSHVGRSHGH"
FT   gene            340167..342419
FT                   /locus_tag="PputW619_0326"
FT   CDS_pept        340167..342419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0326"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; cadmium-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; E1-E2
FT                   ATPase-associated domain protein; KEGG: pen:PSEEN5232
FT                   cadmium translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70832"
FT                   /db_xref="GOA:B1J2M8"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2M8"
FT                   /protein_id="ACA70832.1"
FT                   /translation="MNQPVSHEHVHDHDHVNAGKSHCHDAHAHSCCGSSAAPAFVQLSE
FT                   KASDQARLSRFRIQAMDCPTEQTLIQDKLGKLAGIEQLEFNLINRVLGVRHTLDGTTEI
FT                   ERAIESLGMKAEPLAVEEEGGVIAPAPAKTRWWPLALSGIAAIAAEIIHFSALAPEWVV
FT                   AALALAAILGCGLSTYKKGWIALKNRNLNINALMSIAVTGAVLIGQWPEAAMVMVLFTI
FT                   AELIEARSLDRARHAISGLMQLTPDMATVQQADGQWREAEVRHVAIGTLVRVRPGERIG
FT                   LDGEVVSGQSSVDQAPITGESLPVDKAPGDKLFAGTINQAGALEYRVTAVAGHSTLARI
FT                   IKAVEQAQGARAPTQRFVDTFSRIYTPVVFALALAVALIPPLFMAGAWFDWVYRALVLL
FT                   VVACPCALVISTPVTIVSGLAAAARKGILIKGGVYLEGGRKLDFLALDKTGTLTYGKPV
FT                   QTDTKVLDPLFEGRAQALAASLAERSDHPVSAAIAQFARAQGLALSEVSAFSALAGRGV
FT                   RGDIDGETYHLGNHRLVEELGLCSPQLEAQLDQLERQGKTVVLLLDRSGPLALFAVADT
FT                   VKESSREAIAELHALGIKTVMLTGDNAHTAQAIAAQVGIDRAEGNLLPADKLSTIEQLY
FT                   AQGHRVGMVGDGINDAPALARAEIGFAMAAAGTDTAIETADVALMDDDLRKIPAFVRLS
FT                   RQSAAILKQNIVLALGIKAIFLAITFAGMATLWMAVFADMGVSLLVVFNGLRLLRK"
FT   gene            342520..343389
FT                   /locus_tag="PputW619_0327"
FT   CDS_pept        342520..343389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0327"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="TIGRFAM: aminoethylphosphonate catabolism associated
FT                   LysR family transcriptional regulator; PFAM: regulatory
FT                   protein LysR; LysR substrate-binding; KEGG: pen:PSEEN5231
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70833"
FT                   /db_xref="GOA:B1J2M9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR017724"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2M9"
FT                   /protein_id="ACA70833.1"
FT                   /translation="MLSAELKAFYMVARLGSITLAAKKLGLSQPTVTTQIRNLESQYAV
FT                   ELFYRGGRRLVLSEEGVRLLPMVKALLQQEADIEFELRNSGHAQGNLRIAATAPYYILD
FT                   LVKIFRERLPQVGVTVEIGNSQQVLEMLEDYRVDVAASSQLVEDARLVRRVLGTDPLVV
FT                   AVHRNHPLAHRQVVSIEVVAGQCLLMREKGSTTRKLTEEMMHGAGLKAEAVLEIGSRES
FT                   IREAVLRNIGVSVIARHEVPHNSELRVLTLEDAPVMHEYLYCLKERRQARLPAAFLGVA
FT                   QEVVGSQF"
FT   gene            343507..344565
FT                   /locus_tag="PputW619_0328"
FT   CDS_pept        343507..344565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0328"
FT                   /product="2-aminoethylphosphonate ABC transport system,
FT                   ATP-binding protein component"
FT                   /note="KEGG: pen:PSEEN0267 ABC transporter, ATP-binding
FT                   protein; TIGRFAM: 2-aminoethylphosphonate ABC transport
FT                   system, ATP-binding protein component; PFAM: ABC
FT                   transporter related; Transport-associated OB domain
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70834"
FT                   /db_xref="GOA:B1J2N0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017666"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2N0"
FT                   /protein_id="ACA70834.1"
FT                   /translation="MNHATPGAQMKVRGIHKRFGAFTALNNVSLDIAAGELVCLLGPSG
FT                   CGKTTLLRCIAGLERQDRGELYIGERDISELPPQARDYGILFQSYALFPNLNVEANIAY
FT                   GLNRSGREESRQRVAEMLDLVGLAGSEKKYPGQLSGGQQQRVALARALAPSPSLLLLDE
FT                   PMSALDARVREHLCTELRQLQRQLGITTLMVTHNQDEAMLMADRIAVMNNGQVEQYATP
FT                   QEIYDQPSTPFVAEFVGQGNWLPFQRTGDSHAQVGAMSMRLAAGALRASSGRLFCRPEA
FT                   ITVNPVMHEENLFPAKVHEITFLGNRCRMSFELKALPGHPLLAELSPEAMPRLGSQDIW
FT                   VALPPQSLQVFA"
FT   gene            344567..346291
FT                   /locus_tag="PputW619_0329"
FT   CDS_pept        344567..346291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0329"
FT                   /product="2-aminoethylphosphonate ABC transport system,
FT                   permease protein"
FT                   /note="TIGRFAM: 2-aminoethylphosphonate ABC transport
FT                   system, permease protein; PFAM: binding-protein-dependent
FT                   transport systems inner membrane component; KEGG:
FT                   pen:PSEEN0268 ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70835"
FT                   /db_xref="GOA:B1J2N1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR017664"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2N1"
FT                   /protein_id="ACA70835.1"
FT                   /translation="MAAPMPLSLTQPKHTARNDVAFGDRLFVVGGKCLLLTLLLLAVLM
FT                   PLLAIFWRGFSGDAGQGGGLLAARELFASENFHWLLGNSLSVAFTVAAIVVPLAYLFAY
FT                   ALQRTLIPAKGLWRGISLLPLLAPSMLPAIALVYLFGNQGLLRGLLSDNIYGFWGIVLG
FT                   EAIYTFPHALMILLSALSLADARLFDAASSMGAGASRAFRSITWPATRQAVFAAFCLVF
FT                   TLTITDFGVPVVVGGDYQVLALEAYKAVVGQQQFGRGALIGMVLLVPALLSFAVDAWLR
FT                   RRQGEAMSGRAQVFEPKPSSGRDACYLVIVLLVCTVLVGVIGMAVYSSLVTFWPYNLTL
FT                   SFKHYMFEDTAGGGWLAYRNSVTMAIGTALIGSMVIFAGAYLMEKTQGQRLLNQALRLL
FT                   SFIPMAVPGLVLGLGYVFFFNLSGNPLHVFYGGMGLLVVCTIAHYLTTAQMTATTALRQ
FT                   LDGEFEAAALSLKAPLYKHFVRVTVPICLPALLDIIRYLFVSAMTTVSAAIFLYSPDTI
FT                   LAAVAVLNMDDAGNVGGAAAMSTLILLTSAAASLLLAGASRGLLRRSQAWRQRAPGH"
FT   gene            346322..347347
FT                   /locus_tag="PputW619_0330"
FT   CDS_pept        346322..347347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0330"
FT                   /product="2-aminoethylphosphonate ABC transport system,
FT                   1-aminoethylphosphonate-binding protein component"
FT                   /note="TIGRFAM: 2-aminoethylphosphonate ABC transport
FT                   system, 1-aminoethylphosphonate-binding protein component;
FT                   PFAM: extracellular solute-binding protein family 1; KEGG:
FT                   pen:PSEEN0269 ABC transporter, periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70836"
FT                   /db_xref="GOA:B1J2N2"
FT                   /db_xref="InterPro:IPR017663"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2N2"
FT                   /protein_id="ACA70836.1"
FT                   /translation="MFKPLALAAAVSAVFSLQASAASTQLTVYTALEAEQLKTYKLAFE
FT                   KANPDIEIKWVRDSTGIITAKLLAEKERPQADAVWGLAASSLAILDQNGMLEAYAPKDL
FT                   GKISANYRDAANPPAWVGMDVWAATICFNTIEAQKQGLSKPVSWQDLTKPEYKGKIVMP
FT                   NPASSGTGFLDVSAWLQTFGEPQGWAYMDALHQNIGQYVHSGSKPCKLAAAGEFPIGIS
FT                   FEYPAVQLKRQGAPLDIVLPKEGLGWEIEATAVIKGSPKADAAKRLADFSASPAAMELY
FT                   KENFAVLAAPGIAKPQTELPADYEQRLIKNDFAWASKNRDQILAEWRKRYDGKSEKVAQ
FT                   Q"
FT   sig_peptide     346322..346387
FT                   /locus_tag="PputW619_0330"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 22"
FT   gene            complement(347431..348795)
FT                   /locus_tag="PputW619_0331"
FT   CDS_pept        complement(347431..348795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0331"
FT                   /product="GTP-binding protein HSR1-related"
FT                   /note="PFAM: GTP-binding protein HSR1-related; KEGG:
FT                   pen:PSEEN0271 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70837"
FT                   /db_xref="GOA:B1J2N3"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR021871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2N3"
FT                   /protein_id="ACA70837.1"
FT                   /translation="MTEPLKLAVVGHTNVGKTSLLRTLTRDVGFGEVSHRPSTTRHVEG
FT                   ARLSVDGEPLLELYDTPGLEDAIALLDYLERLERPGERLDGPARLERFLQGSEARQRFE
FT                   QEAKVLRQLLASNAGLYVIDAREPVLAKYRDELEVLASCGKPLLPVLNFVASSQHREPE
FT                   WREALARLGLHALVRFDSVAPPEDGERRLYESLALLLEDARPALQRLIDDQQAQRLARQ
FT                   HSGKRLIAELLLDCAACRRSVETEPAAEAKAIEALRQDVRQREQRCVEALLKLYGFRRE
FT                   DANAGDLPLLNGRWGDDLFNPETLKLLGVRLGSGVAAGAAAGAGVDLLVGGLTLGAAAL
FT                   AGAIAGGALQTARNYGARLMGKLKGQRELTVDDTVLRLLALRQQQLMAALDTRGHAAQN
FT                   SIRLNEPDEKTWREGKLPEALSKARAHPQWSTLNPGARVNQTERQEQLEALVLQI"
FT   gene            complement(348788..350212)
FT                   /locus_tag="PputW619_0332"
FT   CDS_pept        complement(348788..350212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0332"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN0272 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70838"
FT                   /db_xref="GOA:B1J2N4"
FT                   /db_xref="InterPro:IPR021296"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2N4"
FT                   /protein_id="ACA70838.1"
FT                   /translation="MVGYACALNRAMEYPVTGHTPLDKRWLTEAVRLREEHAGPLEDQE
FT                   ANRHARQQGGDLAARIEARALFLADRDGMTTALQHWKQGARLALLALLLLAILSGAGLA
FT                   FAALGDGLRPVNVFWALGSLLGLNLLMLLGWAAGLALSGEHGASLGRLWLWLSERFARD
FT                   AKAVHLAPALLVLLQRQRLNRWLLGLLVHSLWLAAMLSALTLLLVLLATRRYGFVWETT
FT                   LLAPEPFITLTQTLGALPSLLGFAVPDEGMIRASGDTQLAVDIARQAWASWLLGVVLVY
FT                   GLLPRLLLAGLCLWRWYQGRRRLALDLSLPGYAQLRDALMPRSERIGVQDTAPEALPQF
FT                   QAGQLETGSSGALLVGLELDDQRPWPPALAKGVTDAGVLDSRESRNRLLEQLSRFPPAR
FT                   LAIACDPRRSPDRGSLALLAELARNAGATRIWLLQAAPGQVLDAERLGDWHEALDRLGL
FT                   PHADSAPMNWLEHGHD"
FT   gene            350234..350749
FT                   /locus_tag="PputW619_0333"
FT   CDS_pept        350234..350749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0333"
FT                   /product="Dihydrofolate reductase"
FT                   /EC_number="1.5.1.3"
FT                   /note="PFAM: dihydrofolate reductase region; KEGG:
FT                   pen:PSEEN0273 dihydrofolate reductase type I, trimethoprim
FT                   resistance"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70839"
FT                   /db_xref="GOA:B1J2N5"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR017925"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2N5"
FT                   /protein_id="ACA70839.1"
FT                   /translation="MTTSLPLSLIAALAENRVIGIDNTMPWHLPGDFKYFKATTLGKPI
FT                   IMGRKTWDSLGRPLPGRLNIVVSRQTGLALAGAEVFASLEDALERAEQWAREQGVDELM
FT                   LIGGAQLYAQALEKGLVSRMYLTRVELSPQGDAWFPEFDKAQWQLASSEPQTEADKPAY
FT                   HFEVWDKS"
FT   gene            complement(350784..352175)
FT                   /locus_tag="PputW619_0334"
FT   CDS_pept        complement(350784..352175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0334"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="PFAM: sodium:dicarboxylate symporter; KEGG:
FT                   pen:PSEEN0277 sodium:dicarboxylate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70840"
FT                   /db_xref="GOA:B1J2N6"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2N6"
FT                   /protein_id="ACA70840.1"
FT                   /translation="MNLPLSLNLLVFLALLLGLAQTRHTDWSLAKKVLLGLALGVGFGL
FT                   VLHTIYGAGHPVLKATIGWLDLVGNGYVGLLQMIVMPLIFASILSAVARLHNASSLGRI
FT                   SFLTIGTLLLTTAIAALIGIALTNLFGLSAEGLVAGAQESARLQAIHSDYAGKVADLNI
FT                   PQLLLSFIPSNPVGDLARAKPTSIISVVIFAVFVGLAALQLIKDDSEKGARALSAIDTL
FT                   QAWVMRLVRLVMKLTPYGVLALMTKVVASSNLDDILKLGSFVVVSYIGLGLMFVVHGII
FT                   LAATGVSPLRFLRKVWPVLTFAFTSRSSAASIPLNIEAQTRRLGVPQSIASFSASFGAT
FT                   IGQNGCAGLYPAMLAVMVAPAVGIDTFDPLWIATLVAIVTLSSAGVAGVGGGATFAALI
FT                   VLPAMGLPVELVALLISVEPLIDMGRTALNVNGSMTAGVVTSQLLKETDKDVMAGDEHA
FT                   ELSHS"
FT   sig_peptide     complement(352098..352175)
FT                   /locus_tag="PputW619_0334"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.802 at
FT                   residue 26"
FT   gene            352417..353472
FT                   /locus_tag="PputW619_0335"
FT   CDS_pept        352417..353472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0335"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN0278 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70841"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2L9"
FT                   /protein_id="ACA70841.1"
FT                   /translation="MKFAPKALAIGLSLLFSIESGATELKHWPTEAAKQLDAMIAANAN
FT                   KGNYAVFDMDNTSYRYDLEEALLPFMENKGLLTREKLDPSLKLIPFKDTAEHKESLFSY
FT                   YYRLCEIDDMVCYPWVAQVFSGFTLKELKVQVDELMASATPIPSTYFEGGKVKAIEVQP
FT                   PKVFTGQAELYNKLMENGIEVYVISAASEELVRMVASDPKYGYNVKPQNVIGVSLLLKD
FT                   RTSGHLTTARKQISEGKYDATANAGLELTPYLWTPATWMAGKQAAILTYIDEWKKPVLV
FT                   GGDTPTSDGYMQFHGVDIGKGGIHLWINRKAKYMDQLNGMIARNAAAQAKAGLPVTADK
FT                   NWVIVTPEQIQ"
FT   sig_peptide     352417..352485
FT                   /locus_tag="PputW619_0335"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.700 at
FT                   residue 23"
FT   gene            complement(353854..355695)
FT                   /locus_tag="PputW619_0336"
FT   CDS_pept        complement(353854..355695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0336"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="KEGG: pen:PSEEN0282 dihydroxy-acid dehydratase;
FT                   TIGRFAM: dihydroxy-acid dehydratase; PFAM: dihydroxy-acid
FT                   and 6-phosphogluconate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70842"
FT                   /db_xref="GOA:B1J2M0"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1J2M0"
FT                   /protein_id="ACA70842.1"
FT                   /translation="MPDYRSKTSTQGRNMAGARALWRATGMKDEDFKKPIIAIANSFTQ
FT                   FVPGHVHLKDLGQLVAREIERAGGVAKEFNTIAVDDGIAMGHDGMLYSLPSREIIADAV
FT                   EYMVNAHCADAIVCISNCDKITPGMLMAALRLNIPVIFVSGGPMEAGKTKLASHGLDLV
FT                   DAMVIAADSSASDEKVAEYERSACPTCGSCSGMFTANSMNCLTEALGLALPGNGSTLAT
FT                   HADREQLFLTAGRTIVELCKRYYGENDDSVLPRSIANFKAFENAMMLDIAMGGSTNTIL
FT                   HLLAAAQEGEVAFDLRDIDRLSRKVPQLCKVAPNIQKYHMEDVHRAGGIFSILGSLARG
FT                   GLLHTDLPTVHSRSMEEAIAKWDITQTDDEAVHTFFKAGPAGIPTQTAFSQSTRWETLD
FT                   DDRENGCIRSFEHAYSQEGGLAVLYGNIALDGCVVKTAGVDESIHVFEGNAKIFESQDS
FT                   AVRGILADEVKAGDIVIIRYEGPKGGPGMQEMLYPTSYLKSKGLGKACALLTDGRFSGG
FT                   TSGLSIGHASPEAAAGGAIGLVRDGDKVLIDIPNRSINLQVSDEELAARRVEQDKKGWK
FT                   PAEVRPRKVTTALKAYALLATSADKGAVRNKAMLEGL"
FT   gene            356175..357230
FT                   /locus_tag="PputW619_0337"
FT   CDS_pept        356175..357230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0337"
FT                   /product="MgtE integral membrane region"
FT                   /note="PFAM: CBS domain containing protein; MgtE integral
FT                   membrane region; KEGG: noc:Noc_1785 divalent cation
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70843"
FT                   /db_xref="GOA:B1J2M1"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2M1"
FT                   /protein_id="ACA70843.1"
FT                   /translation="MQHTSDFVVSPLDLRQAAQARRDCLLHPEGYPEGTAGYLMTSEYS
FT                   CLDAGLTASQAIDMLRREAADAETIYQSYVLDEKRNLLGTLSLRELILAAPEQPIEQFM
FT                   VRKVICVCTSTRQEEVARLIREHDLLAVPVLDEAGRLVGLVTCDDALDVVVEEATEDFH
FT                   KGASITNHVGNLRDATVSLLYRKRVLWLVLLVFGNLFSGAGIAAFEETIAAHIVLVFFL
FT                   PLLVDSGGNAGAQSATLMVRGLATGEVVMRDWLRMLARECAVALALGGTMAVAVASLGA
FT                   LRGGADVALIVASSMLVIVLLGSLIGMSLPFMFTRLKLDPATASGPLVTSIADAAGVLV
FT                   YFGIASYVLDI"
FT   gene            complement(357270..358466)
FT                   /locus_tag="PputW619_0338"
FT   CDS_pept        complement(357270..358466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0338"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN0284 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70844"
FT                   /db_xref="GOA:B1J2M2"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041532"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2M2"
FT                   /protein_id="ACA70844.1"
FT                   /translation="MSLPSLRLKANADRRLRAGHLWVYSNEVDVTATPLQGFQAGQQAI
FT                   LEAANGKPLGIVALSPNNLICARLLSRDAKLPLDKSLLVHRLNVALSLRQRLFDQPCYR
FT                   LVYGDSDLLPGLVVDRFFDILVVQLASATMELHKDDVIAALVQVLKPSGILFKNDSAAR
FT                   DAEGLQRYVETVYGEVPDWVPLEENGVKFEAPVREGQKTGWFYDHRMNRARLAPYVKGK
FT                   RVLDLFSYIGGWGVQAGAFGASEVFCVDASGFALDGVERNAALNGISEKLTCIEGDVFE
FT                   ALRELKAAEERFDVIIADPPAFIKRKKDLKNGEAAYRRLNEQAMRMLTKDGILVSASCS
FT                   MHLPEDDLNNILLTSARHLDRNLQLLERGGQGPDHPVHPAIAETRYIKSITCRLLPNS"
FT   gene            358622..359494
FT                   /locus_tag="PputW619_0339"
FT   CDS_pept        358622..359494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0339"
FT                   /product="putative signal transduction protein"
FT                   /note="PFAM: Metal-dependent hydrolase HDOD; KEGG:
FT                   pen:PSEEN0286 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70845"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2M3"
FT                   /protein_id="ACA70845.1"
FT                   /translation="MSQELSAEQIQQALQGITIPPQPQIMVDLQFEQYMPDPDLETIAK
FT                   LISQDPGLSGALLKLVNSPHFGLSNKIGSIQRAVNLLGSRSIINLINAQSIKGEMSDET
FT                   IVTLNRFWDTAQDVAMTCLTLAKRTGIQAADEAYTLGLFHDCGVPLMLKRFPNYMDVLE
FT                   EAYAKADAQTRVVDTENRAFNTNHSVVGYFTAKSWRLPEHISAAIANHHNALAVFREES
FT                   PRNTQSQLKNLLAVLKMAEHICASCRVLGNQHVDHEWNAVGPLVLDYIGLSEYDFENLK
FT                   QTIRELGGH"
FT   gene            359498..360310
FT                   /locus_tag="PputW619_0340"
FT   CDS_pept        359498..360310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0340"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /note="KEGG: pen:PSEEN0287 formamidopyrimidine-DNA
FT                   glycosylase; TIGRFAM: formamidopyrimidine-DNA glycosylase;
FT                   PFAM: Formamidopyrimidine-DNA glycosylase catalytic domain
FT                   protein; Formamidopyrimidine-DNA glycolase, H2TH DNA
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70846"
FT                   /db_xref="GOA:B1J2M4"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1J2M4"
FT                   /protein_id="ACA70846.1"
FT                   /translation="MPELPEVETTRRGIAPHLEGQRVSRVVVRDRRLRWPIPEDLDVRL
FT                   SGQRILSVERRAKYLLINAEVGTLISHLGMSGNLRLVQLGLPAAKHEHVDIELESGLML
FT                   RYTDPRRFGAMLWSLDPLNHELLLRLGPEPLTDLFDGERLFQLSRGRTMAVKPFIMDNA
FT                   VVVGVGNIYATEALFAAGIDPRREAGGISRTRYLKLAIEIKRVLAAAIEQGGTTLRDFI
FT                   GGDGQPGYFQQELFVYGRGGMPCKLCGTTLREAKLGQRASVYCPRCQR"
FT   gene            complement(360369..360620)
FT                   /locus_tag="PputW619_0341"
FT   CDS_pept        complement(360369..360620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0341"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: pen:PSEEN0289 ferredoxin 4Fe-4S"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70847"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2M5"
FT                   /protein_id="ACA70847.1"
FT                   /translation="MSLIITDDCINCDVCEPECPNEAISQGEEIYVIDPNLCTQCVGHY
FT                   DEPQCQQVCPVDCIPLDEAHPETEEQLMAKYRRITGKA"
FT   gene            complement(360728..361207)
FT                   /locus_tag="PputW619_0342"
FT   CDS_pept        complement(360728..361207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0342"
FT                   /product="pantetheine-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /note="KEGG: pen:PSEEN0290 phosphopantetheine
FT                   adenylyltransferase; TIGRFAM: pantetheine-phosphate
FT                   adenylyltransferase; cytidyltransferase-related domain
FT                   protein; PFAM: cytidylyltransferase; Citrate lyase ligase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70848"
FT                   /db_xref="GOA:B1J2E9"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1J2E9"
FT                   /protein_id="ACA70848.1"
FT                   /translation="MNRVLYPGTFDPITKGHGDLVERASRLFDHVIIAVAASPKKNPLF
FT                   PLEQRVALAREVTKHLPNVEVIGFSTLLAHFAKEQGANVFLRGLRAVSDFEYEFQLANM
FT                   NRQLAPEVESLFLTPSERYSFISSTLVREIAALGGDITKFVHPVVAEALTERFKK"
FT   gene            complement(361319..362917)
FT                   /locus_tag="PputW619_0343"
FT   CDS_pept        complement(361319..362917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0343"
FT                   /product="glucose-methanol-choline oxidoreductase"
FT                   /note="PFAM: glucose-methanol-choline oxidoreductase; FAD
FT                   dependent oxidoreductase; GMC oxidoreductase; KEGG:
FT                   pen:PSEEN0291 oxidoreductase, GMC family"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70849"
FT                   /db_xref="GOA:B1J2F0"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2F0"
FT                   /protein_id="ACA70849.1"
FT                   /translation="MPVIDPFRQGLERGWITHDGSRLEQDLSLQADIAVIGSGAGGATS
FT                   AQMLSAAGLKVLLIEEGPLKTSSDFHLLENEAYASLYQEGLGRMSKDGAITILQGRAVG
FT                   GTTLVNWTSSFRTPAPTLAHWATAHNVKGLDKDALRPWFERIEQDLGITPWAVPPNANN
FT                   DVLRRGCEQLGYRWAVIARNVRGCWNLGYCGMGCPVNAKQSMLVTRIPAMLDKGGELLY
FT                   LARAERFEHDGERIEHLRCQGLDARGIHTNGRSITVRARHYILAGGGINSPALLLRSKA
FT                   PDPHQCLGKRTFLHLVNFSAARFEARIDPYYGAPQSIYSDHFQWQDGVDGAVGYKLEVP
FT                   PLHPALASTLLGGDGVENALRMAELPHTHVMLALLRDGFHPESPGGTVELRGDGSPVLD
FT                   YQVTDYLRDGLRRAFHSMAQIQFAAGATQVTPAHSSACAATSLAQAQRMIDGLQLEPFH
FT                   TRLGSAHVMGGCAMGEDPRHAVCDSLGRHHQLENLSIHDGSLFPTSIGANPQLSVYAIS
FT                   AKLTDALLSRLAQSA"
FT   gene            complement(362939..363424)
FT                   /locus_tag="PputW619_0344"
FT   CDS_pept        complement(362939..363424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0344"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN0292 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70850"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2F1"
FT                   /protein_id="ACA70850.1"
FT                   /translation="MQRREFMRFSLGASVFLASASLVGCSPQAPASGYHVLREDDLPLL
FT                   RALIPVVLAGTSASAVLVLPTLDDKLAALSPQMLKLTRQLFDVLSLPLTRGPLTGVWGA
FT                   WEQAGEPQITAFLQRWQDSSLNLLRMGHSSIVQLLTMAWYERPESWAACGYPGPPKI"
FT   sig_peptide     complement(363350..363424)
FT                   /locus_tag="PputW619_0344"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.931 at
FT                   residue 25"
FT   gene            complement(363435..364877)
FT                   /locus_tag="PputW619_0345"
FT   CDS_pept        complement(363435..364877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0345"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: pen:PSEEN0293
FT                   coniferyl aldehyde dehydrogenase (CALDH)"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70851"
FT                   /db_xref="GOA:B1J2F2"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2F2"
FT                   /protein_id="ACA70851.1"
FT                   /translation="MRAAVTSPIAVPPLQSDIDLAATFATQRKAFAGNPMPPLAQRRQW
FT                   LKSLREALLADQQRLIEAIDTDFSGRSADETLLAELLPSVQGIRHAERHLKRWMRPARR
FT                   TVGLAFQPAIARVLYQPLGVVGIIVPWNYPLFLAIGPLTCALAAGNRVMLKLSEATPAS
FT                   ALALKTLLEQVFPHDLVSVVLGEVEVGQAFARLPFDHLLFTGATSVGRQVMLAAAQNLT
FT                   PVTLELGGKSPAIVSSSVPLDSAAERIAFGKTLNAGQTCVAPDYVLVPRERLIAFSDAY
FT                   RRAVHRFYPRIADNPDYSAIINPRQLQRLQHLADDASSKGAQIIDLYPDEPRQGRRLPP
FT                   QLLLEVNDSMQVMQDEIFGPLLPVIPYDSIDDALDYINERPRPLALYYFGYDRAEQEHV
FT                   LQHSHSGGVCLNDTLLHVAQDDLPFGGIGPSGMGHYHGHDGFLTFSKAKAVLAKQRLNA
FT                   ARLIYPPYGKALQRLVYKLFIR"
FT   gene            365017..365682
FT                   /locus_tag="PputW619_0346"
FT   CDS_pept        365017..365682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0346"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: pen:PSEEN0294
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70852"
FT                   /db_xref="GOA:B1J2F3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025722"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2F3"
FT                   /protein_id="ACA70852.1"
FT                   /translation="MAPRMKTRERIVQNSLELFNQQGERSVSTNHIAAHMEISPGNLYY
FT                   HFPNKQAIIALLFSQYEELVDSFLRPPQGRAATVEDKRFYLKALLAAMWNYRFLHRDLE
FT                   HLLDSDPELAARYRRFSERCLRQGQAIYRGFVEAGILVMAPAQIESLTINAWIVLTSWV
FT                   RFLSTTREHSAHLGEEAFKRGVYQVLVLELGFVTASARSAVDALCQEFHVPFNQALER"
FT   gene            365718..366572
FT                   /locus_tag="PputW619_0347"
FT   CDS_pept        365718..366572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0347"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: pen:PSEEN0295
FT                   thiosulfate sulfurtransferase (rhodanese-like protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70853"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2F4"
FT                   /protein_id="ACA70853.1"
FT                   /translation="MPLAQLITPQQLAERLGSPKLVILDCRFALEDVDYGQRSYAEGHI
FT                   AGAHFADLERDLSGPVSKGKTGRHPLPDPQRLVERLREWGLDNDSEVVLYDDGPGAFAA
FT                   RAWWLLAWLGNRTGVAMLDGGLKAWHTAGQPLSLDAPARYEGTFNGEPDTKLLIDAEHL
FT                   VTELASPELTLIDARALPRFRGDVEPIDPVAGHIPGAQCAAFTDNLGEDGRFLAPEQLR
FT                   QRFAEKLAGRSPEHLVAYCGSGVTACHNLFALALAGYPLGRLYAGSWSEWINEPTRQVA
FT                   TGD"
FT   gene            complement(366582..367574)
FT                   /locus_tag="PputW619_0348"
FT   CDS_pept        complement(366582..367574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0348"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: pen:PSEEN0296
FT                   hydrolase, alpha/beta superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70854"
FT                   /db_xref="GOA:B1J2F5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR012020"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2F5"
FT                   /protein_id="ACA70854.1"
FT                   /translation="MPSLPATFRPATGLSNPHLQTLWGPLWRKLPALERKRERLWLADG
FT                   DFMDLDWHGPHQPDTPLVLVLHGLTGSSHSPYVKGLQQALNARGWASVALNWRGCSGEP
FT                   NLLARSYHSGASGDLAEVVAHLRAQRPLAPLYAVGYSLGGNVLLKYLGESGSASQLQAA
FT                   VAVSVPFRLDQCADRIGQGFSKVYQAHFMREMMAYVQVKQRHFRAQGRHEGLAALDRLG
FT                   SLRKLRTFWDFDGKVTAPLNGFDDVHDYYRRSSSRYYLGENRTPTLIIHANDDPFVSRH
FT                   SQPTASELTPQTQFELHERGGHVGFVEGSLRNPGYYLERRIPQWLVDGR"
FT   gene            complement(367646..369040)
FT                   /locus_tag="PputW619_0349"
FT   CDS_pept        complement(367646..369040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0349"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   psa:PST_3994 predicted Zn-dependent peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70855"
FT                   /db_xref="GOA:B1J2F6"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2F6"
FT                   /protein_id="ACA70855.1"
FT                   /translation="MNKPLTTSSMPLICKGPMTDTAVAAMARLESTQGLDLEQHQPLPA
FT                   QIQQWQTDEGAKVSFTPSHDRPIFDLALRFRAGSALDGNRPGLAALVLYSLDQGTEGLD
FT                   AAQFAQAIEGLGAIMARQMNQDEAVITLRCLSLPALRTSALQLLTQMLARPAFREEAVA
FT                   GIRERLLNYLGAMASTPVFGMSHATMSHVFDGHPYATHWAGTPESLNQIDEQQLRDFHR
FT                   RAYSANNLDIGLVGDLSRDEAQTLITELLQALPQHWAGQPPPPAPLPEALTRHQEHTAS
FT                   TTRATLTLLLPISPDKPGYAALTMLDEILGSGFESRLTQELRSRRTLTYTIRSSLKPFD
FT                   AASLLQIEWDIAPEYRDASRELVSGMLACLREHGPSQAECDMACNQIAGRLHRTMVSNA
FT                   ELAESLATSSHLGQPADHFATYIQSLAALTPKDIREAARVWLSPAQEVFITVGPSHAQK
FT                   SLPELS"
FT   gene            complement(369037..370380)
FT                   /locus_tag="PputW619_0350"
FT   CDS_pept        complement(369037..370380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0350"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   pmy:Pmen_4176 peptidase M16 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70856"
FT                   /db_xref="GOA:B1J2F7"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2F7"
FT                   /protein_id="ACA70856.1"
FT                   /translation="MPSTPPFTLDDKTLSAGIESIADATQPSLQHFTLDNGLSVYLRED
FT                   HSTPLAAIQLWYHVGTSHEPAGHTNLSHLLEHLIFEGSRKLEAGRYTQVIARLGGEANA
FT                   TTTDDATAYDVLLPAARLPIALEIMADAMTGATFGQAEMERAVKAIEDERRLKVENVPA
FT                   QQAAERHMALAHGGSPYATATFGNPSDLSNLRLDMVRTWYQTWYRPNNATLVVVGAVDL
FT                   PTLRQHVSRYFASIARASLGAVPVPRHDAHLQERSQKLELPGLRDGLFMSFNVPSHATA
FT                   IDASTVPALGLLCEVLGKGFSARLYSELVRDQRLLKGIGLSYEPIARGDTLLTLSTYIN
FT                   SQRSTHEHAVEAIYALIDTLRHTLLSPQELERAKLRMLTRRLFSRDSITLQAERIGAGA
FT                   AAGLSTSLIDQEAESVRHLDSATLRQVAFDYLSRERLTITHLQTGAAA"
FT   gene            complement(370466..371068)
FT                   /locus_tag="PputW619_0351"
FT   CDS_pept        complement(370466..371068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0351"
FT                   /product="methyltransferase"
FT                   /note="TIGRFAM: methyltransferase; PFAM: conserved
FT                   hypothetical protein; KEGG: pen:PSEEN0297
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70857"
FT                   /db_xref="GOA:B1J2F8"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2F8"
FT                   /protein_id="ACA70857.1"
FT                   /translation="MPRSTPPARPQQGQSKGQGHLRIIAGEWRSRRLAVPEGEGLRPTT
FT                   DRVRETLFNWLAPYIEGARVLDAFTGSGALVLEALSRGAADAVALDSNAAAINNLKNNL
FT                   EILRCPRGQILQTDAQRYLQAPAKQQFDVVFLDPPFHQDLLANTCNLLEQNQWLREQAW
FT                   IYTESEAAPSTLQMPGNWRLHREKKTGQVHYALWQRA"
FT   gene            complement(371068..372552)
FT                   /locus_tag="PputW619_0352"
FT   CDS_pept        complement(371068..372552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0352"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   pen:PSEEN0298 zinc-dependent peptidase, M16 family"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70858"
FT                   /db_xref="GOA:B1J2F9"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2F9"
FT                   /protein_id="ACA70858.1"
FT                   /translation="MSDRSAPRYTLIGTGIIALVVALTCVLARPAHAEADSTAARPANT
FT                   LQSLAELDGKAPSRRQLNIQNWTTAEGARVLFVEARELPMFDLRVTFAAGSSQDGNTPG
FT                   LATLTNAMLNEGVAGKDVTAIAEGFEGLGADFGNGSYRDMAVASLRSLSVKDKREPALK
FT                   LFAEVAGKPTFPEDALKRIKNQLLAGFEYEKQNPGKIAGKALFGKLYGEHPYAHPSDGS
FT                   AESIPGITLEQLRAFHAKAYAAGNAVIALVGDLSREEAETIAAQVSAALPKGPALAKPA
FT                   QPVEPKAGATHIDFPSKQTHLMLAELGIDRQDPDWPALSLGNQILGGGAFGTRLMSEVR
FT                   EKRGLTYGVYSVFSPMQVRGPFMINLQTRAELSEGTLKLVQGILADYLKSGPTQQELDD
FT                   AKRELAGSFPLSNASNASIVGQLGAIGFYNLPLTWLEDFMQQSQALTVEQVKAAMNKHL
FT                   AADKLVIVTVGPSVPQKPLPAPTDKPAEQPLGVPEH"
FT   sig_peptide     complement(372451..372552)
FT                   /locus_tag="PputW619_0352"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.996 at
FT                   residue 34"
FT   gene            complement(372545..373900)
FT                   /locus_tag="PputW619_0353"
FT   CDS_pept        complement(372545..373900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0353"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   pen:PSEEN0299 zinc-dependent peptidase, M16 family"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70859"
FT                   /db_xref="GOA:B1J2G0"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2G0"
FT                   /protein_id="ACA70859.1"
FT                   /translation="MNALARRAAGLLLSTLCLPLAAFAADAQPTHEFILDNGLKVVVRE
FT                   DHRAPVVVSQIWYKVGSSYETPGQTGLSHALEHMMFKGSAKVGPGEASRILRDLGAEEN
FT                   AFTSDDYTAYYQVLARDRLPVALELEADRLASLRLPADEFSREIEVIKEERRLRTDDQP
FT                   SAKAFELFRAMAYPASGYHTPTIGWMADLERMKVEELRHWYESWYAPNNATLVVVGDIT
FT                   AAEVKGLAQKYFGSIPKRAVPAAKLPLELAEPGRRQLTLHVRTQLPSLIYGFNVPGLAT
FT                   AKDPRTAHALRLISALLDGGYSARLPARLERGQELVAGASSSYNAFTRGDSLFLISATP
FT                   NVQKQKTLADVEKGVWQLLDELKTTPPSAEELERVRAQVIAGLVYDRDSISSQATTIGQ
FT                   LETVGLSWKLIDSELDELKRVTPEDIQAAARTYFTRERLSVAHVLPEESAHE"
FT   sig_peptide     complement(373826..373900)
FT                   /locus_tag="PputW619_0353"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.972 at
FT                   residue 25"
FT   gene            374133..375677
FT                   /locus_tag="PputW619_0354"
FT   CDS_pept        374133..375677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0354"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /note="KEGG: pen:PSEEN0300 cell division protein FtsY;
FT                   TIGRFAM: signal recognition particle-docking protein FtsY;
FT                   PFAM: GTP-binding signal recognition particle SRP54 G-
FT                   domain; GTP-binding signal recognition particle SRP54
FT                   helical bundle; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70860"
FT                   /db_xref="GOA:B1J2G1"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2G1"
FT                   /protein_id="ACA70860.1"
FT                   /translation="MFGSNDDKKAPAEAGEKKGLFSWFRKKPQQPVAEQPQAPDAQAVE
FT                   PVSPQPAAEQPEAAAAEPVVAEAPPSAAEPVLAPQPAPVVEPAPAPEVEPAPEPAPAPE
FT                   VAPVPEPAPAPEPVPVPEPAPAPVSAELPASAEPAAAQLESPAPVAAAPEAPVSNLVLP
FT                   VAEEPVALVPDLEPKAPPAIPERPAPEQAVAAATPAVAEPAKPGFFARLKQGLSKTSAS
FT                   IGEGMASLFLGKKVIDDDLLDEIETRLLTADVGVEATSTIVQNLTQKVARKQLADADAL
FT                   YKSLQEELAALLRPVEQPLKIQAQNKPYVILVVGVNGAGKTTTIGKLAKKLQLEGKKVM
FT                   LAAGDTFRAAAVEQLQVWGERNQIPVIAQHTGADSASVIFDAVQAAKARGVDVLIADTA
FT                   GRLHTKDNLMEELKKVRRVIGKLDAEAPHEVLLVLDAGTGQNAISQAKYFNQSVELTGL
FT                   ALTKLDGTAKGGVIFALAKQFNIPIRFIGVGEGIDDLRTFEAEPFVKALFAEREHP"
FT   gene            375674..376345
FT                   /locus_tag="PputW619_0355"
FT   CDS_pept        375674..376345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0355"
FT                   /product="cell division ATP-binding protein FtsE"
FT                   /note="KEGG: pen:PSEEN0301 cell division ATP binding
FT                   protein FtsE; TIGRFAM: cell division ATP-binding protein
FT                   FtsE; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70861"
FT                   /db_xref="GOA:B1J2G2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2G2"
FT                   /protein_id="ACA70861.1"
FT                   /translation="MIRFEQVAKRYPNGHVGLHELSFRARRGEFLFVTGHSGAGKSTLL
FT                   RLLLAMERPTSGKLMLAGQDLGQISNAQIPFLRRQIGVVFQNHQLLFDRTVFNNIALPL
FT                   QILGLSKAEITKRVDSALERVSLVDKGELFPADLSTGQQQRVGIARAIVHQPALLLADE
FT                   PTGNLDPRLAAEIMGVFEDINRLGTTVLIASHDLALIARMRHRMLTLQRGRLIGDGEAG
FT                   Q"
FT   gene            376342..377367
FT                   /locus_tag="PputW619_0356"
FT   CDS_pept        376342..377367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0356"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   pen:PSEEN0302 cell division protein FtsX"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70862"
FT                   /db_xref="GOA:B1J2G3"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2G3"
FT                   /protein_id="ACA70862.1"
FT                   /translation="MSTTRTPKVSERVAPKAADADTRKKRGEHDDDGPDFRTLLHAWLD
FT                   SHRASLADSLRRLGKQPIGSFFTCLVMAVALSMPMGLSLLLKNVEKLGGSWQRAAQVSL
FT                   YLKLDAGSKEGEALREEIKGMPGVADALYISPGQALEEFQQQSGLGEALRELPDNPLPG
FT                   VVVVTPTEVDKPALEALRQRLAELPRVENAQLDLVWVERLAAILKLGDRFVFGLAVMLI
FT                   SALLLVIGNTIRLHIENRRTEIEVIKLVGGTDSYVRRPFLYMGALYGLGAGLLAWGILA
FT                   FGLNWLNEAVVGLSGLYGSDFSLGGVPASDGLSLLIGAVLLGYIGAWIAVARHLNELAP
FT                   R"
FT   gene            377479..378333
FT                   /locus_tag="PputW619_0357"
FT   CDS_pept        377479..378333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0357"
FT                   /product="RNA polymerase, sigma 32 subunit, RpoH"
FT                   /note="TIGRFAM: RNA polymerase sigma factor RpoH; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   region 2 domain protein; sigma-70 region 4 domain protein;
FT                   KEGG: pen:PSEEN0303 sigma H (sigma 32) factor of RNA
FT                   polymerase RpoH"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70863"
FT                   /db_xref="GOA:B1J2G4"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2G4"
FT                   /protein_id="ACA70863.1"
FT                   /translation="MTTSLQPAYALVPGANLEAYVHTVNSIPLLTVEQERDLAERLYYE
FT                   QDLEAARQMVMAHLRFVVHIARSYAGYGLAQADLIQEGNVGLMKAVKRFNPEMGVRLVS
FT                   FAVHWIKAEIHEFILRNWRIVKVATTKAQRKLFFNLRSQKKRLAWLNNDEVHRVAESLG
FT                   VEPREVREMESRLSGQDMAFDPAAEADDDSAFQSPAHYLEDHRYDPAVQLEDADWSDNS
FT                   TSNLHEALQGLDERSRDILYQRWLAEEKATLHELADKYSVSAERIRQLEKNAMNKVKAL
FT                   IAA"
FT   gene            complement(378446..379156)
FT                   /locus_tag="PputW619_0358"
FT   CDS_pept        complement(378446..379156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0358"
FT                   /product="monofunctional biosynthetic peptidoglycan
FT                   transglycosylase"
FT                   /note="TIGRFAM: monofunctional biosynthetic peptidoglycan
FT                   transglycosylase; PFAM: glycosyl transferase family 51;
FT                   KEGG: pen:PSEEN0304 peptidoglycan transglycosylase,
FT                   biosynthetic"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70864"
FT                   /db_xref="GOA:B1J2G5"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR011812"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1J2G5"
FT                   /protein_id="ACA70864.1"
FT                   /translation="MLSSLLRRLARALFWFAAGSIVLVLVFRWVPPPGTALMVERKVQS
FT                   WVSGEPIDLQRDWQPWESISDDLKVAVIAGEDQKFANHWGFDIPAIQAALAYNERGGNI
FT                   RGASTLTQQVAKNLFLWSGRSWLRKGLEAWFTALIELFWSKERILEVYLNSAEWGKGVF
FT                   GAQAAARYHFGIDASRLSRQQAAQLAAVLPSPIKWSASRPSAYVASRAGWIRRQMSQLG
FT                   GPSYLMQLDASRRP"
FT   gene            379221..379592
FT                   /locus_tag="PputW619_0359"
FT   CDS_pept        379221..379592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0359"
FT                   /product="protein of unknown function DUF423"
FT                   /note="PFAM: protein of unknown function DUF423; KEGG:
FT                   pen:PSEEN0305 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70865"
FT                   /db_xref="GOA:B1J2G6"
FT                   /db_xref="InterPro:IPR006696"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2G6"
FT                   /protein_id="ACA70865.1"
FT                   /translation="MLRTFLMLAAFFGFTGVGLGAFAAHGLKNRLSADYLAIFQTGVTY
FT                   QLVHALAIFGVALLAAHLPGRLVGWAGGLFALGIVLFSGSLYLLTLSGLGKLGIITPIG
FT                   GLCFLAGWVCLGMAAWRLG"
FT   sig_peptide     379221..379292
FT                   /locus_tag="PputW619_0359"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.930 at
FT                   residue 24"
FT   gene            379696..379896
FT                   /locus_tag="PputW619_0360"
FT   CDS_pept        379696..379896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0360"
FT                   /product="thiamine biosynthesis protein ThiS"
FT                   /note="TIGRFAM: thiamine biosynthesis protein ThiS; PFAM:
FT                   thiamineS protein; KEGG: pen:PSEEN0306 thiamine
FT                   biosynthesis protein ThiS"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70866"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2G7"
FT                   /protein_id="ACA70866.1"
FT                   /translation="MRIQLNGEPYELPAGESVAALLTRLELTGRRVAVELNLDIVPRSQ
FT                   HDSTQLNDGDQVEVVHAIGGG"
FT   gene            379951..380745
FT                   /locus_tag="PputW619_0361"
FT   CDS_pept        379951..380745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0361"
FT                   /product="thiazole biosynthesis family protein"
FT                   /note="PFAM: thiazole biosynthesis family protein; KEGG:
FT                   pfl:PFL_5850 thiazole synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70867"
FT                   /db_xref="GOA:B1J2G8"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1J2G8"
FT                   /protein_id="ACA70867.1"
FT                   /translation="MSNVRSDKPFTLAGRTFQSRLLVGTGKYRDMEETRLAIEASGAEI
FT                   VTVAVRRTNLGQNPGEPNLLDVLPPDRYTILPNTAGCYDAVEAVRTCRLARELLDGHNL
FT                   VKLEVLADQKTLFPNVIETLKAAEVLVKDGFDVMVYTSDDPIIARQLAEAGCIAVMPLA
FT                   GLIGTGLGICNPYNLQIILEESKVPVLVDAGVGTASDATIAMEMGCEAVLMNSAIAHAQ
FT                   QPVLMAEAMKHAIVAGRMAYLAGRMPKKLYASASSPLDGLIK"
FT   gene            380755..381477
FT                   /locus_tag="PputW619_0362"
FT   CDS_pept        380755..381477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0362"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /note="KEGG: pen:PSEEN0308
FT                   tRNA(guanine-7)methyltransferase; TIGRFAM: tRNA
FT                   (guanine-N(7)-)-methyltransferase; PFAM: putative
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70868"
FT                   /db_xref="GOA:B1J2G9"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1J2G9"
FT                   /protein_id="ACA70868.1"
FT                   /translation="MTESQDTPITTDGEARPHRRIKSFVMRAGRMTEGQQRGLDQGGPL
FT                   YILPLAESPVDYDQVFGRSAPRTLEIGFGMGHSLLEMAAAAPEQDFIGVEVHRPGVGAL
FT                   LNGVLTEGLKNLRVYDCDAIEVLNRCVADNSLDRLMLFFPDPWHKARHHKRRIVQLEFA
FT                   ELVRRKLKPGGIFHMATDWEPYAEYMLEVMSAAPGYRNLAADGAYVPRPEERPITKFER
FT                   RGERLGHGVWDLKFEKVG"
FT   gene            complement(381647..381973)
FT                   /locus_tag="PputW619_0363"
FT   CDS_pept        complement(381647..381973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0363"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN0310 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70869"
FT                   /db_xref="GOA:B1J2H0"
FT                   /db_xref="InterPro:IPR021813"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2H0"
FT                   /protein_id="ACA70869.1"
FT                   /translation="MDLVLDLLATVSRWSRSNLSEISLALVGCLLVLFGTDIKGWVEQR
FT                   LGGLAGALRVPFMALLVMIGSGAALIYATPWVVKGLSQFNNYALAPVLLVVLVLIGVVA
FT                   DRRG"
FT   gene            complement(381983..383170)
FT                   /locus_tag="PputW619_0364"
FT   CDS_pept        complement(381983..383170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0364"
FT                   /product="oxygen-independent coproporphyrinogen III
FT                   oxidase"
FT                   /EC_number="1.3.98.3"
FT                   /note="KEGG: pen:PSEEN0311 oxygen-independent
FT                   coproporphyrinogen III oxidase; TIGRFAM: oxygen-independent
FT                   coproporphyrinogen III oxidase; PFAM: Radical SAM domain
FT                   protein; HemN domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70870"
FT                   /db_xref="GOA:B1J2H1"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2H1"
FT                   /protein_id="ACA70870.1"
FT                   /translation="MIELLSTQPRQPGVAGFATLPPLALYIHIPWCVRKCPYCDFNSHA
FT                   AGPDLPEEAYVDALLTDLDQELPAVQGRPISSIFFGGGTPSLFSANALGRLLRGVEQRI
FT                   PFEPDIEITLEANPGTFEQEKFKAYRQTGINRLSIGVQSFQPAKLQALGRIHNGDEAIR
FT                   AAGMARAAGFDNFNMDLMHGLPDQSLNDALGDLRQAIDLGPTHLSWYQLTVEPNTVFWN
FT                   QPPELPEDDILWDIQEAGQALMAAHGYKQYEVSAYAQPGRAAKHNLNYWCFGDFIGIGA
FT                   GAHGKQTFADGRILRTWKTRLPKDYLNLAKPFKAGEKLLPVDELPFEFLMNALRLTDGV
FT                   EAELFSQRTGLPLVQLAEARRAAEQKGLLQVEPDRLVATPRGQLFLNDLLQYFLT"
FT   gene            complement(383167..383763)
FT                   /locus_tag="PputW619_0365"
FT   CDS_pept        complement(383167..383763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0365"
FT                   /product="non-canonical purine NTP pyrophosphatase,
FT                   rdgB/HAM1 family"
FT                   /note="TIGRFAM: non-canonical purine NTP pyrophosphatase,
FT                   rdgB/HAM1 family; PFAM: Ham1 family protein; KEGG:
FT                   pen:PSEEN0312 non-canonical purine NTP pyrophosphatase
FT                   RdgB"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70871"
FT                   /db_xref="GOA:B1J2H2"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2H2"
FT                   /protein_id="ACA70871.1"
FT                   /translation="MMNLQQLVLASHNAGKLKELQAMLGQAVQLRSIGEFSQVEPEETG
FT                   LSFVENAILKARNAARISGLPALADDSGLAVDFLGGAPGIYSARYADGKGDAANNAKLL
FT                   EALKDVPQDQRGAQFVCVLALVRHADDPLPILCEGLWHGRIMCEASGEQGFGYDPLFWV
FT                   PERNCSSADLAPADKNQLSHRARAMALLRQRLGLA"
FT   gene            complement(383760..384194)
FT                   /locus_tag="PputW619_0366"
FT   CDS_pept        complement(383760..384194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0366"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN0313 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70872"
FT                   /db_xref="InterPro:IPR025218"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2H3"
FT                   /protein_id="ACA70872.1"
FT                   /translation="MRRLALFLISLCLALPVLAADAAKPERKEVFGDVTVHYSAFTSSM
FT                   LQPDVAAATGLVRSKNQGVLNIAVLKASKPAMAVVSGTVKDLTGRSNPLSFKQITDRGA
FT                   IYYIAQFKIEQAETLTFDLNVETGGVSHKLSFNQEVFPGE"
FT   sig_peptide     complement(384135..384194)
FT                   /locus_tag="PputW619_0366"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.987 at
FT                   residue 20"
FT   gene            complement(384217..384837)
FT                   /locus_tag="PputW619_0367"
FT   CDS_pept        complement(384217..384837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0367"
FT                   /product="methionine biosynthesis protein MetW"
FT                   /note="TIGRFAM: methionine biosynthesis protein MetW; PFAM:
FT                   Methionine biosynthesis MetW protein; Methyltransferase
FT                   type 11; Methyltransferase type 12; KEGG: pen:PSEEN0314
FT                   methionine biosynthesis protein MetW"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70873"
FT                   /db_xref="InterPro:IPR010743"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2H4"
FT                   /protein_id="ACA70873.1"
FT                   /translation="MRADLEIIHDWIPAGSRVLDLGCGSGELLASLRDRKQVTGYGLEI
FT                   DPDNIAACVAKGVNVIEQDLDKGLGNFASNSFDVVIMTQALQAVEYPDRILDEMLRVGR
FT                   QCIITFPNFGHWRCRWYLATKGRMPVSDFMPYTWYNTPNIHFCTFADFEQLCHERRAKV
FT                   LDRLAVDHLHRNGWGGRLWPNLLGEIGIYRVSSPGLQEHQLAV"
FT   gene            complement(384845..385984)
FT                   /locus_tag="PputW619_0368"
FT   CDS_pept        complement(384845..385984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0368"
FT                   /product="homoserine O-acetyltransferase"
FT                   /EC_number="2.3.1.31"
FT                   /note="KEGG: pen:PSEEN0315 homoserine O-acetyltransferase;
FT                   TIGRFAM: homoserine O-acetyltransferase; PFAM: alpha/beta
FT                   hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70874"
FT                   /db_xref="GOA:B1J2H5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1J2H5"
FT                   /protein_id="ACA70874.1"
FT                   /translation="MSTVLPEDSVGLVTPQTARFDEPLALACGRSLASYELVYETYGSL
FT                   NASASNAVLICHALSGHHHAAGYHATTDRKPGWWDSCIGPGKPIDTNRFFVVSLNNLGG
FT                   CNGSTGPSSVNPATGKPYGADFPVLTVEDWVHSQARLADRLGIRQWAAIVGGSLGGMQA
FT                   LQWTMTYPDRVRHCVDIASAPKLSAQNIAFNEVARQAILTDPEFHGGSFQDQGVIPKRG
FT                   LMLARMVGHITYLSDDSMGEKFGRELKSDKLNYDFHSVEFQVESYLRYQGEEFSGRFDA
FT                   NTYLLMTKALDYFDPAAANGGDLAATLAHVTADYCIMSFTTDWRFSPARSREIVDALMA
FT                   ARKNVCYLEIDSPYGHDAFLIPTPRYMQGFANYMNRIAI"
FT   gene            complement(386073..386663)
FT                   /locus_tag="PputW619_0369"
FT   CDS_pept        complement(386073..386663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0369"
FT                   /product="protein of unknown function YGGT"
FT                   /note="PFAM: protein of unknown function YGGT; KEGG:
FT                   pen:PSEEN0316 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70875"
FT                   /db_xref="GOA:B1J2H6"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2H6"
FT                   /protein_id="ACA70875.1"
FT                   /translation="MNALSGAAIFVVQTLVSLYLVIVLLRFVLQLVKANFYNPLCQFAV
FT                   RATQPLLKPIRRIIPSVGGLDTSSLLLAVVIQALLMGFVLMVTYGTFGDVLHLLMWAII
FT                   GITSLFLKIFWVAMIVMVIVSWVAPNSHNPAAELAYQISEPVLAPFRRIVPNLGGMDIS
FT                   PIFAFIAIQVLQSFVMPPLAAYAGMPQELWRMI"
FT   gene            complement(386674..387492)
FT                   /locus_tag="PputW619_0370"
FT   CDS_pept        complement(386674..387492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0370"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="KEGG: pen:PSEEN0317 pyrroline-5-carboxylate
FT                   reductase; TIGRFAM: pyrroline-5-carboxylate reductase;
FT                   PFAM: CoA-binding domain protein; NADP oxidoreductase
FT                   coenzyme F420-dependent; 6-phosphogluconate dehydrogenase
FT                   NAD-binding; NAD-dependent glycerol-3-phosphate
FT                   dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70876"
FT                   /db_xref="GOA:B1J2H7"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2H7"
FT                   /protein_id="ACA70876.1"
FT                   /translation="MSKTRIAFIGAGNMAASLIGGLRAQGLDATQIRASDPGAETRTRV
FT                   QAEHGIEVFEDNAQAIAGADVIVLAVKPQVMKTVCEALQPNLQDGQLIVSIAAGITCAS
FT                   LQAWLGARPVVRCMPNTPALLRQGVSGLYATAEVSSTQHQQAEQLLSAVGTALWLEHEH
FT                   QLDAVTAVSGSGPAYFFLLIEAMTAAGEKLGLPRETATQLTLQTALGAAHMAVASDVDA
FT                   AELRRRVTSPAGTTEAAIKSFQSNGFEAIVEQALAAAAKRSAELAEQLGK"
FT   sig_peptide     complement(387418..387492)
FT                   /locus_tag="PputW619_0370"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.816 at
FT                   residue 25"
FT   gene            complement(387531..388217)
FT                   /locus_tag="PputW619_0371"
FT   CDS_pept        complement(387531..388217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0371"
FT                   /product="alanine racemase domain protein"
FT                   /note="PFAM: alanine racemase domain protein; KEGG:
FT                   pen:PSEEN0318 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70877"
FT                   /db_xref="GOA:B1J2H8"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2H8"
FT                   /protein_id="ACA70877.1"
FT                   /translation="MSTIADNLCALAARIDSAAKAAGRDPASLHLLAVSKTKPASAIRE
FT                   LHAAGVCDVGENYLQEALAKQDDLRDLPLIWHFIGPIQSNKTKAIAEHFDWVHSVDRLK
FT                   IAQRLSEQRPKDLPPLNICLQVNVSGEESKSGCAPEDLPALANAVAVLPNLRLRGLMAI
FT                   PEPSEDRAEQEAAFASLRQLQEGLNLGLDTLSMGMSHDLEAAIAQGATWVRIGTALFGA
FT                   RSYGPA"
FT   gene            388283..389281
FT                   /locus_tag="PputW619_0372"
FT   CDS_pept        388283..389281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0372"
FT                   /product="twitching motility protein"
FT                   /note="TIGRFAM: twitching motility protein; PFAM: type II
FT                   secretion system protein E; KEGG: pen:PSEEN0319 type IV
FT                   pili twitching motility protein PilT"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70878"
FT                   /db_xref="GOA:B1J2H9"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2H9"
FT                   /protein_id="ACA70878.1"
FT                   /translation="MDVTDLLARAGDAGASDLHLAAGEIPMLRVDGELRRMALPSVTPV
FT                   ALSDALAPLLDEGQRQRWAQGDEQDLALDLPSLGRFRLNLFRQLNGPAATFRLIPKRIA
FT                   TLDELGLEDVFRSVAHWTDGLILVGGPTGSGKSSTMATLIDQLNRQRSLHIITLEDPVE
FT                   VIHSSERSLVNQREIGRHCRDFSQGLRSALRQDPDVIVIGELRDLETIRLALRAAETGH
FT                   LVLATVHTRSAAGSVDRLVEVFAAEEKPLMRAMLAESLRMVVAQVLVKGVGGGRVAARE
FT                   VLVATPAVRNLIREGRMAQLNSVMQTGAAQGMRTMEGALQRLKTEGLIGAV"
FT   gene            complement(389318..389944)
FT                   /locus_tag="PputW619_0373"
FT   CDS_pept        complement(389318..389944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0373"
FT                   /product="NLP/P60 protein"
FT                   /note="PFAM: NLP/P60 protein; KEGG: pen:PSEEN0320
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70879"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2I0"
FT                   /protein_id="ACA70879.1"
FT                   /translation="MPPLLKTWLTLCLLLPLAAHATNREQRLPNGFTGYTTNATVKHAP
FT                   SKHTAMRARANNAGQVHNLPVAAMSPKQSSDVLSRAVNVLGTPYVWGGSSPKKGFDCSG
FT                   LVKYAFNDVADVDLPRTSNAMAQGHGVKVAKSDLKPGDLIFFNIKSRRVNHVAIYLGND
FT                   RFIHAPRRGKRVSIDNLSKPYWQKHYVVAKRVLPKAPQQLALAKR"
FT   sig_peptide     complement(389879..389944)
FT                   /locus_tag="PputW619_0373"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.994 at
FT                   residue 22"
FT   gene            390121..390540
FT                   /locus_tag="PputW619_0374"
FT   CDS_pept        390121..390540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0374"
FT                   /product="TM2 domain containing protein"
FT                   /note="PFAM: TM2 domain containing protein; KEGG:
FT                   pen:PSEEN0321 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70880"
FT                   /db_xref="GOA:B1J2I1"
FT                   /db_xref="InterPro:IPR007829"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2I1"
FT                   /protein_id="ACA70880.1"
FT                   /translation="MNSYESGAPFHDTHSKVIGYLLWIFGFTGSHRFYYGKPITGTIWF
FT                   FTLGLLGIGWLIDLFLIPSMDREADLRFQSGRIDYNIAWILLTFLGIFGVHRLYQGKWI
FT                   TAIIYFFTGGLFLVGVLYDFWTLNSQVSQANAERR"
FT   gene            complement(390585..391283)
FT                   /locus_tag="PputW619_0375"
FT   CDS_pept        complement(390585..391283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0375"
FT                   /product="Sporulation domain protein"
FT                   /note="PFAM: Sporulation domain protein; KEGG:
FT                   pen:PSEEN0322 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70881"
FT                   /db_xref="GOA:B1J2I2"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2I2"
FT                   /protein_id="ACA70881.1"
FT                   /translation="MAAKKKPAPKRGASRTQAPAKQPIPGWIWLAVGLTVGAFIVFLMK
FT                   LEPGGGDIKRAKPEQQKPEKVAEAGKSTAATTQQPVKPKYDFYTLLPESEVIVPPEAVP
FT                   EKTPPVPAQPVTPVTPAEAAKIDTARAQAALLGQTPPPAPPVIKPAATTQYFLQAGSFR
FT                   KQADADKVRAQIILLGQTVKVESGTVKDETWYRVLVGPYSNREQLTGAQKQLAGAGFSN
FT                   LLLQQRQTRQ"
FT   gene            complement(391285..393021)
FT                   /locus_tag="PputW619_0376"
FT   CDS_pept        complement(391285..393021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0376"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="KEGG: pen:PSEEN0323 arginine tRNA synthetase;
FT                   TIGRFAM: arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70882"
FT                   /db_xref="GOA:B1J2I3"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1J2I3"
FT                   /protein_id="ACA70882.1"
FT                   /translation="MKDTIRQLIQQALTQLVTDGVLPEGLSPAIQVENARDKTHGDFAS
FT                   NIAMMLAKPAGMKPRDLAEKLIAALPASADISKAEIAGPGFLNFFQNTDALANRLDAAL
FT                   ADAHLGARKAGPAQKVVIDMSAPNLAKEMHVGHLRSTIIGDSVARVLEFLGDQVIRQNH
FT                   VGDWGTQFGMLLAYLEENPITSDELSDLENFYRAAKKRFDESEEFATRARGLVVKLQAG
FT                   DPDCMALWTRFKDISLSHCQKTYELLNVKLTMADVMGESAYNADLANVVADLKAKGLLV
FT                   EDQGAQCVFLEEFKNSEGEPLPVIVQKADGGYLYATTDLAAVRYRSNVLKADRALYFVD
FT                   QRQALHFNQVFEVARRAGFVGHPMQMEHMGFGTMNGADGRPFKTRDGGTVKLIDLLTEA
FT                   KERAYALVKEKNPSLAEDELRHIGEVVGIGAVKYADLSKHRTSDYSFNFELMLNFEGNT
FT                   APYLLYAYTRVAGVFRKLGKGFDEVEGHIVLQAAHEQDLAARLAQFGEILNNVADKGTP
FT                   HVLCTYLYDLAGLFSSFYENCPILAAETPEQQQSRLRLAALTGRTLKQGLELLGLETLE
FT                   RM"
FT   gene            complement(393186..395426)
FT                   /locus_tag="PputW619_0377"
FT   CDS_pept        complement(393186..395426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0377"
FT                   /product="primosomal protein N'"
FT                   /note="KEGG: pen:PSEEN0324 primosomal protein N'; TIGRFAM:
FT                   primosomal protein N'; PFAM: helicase domain protein; type
FT                   III restriction protein res subunit; DEAD/DEAH box helicase
FT                   domain protein; SMART: DEAD-like helicases"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70883"
FT                   /db_xref="GOA:B1J2I4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2I4"
FT                   /protein_id="ACA70883.1"
FT                   /translation="MPCETLRVSDVILRLALPSPLRRLFDYRAPASMARQALTPGMRIR
FT                   VPFGRREMIGVLVEVCDHSEVPADKLKPASALLDPVSPVPAPLFKLCLWTAQYYQHSLG
FT                   DTLSWALPTLLRQGEPAEMRQERFWHVAPGARLEDPRIARAPRQRDALKTLAQHPHGVA
FT                   HSLLSKLNLNKDSLDLLLAKDLVQQEVRRHLPAQRHEHWLAQPELPLNDEQREAFEAVR
FT                   DGFGGFNAFLLAGVTGSGKTEVYLQLIRETLEAGKQALVLIPEINLGPQTLARFEQRFN
FT                   ARIALVHSAVNDRERLDAWLAARDGEADIIIGTRSALFTPMKNPGLIIIDEEHDGSYKQ
FT                   QEGLRYHARDLAMVRAHQENIPILLGSATPSLETLHNALTGRYRLLRMNQRAGGARPPR
FT                   MLRLDVKSLPLDSGISGPLQQAIRQTLEAGQQVLVFLNRRGFAPTLLCHDCGWLSECPR
FT                   CDARMTVHQRAGVLRCHHCGYDERLPHQCPKCNHVDLRPVGAGTERAEERLKVLFPDYP
FT                   ILRVDRDSTARKDAMNNLFSTIQRGQPSILVGTQMLAKGHHFPRVTLVAILDADGGLFS
FT                   GDFRATERMAQLIVQVAGRAGRAEEPGKVVIQTHLADHPLLVQLTEQGYFAFAEQALDE
FT                   RRAAGLPPYSHLALLRAEAHKPGQAEGFLDEACNAAQRLVAEQRLPGIELLGPVPAPME
FT                   RKAGRFRAQLLIQAETRAPLHRLISAWLLVLEQLPGGRQVRWSLDVDPVDLY"
FT   gene            395573..395788
FT                   /locus_tag="PputW619_0378"
FT   CDS_pept        395573..395788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0378"
FT                   /product="ribosomal protein L31"
FT                   /note="PFAM: ribosomal protein L31; KEGG: pen:PSEEN0325 50S
FT                   ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70884"
FT                   /db_xref="GOA:B1J2I5"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1J2I5"
FT                   /protein_id="ACA70884.1"
FT                   /translation="MKADIHPNYEAVAVTCSCGNKFETRSTLGSTLAIDVCNLCHPFYT
FT                   GKQKVLDTGGRVQRFADRFGMFGTKK"
FT   gene            395791..396612
FT                   /locus_tag="PputW619_0379"
FT   CDS_pept        395791..396612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0379"
FT                   /product="nuclease (SNase domain protein)"
FT                   /note="PFAM: nuclease (SNase domain protein); KEGG:
FT                   pen:PSEEN0326 nuclease, staphylococcal nuclease homologue"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70885"
FT                   /db_xref="GOA:B1J2I6"
FT                   /db_xref="InterPro:IPR002071"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2I6"
FT                   /protein_id="ACA70885.1"
FT                   /translation="MRMANPSGFALLLKKAPLVGAFFVGALWQVPALAFCPLPDRPQIV
FT                   AVRQVVDGDTLRLTDGRSVRMIGINAPEIGRKGRTSEPFAEAAKRRLQALVKASDGRVG
FT                   LVLGVEPKDKYGRTLAHVYARTGDNLEARLLGEGLGYRVAVAPNVRLVACQQVAEQSAR
FT                   KAGAGLWRSSPVLRASQVRESGFAVIGGTIRNIARNRGGIWLELETGVVLQVPARLQRN
FT                   FPKGFFDNLKGRQVEARGWVLDRSRKGGLKPGQRRWVLPITDPSMLERISS"
FT   gene            396783..398060
FT                   /locus_tag="PputW619_0380"
FT   CDS_pept        396783..398060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0380"
FT                   /product="Malate dehydrogenase
FT                   (oxaloacetate-decarboxylating) (NADP(+))"
FT                   /EC_number="1.1.1.40"
FT                   /note="PFAM: malic protein domain protein; malic protein
FT                   NAD-binding; KEGG: pen:PSEEN0327 bifunctional protein
FT                   (MaeB) [includes: malic oxidoreductase N-terminal;
FT                   phosphotransacetylase C-terminal]"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70886"
FT                   /db_xref="GOA:B1J2I7"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2I7"
FT                   /protein_id="ACA70886.1"
FT                   /translation="MPTMSDLKTAALEYHAQPRPGKLSVELSKPTATARDLALAYSPGV
FT                   AEPVREIGRDPELAYKYTGKGNLVAVISDGTAILGLGDLGPLASKPVMEGKGVLFKRFA
FT                   GIDVFDIEVESESPQAFIDTVRRISITFGGINLEDIKAPECFEIERTLIEQCDIPVFHD
FT                   DQHGTAIVTAAGMINALEIAGKKLEDAKIVCLGAGAAAISCMKLLVSMGAKVENIFMID
FT                   RSGVIHAGRDDLNQYKAQFAHATDKRTLADALDGADVFVGLSGPNLLSAEGLKSMAANP
FT                   IVFACSNPDPEISPELAHATRNDVIMATGRSDYPNQVNNVLGFPFIFRGALDVRAKRIN
FT                   EEMKIAAAIALKDLAKLPVPKEVCEAYGVEGLEFGREYIIPKPLDARLITVVSDAVAKA
FT                   AIESGVATLPYPKHYPLNSVDEVFNG"
FT   gene            complement(398202..400655)
FT                   /locus_tag="PputW619_0381"
FT   CDS_pept        complement(398202..400655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0381"
FT                   /product="penicillin-binding protein, 1A family"
FT                   /EC_number="2.4.1.129"
FT                   /note="KEGG: pen:PSEEN0328 penicillin-binding protein 1A;
FT                   TIGRFAM: penicillin-binding protein, 1A family; PFAM:
FT                   glycosyl transferase family 51; penicillin-binding protein
FT                   transpeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70887"
FT                   /db_xref="GOA:B1J2I8"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031376"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2I8"
FT                   /protein_id="ACA70887.1"
FT                   /translation="MIRLLKFFWWSFVAVICALVLGVSGAFLYLSPNLPSVDSLRSIQL
FT                   QIPLRVYSSDGKLIAEFGEMRRSPIRFADIPPQFIQALLSAEDDNFLNHYGVDPGSLMR
FT                   AATQLVKTGHIQTGGSTITMQVAKNFFLTSERSFSRKTNEILLALQIERELTKDEILEL
FT                   YVNKIYLGNRAYGIDAAAQVYYGKSIRDVSLAQMAMIAGLPKAPSRFNPLANPVRAKER
FT                   RDWILGRMYKLGKIDEASYQAALAEPLNASYHVSAPEVNAPYIAEMARAEMVGRYGSDA
FT                   YTEGFRVTTTVPSDMQEIANKAVHGGLSDYDERHGYRGPESRFPGKGQAAWLQELNKQR
FT                   TLGGLEPAIVTQVDKSGLKVLTRGGKEEDVAWDTMKWARPFINSNAQGRAPQSPADVAQ
FT                   VGDLVRVQRLDDGKLKFSQVPAAQSALITLDPYNGAIRALVGGFSFEQSNYNRAMQAKR
FT                   QPGSSFKPFIYSAALDSGYTAASLVNDAPIVFVDEYLDKEWRPKNDTNTFLGPIRMREA
FT                   LYKSRNLVSIRLLQAMGVGRTIDYITKFGFNKQDLPPNLSLALGTATLTPMEIATGWST
FT                   FANGGYKINPYLIERIESRNGETLFTANPARVPQGAEDDAGLAAPEQPISTASLPGEAP
FT                   SVPGLPAPATQVPVTAEQIIDGRTTYILTSMLQDVIKRGTGRRALALGRTDLAGKTGTT
FT                   NESKDAWFSGYNADYVTTVWVGFDQPETLGRREYGGTAALPIWMSFMGAALKDKPNHPP
FT                   AEPEGILSLRVDPVSGRAASPSTPNAYFELFKAEDSPPSVDELGNGAAPGSPLPADEAA
FT                   PMDLF"
FT   sig_peptide     complement(400569..400655)
FT                   /locus_tag="PputW619_0381"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.626 at
FT                   residue 29"
FT   gene            complement(400786..402492)
FT                   /locus_tag="PputW619_0382"
FT   CDS_pept        complement(400786..402492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0382"
FT                   /product="RNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.49"
FT                   /note="KEGG: pau:PA14_07480 putative reverse transcriptase;
FT                   PFAM: RNA-directed DNA polymerase (Reverse transcriptase);
FT                   Group II intron maturase-specific domain protein; SMART:
FT                   HNH nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70888"
FT                   /db_xref="GOA:B1J2I9"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR025960"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2I9"
FT                   /protein_id="ACA70888.1"
FT                   /translation="MKELSQQGEPALSGTPQQWHDVDWRRVQRNVRGMQVRIAKACREG
FT                   KWRKVKSLQRMLTHSKSARYLAVRRVTENQGSRTAGVDRQLWDTPNAKWNAVGQLKTRG
FT                   YRARPLRRVYIPKSDGRERPLGIPTMTDRAMQALYMLALSPIAETQGDPNSYGFRIERC
FT                   TADAMAQLFLCLSKQASACWVLDADIEGFFDNINHEWLLGNAPTDNRMLRQWLKAGVIH
FT                   KGQLHATDAGTPQGGIISPVLANLALDGLETLLKQHLGVTRAKKLKVNVVRYADDFVIT
FT                   GTSSEVLENEVKPWVEQFLAKRGLRLSLKKTRIAHIDEGFDFLGWNFRKYEGKLLIKPS
FT                   KKNVKAFYGKIREAINTHKTSKQEDLIQLLNPMLRGWALYHQPVVAKQTYSRMDHRVFV
FT                   KLWRWAKRRHPNKSLDWVRKKYFRASGERNWVFATTTVDDAGRRREIELCSLASTPIER
FT                   HKKVSGDYNPYDPAMEAQSEKLRMDRMLKKLQYRKQIGSLYASQNGLCLLCKQPITKET
FT                   GWHDHHIIHRAVDGGDALANRVLLHPNCHNQLHTRGLYVTKPAPLGGLKKA"
FT   gene            403679..404527
FT                   /locus_tag="PputW619_0383"
FT   CDS_pept        403679..404527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0383"
FT                   /product="type IV pili biogenesis protein PilM"
FT                   /note="KEGG: pen:PSEEN0330 type IV pili biogenesis protein
FT                   PilM"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70889"
FT                   /db_xref="InterPro:IPR005883"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2J0"
FT                   /protein_id="ACA70889.1"
FT                   /translation="MLGRIGKDAGSLLGVEIAADSVRLVQLRRRKGRCERLAWEVERFE
FT                   PAGTADWWQVPDRVVAALRSACRRSGSRQRRVAVALPASQVICKLCQLPADLPVAEMEA
FT                   QLLADADRLFPFPLEDLVMDFQVLGASCGQAGAHDVLVVACRQTVLQPLEALFDEAGLQ
FT                   LEVVEVDSIALLRMMPQPRADGSALLRLEPGGATLHCWSQGMLPQRREVALGRLGELFV
FT                   DDLQVQDLLLTGSVLLEQVRLGELFDQLSMPCRPLPQVAGLTCHDDNMALAAALALGAL
FT                   R"
FT   gene            404527..405063
FT                   /locus_tag="PputW619_0384"
FT   CDS_pept        404527..405063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0384"
FT                   /product="Fimbrial assembly family protein"
FT                   /note="PFAM: Fimbrial assembly family protein; KEGG:
FT                   pen:PSEEN0331 type IV pili biogenesis protein PilN"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70890"
FT                   /db_xref="GOA:B1J2J1"
FT                   /db_xref="InterPro:IPR007813"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2J1"
FT                   /protein_id="ACA70890.1"
FT                   /translation="MLRINLLPWREQQRQAALRRLRFMLLGGVVLALCVVLLMDQLARQ
FT                   RAQHHANANLARQAVITELNTQLEQLDGIQKAIDAVRAQTTVLDALYADQELLTTLFTD
FT                   LERALPEGVQVVELRVEGERLHLAGLAASSAVIAQLMRDLGRSGILLDLELKRIKSMPA
FT                   GEEFLLLARMSASWS"
FT   gene            405060..406076
FT                   /locus_tag="PputW619_0385"
FT   CDS_pept        405060..406076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0385"
FT                   /product="type IV pili biogenesis protein PilP"
FT                   /note="KEGG: pen:PSEEN0332 type IV pili biogenesis protein
FT                   PilP"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70891"
FT                   /db_xref="InterPro:IPR007445"
FT                   /db_xref="InterPro:IPR007446"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2J2"
FT                   /protein_id="ACA70891.1"
FT                   /translation="MNLLLRLDWQALVARSRLFRCALPIVTACLVFAAGCLVRWPEWRQ
FT                   LQQTEQANQRTLNDMHQAKATQVLARVHSPQALSEAQRRLDDMRWRLAAGGEISDLLDQ
FT                   LAASGPVHGLHFEQLEVLEEQSQAGFGRTPLDVQVVGRYAALRMWLDDWLGQVRLLRAG
FT                   DMHLASAHGRPGLLRLRLRVDAFHADGAVAEPESLAWLPARDHIKPPVADPFSVWSGRA
FT                   VRQGLANIPLAQLEMVGSLSRGMQHEALLLSSGRLYRVRSGDRLGRDEGVVVRVDEQQV
FT                   EVCERLFVGGTWRERTTLLTLRKGVDREIQEDNERVDEVAGGGIAADAVAGGNALSG"
FT   sig_peptide     405999..406061
FT                   /locus_tag="PputW619_0385"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.940 at
FT                   residue 20"
FT   gene            406000..407268
FT                   /locus_tag="PputW619_0386"
FT   CDS_pept        406000..407268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0386"
FT                   /product="type IV pilus secretin PilQ"
FT                   /note="TIGRFAM: type IV pilus secretin PilQ; PFAM: type II
FT                   and III secretion system protein; NolW domain protein;
FT                   Secretin/TonB short domain; KEGG: pen:PSEEN0333 type IV
FT                   pili biogenesis protein PilQ"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70892"
FT                   /db_xref="GOA:B1J2J3"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR013355"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2J3"
FT                   /protein_id="ACA70892.1"
FT                   /translation="MNGLMKWLVAALLPMPLLAATPYRGEPISLNFQDVEVRLVLQVLA
FT                   DYAGINLVASDTVQGSITLRLQDVPWDQALELVLRSKGLGRREEGNVLLVAPAVELAEQ
FT                   ALGARMGLELEAQSRPLRRELLPIHHAEASELAELLLATLADDGILTGRGSLSVDVRTN
FT                   TLVAHQPEDRLAELRQLVAQLDVPVRQVEIEARIVEANVDYENSLGVRWGPRLYSEAPA
FT                   LGKDVFVDLGMERAGSSIGFGVLRGGVLLDLELSAMEKTGNGEIISQPKVVTANNETAR
FT                   ILKGTEVPYQETTKSGATSVTFREASLSLEVTPQITPDGKVIMTVKVTKDEPDFVNALN
FT                   DVPPIRKNEVNAKVRVADGETIVIGGVYSTTQNNVVDKVPFFGDLPYVGRLFRRDALQE
FT                   KKSELLVFLTPRIMNDQAIAVSR"
FT   gene            407300..407791
FT                   /locus_tag="PputW619_0387"
FT   CDS_pept        407300..407791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0387"
FT                   /product="Shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="PFAM: shikimate kinase; KEGG: pen:PSEEN0334
FT                   shikimate-kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70893"
FT                   /db_xref="GOA:B1J2J4"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2J4"
FT                   /protein_id="ACA70893.1"
FT                   /translation="MGAGKSTIGRLLAKELRLLFKDSDKEIELKTGANIPWIFDKEGEP
FT                   GFRDREQAMIAELCALDGVVVATGGGAVMREANRQALHHGGRVIYLHASVEQQVGRTAR
FT                   DRNRPLLRTANPEATLRSLLEARDPLYREIADIVVETDERPPRMVVLDILERLQQLPPR
FT                   "
FT   gene            407886..408983
FT                   /locus_tag="PputW619_0388"
FT   CDS_pept        407886..408983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0388"
FT                   /product="3-dehydroquinate synthase"
FT                   /note="PFAM: 3-dehydroquinate synthase; KEGG: pen:PSEEN0335
FT                   3-dehydroquinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70894"
FT                   /db_xref="GOA:B1J2J5"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1J2J5"
FT                   /protein_id="ACA70894.1"
FT                   /translation="MQTLKVDLGERSYPIYIGEGLLDQPELLAPHIAGRQIAIVSNETV
FT                   APLYLERLSKALGAYSVLPVILPDGEAHKNWETLQLIFDGLLTARHDRRTTVVALGGGV
FT                   IGDMAGFAAACYQRGVDFIQVPTTLLSQVDSSVGGKTGINHPLGKNMVGAFYQPNAVLI
FT                   DTTTLNTLPERELSAGLAEVIKYGLICDKPFLGWLEDNIKALRALEPAALTEAIQRSCA
FT                   AKAAVVGADERESGVRATLNLGHTFGHAIETHMGYGVWLHGEAVAAGTVMALEMSMRLG
FT                   WIDQSERDRAIRLLQDAGLPVVPPQEMTPAHFMEHMAVDKKVIDGRLRLVLLRQMGEAV
FT                   VTDDYPKEILQATLSADYRAIVAQL"
FT   gene            408999..410579
FT                   /locus_tag="PputW619_0389"
FT   CDS_pept        408999..410579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0389"
FT                   /product="Sporulation domain protein"
FT                   /note="PFAM: Sporulation domain protein; KEGG:
FT                   pen:PSEEN0336 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70895"
FT                   /db_xref="GOA:B1J2J6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2J6"
FT                   /protein_id="ACA70895.1"
FT                   /translation="MTSLHADEAFLDHYQLSHDPFAPRVPGFKFFPAQRKPVLGQLHHL
FT                   ARYSQLMLVVTGPVGSGKTLLRQALVASTNKQSVQSVVVSARGASDAASVLGQVAQALD
FT                   VAPAEVQAILSKVVQLALTGQEVYLLVDDAEQLDESALQALLELAAGVPEGRPHVFLFG
FT                   EASLIAGLDEIHVEEERFHVIELAPYSEEETREYLEQRLEGAGRGIEVFTHEQIVDIHE
FT                   HSDGWPGNINQVARDTLIEAMIASRSTAKRPTMGFKMPKKHVLALSAVVVVAVAAAVLM
FT                   PKKSDKAATDAPAAQAQLPLGEAKPTDPAIEFSGSSQPMPLPLVGQSQPVMREPLAQAA
FT                   GMGDGEEGGPADSTALQPGNPPTVTTIAPPQGEAAGPAPTMAQATTSAPPAQPVAPAQK
FT                   PVATQPAKPVAPAKPAPAPTQVATAKPAGGSGNSGWYSGQKPGNYVVQILGTSSEASAQ
FT                   AFVKAQGGDYRYFKKNLQGKPLYVVTYGSFANRDAAVAAIKNLPAKVQAGKPWPRTVAS
FT                   VQQELATAR"
FT   gene            410953..415398
FT                   /locus_tag="PputW619_0390"
FT   CDS_pept        410953..415398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0390"
FT                   /product="Glutamate synthase (ferredoxin)"
FT                   /EC_number="1.4.7.1"
FT                   /note="PFAM: glutamine amidotransferase class-II; glutamate
FT                   synthase alpha subunit domain protein; ferredoxin-dependent
FT                   glutamate synthase; glutamate synthase; KEGG: pen:PSEEN0337
FT                   glutamate synthase [NADPH] large chain precursor (GOGAT)"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70896"
FT                   /db_xref="GOA:B1J2J7"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2J7"
FT                   /protein_id="ACA70896.1"
FT                   /translation="MKTGLYHPEEFKDNCGFGLIAHMTGEPSHHLLQTAMQALTCMTHR
FT                   GGINADGKTGDGCGLLMQKPDQFLRAVAQEHFAVELPKQYAVGMVFFNQDPVKAEAARA
FT                   NMDREIIAAGLTLIGWRKVPIDTSVLGRLALERLPQIEQVFIGGEGLSDQEFAIKLFSA
FT                   RRRSSVANAHDADHYICSFSHKTIIYKGLMMPRDLAAFYPDLDDERLQTAICVFHQRFS
FT                   TNTLPKWPLAQPFRFLAHNGEINTITGNRNWAMARRTKFANDQIPDLEELGPLVNRVGS
FT                   DSSSMDNMLELMVTGGIDLFRGVRMLVPPAWQNVETMDADLRAFYEYNSMHMEPWDGPA
FT                   GIVMTEGRHAVCLLDRNGLRPARWVTTKNGYITLASEIGVWDYKPEDVIAKGRVGPGQI
FT                   FAVDTETGHILDTDAIDNRLKSRHPYKRWLRQHALRIQATLTDDQGAASYDADQLKQYM
FT                   KMFQVTFEERDQVLRPLGEQGQEAVGSMGDDTPMAVLSQRVRSPYDFFRQQFAQVTNPP
FT                   IDPLREAIVMSLEICLGAERNIFQESPEHASRVILSSPVISPAKWRSLMNLEREGFDRQ
FT                   LIDLNYEEGIGLEAAIRNIADQAEEAVRAGKTQLVLSDRYIAPGKLPVHASFAVGAVHH
FT                   RLTEKGLRCDSNILVETATARDPHHFAVLLGFGASAVYPYLAYEVLADLIRTGEVLGDL
FT                   DEVFKYYRKGISKGLLKILSKMGISTIASYRGAQLFEAVGLAEEVVGLSFKGVSSRIKG
FT                   ARFVDLEGDQKLLAAEAWSARKPIQQGGLLKFVHGGEYHAYNPDVVNTLQAAVQQGDYA
FT                   KFKEYTTLVDQRPVSMIRDLLKVKVADEALPLDQIEPLEAILKRFDSAGISLGALSPEA
FT                   HEALAEAMNRLGARSNSGEGGEDPSRYGTIRSSKIKQVATGRFGVTPEYLVNAEVLQIK
FT                   VAQGAKPGEGGQLPGGKVNGLIAKLRYAVPGVTLISPPPHHDIYSIEDLAQLIYDLKQV
FT                   NPQALVSVKLVAEAGVGTIAAGVAKAYADLITISGYDGGTGASPLTSIKYAGAPWELGL
FT                   AETHQTLRGNDLRGKVRVQTDGGLKTGLDVIKAAILGAESFGFGTAPMIALGCKYLRIC
FT                   HLNNCATGVATQNDKLRKDHYIGTVDMVINFFTFVAEETREWLAKLGVRSLGELIGRTD
FT                   LLDVLPGDTERQHYLDLSPLLGSSHIPADKPQFCEVDKNPPFDKGELAEKMVEMALPAI
FT                   RDQAGGEFALDICNCDRSIGARISGEIAKLHGNQGMAAAPITFRFKGTAGQSFGVWNAG
FT                   GLNLYLEGDANDYVGKGMTGGKVTIVPPAGSPFETQHSAIVGNTCLYGATGGKLFAAGT
FT                   AGERFAVRNSGAHAVVEGTGDHCCEYMTGGFVCVLGKTGYNFGSGMTGGFAYVLDMDNS
FT                   FVDKLNHELVEIQRISGEAMEAYRSHLARVLGEYVEETGSEWGRELSENLDDYVRRFWL
FT                   VKPKAANLKQLLSSTRANPQ"
FT   gene            415522..416940
FT                   /locus_tag="PputW619_0391"
FT   CDS_pept        415522..416940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0391"
FT                   /product="glutamate synthase, small subunit"
FT                   /note="TIGRFAM: glutamate synthase, small subunit; PFAM:
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: pen:PSEEN0338 glutamate synthase
FT                   [NADPH] small chain (GOGAT)"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70897"
FT                   /db_xref="GOA:B1J2J8"
FT                   /db_xref="InterPro:IPR006006"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2J8"
FT                   /protein_id="ACA70897.1"
FT                   /translation="MAERLSNDFQFIEVGRKDPKKKLLRQRKKEFVEIYEPFKPQQSVE
FT                   QAHRCLGCGNPYCEWKCPVHNFIPNWLKLVSEGNILAAAELSHQTNTLPEVCGRVCPQD
FT                   RLCEGACTLNDGFGAVTIGSVEKYITDTAFAMGWRPDMSKVKPTGKRVAIIGAGPAGLG
FT                   CADVLVRAGVTPVVFDKNPEIGGLLTFGIPEFKLEKTVLSNRREVFTGMGIEFRLNTEV
FT                   GTDITMEQLLAEYDAVFMGMGTYTYMKGGFPGEDLPGVHDALDFLIANVNRNLGFEKSP
FT                   EDFIDMQGKKVVVLGGGDTAMDCNRTSIRQGAKAVTCAYRRDEANMPGSRKEVKNAKEE
FT                   GVKFLYNRQPIAIVGEDKVEGVKVVETRLGEPDARGRRSPEPIPGSEEILPADAVVIAF
FT                   GFRPSPAPWFEQHGIQMDSQGRVVAPEKGKFKHQTSNPKIFAGGDMVRGSDLVVTAIFE
FT                   GRTAAEGILDYLEV"
FT   gene            417092..418156
FT                   /locus_tag="PputW619_0392"
FT   CDS_pept        417092..418156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0392"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /note="KEGG: pen:PSEEN0339 uroporphyrinogen decarboxylase;
FT                   TIGRFAM: uroporphyrinogen decarboxylase; PFAM:
FT                   Uroporphyrinogen decarboxylase (URO-D)"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70898"
FT                   /db_xref="GOA:B1J2J9"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1J2J9"
FT                   /protein_id="ACA70898.1"
FT                   /translation="MTALKNDRFLRALLKQPVDVTPVWMMRQAGRYLPEYRASRAKAGD
FT                   FMSLCMNPQFACEVTLQPLERYPLDAAILFSDILTIPDAMGLGLYFETGEGPRFKKVIS
FT                   TPADIEALLIPDPQKDLGYVMDAVSTIRRELNGRVPLIGFSGSPWTLATYMVEGGSSKD
FT                   FRKTKAMAYDNPQALHLLLDKLAQSVTSYLNGQILAGAQAVQIFDTWGGNLSAAAYQEF
FT                   SLAYMRKIVSGLIREHDGRKVPVILFTKNGGLWLESIAEAGADALGLDWTCEIGDARRR
FT                   VGDKVALQGNMDPTVLYAKPEAIRNEVARILASYGKGTGHVFNLGHGITPEVDPEHAGV
FT                   FINAVHELSAQYHQ"
FT   gene            418316..418663
FT                   /locus_tag="PputW619_0393"
FT   CDS_pept        418316..418663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0393"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   pen:PSEEN0340 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70899"
FT                   /db_xref="InterPro:IPR005220"
FT                   /db_xref="InterPro:IPR036700"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2K0"
FT                   /protein_id="ACA70899.1"
FT                   /translation="MKTRYLALILAPLFSTAALAAGYTGPGAQSVTTVAAASDAADDTP
FT                   VVLQGYVTKKIDNDDKYEFKDSTGTITVEIDDEDLPPTPFNDKTKVKLTGEVEKHLMSR
FT                   EVDVDIVEILN"
FT   sig_peptide     418316..418378
FT                   /locus_tag="PputW619_0393"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 21"
FT   gene            complement(418780..420024)
FT                   /locus_tag="PputW619_0394"
FT   CDS_pept        complement(418780..420024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0394"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   pen:PSEEN0341 transporter, MFS superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70900"
FT                   /db_xref="GOA:B1J2K1"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2K1"
FT                   /protein_id="ACA70900.1"
FT                   /translation="MKTAVAPLPADPEPAPLNDIWIEKGTPAFMKTVLALFSGGFATFA
FT                   LLYCVQPMMPLLSQEFSINAAQSSLVLSVSTGMLAFGLLITGPISDRIGRKPVMVFALL
FT                   CAALSTIVSAVMPTWEGVLATRALVGLSLSGLAAVAMTYLSEEIHPQHIGLAMGLYIGG
FT                   NAIGGMSGRLITGVLIDFVSWHTAMLTIGGLALIAALVFWKVLPESRNFRAQTLKPRSL
FT                   LDGFVIHFKDAGLPWLFLEAFLLMGAFVTLFNYIGYRLLAEPYHMNQALVGLLSVVYLS
FT                   GIYSSAQVGALADKLGRRRVFWASILVMAAGLLMTLASPLVMIIVGMLIFTFGFFGAHS
FT                   VASSWIGRRALKAKGQASSLYLFCYYAGSSVAGTAGGVFWHQWGWSGIGLFIGSLLAVA
FT                   LLVALHLSKLAPKAA"
FT   gene            420133..421032
FT                   /locus_tag="PputW619_0395"
FT   CDS_pept        420133..421032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0395"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: pen:PSEEN0342 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70901"
FT                   /db_xref="GOA:B1J2K2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2K2"
FT                   /protein_id="ACA70901.1"
FT                   /translation="MELRHLRYFIAVAEELHFGRAALQLGISQPPLSQQIQALEQELGA
FT                   RLFERTNRRVELSEAGRLFLEEARQVLAQVEKAADVARRAQLGELGEMKIGFTSSAPFT
FT                   SKIPKAIHAFRQRFPAVHLNLKEMSSRDVAEGVFDESIEVGLMRPMPLPEGLVATELFR
FT                   EPLVAVINASHALAEGTEHGVHMAALAHEPFVFFPRSYGSGLHAQLLSLARQAGFNPHF
FT                   AQEAGEAMTIIGLVSAGLGVSILPASFQRMRIEGVVYRTLLDEGATSAVWLVQRQHGGS
FT                   AMAKAFAELLTGVTAGVN"
FT   gene            421123..421896
FT                   /locus_tag="PputW619_0396"
FT   CDS_pept        421123..421896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0396"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid ac-diamide synthase; KEGG:
FT                   pen:PSEEN0365 chromosome partitioning protein, ParA family"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70902"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2K3"
FT                   /protein_id="ACA70902.1"
FT                   /translation="MRRVVFNQKGGVGKSSIACNLAAVSASEGYRTLLIDLDAQANSTQ
FT                   YLTGLTGEDIPMGIADFFKQSLSSGPFSKKNKVDIYETPFDNLHVITATSELADLQPKL
FT                   EAKHKINKLRKLLDELDEDYERIYIDTPPALNFYAVSALIAADRVLIPFDCDSFSRQAL
FT                   YGLLAEIEELKDDHNEELVVEGIVVNQFQSRASLPQQMLDELLAEGLPVLPVYLSSSVK
FT                   MRESHHASLPLIHLEPRHKLTQQFVELHSLLEENA"
FT   gene            complement(421893..422327)
FT                   /locus_tag="PputW619_0397"
FT   CDS_pept        complement(421893..422327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0397"
FT                   /product="thioredoxin"
FT                   /note="TIGRFAM: thioredoxin; PFAM: Thioredoxin domain;
FT                   KEGG: pen:PSEEN0368 thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70903"
FT                   /db_xref="GOA:B1J2K4"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2K4"
FT                   /protein_id="ACA70903.1"
FT                   /translation="MSDPLLIPCPHCDGLNRLPATRLGDAPKCGRCKQDVLLGRSFELS
FT                   ERNYASQIKGDLPLLIDVWADWCGPCKSFAPTFEQAARQLNGRCRLAKLDSEANRNLAG
FT                   QLGIRSIPSLILFKNGREVSRQAGAFPLQSLLEWLRSQGV"
FT   gene            complement(422464..423924)
FT                   /locus_tag="PputW619_0398"
FT   CDS_pept        complement(422464..423924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0398"
FT                   /product="protein of unknown function UPF0061"
FT                   /note="PFAM: protein of unknown function UPF0061; KEGG:
FT                   pen:PSEEN0369 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70904"
FT                   /db_xref="GOA:B1J2K5"
FT                   /db_xref="InterPro:IPR003846"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1J2K5"
FT                   /protein_id="ACA70904.1"
FT                   /translation="MKALDQLTFDNRFARLGDAFSTQVLPEPIADPRLVIASKSAMALL
FT                   DLDPAQADTPVFAELFSGHKLWEGADPRAMVYSGHQFGSYNPRLGDGRGLLLAEVVNDA
FT                   GEHWDLHLKGAGQTPYSRMGDGRAVLRSSIREFLASEALHALGIATSRALCVIGSSTPV
FT                   WRETRESAAMLTRLAQSHVRFGHFEYFYYTKQPEQQRVLIDHVLEQHYPECREAEQPYL
FT                   AMFRTIVERNAELIAHWQAYGFCHGVMNTDNMSILGITFDFGPYAFLDDFDANFICNHS
FT                   DDRGRYSYANQVPIAHWNLSALAQALTTVIEVEPLKEALGLFLPLYQAHYLDLMRRRLG
FT                   LTTAEDDDMALVERLLQRMQSGGVDYNLFFRRLGDQPVAEALKGVRDDFIDLAGFDAWG
FT                   ADYLARCEREAGNGDGRRERMHAVNPLYVLRNYLAQKAIEAAEAGDYSEVRRLHQVLST
FT                   PFEEQAGMQAYAERPPAWGKHLEISCSS"
FT   gene            complement(424095..427403)
FT                   /locus_tag="PputW619_0399"
FT   CDS_pept        complement(424095..427403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0399"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   pen:PSEEN0370 potassium efflux system protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70905"
FT                   /db_xref="GOA:B1J2K6"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR006686"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="InterPro:IPR024393"
FT                   /db_xref="InterPro:IPR025692"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2K6"
FT                   /protein_id="ACA70905.1"
FT                   /translation="MSLRVYLRTALLGLCLSLSFAAAAAEAPSAASIQNSLDKIAERKL
FT                   PEADQKALQQVLEQTLSLLANKEDSEKKLAALKQQLADAPKETSDSQKELAKLKASKPQ
FT                   PVAQRYASLSVPQLEQMLSERNTLQGELQKALSDANSLIINSQTRPERAQAEISNNQTR
FT                   SQQINTILKSGKDGGKSINADQRNQLNAELASLNAVTLLRRQELAGNGLLQDLGNARHD
FT                   LLIERTARLEQEIQDLQTLINEKRLAQSQQTVTQQSIEAQKAGGSSLLASESAANLKLS
FT                   DYLLKSTDRLNELTQQNLRTKQQLDSLTQADQALDEQISVLKGSLLLSKILYKQKQALP
FT                   HLKLDRDLADQIADIRLYQFEINQQREQMSSPVTYVDKLLANQPQQDVTPALRKALLEV
FT                   AITRSDLLERLNRELSALLNESITLQLNQKQLLSTAQGLRTTLDEQMFWIPSNKPLDWD
FT                   WLKTVPERFAKQVADLPWGSGLKELGDGLSQRPLLFLPLLLVIGALLWRRKYLYQRLNK
FT                   VHQDIGHFRRDSQWHTPQAILINILLAMPVSLGLALCSYALQIDARGQNANLGSALWQL
FT                   AQAWLVFYTAYRILAPGGVAEIHFRWHKPQVEFLRGWVRRLGTVVLALVGVVAVAEHQP
FT                   SALADDVLGIGVVLTCYALMAWLLSRLLLSSPAHRDASLFRRAVGLAFTALPIALFVAV
FT                   CFGYYYTALKLTDRLIYTLYLLMFWLVIEAAFVRGLSVAARRLAYQRALSKRAAAKEGL
FT                   DGEVITEEPTLDIEQVNQQSLRLIRLALLGGFIAGLYWVWADLITVFAYLNNFTLYEYT
FT                   SGTGTAASMVPISLGDLLGALVIVGITFALAGNLPGLLEVLVLSRLNLAQGSAYATTTL
FT                   LSYTIVGIGIVSTLSTLGVSWDKLQWLVAALSVGLGFGMQEIFANFISGIMILFERPVR
FT                   IGDTITIGNLSGTVSKIRIRATTITDFDRKDIIVPNKTFITGQLINWSLTDTVTRVTLK
FT                   LGIDYGSDLDLVRELLLKGAHENPRVLKDPEPLVYFLNFGESSLDHELRMHVRDLGDRN
FT                   PTLDEINRFINREFKAHNIKISVRQVEVYLMDMQGGKQQLIPVEQPKPDGTQPV"
FT   sig_peptide     complement(427329..427403)
FT                   /locus_tag="PputW619_0399"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.982 at
FT                   residue 25"
FT   gene            complement(427439..429181)
FT                   /locus_tag="PputW619_0400"
FT   CDS_pept        complement(427439..429181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0400"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: transporter-associated region; TrkA-C domain
FT                   protein; sodium/hydrogen exchanger; KEGG: pen:PSEEN0371
FT                   cell volume regulation protein A"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70906"
FT                   /db_xref="GOA:B1J2K7"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR023729"
FT                   /db_xref="InterPro:IPR030151"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1J2K7"
FT                   /protein_id="ACA70906.1"
FT                   /translation="MDASTINSLFLIGALLVGASILVSSLSSRLGIPILVIILAVGMLA
FT                   GVDGGGIIFNNYPTAYLVGNLALAVILLDGGLRTRVASFRVALWPALSLATVGVMITTA
FT                   LTGLVAAWLFDLSLIQGLLIGAIVGSTDAAAVFSLLGGKGLNERVTATLEIESGSNDPM
FT                   AVFLTVTLIDMIASGQTGLHWSLLGHLLREFGIGGLLGLGGGWLMLQLVNRINLAGGLY
FT                   PILVIAGGLAVFSLTNALHGSGFLAVYLCGLVLGNKPIRSRHGILHMLDGMAWLAQIGM
FT                   FLVLGLLVTPHDLLPIALPALGLALWMILIARPLSVVAALLPFKAFHGREKAFISWVGL
FT                   RGAVPIILAVFPLMAGLPDAQLFFNLAFFIVLVSLLVQGTSLPWMAKLLKVTVPPDPAP
FT                   ISRSALEVHITSEWELFVYRLGAEKWCIGAALRELKMPEGTRIAALFRGEQLLHPSGST
FT                   VLEVGDMLCVIGHEHNLPALGKLFSQAPQRGLDLRFFGDFVLEGDAELGAVAALYGLKL
FT                   DGLDAKMPLAQFIRQKVGGAPVVGDQVEWHGTIWTVATMDGNKIQKVGVRFPEGTRPGP
FT                   GLFL"
FT   sig_peptide     complement(429089..429181)
FT                   /locus_tag="PputW619_0400"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.807) with cleavage site probability 0.373 at
FT                   residue 31"
FT   gene            complement(429368..431059)
FT                   /locus_tag="PputW619_0401"
FT   CDS_pept        complement(429368..431059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0401"
FT                   /product="choline dehydrogenase"
FT                   /EC_number="1.1.99.1"
FT                   /note="KEGG: pen:PSEEN0372 choline dehydrogenase; TIGRFAM:
FT                   choline dehydrogenase; PFAM: glucose-methanol-choline
FT                   oxidoreductase; GMC oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70907"
FT                   /db_xref="GOA:B1J2K8"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR011533"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2K8"
FT                   /protein_id="ACA70907.1"
FT                   /translation="MEYDYIIVGAGSAGNTLATRLTEDASVTVLLLEAGGPDYRFDFRT
FT                   QMPAALAFPLQGRRYNWAYETDPEPHMDGRRMECGRGKGLGGSSLINGMCYIRGNALDF
FT                   DGWAKLPGLEDWAYLDCLPYFRKAETRDIGPNDYHGGEGPLSVATPKAGNNPLFNAMVE
FT                   AGVQAGYPRTEDLNGYQQEGFGPMDRSVTKNGRRSSTARGYLDQAKKRPNLTIVTHALS
FT                   DRVLFEGKRAVGVTYLVGDSEERVEARARKEVIVSSGAIASPQLLQRSGVGPRALLESL
FT                   DIPVVHDLPGVGENLQDHLELYLQYACTQPVSLYPSLLWWNQPAIGAEWLFNGTGIGAS
FT                   NQFEAGGFIRTRPEFEWPNIQYHFLPVAINYNGSNGVKEHGFQAHMGSMRSPSRGRIQV
FT                   KSKDPRQHPSILFNYMATEQDWQEFRDGIRLTREIMAQPALDPYRGREISPGAHVQTDE
FT                   ELDKFIREHAETAFHPSCSCKMGTDDMAVVDGEGRVHGMQGLRVVDASIMPIIITGNLN
FT                   ATTIMIAEKISDKIRNRKPLPRSTAKYYVANGAPVKGKPMREVKQA"
FT   gene            complement(431220..432692)
FT                   /locus_tag="PputW619_0402"
FT   CDS_pept        complement(431220..432692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0402"
FT                   /product="betaine aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.8"
FT                   /note="KEGG: pen:PSEEN0373 NAD+-dependent betaine aldehyde
FT                   dehydrogenase; TIGRFAM: betaine aldehyde dehydrogenase;
FT                   PFAM: Aldehyde Dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70908"
FT                   /db_xref="GOA:B1J2K9"
FT                   /db_xref="InterPro:IPR011264"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1J2K9"
FT                   /protein_id="ACA70908.1"
FT                   /translation="MARFGTQKLYIDGGYVDAGSDATFEAINPATGEVLAHVQRATQAD
FT                   VEKAVESAERGQKIWAAMTAMQRSRILRRAVDILRERNDELAMLETLDTGKSYSETRYV
FT                   DIVTGADVLEYYAGLVPAIEGEQIPLRESSFVYTRREPLGVTVGIGAWNYPIQIALWKS
FT                   APALAAGNAMIFKPSEVTSLTTLKLAEIYTEAGLPDGVFNVLTGSGREVGTWLTEHPRI
FT                   EKVSFTGGTTTGKKVMASASSSSLKEVTMELGGKSPLIICADADLDKAADIAMMANFYS
FT                   SGQVCTNGTRVFIPAQMKAAFEAKIAERVARIRAGNPEDENTNFGPLVSFQHMESVLGY
FT                   IAKGKQEGARVLCGGERLTEGDFAKGAFVAPTVFTDCTDDMTIVKEEIFGPVMSILTYE
FT                   TEEEVIRRANDTEYGLAAGVCTNDITRAHRIIHKLEAGICWINAWGESPAEMPVGGYKQ
FT                   SGVGRENGISSLAQYTRIKSVQVELGGYSSVF"
FT   gene            complement(432731..433387)
FT                   /locus_tag="PputW619_0403"
FT   CDS_pept        complement(432731..433387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0403"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="TIGRFAM: transcriptional repressor BetI; PFAM:
FT                   regulatory protein TetR; KEGG: pen:PSEEN0374
FT                   transcriptional regulator BetI"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70909"
FT                   /db_xref="GOA:B1J2L0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017757"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2L0"
FT                   /protein_id="ACA70909.1"
FT                   /translation="MPKVGMQPIRRQQLIEATLQAVDQVGLGDASIALIARLAGVSNGI
FT                   ISHYFQDKNGLIAATMRYIMNMLNEGVIARRQALTDDSPRAHLRVIIEGNFDASQVNGP
FT                   AMKTWLAFWASSMHQPSLHRLQRINDHRLYSNLCCQFRRAMPLDEARTAARGLAALIDG
FT                   LWLRGALSGDAFDTDQAIQIAYEYLELQLAKQQRPDTQPPASEKMRTALAQPAGA"
FT   gene            433864..435867
FT                   /locus_tag="PputW619_0404"
FT   CDS_pept        433864..435867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0404"
FT                   /product="choline/carnitine/betaine transporter"
FT                   /note="TIGRFAM: choline/carnitine/betaine transporter;
FT                   PFAM: BCCT transporter; KEGG: pen:PSEEN0375 choline
FT                   transporter BetT"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70910"
FT                   /db_xref="GOA:B1J2L1"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2L1"
FT                   /protein_id="ACA70910.1"
FT                   /translation="MSSASLTKPPAERVRVNRVVFFTSALMILVLTALLIAVPETAGQV
FT                   LGVAQKWLTRTFGWYYMLVICGYLLFVVYLAFSDYGKLKLGGKDDQPDFSYGAWAGMLF
FT                   SSGIGISLLYFGASEPLDHYFNPPQGTPASLEAARQGLQLTFLHWGLHGWAIYALVGLA
FT                   VGYFAYRHNQPLALRSALYPLVGERWVKGAAGNAVDIFGMFVTLLGLVTNLGIGAMQVS
FT                   SGLEYLFGMDHSQTSLLVVILVMAGVATVAAVSGVENGIRRLSNLNIMLFSGLLIFVLL
FT                   GGETLHLLNGLVQNVGDYLNGIVLKTFDLYVYEGEAGNSERWLGLWTVFYWAWWISWGP
FT                   FVGMFIARISKGRTVRQLVCGVLLIPLGFTLAWLSIFGNTALDLVINQGAVELGKTALE
FT                   QPSMSIYQLLEYFPAAKIVIGVAVFVGFVLFLTPADSGAVMMANLSCKGGKVDEDAPHW
FT                   MVVFWSVIITLVTIGLLFAGNFEAMQTMVVLAGLPFSVVLVLFMFGLYKAMKQDVAVEQ
FT                   ERAELAARGRRGFSERLSQLELQPTQAVVQRFMDRQVSPALKEAAEQLRTLGFDVESRV
FT                   GQSRNMMGLRVMMEEGNPFVYEVSLDGYMAAPSDAPVEGEPEVRQRFYRAEVYLHDGSQ
FT                   EYDLMGFAPEQIVRDVLDQFESHRQLLGRVYS"
FT   sig_peptide     433864..433992
FT                   /locus_tag="PputW619_0404"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.890) with cleavage site probability 0.580 at
FT                   residue 43"
FT   gene            435987..440654
FT                   /locus_tag="PputW619_0405"
FT   CDS_pept        435987..440654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0405"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN0376 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70911"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2L2"
FT                   /protein_id="ACA70911.1"
FT                   /translation="MPIQPSPVPDFRRAVATEFLSRPTLRSVLSQQVLELLVPCHATLA
FT                   GAGLPDAESLILNIPAHIASGPQTYDAWTPRPLLEVMLEALHARQPLASLGADGGDFLL
FT                   AVREPWFLRDQAGNPLPSGAISIGAQLAELDDLLLLLADSFCQAQVDFWKAPGSQGVSR
FT                   DLWLQHLLKRVLLHNLPLQGLDEQQRQCLLSLLKNHGSTPSVFLVQVQLDKDVQWLPNL
FT                   LVRGEWDEREVFLWCAPSSLVRAFSSLDLFAKALRDELAERQRFESMAWHRYELEGDVF
FT                   AQQSSLLLEIMLDDIERLRYAQLPNCSLLERDFAALSDPARWFIEGYGQASGAQIALPP
FT                   GLRHSSAANGFAYQRGVFELALAQAQSEGSGALEDVLDLRSYTRQVLRAQMLADFPVEA
FT                   NYFSDDLDLQLTINAGWPGGAGVGPGDSTVEHRSMTLTEFAIGNLWSLQNAQLTAVTHR
FT                   ENQLIMDWMNADYVKSLVQRVDIGKHYPTYVARKLDDPATQAERIKRFGREWRCSLLFS
FT                   ALYARLQGELSDAGLQCVTDFCHGYLDPQLPALMLMPLAFRREAGEIEQDEVSGMYVLF
FT                   ATEPARVLLYRPLYNETPLLEFASLDLMMAAIRRPGPLQDSVLEWMSPASRAVYAYGGF
FT                   YEPHWPGPILNTQLLPERGHPPTFAAQFWRNDVDVKLYMANRNLLVELADRESVSNAES
FT                   RWAILVRGAWLLFDVVTLMLRGPVAGVAWLVQAISGLHNDLAALRDGSAFERSAAVVDL
FT                   LLNACMALMHLRLPQLPLGEPVQNIPRRGAMPAWGGAEALVVPVQGKVGVPGGLAQHGS
FT                   TRLDFSWRGAQGFNVLSPQQRKVVSGMRVEQSLEGLEPLAAGPGRGLYRVGEHYYLTLG
FT                   DGVYRATFEEQGLRMVGADGVMGPWLAFEHGQWRVDRGLRLRGGMPRSRLEALKEENRK
FT                   KVEQLKSEESVLANQHNALAETLNRHRDLLNEKDKRIAVLEAVTEPDELTTRELELTRR
FT                   LRKQIHLKIIYEVKGLAESSLKHEQVINSLFNMRHEDSAYSIVVAGQRSLIRQSLIENI
FT                   SVFYNEMAKIINAEDLANLAEQVVIHPESEEEISQYKHFRSVLEEVIQWEVDLVDMSRL
FT                   LDALLEETLKDDTFVFKDDDTQERINKDNELKGTIEARRLSAIDLDFRLLQDLAEASLE
FT                   RLADVEERVLSQYLDYLAGDSLKSAGNAHGDLAGSELSLAERIEVLSGILEGYEEAAAM
FT                   ADYLGSVGGAAIRQEALQLYKKTLHGLQRAAQGDLAQAVREQELCEPAPPRPTVYAPRG
FT                   GRRKLVRTQRGRKVLAQEVEVDGVAIVQQRDERTQHVLKTFHQRGSEWVEDVPQPAESE
FT                   PPFSPLEPRLARKRAQALLAEVERINKLARSFFQAEQPNSLATVVDGHLEKLRHALSTL
FT                   PRMSPEDALFENLGEAIERLQATRRDLLTGIYLSTDHPDARSLKFLLDNNQVTVQRAGP
FT                   RKALAAGDYLDVYEVRRLPRAGQGQGDGLWEAHFHYPDIGTPARQFSKGHLKLWAQRKL
FT                   GRLAQLRAATSGEDLVAIYRGDLRLNQVEGLIPFE"
FT   gene            complement(440660..441439)
FT                   /locus_tag="PputW619_0406"
FT   CDS_pept        complement(440660..441439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0406"
FT                   /product="protein of unknown function DUF610 YibQ"
FT                   /note="PFAM: protein of unknown function DUF610 YibQ; KEGG:
FT                   pen:PSEEN0377 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70912"
FT                   /db_xref="GOA:B1J2L3"
FT                   /db_xref="InterPro:IPR006837"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2L3"
FT                   /protein_id="ACA70912.1"
FT                   /translation="MIHPMRYLLPVLLCLSAAFAHAAPAKKAYMSIIIDDLGQSTERDS
FT                   RTLALPGPVTMAIMPDTPHASEFARQAHKAGKTVILHMPMDPATGPYAWHPDIALPELA
FT                   RRLDAALAKVPYAAGINNHMGSRMTAQRGAMTWLMGELQRRHLFFVDSRTSAATVAAAE
FT                   AQAQALGHVSRDVFLDDVRTTEAITTQLQQGVALARRQGSAVLIGHPYPQTLQVLEQEM
FT                   PRLRSQGIELVTLTQMIAERGNQAMPAHGKHGRYSNR"
FT   sig_peptide     complement(441371..441439)
FT                   /locus_tag="PputW619_0406"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 23"
FT   gene            complement(441436..442749)
FT                   /locus_tag="PputW619_0407"
FT   CDS_pept        complement(441436..442749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0407"
FT                   /product="carboxyl-terminal protease"
FT                   /EC_number="3.4.21.102"
FT                   /note="KEGG: pen:PSEEN0378 carboxy-terminal processing
FT                   protease precursor; TIGRFAM: carboxyl-terminal protease;
FT                   PFAM: PDZ/DHR/GLGF domain protein; peptidase S41"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70913"
FT                   /db_xref="GOA:B1J2L4"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2L4"
FT                   /protein_id="ACA70913.1"
FT                   /translation="MLHSPRLTQLALTIALATGMPLAIAAEPAPAAVPATEVTAKAPLP
FT                   LEELRTFAEVMDRIKAAYVEPVDDKTLLENAIKGMLSNLDPHSAYLGPEDFQELQESTS
FT                   GEFGGLGIEVGQEDGFVKVVSPIDDTPASRAGVQAGDLIVKINGAPTRGQSMTEAVDKM
FT                   RGKVGEKITLTLVRDGGTPFDVNLVRAVIQVKSVKSQLLENDYGYIRITQFQVKTGDEV
FT                   GKALAKMRKDNGKKLRGVVLDLRNNPGGVLQSAVEVADHFLTKGLIVYTKGRIANSELR
FT                   FSADPADASEAVPLVVLINGGSASASEIVAGALQDQKRAVLMGTDSFGKGSVQTVLPLA
FT                   NDRALKLTTALYFTPNGRSIQAQGIVPDIEVRPAKLTAEVDTENFKEADLQGHLGNGNG
FT                   GADRPTGSSKRKERPQDDDFQLSQALSLLKGLNITSGK"
FT   sig_peptide     complement(442672..442749)
FT                   /locus_tag="PputW619_0407"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.971 at
FT                   residue 26"
FT   gene            complement(442842..444128)
FT                   /locus_tag="PputW619_0408"
FT   CDS_pept        complement(442842..444128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0408"
FT                   /product="peptidase M23B"
FT                   /note="PFAM: peptidase M23B; KEGG: pen:PSEEN0379
FT                   metalloendopeptidase, M23/M37 family"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70914"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2L5"
FT                   /protein_id="ACA70914.1"
FT                   /translation="MLRALILLALSCLLSPAFADERAQTQQQLDATRQDIAELKKTLGK
FT                   LQEEKSGVQKDLKATETDIGNLEKQVEALQQELKKTEGELERLDTEKKKLQSSRIEQQR
FT                   LIAIQARSAYQNNGREEYLKLLLNQQNPEKFARTLSYYDYLSKARMEQLRAFNETLRQL
FT                   ANVEQDISRQQEQLLAQRADLDSRRQALEAERGKRQQVLAKLNSDMKDRDKKLQAREQD
FT                   QADLAKVLKTIEETLARQAREAEEARKKALLAEQEAQKRRQQQALAAQQDSEPPKKART
FT                   TLGPLVSSDSSTYGGAFSAARGKLPWPVNGRLLARFGEARGSDARAKWDGVMISANPGT
FT                   QVRAVHGGRVVFADWLRGAGLLVILDHGNGYLSLYGHNQSLLKSAGDIVKAGEAISTVG
FT                   DSGGQDAAGLYFAIRQQGRPTDPSQWCRG"
FT   sig_peptide     complement(444069..444128)
FT                   /locus_tag="PputW619_0408"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 20"
FT   gene            complement(444291..445826)
FT                   /locus_tag="PputW619_0409"
FT   CDS_pept        complement(444291..445826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0409"
FT                   /product="phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent"
FT                   /note="KEGG: pen:PSEEN0380 phosphoglycerate mutase;
FT                   TIGRFAM: phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent; PFAM: metalloenzyme
FT                   domain protein; BPG-independent PGAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70915"
FT                   /db_xref="GOA:B1J2L6"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2L6"
FT                   /protein_id="ACA70915.1"
FT                   /translation="MTSTPKPLVLIILDGFGHSENPEYNAIYAANTPVYDHLRATAPHG
FT                   LISGSGMDVGLPDGQMGNSEVGHMNLGAGRVVYQDFTRVTKAIRDGDFFENPVLTGAVD
FT                   QAAGAGKAVHILGLLSDGGVHSHQDHLIAMAELAAQRGAEKIYLHAFLDGRDTPPRSAQ
FT                   SSIELLDSTFAKLGKGRIASLIGRYYAMDRDNRWDRVSAAYNLIVDSVAEHTADSAIAG
FT                   LEAAYARDESDEFVKATRIGEAVKVEDGDAVIFMNFRADRARELSRVFVEADFNEFPRA
FT                   RLPKLAAYIGLTQYSAKIPAPAAFAPASLNNVLGEYLAKNGKTQLRIAETEKYAHVTFF
FT                   FSGGREEPFEGEKRILIPSPKVATYDMQPEMSAPEVTDRIVEAIEQQRYDVIVVNYANG
FT                   DMVGHTGVFDAAVKAVEALDGCVGRIVGALDKVGGEALITADHGNVEQMEDECTGQAHT
FT                   AHTTEPVPFIYVGKRQVKVREGGVLADVAPTMLKLLGLEKPAEMTGTSILVDD"
FT   gene            446033..446446
FT                   /locus_tag="PputW619_0410"
FT   CDS_pept        446033..446446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0410"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: pen:PSEEN0381
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70916"
FT                   /db_xref="GOA:B1J2L7"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2L7"
FT                   /protein_id="ACA70916.1"
FT                   /translation="MVAHLIQFATDHYILVAIFVVLLVLLLLNEIRRGGQSLSNGQLTA
FT                   LVNAEKGLVIDIRPAKEYSAGHIVGAVNIPQDKVATRMTELDKHKEKTLIVVDAMGQQS
FT                   GTICRELLKAGYNAAKLSGGVSSWKADNLPLVK"
FT   gene            446448..446702
FT                   /locus_tag="PputW619_0411"
FT   CDS_pept        446448..446702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0411"
FT                   /product="glutaredoxin 3"
FT                   /note="TIGRFAM: glutaredoxin 3; PFAM: glutaredoxin; KEGG:
FT                   pen:PSEEN0382 glutaredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70917"
FT                   /db_xref="GOA:B1J2L8"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011900"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2L8"
FT                   /protein_id="ACA70917.1"
FT                   /translation="MNDVIVYSSDYCPYCMRAKYLLQSKGVAFEEIKVDGKPQVRAEMT
FT                   QKAGRTSVPQIWIGSKHVGGCDDLYALERAGKLDALLKA"
FT   gene            446742..447227
FT                   /locus_tag="PputW619_0412"
FT   CDS_pept        446742..447227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0412"
FT                   /product="protein-export protein SecB"
FT                   /note="TIGRFAM: protein-export protein SecB; PFAM: protein
FT                   export chaperone SecB; KEGG: pen:PSEEN0383 preprotein
FT                   translocase chaperone subunit SecB"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70918"
FT                   /db_xref="GOA:B1J2T8"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1J2T8"
FT                   /protein_id="ACA70918.1"
FT                   /translation="MTDQQTNGAAAEDNSPQFSMQRIYVRDLSFEAPKSPQIFRQTWEP
FT                   SVALDLNTKQKALEGDFHEVVLTLSVTVKNGDEVAFIAEVQQAGIFLIKNLDASSMSHT
FT                   LGAFCPNILFPYARETLDSLVTRGSFPALMLSPVNFDALYAQEMQRMQEAGEAPTVQ"
FT   gene            complement(447298..447759)
FT                   /locus_tag="PputW619_0413"
FT   CDS_pept        complement(447298..447759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0413"
FT                   /product="RNA methyltransferase, TrmH family, group 2"
FT                   /note="TIGRFAM: RNA methyltransferase, TrmH family, group
FT                   2; PFAM: tRNA/rRNA methyltransferase (SpoU); KEGG:
FT                   pen:PSEEN0384 RNA methyltransferase, TrmH family, group 2"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70919"
FT                   /db_xref="GOA:B1J2T9"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2T9"
FT                   /protein_id="ACA70919.1"
FT                   /translation="MFHVILFQPEIPPNTGNIIRLCANSGCALHLIEPISFELDDKRLR
FT                   RAGLDYHEYATLKRHESLARCLENLGNPRLFAFTTKGSHPFHEVAYQPGDAFLFGPESR
FT                   GLPAEVLDSLPAEQRLRLPMMPGCRSLNLSNTVAVTVYEAWRQQGFAGS"
FT   gene            447758..448195
FT                   /locus_tag="PputW619_0414"
FT   CDS_pept        447758..448195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0414"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN0385 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70920"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2U0"
FT                   /protein_id="ACA70920.1"
FT                   /translation="MHGSKREDGEHSTPEPDVRSKGLPKVLLSLAIVGLMVGLMIGRLT
FT                   APEALVLEQVEVVQDGLDLWFNDEPKLHGENVQGTVALLFQADGKAQRGQLTLQGKPVS
FT                   WRLQKSDEGLLLSVIAARPLRGEWAGAEDAGRWRVQVRLHE"
FT   gene            complement(448554..449990)
FT                   /locus_tag="PputW619_0415"
FT   CDS_pept        complement(448554..449990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0415"
FT                   /product="nitrogen metabolism transcriptional regulator,
FT                   NtrC, Fis Family"
FT                   /note="KEGG: pen:PSEEN0386 two-component response regulator
FT                   NtrC; TIGRFAM: nitrogen regulation protein NR(I); PFAM:
FT                   response regulator receiver; sigma-54 factor interaction
FT                   domain-containing protein; helix-turn-helix Fis-type;
FT                   ATPase associated with various cellular activities AAA_5;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70921"
FT                   /db_xref="GOA:B1J2U1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010114"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2U1"
FT                   /protein_id="ACA70921.1"
FT                   /translation="MSRSETVWIVDDDRSIRWVLEKALQQEGMTTQSFDSADGVMGRLA
FT                   RQQPDVIISDIRMPGASGLDLLAQIRDQHPRLPVIIMTAHSDLDSAVASYQGGAFEYLP
FT                   KPFDVDEAVSLVKRANQHAQEQQGLDVPQALARTPEIIGEAPAMQEVFRAIGRLSHSNI
FT                   TVLINGESGTGKELVAHALHRHSPRAASPFIALNMAAIPKDLMESELFGHEKGAFTGAA
FT                   NLRRGRFEQADGGTLFLDEIGDMPADTQTRLLRVLADGEFYRVGGHVPVKVDVRIIAAT
FT                   HQNLESLVQAGKFREDLFHRLNVIRIHIPRLADRREDIPALARHFLGRAAQELAVEPKL
FT                   LKPETEEFIRNLPWPGNVRQLENTCRWITVMASSREVLIGDLPPELLNLPQDAAPVTNW
FT                   EQALRQWADQALARGQSNLLDSAVPSFERIMIETALKHTAGRRRDAAVLLGWGRNTLTR
FT                   KIKELGMNVDGGDDDEGDDH"
FT   gene            complement(449987..451072)
FT                   /locus_tag="PputW619_0416"
FT   CDS_pept        complement(449987..451072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0416"
FT                   /product="signal transduction histidine kinase, nitrogen
FT                   specific, NtrB"
FT                   /note="KEGG: pen:PSEEN0387 sensory box histidine kinase
FT                   NtrB; TIGRFAM: PAS sensor protein; PFAM: ATP-binding region
FT                   ATPase domain protein; histidine kinase A domain protein;
FT                   PAS fold domain protein; SMART: PAS domain containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70922"
FT                   /db_xref="GOA:B1J2U2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2U2"
FT                   /protein_id="ACA70922.1"
FT                   /translation="MTISDAQHRLLLDNLTTATLLLNAELRLEYMNPAAEMLLAVSGQR
FT                   SHGQFISELFTESSEALNSLRQAVEQAHPFTKREAQLTSLTGQTITVDYAVTPILHQGN
FT                   TLLLLEVHPRDRLLRITKEEAQLSKQETTKMLVRGLAHEIKNPLGGIRGAAQLLARELL
FT                   EDGLRDYTNVIIEEADRLRNLVDRMLGSNKLPSLAMTNIHEVLERVCSLVDAESQGCIT
FT                   LVRDYDPSLPDVLIDREQMIQAVLNIVRNAMQAISSQNELRLGRITLRSRAMRQFTIGH
FT                   VRHRLVARVEIIDNGPGIPSELQDTLFYPMVSGRPDGTGLGLAITQNIISQHQGLIECE
FT                   SHAGHTAFSIFLPLEQGATAS"
FT   gene            complement(451330..451545)
FT                   /pseudo
FT                   /locus_tag="PputW619_0417"
FT   gene            complement(451615..453021)
FT                   /locus_tag="PputW619_0418"
FT   CDS_pept        complement(451615..453021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0418"
FT                   /product="glutamine synthetase, type I"
FT                   /note="TIGRFAM: glutamine synthetase, type I; PFAM:
FT                   glutamine synthetase catalytic region; glutamine synthetase
FT                   beta-Grasp; KEGG: pfl:PFL_0386 glutamine synthetase, type
FT                   I"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70923"
FT                   /db_xref="GOA:B1J2U3"
FT                   /db_xref="InterPro:IPR001637"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2U3"
FT                   /protein_id="ACA70923.1"
FT                   /translation="MSKSVQLIKDHDVKWIDLRFTDTKGTQHHVTMPARDGLDEDFFEV
FT                   GKMFDGSSIAGWKGIEASDMILMPVDDTAVLDPFTEEPTLIITCDIVDPSSMQGYDRDP
FT                   RAIAKRAEEYLKSTGIGDTVFAGPEPEFFIFDEVKFQSDISGSMFKIFSEQGSWMTGAD
FT                   VEGGNKGHRPGVKGGYFPVPPFDHDHEIRTAMCNALEEMGQTVEVHHHEVATAGQNEIG
FT                   VKFNTLVKKADEVQALKYVVHNVADAYGRTATFMPKPLYGDNGSGMHVHMSIWKDGKNT
FT                   FAGEGYAGLSETALYFIGGIIKHGKALNGFTNPSTNSYKRLVPGFEAPVMLAYSARNRS
FT                   ASIRIPYVGSPKARRIEARFPDPSANPYLAFAALLMAGLDGIQNKIHPGDAADKNLYDL
FT                   PPEEAKDIPQVCGSLKEALEELDKGRAFLTKGGVFSDDFIDAFIELKSEEEIKVRTFVH
FT                   PLEYELYYSC"
FT   gene            453493..454947
FT                   /locus_tag="PputW619_0419"
FT   CDS_pept        453493..454947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0419"
FT                   /product="thiamine biosynthesis/tRNA modification protein
FT                   ThiI"
FT                   /note="TIGRFAM: thiamine biosynthesis/tRNA modification
FT                   protein ThiI; PFAM: thiamine biosynthesis protein; THUMP
FT                   domain protein; ExsB family protein; KEGG: pen:PSEEN0391
FT                   thiamine biosynthesis protein ThiI"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70924"
FT                   /db_xref="GOA:B1J2U4"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR003720"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020536"
FT                   /db_xref="InterPro:IPR026340"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2U4"
FT                   /protein_id="ACA70924.1"
FT                   /translation="MKLIVKVFPEITIKSRPVRKRFIRQLGKNIRNVLKDLDPELAVDG
FT                   VWDNLEVVTRVEDEKVQREMIERLTCTPGITHFLQVEEYPLGDFDDIVAKCKQHFGHLL
FT                   GGKYFAVRCKRGGHHDFTSMDVDRYVGSQLRQQCGAAGIELKQPEVTVRIEIRNQRLYV
FT                   IHNQHQGIGGYPLGALEQTLVLMSGGFDSTVAAYQMMRRGLMTHFCFFNLGGRAHELGV
FT                   MEVAHYLWKKYGSSQRVLFISVPFEEVVGEILNKVDNSYMGVTLKRMMLRGAARMADRL
FT                   EIDALVTGEAISQVSSQTLPNLSIIDSATDKLVLRPLLASHKQDIIDQATEIGTADFAK
FT                   HMPEYCGVISVNPTTHAKRHRMEHEEKQFDMAVLERALERAKFISIDHVIDELGKDVEI
FT                   EEVSEALPGQIVIDIRHPDAQEDEPLVLEGIEVQVMPFYAINSKFKQLDETRQYLLYCD
FT                   KGVMSRLHAHHLLSEGHANVRVYRPA"
FT   gene            455074..456894
FT                   /locus_tag="PputW619_0420"
FT   CDS_pept        455074..456894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0420"
FT                   /product="GTP-binding protein TypA"
FT                   /note="TIGRFAM: small GTP-binding protein; GTP-binding
FT                   protein TypA; PFAM: elongation factor G domain protein;
FT                   protein synthesis factor GTP-binding; elongation factor Tu
FT                   domain 2 protein; KEGG: pen:PSEEN0392 regulatory protein
FT                   TypA"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70925"
FT                   /db_xref="GOA:B1J2U5"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2U5"
FT                   /protein_id="ACA70925.1"
FT                   /translation="MIENLRNIAIIAHVDHGKTTLVDKLLRQSGTLERNELNDERVMDS
FT                   NDQEKERGITILAKNTAINWNGYHINIVDTPGHADFGGEVERVMSMVDSVLLLVDAQDG
FT                   PMPQTRFVTKKAFEAGLKPIVVINKVDRPGARPDWVLDQIFDLFDNLGATDEQLDFKVV
FT                   YASALNGIAGLDHTAMAEDMTPLYQSIVDNVPAPDVDREGPFQMQISALDYNSFLGVIG
FT                   VGRIARGRVKPNTPVVAIDTNGKKRNGRILKLMGHHGLHRVDVEEAQAGDIVCISGFDE
FT                   LFISDTLCDPTAVEAMKPLTVDEPTVSMTFQVNDSPFCGKEGKFVTSRNIKDRLDKELL
FT                   YNVALRVQETDSPDKFKVSGRGELHLSVLIETMRREGFEMAVGRPEVIIREVGGVKQEP
FT                   FENVTIDIPEESQGKVMEEMGLRKGDLTNMVPDGKGRVRLEYNIPARGLIGFRNQFLTL
FT                   TNGAGILTSIFDRYDTMKSGQMSGRLNGVLVSVETGKALTYSLETLQARGKLFVEHGQE
FT                   IYNGQIIGLNSRDNDLGVNPTKGKKLDNMRASGKDEVIALVPPVRHTLEQALEFIQDDE
FT                   LCEVTPKSIRLRKKILDEGERTRAAKKAKN"
FT   gene            complement(457041..457445)
FT                   /locus_tag="PputW619_0421"
FT   CDS_pept        complement(457041..457445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0421"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="PFAM: protein of unknown function UPF0153; KEGG:
FT                   pen:PSEEN5108 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70926"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2P5"
FT                   /protein_id="ACA70926.1"
FT                   /translation="MKTTLIAAAEVDRLETWQRYASHMCGGCHSTCCTLPVEVKIKDLI
FT                   RIGVVDEFEKDEPPKNVAKRLQKEGIIERFNQKSGIFTLTRMSNDDCMYLDRKSRLCTI
FT                   YDKRPDTCRNHPKVGPRPGYCAYKPKATTR"
FT   gene            457632..460082
FT                   /locus_tag="PputW619_0422"
FT   CDS_pept        457632..460082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0422"
FT                   /product="glycogen/starch/alpha-glucan phosphorylase"
FT                   /EC_number="2.4.1.1"
FT                   /note="KEGG: pen:PSEEN5107 glycogen phosphorylase; TIGRFAM:
FT                   glycogen/starch/alpha-glucan phosphorylase; PFAM: glycosyl
FT                   transferase family 35"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70927"
FT                   /db_xref="GOA:B1J2P6"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2P6"
FT                   /protein_id="ACA70927.1"
FT                   /translation="MSQEPKARDAEVADFRAAVLDKLTYAVGKDPEHAFDHDWFEAIAL
FT                   AARDHMVDHWMDHTRQAYRRSQKRVYYLSLEFLIGRLLYDSLSNLGLLDIARDALEGLD
FT                   VDLERIRLLEPDAALGNGGLGRLAACFMESMSTLGIAAHGYGIRYEHGLFRQAMVDGWQ
FT                   QEQTENWLDFGNPWEFERAEVIYPISFGGSVETVQDTHGQQRQVWWPGETVRAVAYDTP
FT                   VVGWRGSSVNTLRLWRARALEELHLERFNAGDHLGAVAEVARAESISRVLYPADSTEAG
FT                   QELRLRQEYFFVSASLQDLLRRHLNMHKDLLNLPDAAAIQLNDTHPSIAVAELMRLLVD
FT                   QHEIPWEKAWELTVGTLAYTNHTLLPEALETWPVALMERMLPRHMQIIYLINAYHIDAL
FT                   RAKGLHDFDVLRAVSLIEEDNGRRVRMGNLAFLGSHSVNGVSALHSRLMKSTVFAELHK
FT                   LYPQRINNKTNGITFRRWLYQSNPQLTAMLVEALGPELLDDPQGRLANLVPFADKGGFL
FT                   KQFAAQRLHSKRALAGIIQDRVGVTVNPEALFDVQVKRIHEYKRQLLNLLHTVALYQAI
FT                   RNDPGTNWVPRVKIFAGKAAASYHQAKLIIKLANDIARVVNNDPTVRGLLKVVFLPNYN
FT                   VSLAESIIPAADLSEQISTAGYEASGTSNMKFGLNGALTIGTLDGANVEMCEQVGADNM
FT                   FIFGLTAQQVEARKRDGDFGAVAAIAASHRLNDVLQAIRSGVFSPDDPSRYAGLIDGLV
FT                   AYDRFLVCADFDAYWDAQRRVEELWHTPQAWWRMAVLNTARMGWFSSDRTIREYATEIW
FT                   KVLD"
FT   gene            460248..461258
FT                   /locus_tag="PputW619_0423"
FT   CDS_pept        460248..461258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0423"
FT                   /product="Inositol phosphatase/fructose-16-bisphosphatase"
FT                   /note="PFAM: Inositol
FT                   phosphatase/fructose-16-bisphosphatase; KEGG: pen:PSEEN5106
FT                   fructose-1,6-bisphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70928"
FT                   /db_xref="GOA:B1J2P7"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR028343"
FT                   /db_xref="InterPro:IPR033391"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1J2P7"
FT                   /protein_id="ACA70928.1"
FT                   /translation="MSRVTLSRYLIEQTRSNNTPADLRFLIEVVARACKEISHHVSKGA
FT                   LGGVLGSMGTENVQGEVQKKLDVISNDILLEANEWGGHLAGMASEEMDNAYQIPGRYPK
FT                   GAYLLVFDPLDGSSNIDVNVSVGTIFSVLRCPNEYLSQNETLNENAFLQPGTEQVAAGY
FT                   AIYGPQTMLILTLGNGVKGFTLDRELGSFVLTHENIQVPATTAEFAINMSNQRHWEAPV
FT                   QRYVGELLAGETGPLKKNYNMRWIASMVADVHRILTRGGLFMYPRDAREPSKPGKLRLM
FT                   YEANPMSFIIEQAGGASTNGYERILDIKPESLHQRVSVILGSKEEVERVTAYHKE"
FT   gene            461262..461858
FT                   /locus_tag="PputW619_0424"
FT   CDS_pept        461262..461858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0424"
FT                   /product="protein of unknown function DUF924"
FT                   /note="PFAM: protein of unknown function DUF924; KEGG:
FT                   pen:PSEEN5105 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70929"
FT                   /db_xref="InterPro:IPR010323"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2P8"
FT                   /protein_id="ACA70929.1"
FT                   /translation="MLAPWQPLLEWWFGWGTSPQAVADEKSTLWFGKHHDAEAQALFGE
FT                   LVEHALAGGLEEWQQSPQGWLGLLILLDQLPRMIYRDTPRAFEGDRRAQVVAMQGLQKG
FT                   WDYQLLPIQRVFVLLVLEHAEVLDWQNLCVERYQVLLDEQPEANRRLFEGFLDYAEQHQ
FT                   RVIARFGRFPHRNLLLERPSTSEEMDFLLEPGSRF"
FT   gene            complement(461894..463786)
FT                   /locus_tag="PputW619_0425"
FT   CDS_pept        complement(461894..463786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0425"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Cache sensor"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   Cache domain protein; chemotaxis sensory transducer; KEGG:
FT                   pen:PSEEN5104 methyl-accepting chemotaxis transducer"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70930"
FT                   /db_xref="GOA:B1J2P9"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2P9"
FT                   /protein_id="ACA70930.1"
FT                   /translation="MTKNLKFSHKILLAAALVVAVAFTCFVLFNDYRQRQSLRSDTQTN
FT                   LQDLGRLTAGNIRTWLDSRKQLLASLAQQIAADGPGKASLDRSLALPVYASNFQLTYFG
FT                   GQDGSMQSVPVGNRAADYDPRARGWYKAASAGSETIVTEPYISASAGKLVITLATPVQQ
FT                   GGRLIGVSGVDTDLQTISNLINTLDFDGHGHAFIVNGEGKILIHPKADLALKTLADVYP
FT                   GDTPHISSGLKEVELDGRKQFISFTHVDGVPSADWYVALVVDQDAAFAMLSELRTSAIV
FT                   ATLIAILVIIALLGLLIRVLMEPLHLMGRAMHDIAEGEGDLTRRLAIHAQDEFGSLGQS
FT                   FNRFVERIHESIREVASATGQVNAVATQVVSASNASIHNADQQSSRTNSVAAAINQLGA
FT                   AAQEIAQNAALASQHSSEARGLAEDGQQVVGRTIDVMNQLSARISDSCGNIETLNAHTA
FT                   NIGQILDVISGISQQTNLLALNAAIEAARAGEAGRGFAVVADEVRNLAHRTQESAQQVQ
FT                   RLIEELQAGAQMAVSTMNQSREHSDQSVGIANQAGERLGSVTQRIGEIDGMNQSVATAT
FT                   EEQTAVVESINVDITEINTLNQEGVQNLQSTLRACTDLEHQVERLKHLVGSFRI"
FT   sig_peptide     complement(463694..463786)
FT                   /locus_tag="PputW619_0425"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.562 at
FT                   residue 31"
FT   gene            464009..464263
FT                   /locus_tag="PputW619_0426"
FT   CDS_pept        464009..464263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0426"
FT                   /product="lipoprotein"
FT                   /note="KEGG: pen:PSEEN5103 lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70931"
FT                   /db_xref="GOA:B1J2Q0"
FT                   /db_xref="InterPro:IPR007450"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2Q0"
FT                   /protein_id="ACA70931.1"
FT                   /translation="MSLRSLALLSLCVILTACSKINQENYSKLKAGMNKAEVEQLLGTP
FT                   TECSGALGMSSCTWGDEKSFISVQYAADKVLMYSGQGLK"
FT   sig_peptide     464009..464068
FT                   /locus_tag="PputW619_0426"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.743 at
FT                   residue 20"
FT   gene            464260..464832
FT                   /locus_tag="PputW619_0427"
FT   CDS_pept        464260..464832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0427"
FT                   /product="Lipocalin family protein"
FT                   /note="PFAM: Lipocalin family protein; KEGG: pen:PSEEN5102
FT                   outer membrane lipoprotein Blc"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70932"
FT                   /db_xref="GOA:B1J2Q1"
FT                   /db_xref="InterPro:IPR000566"
FT                   /db_xref="InterPro:IPR002446"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR022271"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2Q1"
FT                   /protein_id="ACA70932.1"
FT                   /translation="MTRLHLLLGLCLVMLLGGCATSANDPLAPKTAGNVDLKRYQGKWY
FT                   ELARLPMPYQSECAQSEAHYNLKPDGSYGVLNRCRTMGDEWLRAEGHANIQQPGHTDRL
FT                   WVEFDNWFTRLVPGLTKGEYWILYVDDRYRTAIVGSPDRKYLWILSRTPSLPAWERESL
FT                   LAKARQQGYDTSRLIWRMADKQIVQMH"
FT   sig_peptide     464260..464331
FT                   /locus_tag="PputW619_0427"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.672 at
FT                   residue 24"
FT   gene            complement(464866..466230)
FT                   /locus_tag="PputW619_0428"
FT   CDS_pept        complement(464866..466230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0428"
FT                   /product="formiminoglutamate deiminase"
FT                   /note="TIGRFAM: formiminoglutamate deiminase; PFAM:
FT                   amidohydrolase; KEGG: pen:PSEEN5100 hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70933"
FT                   /db_xref="GOA:B1J2Q2"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR010252"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2Q2"
FT                   /protein_id="ACA70933.1"
FT                   /translation="MSAYFAECALLPDGWASDVRIEVASDGTMTHIESGASANGAERLA
FT                   GPLLPGMPNLHSHAFQRAMAGLAEVAGNPNDSFWTWRELMYRLVGKVTPEQLQVIARQL
FT                   YIEMLKAGYTSVAEFHYVHHDQAGKAYADPAELSRRISAAAASSGIGLTLLPVLYSHAG
FT                   FGGQPPSEGQRRFINSTEQYLQLHAQLAATIAAQPAQQLGLCFHSLRAVTPAQIAQVLA
FT                   AGNQQCPIHIHIAEQQKEVDDCLAWSGLRPLQWLYEHVQVDARWCLVHATHAQADEVAA
FT                   MARSGAVAGLCLTTEANLGDGIFPAVDYLSQGGRMGIGSDSHVSLSVVEELRWLEYGQR
FT                   LRDQRRNRLYREDQPMVGRTLYEAALMGGAQALGQPVGELAVGKRADWLVLDGQDPYIA
FT                   TAGEDAILNRWLFAGSDRQVRDVMVNGHWVVRQGRHGLQEESAREYVEVLRQLLG"
FT   gene            466338..467084
FT                   /locus_tag="PputW619_0429"
FT   CDS_pept        466338..467084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0429"
FT                   /product="transcriptional regulator, histidine utilization
FT                   repressor, GntR family"
FT                   /note="TIGRFAM: histidine utilization repressor; PFAM:
FT                   regulatory protein GntR HTH; UbiC transcription
FT                   regulator-associated domain protein; KEGG: pen:PSEEN5099
FT                   histidine utilization repressor"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70934"
FT                   /db_xref="GOA:B1J2Q3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR010248"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2Q3"
FT                   /protein_id="ACA70934.1"
FT                   /translation="MPTPPVSALVAQMGEGPAPLYARVKQMIIQQIDNGSWPPHHRVPS
FT                   ESELVSQLGFSRMTINRALRELTAEGLLVRMQGVGTFVAEPKSRSALFEVNNIADEIAA
FT                   RGHQHSCQVITLAEEAAGSERALALDMREGQRVFHSLIVHYENGIPVQIEDRYVNAAIA
FT                   PDYLKQDFTRQTPYAYLSQVAPLTEGEHVVEAILAEPHECQLLQIERGEPCLLIRRRTW
FT                   SGRQPVTAARLIHPGSRHRLEGRFSK"
FT   gene            467081..467653
FT                   /locus_tag="PputW619_0430"
FT   CDS_pept        467081..467653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0430"
FT                   /product="protein of unknown function DUF886"
FT                   /note="PFAM: protein of unknown function DUF886; KEGG:
FT                   pen:PSEEN5098 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70935"
FT                   /db_xref="InterPro:IPR010282"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2Q4"
FT                   /protein_id="ACA70935.1"
FT                   /translation="MNPLQLLRAQDYPRMPWKNGGGFTEEITRDSGEGLEGFGWRLSIA
FT                   DIEASGGFSVFTGYQRIITVLQGDGMRLLVDGQASRPLLPFDAFAFAGQSQVSCKLLGG
FT                   KIRDFNLIYSPQRYRARLQWFDGTSRFFSSASTVLLFSGSNQVEVQLAGHDLERLGLYD
FT                   CLRLEGNDALLELQVQGRFCLIELIPT"
FT   gene            467911..469584
FT                   /locus_tag="PputW619_0431"
FT   CDS_pept        467911..469584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0431"
FT                   /product="urocanate hydratase"
FT                   /EC_number="4.2.1.49"
FT                   /note="KEGG: pen:PSEEN5097 urocanate hydratase; TIGRFAM:
FT                   urocanate hydratase; PFAM: Urocanase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70936"
FT                   /db_xref="GOA:B1J2Q5"
FT                   /db_xref="InterPro:IPR023636"
FT                   /db_xref="InterPro:IPR023637"
FT                   /db_xref="InterPro:IPR035085"
FT                   /db_xref="InterPro:IPR035400"
FT                   /db_xref="InterPro:IPR035401"
FT                   /db_xref="InterPro:IPR036190"
FT                   /db_xref="InterPro:IPR038364"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1J2Q5"
FT                   /protein_id="ACA70936.1"
FT                   /translation="MTDNNKYRDVEIRAPRGNKLTAKSWLTEAPLRMLMNNLDPQVAEN
FT                   PKELVVYGGIGRAARNWACYDKIVETLTRLEDDETLLVQSGKPVGVFKTHSNAPRVLIA
FT                   NSNLVPHWANWEHFNELDAKGLAMYGQMTAGSWIYIGSQGIVQGTYETFVEAGRQHYGG
FT                   SLKGKWVLTAGLGGMGGAQPLAATLAGACSLNIECQQSRIDFRLETRYVDEQAKDLDDA
FT                   LARIAKYTAEGKAISIALHGNAAEVLPELVKRGVRPDMVTDQTSAHDPLNGYLPVGWTW
FT                   EQYRDRAQTEPAAVVKAAKQSMAVHVQAMLDFQKQGIPTFDYGNNIRQMAKEEGVANAF
FT                   DFPGFVPAYIRPLFCRGVGPFRWAALSGEAEDIYKTDAKVKELIPDDAHLHRWLDMARE
FT                   RISFQGLPARICWVGLGLRAKLGLAFNEMVRSGELSAPIVIGRDHLDSGSVSSPNRETE
FT                   SMRDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGMGFSQHSGMVIVCDGTDEAAAR
FT                   IARVLTNDPGTGVMRHADAGYDIAVDCAKEQGLDLPMITG"
FT   gene            469654..471186
FT                   /locus_tag="PputW619_0432"
FT   CDS_pept        469654..471186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0432"
FT                   /product="histidine ammonia-lyase"
FT                   /EC_number="4.3.1.3"
FT                   /note="KEGG: pen:PSEEN5096 histidine ammonia-lyase;
FT                   TIGRFAM: histidine ammonia-lyase; PFAM:
FT                   phenylalanine/histidine ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70937"
FT                   /db_xref="GOA:B1J2Q6"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR005921"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR022313"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2Q6"
FT                   /protein_id="ACA70937.1"
FT                   /translation="MTELTLKPGTLTLAQLRAIHAAPVRLRLDASADQPINDSVACVEQ
FT                   ILAEDRTAYGINTGFGLLASTRIASHDLENLQRSLVLSHAAGIGAPLDDALVRLIMVLK
FT                   INSLSRGFSGIRRKVIDALIALVNAEVYPHIPLKGSVGASGDLAPLAHMSLVLLGEGKA
FT                   RYKGQWLSATEALAVAGLEPLTLAAKEGLALLNGTQASSAYALRGLFYAEDLYAAAITC
FT                   GGLTVEAALGSRSPFDARVHAVRGQRGQIDTAACFRDLLGDSSEISQSHKNCDKVQDPY
FT                   SLRCQPQVMGACLTQLRQAAEVLGIEANAVSDNPLVFAAEGDVISGGNFHAEPVAMAAD
FT                   NLALAIAEIGSLSERRISLMMDKHMSQLPPFLVENGGVNSGFMIAQVTAAALASENKAL
FT                   SHPHSVDSLPTSANQEDHVSMAPAAGKRLWEMAENTRGVLAIEWLGACQGLDLRKGLKT
FT                   SVKLEQARQALRSEVPHYDRDRFFAPDIEKAVELLAKGSLTGLLPAGVLPSL"
FT   gene            471252..472655
FT                   /locus_tag="PputW619_0433"
FT   CDS_pept        471252..472655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0433"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   pen:PSEEN5095 amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70938"
FT                   /db_xref="GOA:B1J2Q7"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2Q7"
FT                   /protein_id="ACA70938.1"
FT                   /translation="MQQAQGLKRGLSARHIRFMALGSAIGTGLFYGSASAIQMAGPAVL
FT                   LAYLIGGAAVFMVMRALGEMAVHNPVAGSFGHYATTYLGPMAGFILGWTYAFEMVIVAI
FT                   ADVTAFGIYMGFWFPEVARWIWVLGIVFLIGGLNLCNVKVFGEMEFWLSLLKVGAIVAM
FT                   ILAGLGIMAFGFSQVGTGHAVGLSNLVEHGGFMPNGVGGLIASFAVVMFAFGGIEIIGV
FT                   TAGEAKDPQRVIPKAINAVPLRILLFYVLTLFVLMCLYPWPQIGSEGSPFVQIFSNLGI
FT                   GSAAAVLNVVVISAAVSAINSDIFGAGRMMYGLAQQGHAPRAFSQLSRHGVPWMTVVVM
FT                   GAALLIGVVLNYLIPENVFLLIASIATFATVWVWLMILVTQVAMRRSMSREEAARLKFP
FT                   VPFWPYGPAMAIAFMVFIFGVLGYFPDTQAALLVGVIWVVFLVASYLLWCKPRAGQGEV
FT                   AQAAAELHR"
FT   sig_peptide     471252..471362
FT                   /locus_tag="PputW619_0433"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.896) with cleavage site probability 0.559 at
FT                   residue 37"
FT   gene            472671..473876
FT                   /locus_tag="PputW619_0434"
FT   CDS_pept        472671..473876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0434"
FT                   /product="imidazolonepropionase"
FT                   /EC_number="3.5.2.7"
FT                   /note="KEGG: pen:PSEEN5094 imidazolonepropionase; TIGRFAM:
FT                   imidazolonepropionase; PFAM: amidohydrolase; Amidohydrolase
FT                   3"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70939"
FT                   /db_xref="GOA:B1J2Q8"
FT                   /db_xref="InterPro:IPR005920"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2Q8"
FT                   /protein_id="ACA70939.1"
FT                   /translation="MRTLWQHCHVATMVDGRYSIIEDAAIVTSGGVIEWLGPRSEMRPV
FT                   EAQRTVDLGNAWVTPGLIDCHTHAVFGGNRSGEFEQRLQGVSYAEIAAQGGGIASTVRA
FT                   TRAASEDELFASARQRVQALMRDGVTTIEIKSGYGLDLANERKMLRVARRLADELPLAV
FT                   RATCLAAHALPPEYAGRADDYIAHICNQMLPALAAEGLVDAVDAFCEHLAFSPAQVEQV
FT                   FVRARELGLPVKLHAEQLSSLHGSSLAARYQALSADHLEFMTEEDAMAMGEAGTVAVLL
FT                   PGAFYFLRETQLPPMEALRRHGVRIALASDLNPGTSPGLSLRLMLNMGCTLFRMTPEEA
FT                   LAGVTIHAATALGMGDTHGSLEVGKVADFVAWQIERPADLAYWLGGDLPKRVVRKGHEI
FT                   SH"
FT   gene            473887..474690
FT                   /locus_tag="PputW619_0435"
FT   CDS_pept        473887..474690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0435"
FT                   /product="N-formylglutamate amidohydrolase"
FT                   /note="PFAM: N-formylglutamate amidohydrolase; KEGG:
FT                   pen:PSEEN5093 N-formylglutamate amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70940"
FT                   /db_xref="GOA:B1J2Q9"
FT                   /db_xref="InterPro:IPR007709"
FT                   /db_xref="InterPro:IPR010247"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2Q9"
FT                   /protein_id="ACA70940.1"
FT                   /translation="MDKVLSFHQGRLPLLISMPHAGLKLTPAVRDGLVDQARSLPDTDW
FT                   HIPRLYDFARELGASVVAAEYSRFVIDLNRPDDDKPLYAGATTGLYPSVLFEGQPLFKE
FT                   GCEPSADERKVYLERIWRPYHQLIEHELARLRSEFGYALLWDAHSIRSFIPHLFEGRLP
FT                   DFNLGTFNGASCAPALVERLQSACAQAQGYSHVLNGRFKGGHITRHYGDPGGHVHAVQL
FT                   ELAQSTYMEESIPFEYREDLAQSTQVVLHQLLTAMLAWGREHYAQ"
FT   gene            complement(474745..480288)
FT                   /locus_tag="PputW619_0436"
FT   CDS_pept        complement(474745..480288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0436"
FT                   /product="leucine-rich repeat protein"
FT                   /note="PFAM: leucine-rich repeat protein; SMART:
FT                   leucine-rich repeat-containing protein typical subtype;
FT                   KEGG: psb:Psyr_1302 leucine-rich repeat"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70941"
FT                   /db_xref="GOA:B1J2R0"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR029487"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2R0"
FT                   /protein_id="ACA70941.1"
FT                   /translation="MDLSMPSPTGKTLTSPGTPYATIEQKIPAWLKTASPDTLHPMRNW
FT                   KQAPTWLATAILQMPDIAKAWRDEHARHRDHAAQVRRLFEALPDLQSWARQQLTDAITE
FT                   RFGLTVDVDNCYLVDARLIDMANAIDSRQAIDRATRSLLHCALQNFDAAAAVEGGMDAD
FT                   GGPLKKSVILDHRRFMGTVPITNTLDIAAEGFADLCRELDLGRKYHDRLHAIYYPEATA
FT                   QLSADEAALNVYQALGRAEVSAFRQSLHFARLKGDISEVLYTTALVTPLDKLPAEPERP
FT                   AIAFSLLTLWETELTGIALITLRTSAQETVALYIPDDSETPLKEFASLEALKADLSSRL
FT                   RANIAYLDRHVADRDKASVIARLKDRLTPIGWSIRGLHERVPDPHATLYPVAQPFRHAF
FT                   QGVMAFQKAERHEKDVLFHAVPTEIVDRRAAHAHRQLIAGRVLTGLNIAGFFVPGLGEA
FT                   MMAVCLTQLACEVYEGIEAWKNDERDAAYGYLVDVVENVALMVALSAAAKALKNEGQDA
FT                   AGAPAEEHEVERIPVETPSFIEELENVELPNGEARLWKPDLTPYRSPQMLPANLEPDEH
FT                   GLLHYQGKRWLVLQGNQYIVRPAAATDEYRLVHPSRPVAHEPALRHNGAGAWLLPLEHP
FT                   LQWSRTTLVQRMGLASRQFSEETALQILRVCDVHEDVLRHALTENLRLPGLLEDTLARF
FT                   RLDQAVRRLPDRHQWPAELERVYARMPASQATGAAVIQRVYPNLPAAITEELLRNAASD
FT                   ELAALSAGKLPVRLTEEIRIFQQQVRLARAYEGLFLSSVRSGDTDRLIMHSLELLPGWP
FT                   SETRLELRQHRFWPAHRENVGPTDARYVRVITSAEAGYIVHAETGAQNPVTVHGDLCTA
FT                   IYSALPQAMTRMGIVNGAELRLQLQEGPLLPRASLRQVLGMQPVRPGYRSPMRLADGRI
FT                   GYPLSGGLPAAPGISRHILLDAVNATGLTEHTPRSADQILMIIARNGRNPQQVFGRLQQ
FT                   LVDQRMEMQSRLDDWNEGMSPESDRAAQRYNALRQAIMQHWYDTALIDGDSHTSELSLE
FT                   HVPLADIPMTLPGFFTSNIRRLRLYDLPSGTLAGWAQNERLLQRLLRQVPQLESLEISR
FT                   AYDPTATPSSFIFSIPTITEHLLGLRALSFINQNVALTSNDLSQLAQMPQLRYLDLSGN
FT                   RFAQRDSPSFHELSLDYLGLNTMQLHQWPIGLGSDALERIAHLSLRNNNLRSLPSFLFT
FT                   EAEAIQRPSSLSLEGNDINESHLQRLLLSESRMTVQVNVDHPPELTQRLERIQNERQQL
FT                   REAIEGWAQASSSNAPLTQAVLEDRQRIEVAITEFWSRQEQGLQYLRLQLEDVALEHFP
FT                   RRLPSFFGERVTALTLTRVSGSTAQLNELLGRFPNISRLTLEAHVAPMPSLPSALVRLQ
FT                   RLAHLEFRNMGLEIDQAMIEAFGRLPQLSSLDLSGNQIGAITQIPANLSSNLTSLSLTN
FT                   MNLHAWPAWCDALLPLELLDLSSNHISELPNHILENIHNPMPISSISMFDNPLSEDTIQ
FT                   RVRTFSDSQHSLSFALDIPDNLVLPESSDEGSLLDHPHFPVPYAGDDSPRLEDWALGNE
FT                   AQNEALRDCWQRLQTLESGHNLLALAGRLRNAAPYLDPTSQAAFCERVRMMLVIAATHE
FT                   HELPTMSSIAAAALPDPVTGSQTCHDGALQEFNNIELYLMSNRILTDAGDSLPAFYRRL
FT                   LQLYRIGQLELLANSRTGQGDRVSVRLAYRRELARELDLPIADSMRFRGAAMLAPGEIS
FT                   SVLERIREKENSDAFIQYMLANDDWTRRLRAEYPGQFAEIEQRFGEHVLELAALDLPLT
FT                   EELVLQQNLQNDKDHQELELLQELTRMQGRHE"
FT   gene            480482..481453
FT                   /locus_tag="PputW619_0437"
FT   CDS_pept        480482..481453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0437"
FT                   /product="proline iminopeptidase"
FT                   /EC_number="3.4.11.5"
FT                   /note="KEGG: pen:PSEEN5092 proline iminopeptidase; TIGRFAM:
FT                   proline iminopeptidase; PFAM: alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70942"
FT                   /db_xref="GOA:B1J2R1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR005944"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2R1"
FT                   /protein_id="ACA70942.1"
FT                   /translation="MQTLYPQIKPYARHDLAVEAPHVLYVDESGSPEGLPVVFIHGGPG
FT                   AGCDAQSRCYFDPNLYRIITFDQRGCGRSTPHASLENNTTWHLVEDLERIREHLGIDKW
FT                   VLFGGSWGSTLALAYAQTHPERVHGLILRGIFLCRPQEIEWFYQEGASRLFPDYWQDYI
FT                   APIPPDERNDLVKAFHKRLTGNDQIAQMHAAKAWSTWEGRTATLRPNPLVIDRFSEPQR
FT                   ALSIARIECHYFMNNAFLAPDQLIRDMPKIAHLPAVIVHGRYDVICPLDNAWALHQAWP
FT                   NSELKVIRDAGHAASEPGITDALVRAADQMARRLLDLPLEEA"
FT   gene            481450..481887
FT                   /locus_tag="PputW619_0438"
FT   CDS_pept        481450..481887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0438"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /note="PFAM: D-tyrosyl-tRNA(Tyr) deacylase; KEGG:
FT                   pen:PSEEN5091 D-tyrosyl tRNA(tyr) deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70943"
FT                   /db_xref="GOA:B1J2R2"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1J2R2"
FT                   /protein_id="ACA70943.1"
FT                   /translation="MKGLLQRVRGARVEVAGEIVGAIDQGLLVLVAVEPEDTREQADKL
FT                   LHKLLNYRVFSDEQGKMNLSLKDVGGGLLLVSQFTLAADTRSGMRPSFSTAAPPALGAE
FT                   LFDYLLQQAQGQHADVASGRFGADMQVHLVNDGPVTFLLQI"
FT   gene            482150..483889
FT                   /locus_tag="PputW619_0439"
FT   CDS_pept        482150..483889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0439"
FT                   /product="periplasmic glucan biosynthesis protein MdoG"
FT                   /note="PFAM: periplasmic glucan biosynthesis protein MdoG;
FT                   KEGG: pen:PSEEN5090 periplasmic glucans biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70944"
FT                   /db_xref="GOA:B1J2R3"
FT                   /db_xref="InterPro:IPR007444"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014438"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR023704"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1J2R3"
FT                   /protein_id="ACA70944.1"
FT                   /translation="MIVSPHKASRIPGNRLRKALMASAALVGLMSAGQLWAFNLDDVAA
FT                   KAKDLAGQKYEAPKSNLPAVFRDMKFADYQKIRFLQEKAEWAKDKTPFKLSFYHQGMHF
FT                   DTPVKINEVTATTVEEIKYDPSRFEFGDVPHDPETTKNLGYAGFRVLYPINKADKQDEI
FT                   MTLLGASYFRVVGKGHVYGLSARGLAIDTALPSGEEFPRFTEFWVEKPKPADKHLVIYA
FT                   LLDSPRSTGAYKLILRPGNDTVVDVQSRVFLRDHVSRLGIAPLTSMYLFGPNQPSKVMN
FT                   YRPALHDSEGLSIHAGNGEWLWRPLNNPKHLSVSNFSVENPRGFGLMQRHRDFKDYEDL
FT                   DDNYQKRPSAWIEPKGDWGKGTVDLVEIPTADETNDNIVAFWSPETLPEPGKPFEYDYR
FT                   MHWTIDESRFQAQELGSVTQTMRSTGDVKQSNLIRQPDGSVAFLVDFAGPALAALPEDA
FT                   AVRSQISVGDNAEVVENNLRYNPETKGWRLTLRMKIKEANKATEMRAALVRDVPVEAAK
FT                   PAEEAKHDKTAAKHGKAEKAAKAEQSANAEQPAADAASTNGTPATTEKVLTETWSYQLP
FT                   ADE"
FT   sig_peptide     482150..482263
FT                   /locus_tag="PputW619_0439"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 38"
FT   gene            483882..486455
FT                   /locus_tag="PputW619_0440"
FT   CDS_pept        483882..486455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0440"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   pen:PSEEN5089 periplasmic glucans biosynthesis protein
FT                   MdoH"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70945"
FT                   /db_xref="GOA:B1J2R4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR023725"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1J2R4"
FT                   /protein_id="ACA70945.1"
FT                   /translation="MSNSSARPESLGEYLAHLPLSDEQRAELASCTSFSELHQRLAGNA
FT                   TATTTEAVQASVGPRLTVGSAAELEDAEMLGVDGSGRLCLKIAPPIKRTRVVPEPWRTN
FT                   VLIRMWRRMTGRTNAPQPPKRELPPARWRTVGSIRRYILLTLMIGQTLVAGWYMKGILP
FT                   YQGWSFVDLDEVVNQPLWDTVVQVWPYALQTSILILFGILFCWVSAGFWTALMGFLELL
FT                   TGRDKYRISGSSAGSEPIAPEARTALVMPICNEDVPRVFAGLRATFESVAASGNLDRFD
FT                   FFVLSDTNDTDIAVAEQQAWLDVCRETKGFGRIFYRRRRRRVKRKSGNLDDFCRRWGGE
FT                   YKYMVVLDADSVMSGECLSSLVRLMEANPDAGIIQTAPKASGMDTLYARMQQFATRVYG
FT                   PLFTAGLHFWQLGESHYWGHNAIIRMKPFIEHCALAPLPGKGAFAGAILSHDFVEAALM
FT                   RRAGWGVWIAYDLPGSYEELPPNLLDELKRDRRWCHGNLMNFRLFLVKGMHPVHRAVFL
FT                   TGVMSYLSAPLWFFFLVLSTALLATNTLMEPQYFIEPYQLYPLWPQWHPEKAVALFSTT
FT                   IVLLFLPKLLSIILIWAKGAVEFGGRIKVTLSMLMEMLFSMLLAPVRMIFHTRFVLAAF
FT                   LGWAATWNSPQRDDDSTPWSEAVRRHGPQTLLGIAWAALVAWLNPSFLWWLAPIVGSLV
FT                   LSIPVSVISSRTRLGLAAKDEKLFLIPEEYATPQELLATDQYTHENRWHALHDGFVRAV
FT                   VDPRQNALACAMATARHGQAAPIEAMRAERLAKAIEVGPKGLDLGTRLALLSDPVALAR
FT                   LHAQVWAEHNAAWIDVWRASINNDPHSPLLPLHPANEAQPSLVGA"
FT   gene            486671..487471
FT                   /locus_tag="PputW619_0441"
FT   CDS_pept        486671..487471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0441"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   SMART: ionotropic glutamate receptor; KEGG: pen:PSEEN5087
FT                   amino acid ABC transporter, periplasmic amino acid-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70946"
FT                   /db_xref="GOA:B1J2R5"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2R5"
FT                   /protein_id="ACA70946.1"
FT                   /translation="MMKKYLSRLLVGVTALVAVASAQAGAIDDAVKRGTLRVGMDPTYM
FT                   PFQMTNKRGEIIGFEVDILKAMAKSMGVKLETVSTAYDGIIPALLTDKFDMIGSGMTLT
FT                   QERNLRLNFSEPFIVVGQTLLIRKDLAGEIKSYKDLNNEKYRITSKLGTTGEMVAKKLI
FT                   AKATYHGYDNEQEAVMDVVNGKADAFVYDAPYNVVAVDKAGAGKLLFLEEPFTYEPLAF
FT                   GLKKGDYDSINFINNFLHQIKHDGTYDRIHDKWFKNKDWLKEME"
FT   sig_peptide     486671..486745
FT                   /locus_tag="PputW619_0441"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.751 at
FT                   residue 25"
FT   gene            487583..488545
FT                   /locus_tag="PputW619_0442"
FT   CDS_pept        487583..488545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0442"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: pen:PSEEN5086 amino
FT                   acid ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70947"
FT                   /db_xref="GOA:B1J2R6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2R6"
FT                   /protein_id="ACA70947.1"
FT                   /translation="MIKHKKAQWPWHALTALVLVGLAISLYLATSMISYEWRWNRVPQY
FT                   FAYKAEDVQRASDYGTVQDIVVSGDNARVTLKDENGGEQVLDVAKDSLQLSRGDDVAEG
FT                   DQVGVTRHWAAGPLAWGLWTTLWISVVSGALGLVIGLFAGLCRLSNNPTLRDLSTVYVE
FT                   LVRGTPLLVQIFIFYFFIGTVLNLSREFAGVAALALFTGAYVAEIVRAGVQSIAKGQNE
FT                   AARSLGLNASQSMRHVILPQAFKRVLPPLAGQFISLVKDTSLVSVIAITELTKSGREAI
FT                   TTSFSTFEIWFCVAGLYLLINLPLSHLASRLERRLAQSD"
FT   sig_peptide     487583..487672
FT                   /locus_tag="PputW619_0442"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.901) with cleavage site probability 0.451 at
FT                   residue 30"
FT   gene            488538..489272
FT                   /locus_tag="PputW619_0443"
FT   CDS_pept        488538..489272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0443"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pen:PSEEN5085 amino acid ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70948"
FT                   /db_xref="GOA:B1J2R7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2R7"
FT                   /protein_id="ACA70948.1"
FT                   /translation="MIEVRDLLKVFDTRGQVVRAVDNVTTQVAKGEVVVVLGPSGSGKS
FT                   TFLRCLNGLEHFDEGHVAINGLRLEDPKTDINAYRREVGMVFQHFNLFPHMTVLENLCL
FT                   AQKVVRKRGKAEREAKARALLEKVGISEKANEYPSRLSGGQQQRVAIARALAMEPKVML
FT                   FDEPTSALDPEMVGEVLDVMKTLAQEGMTMVCVTHEMGFAREVADRVLFFDHGKLLEDS
FT                   APAAFFASPKDPRAQAFLRQVL"
FT   gene            complement(489390..491333)
FT                   /locus_tag="PputW619_0444"
FT   CDS_pept        complement(489390..491333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0444"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: pen:PSEEN5084
FT                   methyl-accepting chemotaxis transducer"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70949"
FT                   /db_xref="GOA:B1J2R8"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR032255"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2R8"
FT                   /protein_id="ACA70949.1"
FT                   /translation="MFGYLNRRIGNISVGAKLALGFAVVLLLTVATAASGWRALDDAIT
FT                   RSEQLSEIGRINDLVKDLRAERITYRVLADDASKAQITRILQQLDAMLTTLQQRSSVDE
FT                   SRQMLGQKLQLLQRLHENFATLQRTVESRRGLREAMQAQEQKLNGVIDELETQALLKMP
FT                   ADSQQSGLLGLMDSLTRHVDGANQQSLVPAYTFVPLEDFAKVGQAALDAADKSLGQLIQ
FT                   ALAPLGLSRAVMEQPGVELGKYRASLEQYRRAALSVEQLQNDMEQMGNELRAVSLELSK
FT                   RKVEQRDSEALAARSLLTSVAVLALLVGVAAGWLITLQITQPLRQTLAVAARIARGDLS
FT                   QVEPVDRRDEMGQLQASMQEMTLSLRELIGGIDQGVGHLSQAATQLAASSEDTKLRISQ
FT                   QRDETDQVATAMNQMSATVQEVAQNAEQASLAATNADQQAQQGDQVVTEAIGRIEQLAR
FT                   QMDDCLAAMQHLAGESQRIGSILDVIKSVSEQTNLLALNAAIEAARAGEAGRGFAVVAD
FT                   EVRGLAQRTQQSTEEIEQLIESLHSGTDEVTSLLDNSKRLTEQSVELSRKAGDALSQIT
FT                   DTVSSIQGMNQQIATASEEQSVVAEQINRSVISVRDASDQTSAASEQTAASSGELEHLG
FT                   QQLRGMVGRFSL"
FT   sig_peptide     complement(491232..491333)
FT                   /locus_tag="PputW619_0444"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.890 at
FT                   residue 34"
FT   gene            complement(491516..493432)
FT                   /locus_tag="PputW619_0445"
FT   CDS_pept        complement(491516..493432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0445"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: pen:PSEEN5082
FT                   methyl-accepting chemotaxis transducer"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70950"
FT                   /db_xref="GOA:B1J2R9"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR032255"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2R9"
FT                   /protein_id="ACA70950.1"
FT                   /translation="MFRWVTETLGNVSVNRKLGLGFGLVLLLTLAITFTGWQGMDSIID
FT                   RGDKLGNISVISQGTQELRIARQHYQRDRNEAAIGELEKALAGLDRQISIMLGQIEQPV
FT                   DHQRLQQQQEAVRKYQQAFADLKQAGQRREASRSVLGDSADKAAELTSRVQERLLQAGD
FT                   ITPYQSTVEVSALIQQARFQVRGYTYSGDANYQQTALNAIDQAMTNLKALPAKLPAEYA
FT                   ASLDDSMSALAAYRDAVNQFGSAQSASDQALQVMTDQGTVLMDNSQKMTVSQTEVRDAG
FT                   SRKAKALLASATALALVLGLLAAWAITRQIIVPLRQTLAAAERVANGDLRQDLVTTRRD
FT                   ELGQLQASMQRMTQGLRELIGGIGDGVTQIASAAEELSAVTEQTSAGVNNQKVETDQVA
FT                   TAMNEMAATVHEVARNAEQASEAALMADQQAREGDRVVSEAVAQIERLAGEVVNSSEAM
FT                   NQLKAESDKIGSVLDVIKSVAQQTNLLALNAAIEAARAGEAGRGFAVVADEVRSLAQRT
FT                   QQSTEEIEELIAGLQSGTQRVASVMDASRQLTDSSVELTRRAGTSLETITRTVSSIQAM
FT                   NQQIATAAEQQSATAEEINRSVINVRDISDQTSAASEETASSSVELARLGTHLQDLVRR
FT                   FRL"
FT   gene            complement(493533..494240)
FT                   /locus_tag="PputW619_0446"
FT   CDS_pept        complement(493533..494240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0446"
FT                   /product="protein of unknown function DUF558"
FT                   /note="PFAM: protein of unknown function DUF558; KEGG:
FT                   pen:PSEEN5081 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70951"
FT                   /db_xref="GOA:B1J2S0"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2S0"
FT                   /protein_id="ACA70951.1"
FT                   /translation="MNLLLLEEADFVSADRVVLADRRFTHMQEIHRVVVGDSLRVGRIN
FT                   GLMGTATVVRLAQHEAELEVGFDQPPPAKLPLTLVLAVPRPKMLRRLFQTVATLGVQRL
FT                   ILVNSYKVEKSFWQTPFLNPECIRDNLILGLEQARDTVLPEVVIEKRFKPFVEDRLPAI
FT                   VDGTLGLVGHPGPYPACPRAVEGPVTLAIGPEGGWIPYEVELLGKAGLAPVQLGDRILR
FT                   VETAVTALLSRIF"
FT   gene            complement(494237..495028)
FT                   /locus_tag="PputW619_0447"
FT   CDS_pept        complement(494237..495028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0447"
FT                   /product="Sec-independent protein translocase, TatC
FT                   subunit"
FT                   /note="TIGRFAM: Sec-independent protein translocase, TatC
FT                   subunit; PFAM: Sec-independent periplasmic protein
FT                   translocase; KEGG: pen:PSEEN5080 twin aqrginine translocase
FT                   protein subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70952"
FT                   /db_xref="GOA:B1J2S1"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2S1"
FT                   /protein_id="ACA70952.1"
FT                   /translation="MSEKPQDDQPMPLVSHLTELRTRLLRCVAAIFLIFAGLFSFAQQI
FT                   YTLVSAPLREHLPANATMIATDVASPFLTPFKLTMIVSLFLAIPFILQQIWGFIAPGLY
FT                   RHEKRIAIPLLVSSIFLFYAGMAFAYFLVFPLIFGFFASATPEGVSMMTDISSYLDFVM
FT                   TLFFAFGVAFEIPVAVVLLVWIGVVDVQYLKKIRPYVIIGCFVVGMILTPPDIFSQTLL
FT                   AVPMWLLFEIGVLCGSLIRKRSHAEDDTANDPNDQPPATQP"
FT   gene            complement(495025..495393)
FT                   /locus_tag="PputW619_0448"
FT   CDS_pept        complement(495025..495393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0448"
FT                   /product="twin-arginine translocation protein, TatB
FT                   subunit"
FT                   /note="TIGRFAM: twin-arginine translocation protein, TatB
FT                   subunit; PFAM: sec-independent translocation protein
FT                   mttA/Hcf106; KEGG: pen:PSEEN5079 twin-arginin translocase
FT                   subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70953"
FT                   /db_xref="GOA:B1J2S2"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR018448"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2S2"
FT                   /protein_id="ACA70953.1"
FT                   /translation="MFGMSFSELLLVGLVALLVLGPERLPGAARTAGLWIGRLKRSFNS
FT                   IKMEVEREIGADDIRRQLHNEHILQMEQEAKRILNPLTPPAPTPAAVATEQPAATPTSV
FT                   APAPAAEQPEQPQPPRAP"
FT   gene            complement(495397..495669)
FT                   /locus_tag="PputW619_0449"
FT   CDS_pept        complement(495397..495669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0449"
FT                   /product="twin-arginine translocation protein, TatA/E
FT                   family subunit"
FT                   /note="TIGRFAM: twin-arginine translocation protein, TatA/E
FT                   family subunit; PFAM: sec-independent translocation protein
FT                   mttA/Hcf106; KEGG: pen:PSEEN5078 twin-arginine translocase
FT                   subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70954"
FT                   /db_xref="GOA:B1J2S3"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2S3"
FT                   /protein_id="ACA70954.1"
FT                   /translation="MGIFDWKHWIVLLVVVVLVFGTKKLKNFGSDLGESIKGFRKAMNE
FT                   EESKPAEQTPPPAQPVPPVQNTAQQPQGHTIEGQAQPVQEPQRKD"
FT   gene            complement(495695..496030)
FT                   /locus_tag="PputW619_0450"
FT   CDS_pept        complement(495695..496030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0450"
FT                   /product="phosphoribosyl-ATP diphosphatase"
FT                   /note="TIGRFAM: phosphoribosyl-ATP diphosphatase; PFAM:
FT                   phosphoribosyl-ATP pyrophosphohydrolase; KEGG:
FT                   pen:PSEEN5077 phosphoribosyl-ATP pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70955"
FT                   /db_xref="GOA:B1J2S4"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1J2S4"
FT                   /protein_id="ACA70955.1"
FT                   /translation="MSDTLNRLAEVLEERKQAAPDSSYVASLYHKGLNKILEKLGEESV
FT                   ETIIAAKDAAVSKDYSDVIYETADLWFHSLVMLSALGQHPQAVLDELERRFGLSGHDEK
FT                   AAREPSA"
FT   gene            complement(496032..496424)
FT                   /locus_tag="PputW619_0451"
FT   CDS_pept        complement(496032..496424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0451"
FT                   /product="Phosphoribosyl-AMP cyclohydrolase"
FT                   /EC_number="3.5.4.19"
FT                   /note="PFAM: phosphoribosyl-AMP cyclohydrolase; KEGG:
FT                   pen:PSEEN5076 phosphoribosyl-AMP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70956"
FT                   /db_xref="GOA:B1J2S5"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1J2S5"
FT                   /protein_id="ACA70956.1"
FT                   /translation="MKEWLDEIKWNSDGLVPAIAQDHKTGRVLMMAWMNRESLALTAAE
FT                   QRAIYWSRSRGKLWRKGEESGHVQKLHEMRLDCDADVIILMVEQLGHIACHTGRESCFY
FT                   RVFEDGQWKTVDPVLKDPDAIYNAGH"
FT   gene            complement(496498..498117)
FT                   /locus_tag="PputW619_0452"
FT   CDS_pept        complement(496498..498117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0452"
FT                   /product="2-polyprenylphenol 6-hydroxylase"
FT                   /note="TIGRFAM: 2-polyprenylphenol 6-hydroxylase; PFAM:
FT                   ABC-1 domain protein; KEGG: pen:PSEEN5075
FT                   2-octaprenylphenol hydroxylase of ubiquinone biosynthetic
FT                   pathway"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70957"
FT                   /db_xref="GOA:B1J2S6"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1J2S6"
FT                   /protein_id="ACA70957.1"
FT                   /translation="MKLLAVRRLFRIQRVVIRYRLDDLLFDLPLPWWLRSLRLLMPWRW
FT                   LPRTPSELSRGARLRLALQDLGPIFIKFGQLLSTRRDLLPTDIADELMLLQDRVPPFDP
FT                   KQAVALIESQLGAKVGEVFSRFDVEPLASASVAQVHAARLKTGEEVVVKVVRPGLKPVI
FT                   AQDLAWLFLIAKGAERASADARRLHPVEIVGDYEKTIYDELDLLREAANASQLRRNFEG
FT                   SELMYVPQVYWDLCRPKVLVMERIYGVPVTDMATLADQRTDMKLLAERGVEVFFTQVFR
FT                   HSFFHADMHPGNIFVSTVKPWSPQYIAIDCGIVGSLTAEDQDYLARNLIAFFKRDYRRV
FT                   AELHIDSGWVPAHTKVNEFEAAIRTVCEPIFEKPLKDISFGQVLMRLFQTARRFNMEVQ
FT                   PQLVLLQKTLLNIEGLGRQLYPDLDLWSTAKPFLERWMRERYSPKAMFGNLYSQAEQLP
FT                   HLAGMTRDLLERLSQPHLHDPQLPERRRQGDRWALRLLGAGLLGGGAVLAASAAEAASL
FT                   AAPAAWPAWLMLAAGLYLIVRQ"
FT   gene            complement(498114..498737)
FT                   /locus_tag="PputW619_0453"
FT   CDS_pept        complement(498114..498737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0453"
FT                   /product="Sterol-binding domain protein"
FT                   /note="PFAM: Sterol-binding domain protein; KEGG:
FT                   pen:PSEEN5074 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70958"
FT                   /db_xref="GOA:B1J2S7"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR038989"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2S7"
FT                   /protein_id="ACA70958.1"
FT                   /translation="MLLAGLLASVEHGLNRILRMDSTALPRLGALEGKVIEIDCRQPAL
FT                   QVFILPDEEGLMLAAHWQGEVDCSLRAPAGSLLQLAVAKDKTAVLHSPQVELHGDSAVL
FT                   LDLFGILQDLELDWEHELQRWLGPVATSLLAGHVRLRARWTRQGLARFSQNLSEYLAEE
FT                   SRTLVGKREAEAAFSELDALKVDTERLEARLQRLFRSLDTSDNA"
FT   gene            complement(498737..499507)
FT                   /locus_tag="PputW619_0454"
FT   CDS_pept        complement(498737..499507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0454"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase"
FT                   /note="TIGRFAM: ubiquinone/menaquinone biosynthesis
FT                   methyltransferase; PFAM: putative RNA methylase;
FT                   protein-L-isoaspartate(D-aspartate) O-methyltransferase;
FT                   UbiE/COQ5 methyltransferase; Methyltransferase type 11;
FT                   Methyltransferase type 12; KEGG: pen:PSEEN5073 ubiquinone
FT                   biosynthesis methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70959"
FT                   /db_xref="GOA:B1J2S8"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1J2S8"
FT                   /protein_id="ACA70959.1"
FT                   /translation="MNDQRKGEHAEPTTHFGYQDVPESQKAKKVAEVFHSVAAKYDLMN
FT                   DVLSGGMHRLWKRFTIELSGVRSGNRVLDIAGGTGDLAAKFSRLVGPTGQVVLADINDS
FT                   MLKVGRDRLLDRGVAGNIEFVQADAEKLPFPDNHFDCVTIAFGLRNVTHKDEAIRSMLR
FT                   VLKPGGRLLILEFSKPTNKLMSKAYDAYSFAFMPLAGKLITNDSESYRYLAESIRMHPD
FT                   QETLKAMMVDAGFDRVTYHNMTSGIVAVHRGIKP"
FT   gene            499632..499907
FT                   /locus_tag="PputW619_0455"
FT   CDS_pept        499632..499907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0455"
FT                   /product="polyhydroxyalkanoic acid system protein"
FT                   /note="TIGRFAM: polyhydroxyalkanoic acid system protein;
FT                   PFAM: Putative polyhydroxyalkanoic acid system protein;
FT                   KEGG: pen:PSEEN5072 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70960"
FT                   /db_xref="InterPro:IPR013433"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2S9"
FT                   /protein_id="ACA70960.1"
FT                   /translation="MTQISVERKHTLGREAARAKAQALVDKLSQEYDLKATWNGDRVDV
FT                   ARSGANGSVHIGEDSIRVELKLGMMLSMMSGTIKSEIERALDKALV"
FT   gene            500087..500506
FT                   /locus_tag="PputW619_0456"
FT   CDS_pept        500087..500506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0456"
FT                   /product="poly(hydroxyalkanoate) granule-associated
FT                   protein"
FT                   /note="TIGRFAM: poly(hydroxyalkanoate) granule-associated
FT                   protein; PFAM: poly granule associated family protein;
FT                   KEGG: pen:PSEEN5071 polyhydroxyalkanoate granule-associated
FT                   protein GA1"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70961"
FT                   /db_xref="InterPro:IPR008769"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2T0"
FT                   /protein_id="ACA70961.1"
FT                   /translation="MAKVNVKKKDDAQSTLGEVRGYARKIWLAGIGAYARVGQEGSDYF
FT                   QELVKAGEGVEKRGKKRIDKELDAANTQIDEAAEEVSRVRGKVEVQLDKIEKAFDARVG
FT                   RALNRLGIPSKHDVEALSIKLEQLHELLERVAHKP"
FT   gene            500517..501281
FT                   /locus_tag="PputW619_0457"
FT   CDS_pept        500517..501281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0457"
FT                   /product="poly(hydroxyalkanoate) granule-associated
FT                   protein"
FT                   /note="TIGRFAM: poly(hydroxyalkanoate) granule-associated
FT                   protein; PFAM: poly granule associated family protein;
FT                   KEGG: pen:PSEEN5070 polyhydroxyalkanoate synthesis protein
FT                   PhaF"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70962"
FT                   /db_xref="InterPro:IPR008769"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2T1"
FT                   /protein_id="ACA70962.1"
FT                   /translation="MAGKKNSDKDGSSWVGGIEKYSRKIWLAGLGIYSKIDQDGPKLFD
FT                   SLVKDGEKAEKQAKKTAEDVADNAKASTTSRVSGVKDRALGKWSELEEAFDKRLNSAIS
FT                   RLGVPSRNEIKALHQQVDSLTKQIEKLTGASVTPVSSRAAAAKPAASKTAAKPLAKAAA
FT                   KPAAKTAAAKPAAKTAAAKPAAKPAAKPVAAKPAAKPAAAKKPAVKKAPAKPSAGKPAA
FT                   PAASATPAATAAPSPSAAPASSTPSAPVSAEA"
FT   gene            complement(501408..502022)
FT                   /locus_tag="PputW619_0458"
FT   CDS_pept        complement(501408..502022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0458"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: pen:PSEEN5069
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70963"
FT                   /db_xref="GOA:B1J2T2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025722"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2T2"
FT                   /protein_id="ACA70963.1"
FT                   /translation="MKTRDRILECALQLFNQQGEPNVSTLEIANELGISPGNLYYHFHG
FT                   KEPLIIGLFERFEEALMPLLDPPLEVRLDAEDYWLFLHLIVERMAQYRFLFQDLSNLTG
FT                   RLPKLARGMRSLINALKRTLAALLASLKGQGQVVSETQALGQLVEQITLTLMFSLDYQR
FT                   VLGREGDVGIVVYQVMMLVAPHLQAPAREAAEQLAVRYLEG"
FT   gene            complement(502036..503718)
FT                   /locus_tag="PputW619_0459"
FT   CDS_pept        complement(502036..503718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0459"
FT                   /product="poly(R)-hydroxyalkanoic acid synthase, class II"
FT                   /note="TIGRFAM: poly(R)-hydroxyalkanoic acid synthase,
FT                   class II; PFAM: alpha/beta hydrolase fold;
FT                   Poly-beta-hydroxybutyrate polymerase domain protein; KEGG:
FT                   pen:PSEEN5068 poly(3-hydroxyalkanoate) polymerase 2"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70964"
FT                   /db_xref="GOA:B1J2T3"
FT                   /db_xref="InterPro:IPR010941"
FT                   /db_xref="InterPro:IPR011287"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2T3"
FT                   /protein_id="ACA70964.1"
FT                   /translation="MKDKPAKGTTTLPAMSMNAQNAIVGLRGRDLISTLRNVGRHGLLN
FT                   PLHTARHLLALSGQLGRVMLGDTPYSPSPRDARFSDPTWSQNPFYRRGLQAYLAWQKQT
FT                   RLWIDESHLDDDDRARAHFLFNQINDALAPSNSLLNPLAVKELLNTGGQSLVRGVAHLL
FT                   DDLRHNDGLPRQVDERAFEVGGNLAATPGAVVFRNEMLELIQYKPMSEKQHARPVLVVP
FT                   PQINKFYIFDMQANNSFVQYMLKNGLQVFMVSWRNPDPRHREWGLSSYVEALEEALNAC
FT                   RSISGNRDPNLMGACAGGLTMAALQGHLQAKHQLRRVRSATYLVSLLDSKFDSPASLFA
FT                   DEQTIEAAKRRSYQRGVLDGSEVARIFAWMRPNDLIWNYWVNNYLLGKTPPAFDILYWN
FT                   ADSTRLPAALHGELLDFFKLNPLTHPAGLEVCGTPIDLKQVNLDSFTVAGSNDHITPWD
FT                   AVYRSALLLGGERRFVLANSGHIQSIINPPGNPKAYYLDNPRLSSDPRAWFHDAKRNDG
FT                   SWWPLWLEWITPRSGPLKAPRVELGNATYPPLGPAPGTYVLTR"
FT   gene            complement(503773..504630)
FT                   /locus_tag="PputW619_0460"
FT   CDS_pept        complement(503773..504630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0460"
FT                   /product="poly(3-hydroxyalkanoate) depolymerase"
FT                   /note="TIGRFAM: poly(3-hydroxyalkanoate) depolymerase;
FT                   PFAM: alpha/beta hydrolase fold; KEGG: pen:PSEEN5067
FT                   poly(3-hydroxyalkanoate) depolymerase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70965"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR011942"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2T4"
FT                   /protein_id="ACA70965.1"
FT                   /translation="MRMSSHYIFRTVELDDQSIRTAVRPGKPHLTPLLIFNGIGANLEL
FT                   VFPFIEALDPDLEVIAFDVPGVGGSSTPRHPYRFPGLAKLTARMLDYLDYGQVNVIGVS
FT                   WGGALAQQFAHDYPERCKKLVLAATAAGAFMVPGKPQVLWNMASPRRYIQPSHVIRIAP
FT                   LIYGGAFRRDPDLAMHHASKVRSGGKLGYYWQLFAGLGWTSIHWLHKIQQPTLVLAGDD
FT                   DPLIPLINMRLLAWRIPNAQLHIIDDGHLFLITRAEAVAPIIMKFLEQERQRAVMHPRP
FT                   ASGG"
FT   gene            complement(504688..506367)
FT                   /locus_tag="PputW619_0461"
FT   CDS_pept        complement(504688..506367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0461"
FT                   /product="poly(R)-hydroxyalkanoic acid synthase, class II"
FT                   /note="TIGRFAM: poly(R)-hydroxyalkanoic acid synthase,
FT                   class II; PFAM: alpha/beta hydrolase fold;
FT                   Poly-beta-hydroxybutyrate polymerase domain protein; KEGG:
FT                   pen:PSEEN5066 poly(3-hydroxyalkanoate) polymerase 1"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70966"
FT                   /db_xref="GOA:B1J2T5"
FT                   /db_xref="InterPro:IPR010941"
FT                   /db_xref="InterPro:IPR011287"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2T5"
FT                   /protein_id="ACA70966.1"
FT                   /translation="MSNKNNDELQRQASDNTLGLNPVIGIRRKDLLSSARTVLRQAMRQ
FT                   PLHSAKHVAHFGLELKNVLLGKSSLAPEGDDRRFQDPAWSKNPLYRRYLQTYLAWRKEL
FT                   QDWIGNSDLSPQDISRGQFVINLMTEAMAPTNTLSNPAAVKRFFETGGKSLLDGLSNLA
FT                   KDMVNNGGMPSQVNMDAFEVGKNLGTSEGAVVYRNDVLELIQYSPITEQVHTRPLLVVP
FT                   PQINKFYVFDLSPEKSLARFCLRSHQQTFIISWRNPTKAQREWGLSTYIDALKEAVDAV
FT                   LAITGSKDLNMLGACSGGITCTALVGHYAALGEKKVNALTLLVSVLDTTLDTQVALFVD
FT                   EQTLESAKRHSYQAGVLEGSDMAKVFAWMRPNDLIWNYWVNNYLLGNEPPVFDILFWNN
FT                   DTTRLPAAFHGDLIEMFKNNPLTRADALEVCGTAIDLKKVKCDIFSVAGTADHITPWQS
FT                   CYRSAHLFGGKIEFVLSNSGHIQSILNPPGNPKARFLTGADRPGDALAWQENADKHADS
FT                   WWLYWQTWLSERAGDLKKAPARLGNRAYAAGEAAPGTYVHER"
FT   gene            complement(506720..507097)
FT                   /locus_tag="PputW619_0462"
FT   CDS_pept        complement(506720..507097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0462"
FT                   /product="protein of unknown function DUF971"
FT                   /note="PFAM: protein of unknown function DUF971; KEGG:
FT                   pen:PSEEN5065 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70967"
FT                   /db_xref="InterPro:IPR010376"
FT                   /db_xref="InterPro:IPR038492"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2T6"
FT                   /protein_id="ACA70967.1"
FT                   /translation="MARMPTAINLHKASKTLSLTYGPDEVYHLPAEFLRVHSPSAEVQG
FT                   HGNPILQFGKINVGLSGLEPAGQYALKLTFDDGHDSGLFTWEYLEQLCLRQEQLWAEYL
FT                   DELHKAGKSRDPAETVVKLML"
FT   gene            complement(507259..508602)
FT                   /locus_tag="PputW619_0463"
FT   CDS_pept        complement(507259..508602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0463"
FT                   /product="heat shock protein HslVU, ATPase subunit HslU"
FT                   /note="KEGG: pen:PSEEN5064 ATPase component of the HslUV
FT                   protease; TIGRFAM: heat shock protein HslVU, ATPase subunit
FT                   HslU; PFAM: ATPase AAA-2 domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70968"
FT                   /db_xref="GOA:B1J2T7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1J2T7"
FT                   /protein_id="ACA70968.1"
FT                   /translation="MSMTPREIVHELNRHIIGQDDAKRAVAIALRNRWRRMQLPAELRA
FT                   EVTPKNILMIGPTGVGKTEIARRLAKLANAPFLKVEATKFTEVGYVGRDVESIIRDLAD
FT                   AAMKMLREQEIIRVRHRAEDAAEDRILDALLPQARVTSFSEEAAQTSSDSNTRQLFRKR
FT                   LREGQLDDKEIEIEVADAVGVEIAAPPGMEEMTNQLQSLFANMGKGKRKARKLKVKEAL
FT                   KMVRDEEASRLVNDDDLKAKALEAVEQHGIVFIDEIDKVAKRGNVGGADVSREGVQRDL
FT                   LPLIEGCTVNTKLGMVKTDHILFIASGAFHLSKPSDLVPELQGRLPIRVELKALTPEDF
FT                   ERILQEPHASLTEQYRELLKTEGLNIEFKADGIKRLAEIAYQVNEKTENIGARRLHTLL
FT                   ERLLEEVSFSAGDLASAHDEAPIQIDAAYVNGHLGELAQNEDLSRYIL"
FT   gene            complement(508679..509257)
FT                   /locus_tag="PputW619_0464"
FT   CDS_pept        complement(508679..509257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0464"
FT                   /product="20S proteasome A and B subunits"
FT                   /note="PFAM: 20S proteasome A and B subunits; KEGG:
FT                   pfo:Pfl_0397 ATP-dependent protease peptidase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70969"
FT                   /db_xref="GOA:B1J353"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:B1J353"
FT                   /protein_id="ACA70969.1"
FT                   /translation="MSQHQAILPRCVETLPLTTIVSVRRHGKVVMGGDGQVSLGNTVMK
FT                   GNAKKVRRLYNGEVIAGFAGATADAFTLFERFEAQLQKHSGHLVRAAVELAKEWRTDRS
FT                   LSRLEAMLAVANKDASLIITGNGDVVEPEDGLIAMGSGGAYAQAAARALLNKTDLSARE
FT                   IAETALNIAGDICVFTNHNLTIEEQDLAE"
FT   gene            complement(509463..510734)
FT                   /locus_tag="PputW619_0465"
FT   CDS_pept        complement(509463..510734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0465"
FT                   /product="dihydroorotase, multifunctional complex type"
FT                   /note="TIGRFAM: dihydroorotase, multifunctional complex
FT                   type; PFAM: amidohydrolase; KEGG: pen:PSEEN5062
FT                   dihydroorotase, multifunctional complex type"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70970"
FT                   /db_xref="GOA:B1J354"
FT                   /db_xref="InterPro:IPR004722"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B1J354"
FT                   /protein_id="ACA70970.1"
FT                   /translation="MTLSILGARVIDPKSGLDQVTDLHLDGGRIAAIGAAPAGFSASRT
FT                   IQANGLIAAPGLVDLGVSLREPGYSRKGTIASETRAAVAGGVTSLCCPPQTKPVLDTSA
FT                   VAELILDRAREAGNSKVYPIGALTKGLEGEQLAELVALRDTGCVAFGNGLKEIPNNRTL
FT                   ARALEYAATFDLTVVFHSQDRDLALGGLAHEGAMASFLGLPGIPETAETVALARNLLLV
FT                   EQAGVRAHFTQITSARGARLIAQAQQLGLPVTADVALYQLILTDESLREFSSLYHVQPP
FT                   LRSAADRDGLREAVRSGVIQAISSHHQPHERDAKLAPFGATEPGISSVELLLPLAMTLV
FT                   DDGLLDLQTLLARLTSGPAAAMRLPAGELKLGGAADLVLFDATASTVAGEQWYSRGDNC
FT                   PFIGHCLPGAVRYTVVDGHVCHEG"
FT   gene            complement(510731..511735)
FT                   /locus_tag="PputW619_0466"
FT   CDS_pept        complement(510731..511735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0466"
FT                   /product="aspartate carbamoyltransferase"
FT                   /note="TIGRFAM: aspartate carbamoyltransferase; PFAM:
FT                   aspartate/ornithine carbamoyltransferase Asp/Orn-binding
FT                   region; aspartate/ornithine carbamoyltransferase
FT                   carbamoyl-P binding domain; KEGG: pen:PSEEN5061 aspartate
FT                   carbamoyltransferase, catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70971"
FT                   /db_xref="GOA:B1J355"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1J355"
FT                   /protein_id="ACA70971.1"
FT                   /translation="MTPIDAKRPLQLNDQGQLRHFLSLDGLPRELLTEILDTADSFLEV
FT                   GARAVKKVPLLRGKTVCNVFFENSTRTRTTFELAAQRLSADVISLNVSTSSTSKGETLF
FT                   DTLRNLEAMAADMFVVRHSDSGAAHFIAEHVCPDVAVINGGDGRHAHPTQGMLDMLTIR
FT                   RHKGSFENLSVAIVGDILHSRVARSDMLALKALGCPDIRVIGPKTLIPIGIEQYGVKVY
FT                   TDLTEGLKDVDVVIMLRLQRERMAGGLLPSEGEFYRLFGLTTARLAGAKPDAIVMHPGP
FT                   INRGVEIESAVADGKHSVILNQVTYGIAVRMAVLSMAMSGQNTQRQLDQENAQ"
FT   gene            complement(511749..512267)
FT                   /locus_tag="PputW619_0467"
FT   CDS_pept        complement(511749..512267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0467"
FT                   /product="Uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /note="PFAM: phosphoribosyltransferase; KEGG: pen:PSEEN5060
FT                   transcriptional regulator PyrR"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70972"
FT                   /db_xref="GOA:B1J356"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR023050"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1J356"
FT                   /protein_id="ACA70972.1"
FT                   /translation="MSLPNPADLIRQMAVDLRAHLARRGITEPRYIGIRTGGVWVAQAL
FT                   QQELGDTSPLGTLDVSFYRDDFSQNGLHPQVRPSELPFEVEGQHLVLIDDVLMSGRTIR
FT                   AALNELFDYGRPASVTLVCLLDLDAGELPIRPNVLGATLSLAAHERVKLTGPAPLALER
FT                   QDLATASAL"
FT   gene            complement(512317..512742)
FT                   /locus_tag="PputW619_0468"
FT   CDS_pept        complement(512317..512742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0468"
FT                   /product="Holliday junction resolvase YqgF"
FT                   /note="PFAM: Holliday junction resolvase YqgF; SMART:
FT                   Resolvase RNase H domain protein fold; KEGG: pen:PSEEN5059
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70973"
FT                   /db_xref="GOA:B1J357"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/TrEMBL:B1J357"
FT                   /protein_id="ACA70973.1"
FT                   /translation="MAELRLLLGFDYGSKQIGVAVGQVVTGQARELCTLKAQNGVPDWA
FT                   QVEKLINEWKPDAIVVGLPLNMDGTPSEMSARAEKFARRLNGRFNLPVHTHDERLTTFE
FT                   AKGERMARGGQRGSYRDNPVDAIAAALLLQGWLEANT"
FT   gene            complement(512742..513311)
FT                   /locus_tag="PputW619_0469"
FT   CDS_pept        complement(512742..513311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0469"
FT                   /product="protein of unknown function DUF179"
FT                   /note="PFAM: protein of unknown function DUF179; KEGG:
FT                   pen:PSEEN5058 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70974"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1J358"
FT                   /protein_id="ACA70974.1"
FT                   /translation="MKTLAPSYLKHQFLIAMPHMADPNFAQTLTYIVEHNANGAMGLVV
FT                   NRPQELNLADILEQLRPDEEPPASTLQVPIYQGGPVQTDRGFVLHSSECSYQATVELQG
FT                   LSLSTSQDVLFAIAEGVGPQKSLITLGYAGWEAGQLEAELADNAWLNCPFDPDIIFGLA
FT                   SEQRLGAAAASLGINLSLLTSQAGHA"
FT   gene            complement(513431..514333)
FT                   /locus_tag="PputW619_0470"
FT   CDS_pept        complement(513431..514333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0470"
FT                   /product="TonB family protein"
FT                   /note="TIGRFAM: TonB family protein; KEGG: pen:PSEEN5057
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70975"
FT                   /db_xref="GOA:B1J359"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:B1J359"
FT                   /protein_id="ACA70975.1"
FT                   /translation="MTLPADIPADLLPPRVRPVDRLGFTLFLAALVHLALILGVGFTVV
FT                   KPAEIRQTMDITLATFKSEKPPEKADFQAQANQQGSGTLEKKAVPTTTEIAPFQDSKIN
FT                   KVTPPPAAKPEVKPPPAPQKSAVATQAPKAQKVEPKPKESKPQPKPAATPDFDSSQLSS
FT                   QIASLEAELSNEQQMYAKRPRIHRLNAASTMRDKGAWYKEEWRKKVERVGNLNYPDEAR
FT                   RQQIYGNLRMMVSINRDGSLYEVLVLESSGQAVLDQAAQRIVRLAAPFAPFTGDLAEYD
FT                   RLEIIRTWRFARGDRLSSN"
FT   gene            complement(514479..515432)
FT                   /locus_tag="PputW619_0471"
FT   CDS_pept        complement(514479..515432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0471"
FT                   /product="glutathione synthetase"
FT                   /EC_number="6.3.2.3"
FT                   /note="KEGG: pen:PSEEN5056 glutathione synthetase; TIGRFAM:
FT                   glutathione synthetase; PFAM: glutathione synthetase domain
FT                   protein; glutathione synthetase ATP-binding; RimK domain
FT                   protein ATP-grasp"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70976"
FT                   /db_xref="GOA:B1J360"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B1J360"
FT                   /protein_id="ACA70976.1"
FT                   /translation="MSVRLGIVMDPIASISYKKDSSLAMLLAAQARGWSLFYMEQRDLY
FT                   QAEGKARARMRPLKVFADPARWFELGDEQDSPLAELDVILMRKDPPFDMEFVYSTYLLE
FT                   QAEAEGVLVVNRPQSLRDCNEKLFATLFPQCTPPTLVSRRPDIIRAFAAQHGDVILKPL
FT                   DGMGGTSIFRHRAGDPNLSVILETLTALGAQQIMAQAYLPAIKDGDKRILMIDGEPVDY
FT                   CLARIPASGETRGNLAAGGRGEARPLSERDRWIAAQVGPTLRAKGLLFVGLDVIGDYLT
FT                   EINVTSPTCIREIDAAYNTDIGGKLMDAIDRQLKAR"
FT   gene            515676..516077
FT                   /locus_tag="PputW619_0472"
FT   CDS_pept        515676..516077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0472"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   pen:PSEEN5055 type IV pili response regulator PilG"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70977"
FT                   /db_xref="GOA:B1J2X1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2X1"
FT                   /protein_id="ACA70977.1"
FT                   /translation="MEQPLKVMVIDDSRTIRRTAQMLLGEAGCEVITASDGFDALAKIV
FT                   DHQPQIIFVDVLMPRLDGYQTCAVIKHNSAFKDIPVILLSSRDGLFDKARGRVVGSDQF
FT                   LTKPFSKEELLDAISAHVPGFAAHEQNAP"
FT   gene            516125..516490
FT                   /locus_tag="PputW619_0473"
FT   CDS_pept        516125..516490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0473"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   pen:PSEEN5054 type IV pili response regulator PilH"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70978"
FT                   /db_xref="GOA:B1J2X2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2X2"
FT                   /protein_id="ACA70978.1"
FT                   /translation="MARVLIVDDSPTEMYRLTEWLEKHGHQVLKANNGADAVALARQEK
FT                   PDAVLMDIVMPGMNGFQATRQLSKDPETSAIPVLIVTTKDQETDRIWAQRQGARGFVTK
FT                   PVEEHALIAKLNEVLGA"
FT   gene            516487..517041
FT                   /locus_tag="PputW619_0474"
FT   CDS_pept        516487..517041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0474"
FT                   /product="CheW protein"
FT                   /note="PFAM: CheW domain protein; KEGG: pen:PSEEN5053 type
FT                   IV pili signal transduction protein PilI"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70979"
FT                   /db_xref="GOA:B1J2X3"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2X3"
FT                   /protein_id="ACA70979.1"
FT                   /translation="MTTRPQGASLTAFELLLDIDRRCRLLVADQPPQDTRLQQWSGIGF
FT                   RVAGQWFVAPMGEVAEVSREPRSSRVPGVQPWVCGVANLRGRLLPVMDLSSFFGLGPAA
FT                   SGKQRRVLVLDHEDLFVGLLVDEVLGLQHFALDTLELSPPQPLIRAAVRFVQGHFPRER
FT                   NWAIFSPFALAQAPGFLDVAL"
FT   gene            517053..519113
FT                   /locus_tag="PputW619_0475"
FT   CDS_pept        517053..519113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0475"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; KEGG:
FT                   pen:PSEEN5052 type IV pili methyl-accepting chemotaxis
FT                   transducer PilJ"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70980"
FT                   /db_xref="GOA:B1J2X4"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029095"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2X4"
FT                   /protein_id="ACA70980.1"
FT                   /translation="MNKPATNVAPTSMTPRTRSIAQITVLFVVLILSIILLFANFAYLN
FT                   TQSNHDKQYIGHAGELRVLSQRIAKNATEAATGKALAFKLLSDARNDFEQRWSYLREGD
FT                   KSTGLPAAPAAVKDEMEAVRQDWENLRKDTDIILASEQTVLSLHQVAATLAETVPQLQV
FT                   EYEKVVEVLLQSGAPASQVVVAQRQLLLAERILGSVNTVLAGDDAAAQAADAFGRDASR
FT                   FGQVLEGMLAGNPAIQVTRVEDADARARLAEIAELFQFVAGSVDEILETSPELFRVREA
FT                   AGNIFSLSQTLLDEASHLANGFENLAAGRTLDTVGGYVLGLLALASIILIGLVMVRATH
FT                   RQLQETAEKNERNQQAIMRLLDEIEELADGDLTVTVSVTEDFTGAIADSINYSVDQLRD
FT                   LVATINHSAEQVAAAVQDTQNTARQLAKASEHQAEQISEASEAVGDMVESIDRVSAHAY
FT                   ESAKVAERSVAIANKGNEVVHNTINGMDNIREQIQDTAKRIKRLGESSQEIGDIVSLID
FT                   DIADQTNILALNAAIQASLAGEAGRGFAVVADEVQRLAERSSSATRQIEALVRTIQADT
FT                   NEAVISMEQTTAEVVRGARLAQDAGVALAEIEGVSQNLAELIHSISDAAQLQTSSAGQI
FT                   SHTMSVIQQITAQTSAGSGATADSIRHLARMASEMRRSVSGFTLPAPAERR"
FT   sig_peptide     517053..517187
FT                   /locus_tag="PputW619_0475"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.774) with cleavage site probability 0.612 at
FT                   residue 45"
FT   gene            519123..524012
FT                   /locus_tag="PputW619_0476"
FT   CDS_pept        519123..524012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0476"
FT                   /product="CheA signal transduction histidine kinase"
FT                   /note="PFAM: response regulator receiver; CheW domain
FT                   protein; ATP-binding region ATPase domain protein; Hpt
FT                   domain protein; KEGG: pen:PSEEN5051 sensor histidine
FT                   kinase/response regulator ChpA"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70981"
FT                   /db_xref="GOA:B1J2X5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2X5"
FT                   /protein_id="ACA70981.1"
FT                   /translation="MATAVSPERHDTVALAWTKAAILDCLGRARQALERFAGETDDLSM
FT                   LAFVVDNLHQVHGCLRMLELRGATRLAEELELLARALAEGQVSPRGDCLGPLFRGLEQL
FT                   PSYLERLRGARHDLPLVMLPLLNQLRACRGVEPLAQGSLISGAAQRFAGSDDLANLDLS
FT                   LGNWREQVQAGPGRDALRSVISALCDDLMRIKERLDQFVRGDRQHSEQLDSLLAPLRHV
FT                   ADTLAVLGFQQPRRVIIDQVLALQALAQGQRVADDAVLMDVAGALLYVEASLNGMVGPL
FT                   DEGGQGGLPGSDLAEIRQLVLNESLNVLQQAKDLIGDCLESGWPRQRLQPLPGLLQQVR
FT                   GALAMLMLPAAAEVLAGCAGYVHGWLQHLDVEPPPDELDHLADALSASECYLQWRVADP
FT                   LADAQPFLDRARVSLAALGVQCTLGESVIAQDGSTDGVDDELREVFLEEAGELLPQIER
FT                   HWLRWRADNSLRDALLEVRRDLHTLKGSGRMVHAQAVAELAWGGEHLLNRVLEGRMALA
FT                   PEGVVALQQVVVHLPDLLADFAAGQMPQVTEIEQLASHLHALAENDSPAGAEIDGLDPL
FT                   LLDIFRNEAQGHLASLEAFLQGAGGHDTDVSDTLQRALHTLKGSAAMAGVLPIAELATA
FT                   FDRLVREYRGHHLPLQMAELEWLEAARALLHLSLAQLGSSPLAPIPGAAELIEQVGEAV
FT                   DMRLASLHDEPQHGRRGKRDPQLIASFLAQSMDILLDAEALLSRWQEQPGQRQSLDSLL
FT                   DELTTLCHGAHLADLRQMDDVCEALLDLYGAVEEGSLAADERFFAQARQAHGVLLDMLD
FT                   EIAAGQEPSARPDCIDGLRGLLDDALAPDATGLVAPGSVTRLDGPLALAEEAENPGDKE
FT                   LLEVFLEESSDIVESAAAALARWQADPRNSAEVDNLLRDLHTLKGGARMVEIAAIGDLA
FT                   HELEFLYELLAAGRLPPSAPLFALLQNCHDRLAHMLDAVRLGQPLHAATALIDYIRNFS
FT                   SAALTDSVAGQAPAGAAPADAPATTPERPPGDLVKVDAELLDDLGNLAGEHSVIRGRIE
FT                   QQVNDAQFALSEMETTLERMRDQLLRLDMETQGRISSRQPFEGDAYEDFDPLEMDRHSQ
FT                   LQQLSRALFESASDLLDLKETLAQRAQEAQALLQQQARVNSQLQEGLTATLMVPFERLV
FT                   PRLQRVVRQVASELGKQVELVVGNAEGELDRSVLERMVAPLEHMLRNAVDHGLETREAR
FT                   LAAGKPELGTIHLNLLHEGADIVIEMTDDGAGVPLDAVRRKAIKRGLLDPQARLSDHEI
FT                   LQFILRPGFSTAEKITQISGRGLGMDVVHEEVKQLGGSMSIESAQGKGARFLIRLPFTV
FT                   SINRAVMVHLGEEQYAIPLNTIEGIVRVPPAELAICYQRDVPRYGYAGHEYDLRYLGEL
FT                   LQGLPRPGLLGQSVPLPVLLVHSQEQSFAIQVDSLSPSREIVVKSLGPQFAAVPGLSGA
FT                   TLLGDGRVVLILDLLGQLRGQQRRLARLPGGSGVQRTLFGPAPRRASLVMVVDDSVTVR
FT                   KVTSRLLERHGMSVLTAKDGVDAMALLEEHRPDVLLLDIEMPRMDGFEVATRIRRDERL
FT                   KGLPIIMITSRTGQKHRDRAMAIGVNDYLGKPYQESVLLQSIAHWSQTHA"
FT   gene            524005..524466
FT                   /locus_tag="PputW619_0477"
FT   CDS_pept        524005..524466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0477"
FT                   /product="CheW domain protein"
FT                   /note="PFAM: CheW domain protein; KEGG: pen:PSEEN5050
FT                   chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70982"
FT                   /db_xref="GOA:B1J2X6"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2X6"
FT                   /protein_id="ACA70982.1"
FT                   /translation="MLELIAGQRSSLTGLLLPLGDRTLVLPNVAVAELIGQRNLVCQRA
FT                   EPAWHLGWIDWRQQHLPLIGFEAACGGETPCGERARIVVLNALGDTGLRYLAVLLQDIP
FT                   RSCKLDSQLNYVDVALGSLELAAVQVGEQVARVPDLVGLERLVRDAQLQ"
FT   gene            524585..525202
FT                   /locus_tag="PputW619_0478"
FT   CDS_pept        524585..525202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0478"
FT                   /product="channel protein, hemolysin III family"
FT                   /note="TIGRFAM: channel protein, hemolysin III family;
FT                   PFAM: Hly-III family protein; KEGG: pen:PSEEN5049 hemolysin
FT                   III"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70983"
FT                   /db_xref="GOA:B1J2X7"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="InterPro:IPR005744"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2X7"
FT                   /protein_id="ACA70983.1"
FT                   /translation="MYHGERFNAWTHLVGAILACIGGIWLIVVAGLQGDPWKIVSFSIY
FT                   GGTLLLLYSISTLYHSTRGRAKVIMRKLDHLSIYLLIAGSYTPFCLVSLRGPWGWSLFG
FT                   VVWGLAVIGMLQEIKPRSEARVLSIIIYAVMGWIVLVAVKPLLQSLGTAGFAWLAAGGV
FT                   FYTVGIIFFAFDSRFRHWHGIWHLFVIAGSLMHFVAVSLYVR"
FT   gene            complement(525199..525918)
FT                   /locus_tag="PputW619_0479"
FT   CDS_pept        complement(525199..525918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0479"
FT                   /product="protein of unknown function DUF558"
FT                   /note="PFAM: protein of unknown function DUF558; KEGG:
FT                   pen:PSEEN5048 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70984"
FT                   /db_xref="GOA:B1J2X8"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2X8"
FT                   /protein_id="ACA70984.1"
FT                   /translation="MRLSRFFIDAPLSLGEHDLPEAQAHYIGRVLRMAPGDAVQLFDGS
FT                   GQEYLGQLLEVGKKTVRVSLDQAVAGQAESPLHIHLGQGLSRGERMDWAIQKATELGAN
FT                   EITPIVSERCEVRLKDERADKRLAHWRQVAISACEQCGRSILPIIRAPVTLGDWIKGSD
FT                   ADLKLVLHPVAEPLTSHDKPARLAFLIGPEGGLSEAEVDQAKGAGFQAARLGPRVLRTE
FT                   TAPVVALSVAQQLWGDF"
FT   gene            complement(526090..527496)
FT                   /locus_tag="PputW619_0480"
FT   CDS_pept        complement(526090..527496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0480"
FT                   /product="adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase"
FT                   /note="TIGRFAM: adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase; PFAM: aminotransferase class-III; KEGG:
FT                   pen:PSEEN5047 7,8-diaminopelargonic acid synthetase,
FT                   PLP-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70985"
FT                   /db_xref="GOA:B1J2X9"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR005815"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2X9"
FT                   /protein_id="ACA70985.1"
FT                   /translation="MGLNDQWMQRDLKVLWHPCTQMKDHEQLPLIPIKRGEGVWLEDFE
FT                   GKRYLDAVSSWWVNVFGHANPRINQRIKDQVDQLEHVILAGFSHQPVIELSERLVAMTP
FT                   AGLDRVFYADNGSSCIEVALKMSFHYWQNIGKPAKKRFVTLTNSYHGETIAAMSVGDVP
FT                   LFTETYKALLLDTIKVPSPDCYLRPDGMGWEEHSRNMFAAMEQTLAEHHETLSAVIIEP
FT                   LIQGAGGMRMYHPVYLKLLREACDRYGVHLIHDEIAVGFGRTGTMFACEQAGIRPDFLC
FT                   LSKALTGGYLPLAACLTTDTVYQAFYDDYPTLRAFLHSHSYTGNPLACAAALATLDIFE
FT                   QDNVIEANKALSARMTRATAHLADHAHVAEIRQTGMALAIEMVQDKAGKVAYPWQERRG
FT                   LKVFEHALTRGALLRPLGSVVYFLPPYVITPEQIDFLAEVASEGIDIATRDSVSVAVPA
FT                   NFHPDFRDPG"
FT   gene            complement(527575..528066)
FT                   /locus_tag="PputW619_0481"
FT   CDS_pept        complement(527575..528066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0481"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN5046 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70986"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2Y0"
FT                   /protein_id="ACA70986.1"
FT                   /translation="MIYEEHFAHVKRQLLWHKQTLLTPSGLRIRSNGTSWAGVHEAFKG
FT                   EDGTELVIGEQSEVEISFSQEVESLRLECYVVSDQHFEDVTMLMDTEGFDWGVIAPPPH
FT                   NFYWLTLSGSGYTEFMPGHFSTQPCYQHLPGPFRRLTISTSRAGTVHIRKLEWTHTCRH
FT                   "
FT   gene            528275..529972
FT                   /locus_tag="PputW619_0482"
FT   CDS_pept        528275..529972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0482"
FT                   /product="amine oxidase"
FT                   /note="PFAM: amine oxidase; FAD dependent oxidoreductase;
FT                   KEGG: pen:PSEEN5045 flavin-containing monamine oxidase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70987"
FT                   /db_xref="GOA:B1J2Y1"
FT                   /db_xref="InterPro:IPR001613"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2Y1"
FT                   /protein_id="ACA70987.1"
FT                   /translation="MAAAWVRLCALVLIGVSSGAALAKDKTPSAIVVGGGLAGLTAAYE
FT                   LQSKGWQVTLLEAKAGMGGRSGLATSEWVGNSKAQPVLNQYLERFKLETLPAPEFVRTP
FT                   GYLIDGEYFSASDLATRQPATAEALKRYEKTLDDLARSIDDPLKPQATSTLFALDQMNV
FT                   STWLDKLQLPSTARQLINQQIRTRYDEPSRLSLLYFAQQSRVYRGVSDRDLRAARLPGG
FT                   SPVLAQAFVKQLKTIKTSSPVTSIVQDRGGVTVKVGSASYQADYLVMAVPLRALAKIQI
FT                   TPALDTQHVAALRGTNYGWRDQLLLKFKQPVWESRARMSGEIFSNAGLGMLWIEPALKG
FT                   GANVVINLSGDNARLLQAFGDKQMVDQVLIRLHAFYPKARGAFTGYEVKRYSADAGTGG
FT                   AYLAYGPGQISKYWRLWERPVQRIAFAGEHTDALYPGTLEGALRSGQRAASQVQDLLAG
FT                   KSFDPVKATPVAATAGAQKDKGGFFSNMFGGSSDKEDNAEKAPAKAEPVKAEEARVDKP
FT                   GFFSRLFGSADKPEAKTAPALKPVEAKEAPAKSAPEKQAVTHSQVKAG"
FT   sig_peptide     528275..528346
FT                   /locus_tag="PputW619_0482"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            530178..530729
FT                   /locus_tag="PputW619_0483"
FT   CDS_pept        530178..530729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0483"
FT                   /product="cytochrome B561"
FT                   /note="PFAM: cytochrome B561; KEGG: pen:PSEEN5044
FT                   cytochrome, b561 family"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70988"
FT                   /db_xref="GOA:B1J2Y2"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2Y2"
FT                   /protein_id="ACA70988.1"
FT                   /translation="MQLRNSPSRYGVISIVLHWVVALAVFGLFGLGLWMVGLDYYSPWR
FT                   KAGPDLHKSIGLVLLAVMLVRVLWRLISPPPPAPANHGAFTRLAAKLGHLALYIGLFAV
FT                   MVAGYLISTADGVGIPVFGLFEVPALVSDLPDQADLAGVIHLWLAWGLVIFAVLHALAA
FT                   LKHHYIDRDATLVRMLGRKA"
FT   gene            530761..531339
FT                   /locus_tag="PputW619_0484"
FT   CDS_pept        530761..531339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0484"
FT                   /product="YceI family protein"
FT                   /note="PFAM: YceI family protein; KEGG: pen:PSEEN5043
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70989"
FT                   /db_xref="GOA:B1J2Y3"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR023480"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1J2Y3"
FT                   /protein_id="ACA70989.1"
FT                   /translation="MLKKTFAALALGTALLSAGQAMAAEYKIDKEGQHAFVDWKISHLG
FT                   YSFIHGTFKDFDGNFTWDSAKPEASKISVDLKTASLWSNHAERDKHIASADFLDVKKYP
FT                   EAKFVSTAVKSTGEKTADVTGDLTLHGVTKPVTFKATFNGEGKDPWGGERAGFNATTTL
FT                   NLNDFGIKGPGATSQTLDLDISVEGVKQK"
FT   sig_peptide     530761..530832
FT                   /locus_tag="PputW619_0484"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            complement(531400..533292)
FT                   /locus_tag="PputW619_0485"
FT   CDS_pept        complement(531400..533292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0485"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; SMART: DEAD-like helicases; KEGG:
FT                   pen:PSEEN5042 ATP-dependent RNA helicase RhlE, DEAD box
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70990"
FT                   /db_xref="GOA:B1J2Y4"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028622"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2Y4"
FT                   /protein_id="ACA70990.1"
FT                   /translation="MSFASLGLSEALVRAIEAAGYTQPTPVQQRAIPAVLQGRDLMVAA
FT                   QTGTGKTGGFALPILERLFPAGHPDKSQRHGPRQPRVLVLTPTRELAAQVHDSFKVYAR
FT                   DLPLVSACIFGGVGMNPQIQAIAKGVDVLVACPGRLLDLAGQGRVDLAHVEILVLDEAD
FT                   RMLDMGFIHDVKKVLARLPAKRQNLLFSATFSKDITDLADKLLHNPERIEVTPPNTTVE
FT                   RIEQRVYRLPASHKRALLAHLITLGAWEQVLVFTRTKHGANRLAEYLEKHGLSAAAIHG
FT                   NKSQNARTKALADFKANSVRVLVATDIAARGLDIDQLPHVVNFELPNVEEDYVHRIGRT
FT                   GRAGRSGEAISLVAPDEEKLLKSIERVTRQKIADGDLMGFDPSQVEAEKPEVRERPQNN
FT                   GRGGRNQQARGDGGKDGSGGRKDKGKDKGKAKQQAADKPADKEKSADKQQPRKPRDKKP
FT                   RQQQASQNSVPKAPADRAPDEFLDDEIDNFGNRADYVSPYQNAKNQGRNRRPGASAGAG
FT                   QGQASPGRSNSGGGQGRNGGQPRNASGEKRPPRNNKGGDARRDSNGGGRNRSAGRDDAS
FT                   RQEPAVRSSREPQNQPVIIRKESKLDRFPTPEQLDDLPSRPRGERPALLTRKGG"
FT   gene            complement(533509..534297)
FT                   /locus_tag="PputW619_0486"
FT   CDS_pept        complement(533509..534297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0486"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="SMART: extracellular solute-binding protein family
FT                   3; KEGG: pen:PSEEN5040 periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70991"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2Y5"
FT                   /protein_id="ACA70991.1"
FT                   /translation="MPFIFRFFCILLLACLSPMAQAERLRLVTDDWAPYVYQHNGQPKG
FT                   IDYEVTTEVFRRLGIELEWEFMPWKRCLAMIEQGQADGVMDIFKVDSRQAYMVYPLEPM
FT                   SDVEFVLYQSSRRRHAVNRLSDLTDLTVGTSPGYAYGAEFNDASGFRREAASSHEANFG
FT                   KLVLGRIDLLVTDRLVGRYLRRQLGLEQQVEELPLVISRQAQYLGLARKPGRDALALAF
FT                   TEGLRRFKQEPAYLAIIERYIGSTGHLPHTVEQQESSTQR"
FT   sig_peptide     complement(534229..534297)
FT                   /locus_tag="PputW619_0486"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.982 at
FT                   residue 23"
FT   gene            complement(534374..535450)
FT                   /locus_tag="PputW619_0487"
FT   CDS_pept        complement(534374..535450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0487"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pae:PA0429 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70992"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2Y6"
FT                   /protein_id="ACA70992.1"
FT                   /translation="MQHLTPSRPQLIYLAFGSATYHQEACFSIVSALTHLDTAAGEAMD
FT                   IQVYTDNPAPYGKLPVTVHLLDEATRKAWNEPHGYHFRSKHVVLRQVLQQHSQAVLIDT
FT                   DTFFRKSPLNLFQRVKAGSLLCNAIGGRYGENQQCLLYKNLLTILQARDLADCQMPLVN
FT                   SGVIGLTAEDAGILDHSIALMDELHPLARTAYTLEEFCLAVAAYRKLALAECTDVIHHY
FT                   WSRKAQFRAKIQAWLRKHADHPLSTAALADVLLVNDQLPRPPTLQRLGYKAMSLTLPSR
FT                   ERQFARELLYGSYPYPNEFDRACAPAWWDKALQNLVDRYGPMEPEQLRQCLRHPCLRLS
FT                   LGAQRKEIEAHLLQSTKL"
FT   gene            complement(535545..536390)
FT                   /locus_tag="PputW619_0488"
FT   CDS_pept        complement(535545..536390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0488"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /EC_number="1.5.1.20"
FT                   /note="KEGG: pen:PSEEN5038 5,10-methylenetetrahydrofolate
FT                   reductase; TIGRFAM: 5,10-methylenetetrahydrofolate
FT                   reductase; PFAM: methylenetetrahydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70993"
FT                   /db_xref="GOA:B1J2Y7"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2Y7"
FT                   /protein_id="ACA70993.1"
FT                   /translation="MSQERRYSFEFFPTKTDAGHEKLMGVARQLAAYKPDFFSCTYGAG
FT                   GSTRDRTLNTVLQLENEVKVPAAPHLSCVGDTKDELRALLAEYKAAGIKRIVALRGDLP
FT                   SGMGMASGELRYASDLVEFIRQETGDHFHLEVAAYPEMHPQARNFEADLANFVHKVKAG
FT                   ADSAITQYFFNADSYFYFVERAQKLGVEIPVVPGIMPITNYSKLARFSDACGAEIPRWI
FT                   RKQLEAYADDTASIQAFGEEVITRMCEQLLQGGAPGLHFYTLNQAEASLAIWNNLKLPR
FT                   "
FT   gene            complement(536557..537966)
FT                   /locus_tag="PputW619_0489"
FT   CDS_pept        complement(536557..537966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0489"
FT                   /product="adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /note="KEGG: pfo:Pfl_5280 S-adenosyl-L-homocysteine
FT                   hydrolase; TIGRFAM: adenosylhomocysteinase; PFAM:
FT                   S-adenosyl-L-homocysteine hydrolase;
FT                   S-adenosyl-L-homocysteine hydrolase, NAD binding"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70994"
FT                   /db_xref="GOA:B1J2Y8"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1J2Y8"
FT                   /protein_id="ACA70994.1"
FT                   /translation="MSAVNTPAGFTDFKVADISLAAWGRRETIIAESEMPALMGLRRKY
FT                   LAEQPLKGAKILGCIHMTIQTAVLIETLVALGAEVRWSSCNIFSTQDQAAASIAAAGIP
FT                   VFAWKGETEEEYEWCLEQTILKDGQPWDANMILDDGGDLTELLHKKYPAVLDRVHGVTE
FT                   ETTTGVHRLLDMLAKGELKVPAINVNDSVTKSKNDNKYGCRHSLSDAIKRGTDHLLSGK
FT                   QALVIGYGDVGKGSAQSLRQEGMIVKVTEVDPICAMQACMDGFELVSPFIDGINDGTEA
FT                   SIDKALLGKIDLIVTTTGNVNVCDANMLKALKKRAVVCNIGHFDNEIDTAFMRKNWAWE
FT                   EVKPQVHKIHRTGAGDFDPQNDDYLILLAEGRLVNLGNATGHPSRIMDGSFANQVLAQI
FT                   FLFEQKFADLSAEKKAERLTVEVLPKKLDEEVALEMVRGFGGVVTKLTQQQADYIGVTV
FT                   EGPFKPHAYRY"
FT   gene            538263..538664
FT                   /locus_tag="PputW619_0490"
FT   CDS_pept        538263..538664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0490"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   pen:PSEEN5034 long-chain acyl-CoA thioester hydrolase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70995"
FT                   /db_xref="GOA:B1J2Y9"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2Y9"
FT                   /protein_id="ACA70995.1"
FT                   /translation="MNFHTRKWVKPEDLNPNGTLFGGSLLRWIDEEAAIYAIVQLGNQR
FT                   VVTKYMSEINFVSASRQGDIIELGITATEFGRTSITLKCEVRNKITRKSILTVDKMVFV
FT                   NLGEDGQPAAHGRTEIKYVQDQFPDSAVE"
FT   gene            complement(538754..539989)
FT                   /locus_tag="PputW619_0491"
FT   CDS_pept        complement(538754..539989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0491"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: sodium/hydrogen exchanger; KEGG: pen:PSEEN5033
FT                   Na+/H+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70996"
FT                   /db_xref="GOA:B1J2Z0"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2Z0"
FT                   /protein_id="ACA70996.1"
FT                   /translation="MLELVAAFICLTTLLTYVNYRFIGLPPAIGVMVTALLFSLMLQGL
FT                   SLIGFPGLEERVEGLMNQIDFNDLLMHWMLAFLLFAGALHVNLTDLRSYRWPIGLLATL
FT                   GVLIATVVIGFLSHWVFAMFGWQVPLIYCLLFGALISPTDPIAVLGALRTANASKPLKT
FT                   TIVGESLFNDGTAVVVFTVLLGIIQLGETPSITDTAILFAREAIGGVVFGGLLGYATYR
FT                   MIKSVEQYQVEVMLTLALVIGGSAMCYELHVSAPIAMVVAGLIIGNLGRNLAMNDMTRR
FT                   YMDGFWELIDDMLNALLFALIGLELLLLPFNWLHLAAGSVLALAVLLSRLLTVAPAIVL
FT                   LRRWRPVPKGTVRVLTWGGLRGGVSVALALSLPLGEERDLLLSITYIVVLSSILVQGLS
FT                   IGRVVRKVSAQP"
FT   gene            540192..541025
FT                   /locus_tag="PputW619_0492"
FT   CDS_pept        540192..541025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0492"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: pen:PSEEN5032 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70997"
FT                   /db_xref="GOA:B1J2Z1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2Z1"
FT                   /protein_id="ACA70997.1"
FT                   /translation="MLATSLVLVAALLHATWNTLIKFSGERLLVIASMDSVALAFAVLA
FT                   VAFVDLPPAEIWPWLIASALAEQLYRFLLIQAYRVGDLGLVYPLMRGLSPLVVLGLTLA
FT                   FAGESLSQQQIIGILLIPCGMACLLWQGGGGERLPWSMLPVVALIGLCIGCYTWFDGQA
FT                   VRLWGKPWDYLVWLTLLSAWPFPLLAGVARRGPFVLFWRTQWRLGLAVGFCVLFSYALV
FT                   LWAMHLGSVAEAAALRELSVILVVLLGMRYLKEPFGGPRLLACGLVLAGMLVMKL"
FT   gene            541051..541437
FT                   /locus_tag="PputW619_0493"
FT   CDS_pept        541051..541437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0493"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN5031 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70998"
FT                   /db_xref="GOA:B1J2Z2"
FT                   /db_xref="InterPro:IPR001129"
FT                   /db_xref="InterPro:IPR023352"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2Z2"
FT                   /protein_id="ACA70998.1"
FT                   /translation="MTVALWCILIALFLPPLCALIAKVSSGRFGLKDNHDPRAFLDTLS
FT                   GLPRRAHAAQQNSYEAFPAFAAAVLVADIVGNAEQVTQDVLGVLYITSRLLYIICYLAD
FT                   WAALRSLVWFAGVALIVSFFVVSA"
FT   sig_peptide     541051..541110
FT                   /locus_tag="PputW619_0493"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.667) with cleavage site probability 0.462 at
FT                   residue 20"
FT   gene            complement(541487..542638)
FT                   /locus_tag="PputW619_0494"
FT   CDS_pept        complement(541487..542638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0494"
FT                   /product="MltA domain protein"
FT                   /note="PFAM: MltA domain protein; 3D domain protein; KEGG:
FT                   pen:PSEEN5030 outer membrane-bound lytic murein
FT                   transglycolase A"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACA70999"
FT                   /db_xref="GOA:B1J2Z3"
FT                   /db_xref="InterPro:IPR005300"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR026044"
FT                   /db_xref="InterPro:IPR034654"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2Z3"
FT                   /protein_id="ACA70999.1"
FT                   /translation="MKSALRHLAWALPALALLAGCNGGENAKPEPHAVATYTPAAWADL
FT                   PSVSDSDLVAGFNAWRTGCEKLKRDPVWAATCEAAQPIALEATQVRTFLQGQLQVYGLR
FT                   SAENNATGLITGYYEPVYPGSLTRTEAANVPVYGIPDDMIVVDLASVYPELKGKRLRGR
FT                   LDGRVLKPYDTAEVIYRDGVKAPVLAWLTDPMDLQFLQIQGSGRVKLEDGRQLRLGYAD
FT                   QNGHPYRPIGRWLIEQGQLKKEDVSMGAIHAWAQANPQRVPELLASNPSYVFFSTRPDS
FT                   NEGPRGSLNVPLTAGYSVAIDRKVIPLGSLLWLSTTRPDGTPVVRPVGAQDTGGAITGE
FT                   VRADLFWGTGPEAGELAGNMKQQGQIWMLWPKGKPLPDVPKVL"
FT   sig_peptide     complement(542555..542638)
FT                   /locus_tag="PputW619_0494"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.712 at
FT                   residue 28"
FT   gene            542754..543200
FT                   /locus_tag="PputW619_0495"
FT   CDS_pept        542754..543200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0495"
FT                   /product="cytochrome c prime"
FT                   /note="PFAM: cytochrome c prime; KEGG: pen:PSEEN5029
FT                   cytochrome c'"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71000"
FT                   /db_xref="GOA:B1J2Z4"
FT                   /db_xref="InterPro:IPR002321"
FT                   /db_xref="InterPro:IPR010980"
FT                   /db_xref="InterPro:IPR012127"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2Z4"
FT                   /protein_id="ACA71000.1"
FT                   /translation="MFKCFTAILLVSLSLVACDRVDPNSPLGQRKAIFKQMLKTSEDMG
FT                   GMLRGRLPFDGGKFAEGAVKLDSLAHAPWQHFPQVQDDGDSSARPEVWERQARFHDLAQ
FT                   ALEGVTGELLALTRKQPLDAAMLKEPMDKVEAACKACHTEFRNH"
FT   sig_peptide     542754..542807
FT                   /locus_tag="PputW619_0495"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.970) with cleavage site probability 0.959 at
FT                   residue 18"
FT   gene            complement(543257..543652)
FT                   /locus_tag="PputW619_0496"
FT   CDS_pept        complement(543257..543652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0496"
FT                   /product="protein of unknown function DUF1090"
FT                   /note="PFAM: protein of unknown function DUF1090; KEGG:
FT                   pen:PSEEN5028 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71001"
FT                   /db_xref="InterPro:IPR009468"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2Z5"
FT                   /protein_id="ACA71001.1"
FT                   /translation="MKVISSVVMLAVLGLSASAAQAAQPTPGLTGCAAKRSAIENQLQY
FT                   ARAHNNSGEIRGLEKALQENTEHCTDAGLKEEREQKVREAEAEVQEREADLKQAQAKGD
FT                   TSKIAKREKKLAESKAELEDAKAELTK"
FT   sig_peptide     complement(543584..543652)
FT                   /locus_tag="PputW619_0496"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 23"
FT   gene            complement(543780..544175)
FT                   /locus_tag="PputW619_0497"
FT   CDS_pept        complement(543780..544175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0497"
FT                   /product="protein of unknown function DUF1090"
FT                   /note="PFAM: protein of unknown function DUF1090; KEGG:
FT                   pen:PSEEN5028 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71002"
FT                   /db_xref="InterPro:IPR009468"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2Z6"
FT                   /protein_id="ACA71002.1"
FT                   /translation="MKRMSTLFLLATFALSAHAVQATQEQTGLTGCAAKRQAISEQIEQ
FT                   AKVDNNSEQQSGLEKALSEVDANCTDAGLRKEREQKVLEARHEVNQRTKDLDKAMKKGD
FT                   PEHVNKRKDKLAEAKKELQEAVDDLER"
FT   sig_peptide     complement(544116..544175)
FT                   /locus_tag="PputW619_0497"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.795 at
FT                   residue 20"
FT   gene            complement(544308..546011)
FT                   /locus_tag="PputW619_0498"
FT   CDS_pept        complement(544308..546011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0498"
FT                   /product="DNA ligase (NAD(+))"
FT                   /EC_number="6.5.1.2"
FT                   /note="KEGG: pen:PSEEN5027 DNA ligase, NAD-dependent; PFAM:
FT                   NAD-dependent DNA ligase OB-fold; NAD-dependent DNA ligase
FT                   adenylation; SMART: NAD-dependent DNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71003"
FT                   /db_xref="GOA:B1J2Z7"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR020923"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1J2Z7"
FT                   /protein_id="ACA71003.1"
FT                   /translation="MSFFLRLAALLLLHTSIAQASHCPDWSTKQARTEVAQLRATLANW
FT                   DDHYHRQGIALVADELYDQARHHLLHLQQCFGQEFTDPSPLASARGPIAHPVAHTGVEK
FT                   LHDAAAVARWMTGKKGVWVQPKVDGVAVSLVYRQGRLVQLLSRGDGLQGHDWSRHIKDL
FT                   DSITRQLPQPLDVVLQGELYLRLQAHVQAEAGSSNVRGTVAGMLARKQLGPEPGASIGL
FT                   FVWDWPHGPDNQGERLTQLAAWGFPDSQRFSTAIDTPEEATHWRLHWYRSPLPFATDGV
FT                   ILRQDSRPPADRWQPNAPYWIAAWKYPFAQALAEVREVRFLIGRTGKVTPLLRLKPVTL
FT                   DDRRISQVSLGSLARWRALDIRPGDQVAISLAGLTIPRFDQVVHRAVERQVLPVPEAEQ
FT                   YGQHSCWQASDGCQEQFIARLVWLSGKQGLAMPGTGKGTWKRLVQAGLVTSLTDWLTLD
FT                   AQQLLSVPGISRKTATQLQRSFDIGRNRPFAQWRKGLGVPAPAQVPRDENWQTLAGRSA
FT                   SDWQTLPGIGATRATQLANFFTHEQVQRIATLLGTRGIDGFHGTDDVGSQ"
FT   sig_peptide     complement(545949..546011)
FT                   /locus_tag="PputW619_0498"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.911 at
FT                   residue 21"
FT   gene            complement(546178..547368)
FT                   /locus_tag="PputW619_0499"
FT   CDS_pept        complement(546178..547368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0499"
FT                   /product="Methionine adenosyltransferase"
FT                   /EC_number="2.5.1.6"
FT                   /note="PFAM: S-adenosylmethionine synthetase; KEGG:
FT                   pen:PSEEN5026 methionine adenosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71004"
FT                   /db_xref="GOA:B1J2Z8"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1J2Z8"
FT                   /protein_id="ACA71004.1"
FT                   /translation="MSEYSLFTSESVSEGHPDKIADQISDAVLDAIITQDKYARVACET
FT                   LVKTGVAIIAGEVTTSAWVDLEELVRKVIIDIGYNSSDVGFDGATCAVMNIIGKQSVDI
FT                   AQGVDRSKPEDQGAGDQGLMFGYASNETDVLMPAPICFSHRLVERQAEARKSGLLPWLR
FT                   PDAKSQVTCRYENGKVVGIDAVVLSTQHNPEVSQKDLQEAVMELIVKHTLPAELLHKDT
FT                   QYHINPTGNFIIGGPVGDCGLTGRKIIVDSYGGMARHGGGAFSGKDPSKVDRSAAYAGR
FT                   YVAKNIVAAGLAERCEIQVSYAIGVAQPTSISINTFGTGKVSDDKIIQLVRECFDLRPY
FT                   AITKMLDLLHPMYQETAAYGHFGRTPQQKTVGDDTFTTFTWERTDRAQSLRDAAGL"
FT   gene            complement(547388..548380)
FT                   /locus_tag="PputW619_0500"
FT   CDS_pept        complement(547388..548380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0500"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; Methyltransferase
FT                   type 11; Methyltransferase type 12; KEGG: pen:PSEEN5025
FT                   transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71005"
FT                   /db_xref="GOA:B1J2Z9"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1J2Z9"
FT                   /protein_id="ACA71005.1"
FT                   /translation="MNLRAQPIPQRSDTLAALCKASGDELRLNVLRALASDSFGVLELA
FT                   QIFDIGQSGMSHHLKVLAQAELVATRREGNAIFYRRALPDSHRLGGRLHTALLEEVDDL
FT                   TLPLDVQARIAQVQQRRAATSQDFFLRVEEKFRAQQDLIAGLPQYRESLLALLDTLNFE
FT                   PTASALEVGPGDGGFLPDLARRFACVTAMDNSPTMLELARQVCERERLDNVNLQLADAL
FT                   GATDVEADCVVLNMVLHHFSDPALALRLLAKRVKAGGSLLVTELCSHDQGWAREACGDL
FT                   WLGFEQDDLARWANAAGLAPGDSLYVGLRNGFQIQVRHFQRTAGDTHHR"
FT   gene            548607..550604
FT                   /locus_tag="PputW619_0501"
FT   CDS_pept        548607..550604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0501"
FT                   /product="transketolase"
FT                   /EC_number="2.2.1.1"
FT                   /note="KEGG: pen:PSEEN5024 transketolase 1 thiamin-binding,
FT                   isozyme; TIGRFAM: transketolase; PFAM: Transketolase domain
FT                   protein; Transketolase central region"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71006"
FT                   /db_xref="GOA:B1J300"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:B1J300"
FT                   /protein_id="ACA71006.1"
FT                   /translation="MPSRRERANAIRALSMDAVQKANSGHPGAPMGMADIAEVLWRDYL
FT                   KHNPSNPSFADRDRFVLSNGHGSMLIYSLLHLTGYDVTIDDLKSFRQLHSRTPGHPEFG
FT                   YTPGVETTTGPLGQGLANAVGFALAEKVLGAQFNREGHNIVDHNTYVFLGDGCMMEGIS
FT                   HEVASLAGTLGLNKLVAFYDDNGISIDGEVEGWFTDDTPKRFEAYNWLVIRNVNGHDAD
FT                   EIRTAIETARKSDRPTLICCKTIIGFGSPNKQGKEDCHGAPLGNDEIALARKELNWNHA
FT                   PFEVPADIYAEWNAKEAGAKAEAEWNTRFEAYAAAFPELASELKRRLSGDLPADFSEKA
FT                   AAYIAEVAAKGETIASRKASQNTLNAFGPLLPEFLGGSADLAGSNLTLWKGCKGVDAND
FT                   ASGNYVFYGVREFGMTAIMNGVALHGGLVPYGATFLMFMEYARNAVRMSALMKQRVIHV
FT                   YTHDSIGLGEDGPTHQPIEQLTSLRSTPNLDTWRPADAVESAVSWKHALERKDGPSALI
FT                   FSRQNLQHQDRDAQQIADIARGGYVLKDCAGEPELILIATGSEVGLAVQAFDKLTEQGR
FT                   KVRVVSMPSTSVFDAQDAAYKQSVLPLQVGARIAIEAAHADFWYKYVGLEGRVIGMTTY
FT                   GESAPASALFEEFGFTLENILGTAEELLED"
FT   gene            550761..551822
FT                   /locus_tag="PputW619_0502"
FT   CDS_pept        550761..551822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0502"
FT                   /product="D-erythrose-4-phosphate dehydrogenase"
FT                   /EC_number="1.2.1.12"
FT                   /note="KEGG: pen:PSEEN5023 glyceraldehyde 3-phosphate
FT                   dehydrogenase; TIGRFAM: D-erythrose-4-phosphate
FT                   dehydrogenase; PFAM: glyceraldehyde 3-phosphate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71007"
FT                   /db_xref="GOA:B1J301"
FT                   /db_xref="InterPro:IPR006422"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1J301"
FT                   /protein_id="ACA71007.1"
FT                   /translation="MPHPRPYKVALNGYGRIGRCVLRALFERGAKAGFEIVALNDLADQ
FT                   ASVEYLTRFDSTHGRFPGDVKVDGDCLHINGDCVKVMRSATPEGVDWAALDIDLVLECS
FT                   GAYHTRADGQRFLDAGAPRVLFSQPMASEADVDATVVYGINQACLTGAERLVSNASCTT
FT                   NCGVPLLRVLDQAFGIEYVQITTIHSAMNDQPVIDAYHHEDLRRTRSAFQSVIPVSTGL
FT                   ARGIERLLPELAGRIQAKAVRVPTVNVSCLDITLQTARDTSAVEVNRVLREAALDGPLK
FT                   GLLAYTELPHASCDFNHDPHSAIVDASQTRVSGPRLVNLLAWFDNEWGFANRMLDVAEH
FT                   YLHVVHPTRTKQP"
FT   gene            551835..552998
FT                   /locus_tag="PputW619_0503"
FT   CDS_pept        551835..552998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0503"
FT                   /product="Phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="PFAM: phosphoglycerate kinase; KEGG: pen:PSEEN5022
FT                   phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71008"
FT                   /db_xref="GOA:B1J302"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1J302"
FT                   /protein_id="ACA71008.1"
FT                   /translation="MTVLKMTDLDLQGKRVLIREDLNVPVKDGVVTSDARILAALPTIK
FT                   LALEKGAAVMVCSHLGRPTEGEFSAENSLKPVADYLSKALGRDVALVADYLDGIEVKAG
FT                   DLVLFENVRFNKGEKKNADELAQKYAALCDVFVMDAFGTAHRAEGSTHGVAKFAKVAAA
FT                   GPLLAAELDALGKALKAPAKPMAAIVAGSKVSTKLDVLNSLSSVCDQLIVGGGIANTFL
FT                   AAAGHPVGKSLYEPDLVETAKAIAAKVSVPLPVDVVVAKEFAESAEATVKAIADVAADD
FT                   MILDIGPQTAANFAELLKSSKTILWNGPVGVFEFDQFGNGTKVLAKAIADSAAFSIAGG
FT                   GDTLAAIDKYGVSAEISYISTGGGAFLEFVEGKVLPAVAILEERAKA"
FT   gene            553031..553249
FT                   /locus_tag="PputW619_0504"
FT   CDS_pept        553031..553249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0504"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN5021 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71009"
FT                   /db_xref="UniProtKB/TrEMBL:B1J303"
FT                   /protein_id="ACA71009.1"
FT                   /translation="MVKQLPVILLAGLLSACSSSPSSDNDPAQPPKGGCYQSEWQAETV
FT                   PVISKRVGPEGLEKYDEDHQRKAPGCP"
FT   sig_peptide     553031..553102
FT                   /locus_tag="PputW619_0504"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.648 at
FT                   residue 24"
FT   gene            553314..553643
FT                   /locus_tag="PputW619_0505"
FT   CDS_pept        553314..553643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0505"
FT                   /product="lipoprotein"
FT                   /note="KEGG: pen:PSEEN5020 lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71010"
FT                   /db_xref="InterPro:IPR018660"
FT                   /db_xref="InterPro:IPR036328"
FT                   /db_xref="UniProtKB/TrEMBL:B1J304"
FT                   /protein_id="ACA71010.1"
FT                   /translation="MKALMALMALATLAGCSLLQPAQPAPAAAWTRWVCDSQTDVLWRF
FT                   ADVQQDSVDVRLGGGDQVYRLKSEPSASGAMYSDGVLAFHTKGEEGLVYWVATNDLIGR
FT                   GCKAP"
FT   sig_peptide     553314..553403
FT                   /locus_tag="PputW619_0505"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.809 at
FT                   residue 30"
FT   gene            553745..554809
FT                   /locus_tag="PputW619_0506"
FT   CDS_pept        553745..554809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0506"
FT                   /product="fructose-bisphosphate aldolase, class II, Calvin
FT                   cycle subtype"
FT                   /EC_number="4.1.2.13"
FT                   /note="KEGG: pen:PSEEN5019 fructose-1,6-bisphosphate
FT                   aldolase, class II; TIGRFAM: ketose-bisphosphate aldolase;
FT                   fructose-bisphosphate aldolase, class II, Calvin cycle
FT                   subtype; PFAM: ketose-bisphosphate aldolase class-II"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71011"
FT                   /db_xref="GOA:B1J305"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006412"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B1J305"
FT                   /protein_id="ACA71011.1"
FT                   /translation="MALISMRQMLDHAAEFGYGVPAFNVNNLEQMRAIMEAADKTDSPV
FT                   IVQASAGARKYAGAPFLRHLILAAIEEFPHIPVCMHQDHGTSPDVCQRSIQLGFSSVMM
FT                   DGSLGEDGKTPTDYEYNVRVTQQTVAMAHACGVSVEGELGCLGSLETGMAGEEDGIGAE
FT                   GVLDHSQMLTDPEEAADFVKKTQVDALAIAIGTSHGAYKFTKPPTGDVLAIDRIKEIHK
FT                   RIPNTHLVMHGSSSVPQEWLAIINQYGGDIKETYGVPVEEIVEGIKHGVRKVNIDTDLR
FT                   LASTGAMRRLMAQNPSEFDPRKFFGETVKAMRDVCIARYEAFGTAGNASKIKPISLEGM
FT                   FQRYLKGELAAKVN"
FT   gene            555006..557126
FT                   /locus_tag="PputW619_0507"
FT   CDS_pept        555006..557126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0507"
FT                   /product="response regulator receiver modulated diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC sensor(s)"
FT                   /note="KEGG: pen:PSEEN5017 sensory box protein/response
FT                   regulator (hybrid); TIGRFAM: PAS sensor protein;
FT                   diguanylate cyclase; PFAM: GGDEF domain containing protein;
FT                   EAL domain protein; response regulator receiver; PAS fold-4
FT                   domain protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71012"
FT                   /db_xref="GOA:B1J306"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B1J306"
FT                   /protein_id="ACA71012.1"
FT                   /translation="MDGAYPQPPDGKSVLLVVDDYPENLISMRALLARTDWQVLTAGSG
FT                   TEALSALLEHEVDLVLLDVQMPEMDGFEVARLMRGSHRTRLTPIIFLTANEQSDAAVLK
FT                   GYASGAVDYLFKPFDPQILKPKVQAQLDQQRNRRMQQRLTRELEAARAFNASILENAAE
FT                   GILVVDAHGNISFANPAISRLLDAPVEQLQGAQLLELLQLPHATLWSESDFHQAYQSRQ
FT                   IFRVHDAHLRTAGGHLVPVALSCAPLPADQQAMVVTVLDMSVVRNLHQQLEYQAVTDPL
FT                   TGLLNRRGFYQAAESVLLRNERSDKAQALMYMDLDGFKRINDSLGHEAGDRVLGWVAEQ
FT                   LKDCLGSEALLARMGGDEFTALFDSLPYPEQAGRFAEQLLERMSVQRQVAGLDVCLGVS
FT                   IGIATFPDCGATVEGLLRAADAAMYAAKQAGRGQYRFYDQELNGRARSRLMLEDSVRDA
FT                   VESQGFNMVYQPQVAFADGHLRGFEALLRWQHPSVGDVPPGLFIPLLEEARLITRLASW
FT                   IYRQGAAQRQAWCERFAPDLVLGISLSRAQFAMPGLVDELQRVIQDYRLNPAQLEVEVA
FT                   ETSLMYNIDAAIKQIHRLRELGVRVALDDFGAGDCSLRMLRDLPVDTLKLDRHLVARLP
FT                   DSAPDAALVRSVIGLCADYNVTVIAEGVETEAQAAWLKANGCAYVQGFLVARPMTAADA
FT                   SGFPAFFPWPQS"
FT   gene            557166..557666
FT                   /locus_tag="PputW619_0508"
FT   CDS_pept        557166..557666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0508"
FT                   /product="protein of unknown function DUF45"
FT                   /note="PFAM: protein of unknown function DUF45; KEGG:
FT                   pen:PSEEN5016 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71013"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:B1J307"
FT                   /protein_id="ACA71013.1"
FT                   /translation="MTVLRYLQAYPPHLQEQVQQMIDSDRLGEYLQRRYPGRHDVQSDK
FT                   ALYGYAQELRQQYLRSAPSLDKVLFDNRLDLTHRALGLNTAVSRVQGGKLKAKKEIRIA
FT                   SLFKEAAPQFLRMIVVHELAHLRERDHSKAFYQLCQHMEPDYHQLEFDLRVYLTYRELP
FT                   GNL"
FT   gene            557679..557975
FT                   /locus_tag="PputW619_0509"
FT   CDS_pept        557679..557975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0509"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN5015 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71014"
FT                   /db_xref="InterPro:IPR017162"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B1J308"
FT                   /protein_id="ACA71014.1"
FT                   /translation="MDVSKTKSSFYRRLYVAWLIDSQTATSVPALMEATGMPRRTAQDT
FT                   IAALADLDIVCEFEQQEGARNHAGHYRIHDWGAIDKQWIIRHLRQIREVLGYP"
FT   gene            558126..558863
FT                   /locus_tag="PputW619_0510"
FT   CDS_pept        558126..558863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0510"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="SMART: extracellular solute-binding protein family
FT                   3; KEGG: pen:PSEEN5011 amino acid ABC transporter,
FT                   periplasmic amino acid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71015"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:B1J309"
FT                   /protein_id="ACA71015.1"
FT                   /translation="MRPLFCVLGVLAVMLAAPALGQGKLRLVADTWPPFTDAGMPGAGL
FT                   ATSIVTTALARAGYPSEYQEVPWARALLGVSEGRYDVLINAWYNDSRTRIGQFSKAYLT
FT                   NRIRLLKRKGDSFRYRRQADLYPYSIAVVRDYAYSPEFDSDTRLHKVPVGNFSSAVRML
FT                   AAGRVNLAVEDEFVARYNLQREPEAVRDGVVMVEPPLGENTLHILVSLKHPEHRQIVER
FT                   FERSIAAMKADGSYARLLRQHGF"
FT   sig_peptide     558126..558191
FT                   /locus_tag="PputW619_0510"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 22"
FT   gene            complement(558887..561070)
FT                   /locus_tag="PputW619_0511"
FT   CDS_pept        complement(558887..561070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0511"
FT                   /product="integral membrane protein, YccS/YhfK family"
FT                   /note="TIGRFAM: hypothetical membrane protein; integral
FT                   membrane protein, YccS/YhfK family; PFAM: protein of
FT                   unknown function DUF893 YccS/YhfK; KEGG: pen:PSEEN5010
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71016"
FT                   /db_xref="GOA:B1J310"
FT                   /db_xref="InterPro:IPR010019"
FT                   /db_xref="InterPro:IPR010020"
FT                   /db_xref="InterPro:IPR032692"
FT                   /db_xref="UniProtKB/TrEMBL:B1J310"
FT                   /protein_id="ACA71016.1"
FT                   /translation="MSSSSFRQSLRRLWGQDKFSYAIRVTIALTGSMAWCWYQNEMSLL
FT                   IPLFLGIIASALAETDDSWQGRLSALLVTLLCFAIAALSVELLFPYPWIFAISMALAAF
FT                   SLTMLGALGERYGAIASATLILSVYTMIGVDQRGGEVSDFWHEPLLLVAGAAWYGMLSV
FT                   LWQALFSNQPVQQSLAKLFFELGTYLKLKASLFEPIRTLDVEAQRLALAQQNGKVVGAL
FT                   NAAKEIILHRVGNSQPNSKVSRYLKLYFLAQDIHERVSASHYPYNALTEAFFHSDVMFR
FT                   CQRLLRKQGASCQELARSIRLRQPFVLATGFAEALEDLNASLEHLRNQNNPAWRGLLRS
FT                   LRALAANLATLDRLLGAASNPDSLADASDSSLLDRSPRNLKDVWKRLRTQLTPTSLLFR
FT                   HALRLSLALSVGYGMVHLIHPTQGYWIILTTLFVCQPNYGATRRKLVQRIFGTAIGLTV
FT                   GWALFDLFPNPLIQSAFAVVAGVVFFVNRTTRYTLATAAITLMILFCFNQIGDGYGLFL
FT                   PRLFDTLVGSLIAILAVFLFLPDWQGRRLNKALANTLACASVYLRQIMQQYAHGKRDDL
FT                   AYRLARRNAHNADAALSTTLANMLMEPGHFRKEADVGFRFLVLSHTLLSYLSGLGAHRD
FT                   TALPAEVHEQLIEGAGQALAASLDEIANGLAARLPVAIHSDAEEALANTLEQMPEELDE
FT                   HQRLVQTQLALICRQLGPLRTLAAHLIKQGSPA"
FT   gene            complement(561154..562386)
FT                   /locus_tag="PputW619_0512"
FT   CDS_pept        complement(561154..562386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0512"
FT                   /product="HI0933 family protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; HI0933 family protein; FAD
FT                   dependent oxidoreductase; FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; KEGG: pen:PSEEN5009
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71017"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B1J311"
FT                   /protein_id="ACA71017.1"
FT                   /translation="MSRKGRAAAPALLMRYPVHTTDVIILGAGAAGLMCAQLSARRGRR
FT                   VLLLDHANKPGKKILMSGGGRCNFTNMYTEPANFLSQNAHFCKSALARYTQWDFIELVA
FT                   KHGVPYHEKKLGQLFCDNKASDILDMLLAECDEAGAELRMQTSIEHIEKTESGYILQTS
FT                   AGQFACQSLVIATGGLSIPTLGATGFGYQVARQFGHTLLPTRAGLVPFTITEPQLKALC
FT                   TELSGTSLDCTASCNGTSFRENLLFTHRGLSGPAILQISSFWEAGDTVEINLLPDRDAL
FT                   TWLQQQQAERANAELKTVLGEVFTRKLANLLAEQWFESKPMKQYTPAELAQIADKLAAW
FT                   QLVPAGTEGYRTAEVTLGGVDTREVSSKTMESLKSPNLYFIGEVLDVTGHLGGFNFQWA
FT                   WASANAAAQFV"
FT   gene            complement(562469..563854)
FT                   /locus_tag="PputW619_0513"
FT   CDS_pept        complement(562469..563854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0513"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; DbpA RNA-binding
FT                   domain protein; DEAD/DEAH box helicase domain protein;
FT                   SMART: DEAD-like helicases; KEGG: pen:PSEEN5008
FT                   ATP-dependent RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71018"
FT                   /db_xref="GOA:B1J312"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1J312"
FT                   /protein_id="ACA71018.1"
FT                   /translation="MTTETTAFATLPLSAAMLANLDALGYASMTPIQAQSLPVILRGQD
FT                   LIAQAKTGSGKTAAFGIGLLNPINPRYFGCQALVLCPTRELADQVAKELRRLARAEDNI
FT                   KILTLCGGVSLGPQIASLEHGAHIIVGTPGRIQQHLDKGTLVLDGLNTLVLDEADRMLD
FT                   MGFFDAIASIIGKTPSRRQTLLFSATYPAGIEQLAADFMRKPQQVKVESLHTDNQIEQR
FT                   FIEIDPQQRLEAVTRVLGHYRPQSCVAFCFTKQQCEDVVAHLTAKGIVAQALHGDLEQR
FT                   DRDQVLTMFANRSSSVLVATDVAARGLDIDGLDMVINVELARDAEIHVHRVGRTGRAGE
FT                   KGIAVSLVAPAEGHRAQAIEALQKSPLRWDQLDSLKNKGGELLLPVMTTLCIAAGRKDK
FT                   LRPGDILGALTGDAGIPGKQVGKIAIFDFQAFVAVERALAKQAMQRLNSGKIKGRALKV
FT                   RIL"
FT   sig_peptide     complement(563789..563854)
FT                   /locus_tag="PputW619_0513"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.883) with cleavage site probability 0.378 at
FT                   residue 22"
FT   gene            complement(563919..565346)
FT                   /locus_tag="PputW619_0514"
FT   CDS_pept        complement(563919..565346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0514"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   pen:PSEEN5007 drug resistance transporter, EmrB/QacA
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71019"
FT                   /db_xref="GOA:B1J313"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B1J313"
FT                   /protein_id="ACA71019.1"
FT                   /translation="MPERTPLDPVTARWLPWVVAIAFFMQSLDGTILNTALPAMARSLE
FT                   ENPLRMQGVIIAYMLTVALLIPASGWIADRFGTKRIFFSAILLFSFGSLLCAMANSLGF
FT                   LIFARVVQGLGGALMLPVGRLVVLRAYPRSELVRIMSFITIPGLLGPLLGPTLGGWLVE
FT                   ILTWHWIFLLNLPVGALGCYAVWKFIPDLRGAERTTFDGPGFILFGAAMVLITIAMEGL
FT                   GELHLPHLRVMLLLFAGMACLAAYWLRAGRDPEPLFSPSLFRVRTFAIGILGNLFARLG
FT                   SGALPFLVPLLLQVALGYSPAQAGMSMIPLAAAAMVAKSVARPLIERLGYRIVLTGNTV
FT                   LLGLLLASLGLVDGQTPYAVLLVQLALLGAVNSMQFTAMNTVTLIDLDDASASSGNSLL
FT                   SVVAQLSLSLGVACAGALLGGFTAAGNADGVETTLGAFQLTFVTIGIMAMLAAAIFLQL
FT                   SPTDGRRARRPEQHMES"
FT   gene            complement(565483..566814)
FT                   /locus_tag="PputW619_0515"
FT   CDS_pept        complement(565483..566814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0515"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN5006 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71020"
FT                   /db_xref="GOA:B1J314"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:B1J314"
FT                   /protein_id="ACA71020.1"
FT                   /translation="MSATPQHAFEQLVSALHEVKHAEEQFTLGYSAEQSQFVRFNHAKV
FT                   RQAGEVSQASAHLRLIRDGRQAEQQVTLSGDGQVDRQRLGEALEQLRQTLPLLPADPYL
FT                   RLDQSAWHSHSLQDQALPELSEVLALLEGEAGDLDLVGIYAAGPICRGFASSYGAFGWH
FT                   QANSFNFDWSLFHSNGQAVKANYAGQAWNADEFTARLRQAREQLGFLGRPAITLKPGSY
FT                   RAYLAPAAMDEIAGMLCWGGFSAQALATGNSALQRLYSGDARLSPLVCFHEQVSGSLSP
FT                   AFSDEGSPRQDVPLIREGQALDRLVSARSAAEFELLANGADSYESPCALSLAAGNLANA
FT                   DILARLGTGLYISNLWYLNYSDLPAARMTGLTRFATFWVENGQIQGPVSTMRFDDSLYS
FT                   LLGSQLEDLTCEREMILSTSTYGQRSTGSSHLPGALVKGLTLTL"
FT   gene            complement(566814..568256)
FT                   /locus_tag="PputW619_0516"
FT   CDS_pept        complement(566814..568256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0516"
FT                   /product="peptidase U62 modulator of DNA gyrase"
FT                   /note="PFAM: peptidase U62 modulator of DNA gyrase; KEGG:
FT                   pen:PSEEN5005 peptidase, TldD/PmbA family"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71021"
FT                   /db_xref="GOA:B1J315"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:B1J315"
FT                   /protein_id="ACA71021.1"
FT                   /translation="MFDSSALLRQRFATLRSTAELFSLRHVKQSHQALSVRRNVAEPPF
FT                   FSQDEGAMLTVRVNGVEAYAATADLSQQGLQRALEHAEAMARQIARHSLLDLRDQPVTS
FT                   SRHDHISPNFDRPLPTLADCLGLLAAESASVPKDSRLVDWQASLSQSLVEQTYLNSAGA
FT                   ELRHAQRFLFPGLSVTASDGQDSQSRSLGRDNFGQQGGFEIIERCGLVGAAQRVADEAL
FT                   QLLLAANTPSGQRDLLLMPDQMMLQIHESIGHPLEMDRILGDERNYAGTSFVKASDFGH
FT                   LQYGSPLLNVTFDPTIGEELASYSHDDDGSQASKQFLIREGLLLRPLGGALSQFRSGLD
FT                   GVANSRACGWNRAPIDRMANLNVEPGDQTLEQLIQGIEHGILMRTNRSWSIDDARNKFQ
FT                   FGCEWGQLIEGGELKGIVKNPNYRGISAQFWRNLAAVGDRSTFQVLGTPNCGKGEPNQV
FT                   VRVGHAAPACVFRQIDVFGGDA"
FT   gene            complement(568287..570089)
FT                   /locus_tag="PputW619_0517"
FT   CDS_pept        complement(568287..570089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0517"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   pen:PSEEN5004 probable acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71022"
FT                   /db_xref="GOA:B1J316"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B1J316"
FT                   /protein_id="ACA71022.1"
FT                   /translation="MPETLLSPRNLAFELYEVLDAQALTQRPRFAEHSRETFDAALTTA
FT                   RTIAEKYFAPHNRKADENEPRYVDGRAELIPEVKPAVDAFLKAGFLNANRDFEVGGMQL
FT                   PSLVSQACFAHFQAANAGTTAYPFLTMGAANLIESFGSDEQKHLFLQPMIEGRFFGTMA
FT                   LTEPHAGSSLADIRTRAEPAGDGSYRIKGNKIFISGGDHELSENIVHMVLAKLPDAPPG
FT                   VKGISLFIVPKYLVNQDGSCGGRNDVLLAGLFHKMGWRGTTSTALNFGDNGQCVGYLVG
FT                   QPHQGLACMFQMMNEARIGVGMGAVMLGYAGYLYSLEYARQRPQGRLPDSKDPLSPAVP
FT                   IIEHTDVKRMLLAQKAYVEGAFDLGLYAARLFDDTQTADGESARQQAQALLDLLTPIVK
FT                   SWPSTFCLKANELAIQILGGHGYTREYPVEQYYRDNRLNPIHEGTEGIQSLDLLGRKLV
FT                   QHNGAGLKQLIRLIASTGERASHHPNLDALRQPLEQLVTRLQAVTLGLLGDLAHGQTAG
FT                   ALANSALYLKAFGHCVIGWRWLEQAIFAELGLCKGNAADRDFYLGKLQAARYFLTWEVP
FT                   GCHNELALLEARDDTCLAMQDGWF"
FT   gene            571127..571579
FT                   /locus_tag="PputW619_0518"
FT   CDS_pept        571127..571579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0518"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kpn:KPN_00712 putative arginine/ornithine
FT                   antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71023"
FT                   /db_xref="GOA:B1J317"
FT                   /db_xref="UniProtKB/TrEMBL:B1J317"
FT                   /protein_id="ACA71023.1"
FT                   /translation="MMVSTTNKQRALYLLWASMDAFYIILYILRNIARGAIPFLSDLNS
FT                   GLDVVRSWGGSGIVIWAGLFLQFSVIVTCVGFFRCKKIVVFLALVQMPFRFFFIVPSVS
FT                   VVLLLPMVVAGINNWIWVGLLLASEAFKGWSIWWLWRNSGARMVER"
FT   gene            572230..572379
FT                   /locus_tag="PputW619_0519"
FT   CDS_pept        572230..572379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0519"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN4574 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71024"
FT                   /db_xref="UniProtKB/TrEMBL:B1J318"
FT                   /protein_id="ACA71024.1"
FT                   /translation="MVHHAMQLQPRSPASILMMTTMHELEALRALLESALVQVQMPAEA
FT                   RPVH"
FT   gene            572535..572798
FT                   /locus_tag="PputW619_0520"
FT   CDS_pept        572535..572798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0520"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN0872 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71025"
FT                   /db_xref="InterPro:IPR021427"
FT                   /db_xref="UniProtKB/TrEMBL:B1J319"
FT                   /protein_id="ACA71025.1"
FT                   /translation="MTTEDTQFTVGKTTFYQGENGTHPLFRIEPGIPCRDAREQSSELM
FT                   GYVRELTITGLMDEKPMMLWAAHYLSAMAKALMDDAELGMKQ"
FT   gene            complement(572969..576922)
FT                   /locus_tag="PputW619_0521"
FT   CDS_pept        complement(572969..576922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0521"
FT                   /product="delta-1-pyrroline-5-carboxylate dehydrogenase"
FT                   /note="TIGRFAM: delta-1-pyrroline-5-carboxylate
FT                   dehydrogenase; PFAM: Proline dehydrogenase; Aldehyde
FT                   Dehydrogenase; KEGG: pen:PSEEN4999 proline
FT                   dehydrogenase/delta-1-pyrroline-5-carboxylate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71026"
FT                   /db_xref="GOA:B1J320"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR005933"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR024082"
FT                   /db_xref="InterPro:IPR024089"
FT                   /db_xref="InterPro:IPR024090"
FT                   /db_xref="InterPro:IPR025703"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="InterPro:IPR041349"
FT                   /db_xref="UniProtKB/TrEMBL:B1J320"
FT                   /protein_id="ACA71026.1"
FT                   /translation="MATTTLGVKLDDPTRERLKAAAQSIDRTPHWLIKQAIFNYLEKLE
FT                   GGATLTELNGQANSPADDAGEVQPDHAHQCFLEFAESILPQSVLRSAITAAYRRPEQEV
FT                   VPMLLEQARLSAPLAEATNKMAAGIAEKLRNQKSAGGRAGIVQGLLQEFSLSSQEGVAL
FT                   MCLAEALLRIPDKGTRDALIRDKISSGNWHPHLGNSPSLFVNAATWGLLLTGKLVSTHN
FT                   EAGLTTSLTRIIGKSGEPMIRKGVDMAMRLMGEQFVTGETIAEALANASRFESKGFRYS
FT                   YDMLGEAALTEHDAQKYLASYEQAIHSIGKASHGRGIYEGPGISIKLSALHPRYSRAQY
FT                   ERVMEELYPRLLSLTLLAKQYDIGLNIDAEEADRLELSLDLLERLCFEPSLAGWNGIGF
FT                   VIQAYQKRCPYVIDYVIDLAKRSRHRLMIRLVKGAYWDSEIKRAQVEGLEGYPVYTRKV
FT                   YTDVSYVACARKLLAVPEAIYPQFATHNAHTLSAIYHIAGQNYYPGQYEFQCLHGMGEP
FT                   LYEQVVGKVSEGKLNRPCRVYAPVGTHETLLAYLVRRLLENGANTSFVNRIADHSISIQ
FT                   ELVADPVASIERMATQEGSIGLPHPRIPLPRDLYGSERANSAGIDMANEHRLASLSCAM
FT                   LATAHNDWKATPLLACAASESAATAVLNPADHRDVVGHVQEATVADVDNAIQCALNAAP
FT                   IWQATPPAERAAILERTADLMEAEIQPLMGLLIREAGKTFANAIAEVREAVDFLRYYAV
FT                   QARNDFSNDAHRPLGPVVCISPWNFPLAIFTGQVAAALAAGNPVLAKPAEQTPMIAAQA
FT                   VRLLLEAGIPEGVLQLLPGRGETVGAGLVGDERVKGVMFTGSTEVARLLQRNVAGRLDN
FT                   QGRPIPLIAETGGQNAMIVDSSALTEQVVIDVVSSAFDSAGQRCSALRVLCLQEDSADR
FT                   VIEMLKGAMAESRLGNPDRLAVDIGPVIDAEAKAGIEKHIQGMREKGRPVYQVAIADAA
FT                   ETKRGTFVMPTLIELESFDELKREIFGPVLHVVRYNRRNLDQLIEQINNSGYGLTLGVH
FT                   TRIDETIAKVVENANAGNMYVNRNIVGAVVGVQPFGGEGLSGTGPKAGGPLYLYRLLST
FT                   RPADAIGRHFQQQDGEGKPDRTLHEQLVKPLHGLKAWAQSNQLADLAALCDQFASQSQS
FT                   GIARLLPGPTGERNSYTILPREHVLCLADNEADLLAQLAAVLAVGSSAVWADSEPGKAL
FT                   RARLPRELQAKVKLVADWNKDEVAFDAVIHHGDSDQLRSVCQQVAKRAGAIVGVHGLSS
FT                   GDHQIALERLVIERAVSVNTAAAGGNASLMTIG"
FT   gene            577279..578757
FT                   /locus_tag="PputW619_0522"
FT   CDS_pept        577279..578757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0522"
FT                   /product="sodium/proline symporter"
FT                   /note="TIGRFAM: SSS sodium solute transporter superfamily;
FT                   sodium/proline symporter; PFAM: Na+/solute symporter; KEGG:
FT                   pen:PSEEN4998 major sodium:proline symporter (SSS family)"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71027"
FT                   /db_xref="GOA:B1J321"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR011851"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:B1J321"
FT                   /protein_id="ACA71027.1"
FT                   /translation="MGNPLTITFVIYIAVMVLIGFAAYRSTKNLSDYILGGRSLGSVVT
FT                   ALSAGASDMSGWLLMGLPGAIYFSGLSEAWIAIGLTVGAYLNWLFVAGRLRVQTEHNGD
FT                   ALTLPDYFSSRFEDSSGLLRIISAIVILVFFTIYCASGIVAGARLFESTFGMSYETALW
FT                   AGAAATIAYTFIGGFLAVSWTDTVQASLMIFALILTPIIVLISTGGFDTTFLAIEAQNP
FT                   AHFDMLKGATFIGIISLMGWGLGYFGQPHILARFMAADSVKSIANARRISMTWMILCLV
FT                   GTCAVGFFGIAYFSAHPELAGPVTENHERVFIELAKILFNPWVAGVLLSAILAAVMSTL
FT                   SCQLLVCSSALTEDFYKAFLRKNASQRELVWVGRLMVLAVALIAIAMAANPENRVLGLV
FT                   AYAWAGFGAAFGPVVLISVLWKGMTRNGALAGIVVGALTVILWKQFDTIGLYEIIPGFL
FT                   FASIAIVVVSKLGSPSNSMVSRFETADAAYHAEK"
FT   gene            578887..579723
FT                   /locus_tag="PputW619_0523"
FT   CDS_pept        578887..579723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0523"
FT                   /product="protein of unknown function DUF519"
FT                   /note="PFAM: protein of unknown function DUF519; KEGG:
FT                   pen:PSEEN4997 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71028"
FT                   /db_xref="GOA:B1J322"
FT                   /db_xref="InterPro:IPR007473"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B1J322"
FT                   /protein_id="ACA71028.1"
FT                   /translation="MNYRHAFHAGNHADVLKHIVLTRLIALMSRKEQPFAYIDTHAGLG
FT                   LYDLQGDQATRTGEYLEGVARLWNRDDLPAMAADYLRIIKRLNSDGELRYYPGSPELAR
FT                   RLMRQQDRALLNEKHPEDGPLLKENMKKDPRVVVHLGEGWHVPRALLPVPEKRAIMLID
FT                   PPFEQADELKRCTTSLKEAIGRMRQTVAAIWYPIKDQRSLTRFYQDLTSTGAPKLLRVE
FT                   LYVHHQDSPQGLNGSGLAIANPPWGLEEELKELLPWLAKELAQTAGSYRMDWLIAE"
FT   gene            579908..581665
FT                   /locus_tag="PputW619_0524"
FT   CDS_pept        579908..581665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0524"
FT                   /product="Carbamoyltransferase"
FT                   /note="PFAM: Carbamoyltransferase; KEGG: pen:PSEEN4996
FT                   carbamoyltransferase, NodU family"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71029"
FT                   /db_xref="GOA:B1J323"
FT                   /db_xref="InterPro:IPR003696"
FT                   /db_xref="InterPro:IPR031730"
FT                   /db_xref="InterPro:IPR038152"
FT                   /db_xref="UniProtKB/TrEMBL:B1J323"
FT                   /protein_id="ACA71029.1"
FT                   /translation="MALTILGLSGALSHDPSAALYIDGKLIAAAEEERFVRDKHAKNRM
FT                   PYESAKFCLEQAGIKPSDVDVVAIPFAPISLFGKARWHYAKRYWYAPDRALDAILMGNR
FT                   RYKRYRKKIVWCLEQLGFDPKKVKIEPVEHHLAHASSAYHCSGFKEKTAILGIDGKGEY
FT                   ATTFFGYGENGKIHKIKEFFDPDSLGGLYGAITEFLGFEMLDGEFKVMGMAPYGDASKY
FT                   DFSRLASFENGELVINTEYANVIGLRRYKEKGKGFYFSPKLIEWLGPKREGDIADEPYI
FT                   HYAASMQALFEKLALQMIDHYLGDTLRETGKLAFAGGCALNVKLNQKIIARPDVKELFV
FT                   QPASGDAGTAVGAAAYVSHARGVPVEKMEHVYLGPSYSNEDVIAACARHPNQPKWRKLD
FT                   DMPRQIARIMVDGNPVAWFQGRMEFGPRALGGRSIIGCPSVEGVADRINHQIKFRERWR
FT                   PFCPSMLDTVAPQMIKIDHPAPFMTFTFEVAEEWKTRVPEVVHEDGTSRAQVLKREYNP
FT                   RYYDMMKALEDLTGNGVSLNTSLNRRGEPMICSPTDALNMFFGSDLQYLIMEDILVVKD
FT                   GAAAYDQPL"
FT   gene            581649..582779
FT                   /locus_tag="PputW619_0525"
FT   CDS_pept        581649..582779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0525"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   pen:PSEEN4995 glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71030"
FT                   /db_xref="GOA:B1J324"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B1J324"
FT                   /protein_id="ACA71030.1"
FT                   /translation="MTSRSEPRILQFCHGYDGPFLDCARQYASLFQGSGYKVTTVFLTG
FT                   AADPQVAAGCASDEVLFLQFSSKAVRGLKLGAIRALRRIAAERNFSFCIAHRFKPIYVA
FT                   LLATGLPVIGVHHAFGDYERKGRRLFANLFSKRLSLLGVSDAVRDDMRRCLPQWPAERI
FT                   QTLYNRIDIEALQATLVPRAEARQALGLDAQAWVVGNVGRLHPDKDQATLLRGFAQALP
FT                   ELPAGARLAILGMGRLEDKLKALAGELGIAGQVDFLGQVPDARRYFQAFDVFALSSDHE
FT                   PFGMVLLEAMVAGVPVLATACGGAREVVEGVGVLFPLGDASQLAQGLKHMALLDEQQRD
FT                   ACASHMLRRLRERFSDQAVREAFWQLPQVSALVVRK"
FT   gene            582779..583675
FT                   /locus_tag="PputW619_0526"
FT   CDS_pept        582779..583675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0526"
FT                   /product="Mig-14 family protein"
FT                   /note="PFAM: Mig-14 family protein; KEGG: pen:PSEEN4994
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71031"
FT                   /db_xref="InterPro:IPR009977"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B1J325"
FT                   /protein_id="ACA71031.1"
FT                   /translation="MLNHIQAWRERGWQVIDAAAYAETWARFGGSVATHPLVIEQLADL
FT                   AQIPVRYLGWHQAGELKAGVATWGRHLALSKDVLKRAGKKGLFDLGNAEIILPAAGDAA
FT                   APLRHTARYLSELNQGRFSGLKAQKEQLAMARAHEDLSKKFRYNQRRELRLLEEAGGVV
FT                   RPITDFSAQQIAAMYCDLFQRRWGFPATGAERMADVLERLRELLIGSVLLLDDKPIAIQ
FT                   LVYRVEAPQWISVEYVNGGVDPETKAFSPGSVLSFLNTQAAWDDARARNKPLRFSFGRA
FT                   DREYKDRWCNPVPVFQA"
FT   gene            583672..585075
FT                   /locus_tag="PputW619_0527"
FT   CDS_pept        583672..585075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0527"
FT                   /product="LmbE family protein"
FT                   /note="PFAM: LmbE family protein; KEGG: pen:PSEEN4993
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71032"
FT                   /db_xref="GOA:B1J326"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:B1J326"
FT                   /protein_id="ACA71032.1"
FT                   /translation="MSRKQQLLKRHRRNKRLGLLGGLAVLVAVGVFAWWWLPLLLLPLL
FT                   WAAHEAWFADHLFYAPGEDYAYNFGEQTGEAPVTLRDGVLKVDKALQGNETLILEVRVK
FT                   SGWLGRFLDPCVELLADERADRQTFERGVDGVRFLNLTGLAAPLQAGTLLVCGRHCRLQ
FT                   GQPRLWITPGVEMQRRRVMVIAPHADDAELAAYGLYSQADEAWVVTLTAGEIEAEHYQQ
FT                   MGMGKAEAARLKGRLRAWDSIAVPRWAGVPEARCVQLGYFCLQLPAMQAAPDVPAGSRE
FT                   ADMVDIRPFRRFNPLSLPADSDGAPTWNNLLADLRALLEMARPEVLVMPHPQLDPHPDH
FT                   ICAHMAVMQALRGLVWQPQTLLCYANHLHDNDRWPMGDSGDGVALPPQLSADQPWAPCS
FT                   LVLDLPTQRDKAMALGMMHDLQPAAPFKRRLRRLLQRWLAGRRPSPYGENEFFRKAVRR
FT                   HELFWRREL"
FT   sig_peptide     583672..583773
FT                   /locus_tag="PputW619_0527"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 34"
FT   gene            585124..586080
FT                   /locus_tag="PputW619_0528"
FT   CDS_pept        585124..586080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0528"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN4992 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71033"
FT                   /db_xref="UniProtKB/TrEMBL:B1J327"
FT                   /protein_id="ACA71033.1"
FT                   /translation="MKVLFLVQKEQRAILDRLYDGVAANCECDLRWLTSDDQRNLRRYF
FT                   KREVQVERYDRIVFFLRFKQEIRQAAFIRTVPNLVILEHDAYQNYIPCKYTGKFSAHYR
FT                   KLPWARVISSGYMVSERLRREGFDAVFVPKGYDERLLTDQGLERDIELAFVGSTNSVAY
FT                   SGRKALLDELGRVENLVVTRTKSGEDYCNTLNRIRFFVSADVGMGEYMIKNFEAMACGC
FT                   VLLAFDQGAEENSALGLQDMHNVVLYDSIPMLQAKLRTLRADPDLAQQIAENGRHLAVS
FT                   RFSFAEVGRSIVDHMRPALRPHPPLSAWQRLRLTLGI"
FT   gene            586148..586921
FT                   /locus_tag="PputW619_0529"
FT   CDS_pept        586148..586921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0529"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN4991 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71034"
FT                   /db_xref="GOA:B1J328"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B1J328"
FT                   /protein_id="ACA71034.1"
FT                   /translation="MRFSNDSDVTLVVTSCGRFDLLKETLESFDRYNTAPIREVFITED
FT                   SGDDAVHGAVPEHWKPHCTVFVNRPKLGQLASIDLAYSHVKTAYIFHCEDDWRFYRQAF
FT                   VEDSRAILEVSPGVLQVWLRSHAHDLSIHSPYIHLGDRQVIAGVPCYPLHSEKAEWQAF
FT                   SLNPGLRRLSDYQRCAPFAGYAGEKALSRRYAELNLTAVTLEGDAVLHTGFGSHVTVPE
FT                   EVHRKAKRRNRDRIKLALTLVIGALAGMGISIFVH"
FT   gene            complement(586979..587584)
FT                   /locus_tag="PputW619_0530"
FT   CDS_pept        complement(586979..587584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0530"
FT                   /product="toluene tolerance protein Ttg8"
FT                   /note="KEGG: pen:PSEEN4989 toluene tolerance protein Ttg8"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71035"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B1J329"
FT                   /protein_id="ACA71035.1"
FT                   /translation="MQCSRLTQVDFDQLTLGAQILEADSHGAKVYLLKDGNFLKVFRRK
FT                   RLISSALLRPYSQRFVDNAARLAQLGIPTLEVISQHKLDLPGRTAVLYRPLPGRTLLQM
FT                   SRDEGFSWDIYLPRLITLIRQLHRSGVYFRSLHLGNVVVTPDQHLGLIDVADMRFLRPP
FT                   LSARMVRRNVQHMVSYIAREKLGDRFPLADFQAALLAR"
FT   gene            587810..589621
FT                   /locus_tag="PputW619_0531"
FT   CDS_pept        587810..589621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0531"
FT                   /product="lipid A ABC exporter, fused ATPase and inner
FT                   membrane subunits MsbA"
FT                   /note="KEGG: pen:PSEEN4987 lipid A export
FT                   ATP-binding/permease protein MsbA; TIGRFAM: lipid A ABC
FT                   exporter, fused ATPase and inner membrane subunits MsbA;
FT                   PFAM: ABC transporter transmembrane region; ABC transporter
FT                   related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71036"
FT                   /db_xref="GOA:B1J330"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR011917"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B1J330"
FT                   /protein_id="ACA71036.1"
FT                   /translation="MMAETPLPAEHTSSLKIYFRLLSYVKPYIGIFLLSIVGFVIFAST
FT                   QPMLAGILKYFVDGLSNPEAVLFPNVPYLRDLQLLQAVPLLIILIAAWQGLGSFLGNYF
FT                   LAKVSLSLVHDLRVELFNKLLVLPNRYFDNHNSGHLISRITFNVTMVTGAATDAIKVVI
FT                   REGLTVVFLFAYLLWMNWHLTLVMVAILPVIAVMVSVASKKFRKQSKKIQVAMGDVTHV
FT                   ASETIQGYRVVRSFGGEAYEQQRFGRASQSNTDKQLRMTKTGALYTPMLQLVIYSAMAA
FT                   LMFLVLFLRGDSTAGDLVAYITAAGLLPKPIRQLSEVSSTIQKGLAGAESIFEQLDEQP
FT                   EIDRGTIEKERVAGRLEVRNLSFTYPGTEREVLSDISFTAEPGQMIALVGRSGSGKSTL
FT                   AALIPRFYHHDQGQILLDGVEIEDYRLRNLRRHVSQVTQHVTLFNDTVANNIAYGDLAG
FT                   APRADIEAAAADAYAKEFVDQLPKGFDTDVGENGVLLSGGQRQRLAIARALLKNAPLLI
FT                   LDEATSALDTESERHIQAALDHVMQGRTTLVIAHRLSTIEKADQILVMDQGRLVERGTH
FT                   AELLAANGYYARLHAMGLEEPAKADIT"
FT   gene            589752..591173
FT                   /locus_tag="PputW619_0532"
FT   CDS_pept        589752..591173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0532"
FT                   /product="rfaE bifunctional protein"
FT                   /note="TIGRFAM: cytidyltransferase-related domain protein;
FT                   rfaE bifunctional protein; PFAM: cytidylyltransferase; PfkB
FT                   domain protein; KEGG: pen:PSEEN4986 lipopolysaccharide core
FT                   biosynthesis protein RfaE"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71037"
FT                   /db_xref="GOA:B1J331"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011913"
FT                   /db_xref="InterPro:IPR011914"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023030"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1J331"
FT                   /protein_id="ACA71037.1"
FT                   /translation="MKLSMPRFDQAPVLVVGDVMLDRYWHGGTSRISPEAPVPVVKVDQ
FT                   IEDRPGGAANVALNIAALGAPAALIGVTGQDEAADSLANSLQAAGVRSVFQRIAHQPTI
FT                   VKLRVMSRHQQLLRIDFEEPFATDPLSLGAEVESLLEGVKVLVLSDYGKGALKNHQSLI
FT                   QAARAKGIPVLADPKGKDFSIYRGASLITPNLSEFETIVGRCADEAELVAKGLQLLLDL
FT                   DLGALLVTRGEHGMTLLRTGQPALHLPARAREVFDVTGAGDTVISTLAAAIAAGEDLPH
FT                   AVGLANLAAGIVVGKLGTAAISAPELRRAIQREEGSERGVLGLEQLLLAIDDARAHNEK
FT                   IVFTNGCFDILHAGHVTYLEQARAQGDRLIVAVNDDASVSRLKGPGRPINSVDRRMAVL
FT                   AGLGAVDWVISFPEGTPENLLSQVKPDVLVKGGDYGIDQVVGADIVKGYGGTVKVLGLV
FT                   ENSSTTAIVEKIRKN"
FT   gene            complement(591206..592174)
FT                   /locus_tag="PputW619_0533"
FT   CDS_pept        complement(591206..592174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0533"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN4985 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71038"
FT                   /db_xref="UniProtKB/TrEMBL:B1J332"
FT                   /protein_id="ACA71038.1"
FT                   /translation="MPRTLIRKNPSNFKTLPLHVEATPESLVYQSIGMPLNFAQTQQRR
FT                   RAIELPDNQRFVAELANLGVSVRLTLHWQNRDYWVLVRQRRQDRGDVVLKLISGYVPAQ
FT                   ELNLPLHTAVQEVAEECLLETPEGWLGGRFNDTWLPAPYAAALHYREALPFVLTPESGA
FT                   ARSVYCANLMLLERPRAYVHLPTASLQLIYDMRLQVPKDAKKLSLFHVDERLEGDQLVA
FT                   RLNRKRPDLYLMPVQDGQPLAELYTLKKDELVPASTRGLYLAESFARQDGWVVADERIR
FT                   WKDWVRQQGLVESKAAKASHLRRFGDKARALLERARTSLSK"
FT   gene            complement(592225..593037)
FT                   /locus_tag="PputW619_0534"
FT   CDS_pept        complement(592225..593037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0534"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: pen:PSEEN4984
FT                   oxidoreductase, aldo/keto reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71039"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B1J333"
FT                   /protein_id="ACA71039.1"
FT                   /translation="MTLPTLHDFHRSLGSTGFKVSPLGLGTVKLGRDQGVKYPTGFTIP
FT                   GDDEARLLLAQARELGINLIDTAPAYGCSEERLGPLLRGQRDEWVIVSKVGEEFENGQS
FT                   RFDFSAAHTRLSVERSLRRLETDRIELVLVHSDGNDLEILEQQEVYQTLAALKQEGKIL
FT                   GYGLSGKTVAGGLKALEQGDCAMVTFNLNEQAERPVLDYAAEHGKAILVKKALASGHVC
FT                   LAPGVDPVHASFELLFAHPGVSSAIVGTINPLHLAHNVATVARILGQH"
FT   gene            complement(593034..594209)
FT                   /locus_tag="PputW619_0535"
FT   CDS_pept        complement(593034..594209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0535"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   pen:PSEEN4983 oxidase, FAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71040"
FT                   /db_xref="GOA:B1J334"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B1J334"
FT                   /protein_id="ACA71040.1"
FT                   /translation="MPSAISTDVLIVGAGVAGLWLNARLRRLGYSTVLVERASLGGEQT
FT                   IKSQGIIHGGTKYALHGALTGASEAIADMPRRWREAVAGSGELDLSRTRLLSDAHYLWS
FT                   PGTLAGNLTSFFASKAVRGRVDQVKGDQLPPALQDRAFKGKVYRLAELVIDVPSLLANL
FT                   AELAGDSLLAGEHIEPLHEGELLVGLRVDGREIRAQRIVLSAGAGTEGLLHALGLEQPA
FT                   MQTRPLHMVMAKGPNLKPLYAHCLGGGPKPRVTITTHPAADGQWVWYLGGDLAEADGVA
FT                   RDTQAQIAAAQKEVSQLLPWVDQRLVRWATLRVDRAEPAQSGLVRPDNAFLADQQRLLV
FT                   GWPTKLALAPDFSDRVLASLERDGIRPSAQAELAGLPRPPLGVPAWEQLLP"
FT   gene            complement(594286..594618)
FT                   /locus_tag="PputW619_0536"
FT   CDS_pept        complement(594286..594618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0536"
FT                   /product="small multidrug resistance protein"
FT                   /note="PFAM: small multidrug resistance protein; KEGG:
FT                   pen:PSEEN4982 multidrug efflux SMR transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71041"
FT                   /db_xref="GOA:B1J335"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:B1J335"
FT                   /protein_id="ACA71041.1"
FT                   /translation="MNAYTCLAIAIVAEVIATASMKAVKGLSTPLPLLLMVVGYGIAFW
FT                   MLTLVVRTIPVGIAYAVWSGLGIVLISVAALVIYGQKLDVPAMLGMAMIVGGVVVIQLF
FT                   SKTAGH"
FT   gene            594705..595595
FT                   /locus_tag="PputW619_0537"
FT   CDS_pept        594705..595595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0537"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: pen:PSEEN4981 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71042"
FT                   /db_xref="GOA:B1J336"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1J336"
FT                   /protein_id="ACA71042.1"
FT                   /translation="MADQWNLEQLRTFVRVVELRSFSAVAREQRKAQSAVSNAIAMLEA
FT                   DLGVTLFERSSGRQPRLTENGTALLADARELLRQCERLDGRALALMRGQEALLRVAQDE
FT                   AMPYQPVIDSLDELAIHYPFLEVQLASGAQGDVARKLVERRADLGLFFHHESMPASLER
FT                   RALGSVEMVTVCAVDHPLACESRVTRQQLARYRQLLIAPQQSGYPGGEAISPQVWRADS
FT                   FYAMAELLMRGLGWAWLPRHVVQYPTYQAHMVELASEWRPPALVVELAWRRDEPLGPAA
FT                   QWLAERFAVHLRAIG"
FT   gene            595607..596878
FT                   /locus_tag="PputW619_0538"
FT   CDS_pept        595607..596878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0538"
FT                   /product="Three-deoxy-D-manno-octulosonic-acid transferase
FT                   domain protein"
FT                   /note="PFAM: glycosyl transferase group 1;
FT                   Three-deoxy-D-manno-octulosonic-acid transferase domain
FT                   protein; KEGG: pen:PSEEN4980
FT                   3-deoxy-D-manno-octulosonic-acid transferase (KDO
FT                   transferase)"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71043"
FT                   /db_xref="GOA:B1J337"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:B1J337"
FT                   /protein_id="ACA71043.1"
FT                   /translation="MNRTLYTLLFHLGLPLVALRLYLRARKAPAYGQRIGERFARNLPA
FT                   MRQGGIWVHAVSVGESIAAAPMVRALLKAYPDLPVTLTCMTPTGSERIRALFADEPRIQ
FT                   HCYLPYDLPWAAGRFLDHVRPRLGIIMETELWPNHIHQCAKRGIPVALANARLSERSAR
FT                   GYARFASLTRPMLAEMNLIAVQTETEAQRFRDLGARPECVQVTGSIKFDLKVDDQLLPR
FT                   ARALREQWGASGRPVWIAASTHEGEDALILQAHQQLLQVHGDALLILVPRHPERFDAVH
FT                   ALCSGQFATVRRSAGAAVDGQTRVLLGDTMGELLFLYALADIAFVGGSLVATGGHNPLE
FT                   PAALALPVIMGPHVFNFLEISAMLRDAGALQQVDDAQGLAEAVRQLIELPQDAQRMGEA
FT                   GRAVMQANQGALQRLLDGLGRLIR"
FT   gene            complement(596964..598352)
FT                   /locus_tag="PputW619_0539"
FT   CDS_pept        complement(596964..598352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0539"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain"
FT                   /note="PFAM: regulatory protein GntR HTH; aminotransferase
FT                   class I and II; KEGG: pfl:PFL_4913 transcriptional
FT                   regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71044"
FT                   /db_xref="GOA:B1J338"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1J338"
FT                   /protein_id="ACA71044.1"
FT                   /translation="MWVPHYSDLAQPVYLMIADALEQDIGNGRLAPGDRLPTLKDLAES
FT                   LHVTPGTIGRAYDEAAKRGLVVGEVGRGTFVLQQRPAPTPTAFSRPAPLKHESGQIDLS
FT                   IIKPNDAHMADWLRGAITELAASPDLDQVLDYVTDGGHATHKQAGATWIQRWLPEARSQ
FT                   QVVLTSGAQHGLLVAISSLSKSDDVILCEALCYPGIISLAHSMGRRLRGVAMDEHGLIP
FT                   EALRAACVEHRPSLLVCVTTHQNPTNSVMPHARREAIAQIAREFDLFIVDDDIYGFLEP
FT                   APDYKPLAAYAPERSVYLTSLSKSVLPALRIGYLYAPPQTLSRLSSMVRSSVWMPSPLM
FT                   AQLASNLINSGMAEHLVRVQQEEAAARQLMAQEILGRYKVRSQPNSFHIWLELPEPWTS
FT                   DEFANLARNNGVTVVSGSQFLPERSPASCGVRIALMTPSRAELSFALTKLASLLDSSEP
FT                   RLFY"
FT   gene            598749..599798
FT                   /locus_tag="PputW619_0540"
FT   CDS_pept        598749..599798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0540"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL4688 putative clavaminate
FT                   synthase-like (oxidase)"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71045"
FT                   /db_xref="GOA:B1J339"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR014503"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:B1J339"
FT                   /protein_id="ACA71045.1"
FT                   /translation="MANGIAPEMESAYLQQAAEPQTSLEIRLPWVVSSAWQTLLTNTPL
FT                   DFETSKELYPQLKEQAQEVLGKALCQQIRGFVEDPQLTSMIVRNCPRDRDVPPTPYSGV
FT                   LSPRSTPIACLVSLTMQNLMGINPVVYEGENDGRLFRHVIPARTSSSQKSSHGSRLRFS
FT                   YHVDNPDLPLSSEPLGTVSCCPEYLSFFGMRCDPRISTTLVNLDAVIASLPLATVRELC
FT                   EAQFEIRRPDSFTGNRRCTAELPVLVRGHSGEWLCRFDSENTHGLNLRAEQALATLRGL
FT                   LETRRFDEPHLLLPGDFMIFKNQRVLHARDGFEPQNDGADRWLLRVFAVNDLNRVRFAR
FT                   ADHLYEVLS"
FT   gene            599830..600615
FT                   /locus_tag="PputW619_0541"
FT   CDS_pept        599830..600615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0541"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   fno:Fnod_1043 protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71046"
FT                   /db_xref="GOA:B1J340"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:B1J340"
FT                   /protein_id="ACA71046.1"
FT                   /translation="MELLGAYWAEHWLLAILLLGAIAFVAGFVDSIAGGGGLFLVPGFL
FT                   LVGMPPQVALGQEKLVSTLGTLAAIRNFLANSKMVWQVALVGVPFSLLGAYLGAHLIVS
FT                   ISQETVGKIILALIPFGILIFLTPKDRPIEERELSARMLYTVVPLTCLAIGFYDGFFGP
FT                   GTGSMFIIAFHYLLRMDLVSSSANSKTFNFASNIGALVAFIMAGKVVYLLALPLVACNI
FT                   LGNHMGSALALRKGNDVVRKALVFSMLCLFTSLGVKYLV"
FT   gene            600641..601402
FT                   /locus_tag="PputW619_0542"
FT   CDS_pept        600641..601402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0542"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR domain protein;
FT                   KEGG: pmu:PM0579 oxidoreductase, short chain
FT                   dehydrogenase/reductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71047"
FT                   /db_xref="GOA:B1J341"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1J341"
FT                   /protein_id="ACA71047.1"
FT                   /translation="MKTAFVTGASSGFGRAICRTLVAKGYRVIGGARRMDKLQALEHEL
FT                   GDNFIPLALDVTDGQSISAAVSQINEAAPAIDVLVNNAGLALGIERAQACSAENWQRMI
FT                   DTNITGLAMVTHAVLPQMVQADSGMIINIGSIAGTYPYPGGNVYGASKAFVRQFSLNLR
FT                   ADLAGTRVRVSNIEPGLCSGTDFSVVRLNGDLNAVDALYRDVQAILPEDIAATVAWIAE
FT                   QPPHVNINTLEIMPVAQSSAALNVARNLPPC"
FT   gene            601531..602121
FT                   /locus_tag="PputW619_0543"
FT   CDS_pept        601531..602121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0543"
FT                   /product="molybdopterin oxidoreductase Fe4S4 region"
FT                   /note="PFAM: molybdopterin oxidoreductase Fe4S4 region;
FT                   KEGG: pen:PSEEN0563 formate dehydrogenase-O, major subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71048"
FT                   /db_xref="GOA:B1J342"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="UniProtKB/TrEMBL:B1J342"
FT                   /protein_id="ACA71048.1"
FT                   /translation="MDLNRRQFFKVAAVGLGGSSLAALGMAPTPAFAEQVRHFKLAHTK
FT                   ETRNTCPYCSVGCGLILYSQGDAGKNVKQNIIHIEGDADHPVNRGTLCPKGAGLLDFIH
FT                   SESRLKYPEVRKAGSKEWVRVSWDEALDRVALLMKQDRDANFIEKNAQGQTVNRWLTTG
FT                   FLAASAASSEAGYLTHKVIRATGMLGFDNQARV"
FT   sig_peptide     601531..601632
FT                   /locus_tag="PputW619_0543"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 34"
FT   gene            602170..604599
FT                   /locus_tag="PputW619_0544"
FT   CDS_pept        602170..604599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0544"
FT                   /product="formate dehydrogenase, alpha subunit"
FT                   /EC_number="1.17.1.9"
FT                   /note="KEGG: pen:PSEEN0564 formate dehydrogenase-N major
FT                   subunit, anaerobic; selenopeptide; TIGRFAM: formate
FT                   dehydrogenase, alpha subunit; PFAM: molybdopterin
FT                   oxidoreductase; molydopterin dinucleotide-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71049"
FT                   /db_xref="GOA:B1J343"
FT                   /db_xref="InterPro:IPR006443"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:B1J343"
FT                   /protein_id="ACA71049.1"
FT                   /translation="MTNHWSDIANANLVLVMGGNAAEAHPCGFKWVTEAKAHNKARLIV
FT                   VDPRFTRTASVADYYAPIRTGSDIAFMGGLINYLLSNDKIQHEYVRNYTDVSFIVKETY
FT                   GFEDGLFSGYDAAKRVYADKSGWGYELGEDGFAKVDPTLQHPRCVFQLMKQHYSRYTPE
FT                   LASMTCGMPQDAMMKIWEEIATCSVPGKTMTILYALGWTQHSIGAQIIRSAAMVQLLLG
FT                   NVGMPGGGVNALRGHSNIQGLTDLGLLSNSLPGYLSLPGDAEQDYAAYIDKRASKPLRP
FT                   GQLSYWQNYGKFHVSLMKAWYGANATAENNWGYDWLPKLDVPAYDVLRMFEMMSQGKVN
FT                   GYFCQGFNPIAALPDKNRVTAALGKLKWLVVMDPLATETSEFWRNAGPFNDVDTANIQT
FT                   EVIRLPTTCFAEEDGSLVNSSRWLQWHWKGADGPGETRTDVQIMSELFLRMRQRYQTEG
FT                   GTYPDPIMNISWPYKLPDEPSPEELAKEMNGWAVTDVTDPTGALIKAGQQLAGFGQLKD
FT                   DGSTASGCWIFAGCWTEQGNQMARRDNSDPYGMHQAQNWAWAWPANRRILYNRASSDLQ
FT                   GKPWDPEKKRLVWWNGKAWTGTDVPDFKVDSPPEAGMNPFIMNPEGVARFFAIDKMAEG
FT                   PFPEHYEPFETPIGINPLHPKNNKATSNPAGRIFDSVWDTLGKHDEFPYAATTYRLTEH
FT                   FHFWSKHCRLNAIAQPEQFVEIGEVLANEKGIKAGDRVRVSSKRGHIEAVAVVTKRIRP
FT                   LQVNNQTVHQIGIPLHWGFTGATRHGYLTNTLVPFLGDGNTQTPESKSFLVKVEKL"
FT   gene            604599..605555
FT                   /locus_tag="PputW619_0545"
FT   CDS_pept        604599..605555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0545"
FT                   /product="formate dehydrogenase, beta subunit"
FT                   /note="TIGRFAM: formate dehydrogenase, beta subunit; PFAM:
FT                   4Fe-4S ferredoxin iron-sulfur binding domain protein;
FT                   Formate dehydrogenase transmembrane domain protein; KEGG:
FT                   pen:PSEEN0565 formate dehydrogenase-O, Fe-S subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71050"
FT                   /db_xref="GOA:B1J344"
FT                   /db_xref="InterPro:IPR006470"
FT                   /db_xref="InterPro:IPR014603"
FT                   /db_xref="InterPro:IPR015246"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR038384"
FT                   /db_xref="UniProtKB/TrEMBL:B1J344"
FT                   /protein_id="ACA71050.1"
FT                   /translation="MASQDIIARSATTTVPPSVRQQEEVAKLIDTTKCIGCKACQVACS
FT                   EWNELRDEVGHNHGTYDNPQDLTADTWTLMRFTEHERDDGNLEWLIRKDGCMHCAEPGC
FT                   LKACPSPGAIIKHANGIVDFNQDHCIGCGYCITGCPFNIPRISQKDHKAYKCSLCSDRV
FT                   SVGLEPACVKTCPTGAIVFGSKDEMKVHAAERIVDLKSRGYDNAGLYDPDGVGGTHVMY
FT                   VLHHADTPRLYAGLPDQPVISPLVGLWKGITKPLALLAMGAAVLAGFFHYVRVGPQRVE
FT                   EDEHPTTTPPDDSVHQVDPAVHVYDPKQPGGQGEQRP"
FT   gene            605552..606208
FT                   /locus_tag="PputW619_0546"
FT   CDS_pept        605552..606208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0546"
FT                   /product="formate dehydrogenase, gamma subunit"
FT                   /note="TIGRFAM: formate dehydrogenase, gamma subunit; KEGG:
FT                   pen:PSEEN0566 formate dehydrogenase-O, cytochrome b556
FT                   (FDO) subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71051"
FT                   /db_xref="GOA:B1J345"
FT                   /db_xref="InterPro:IPR006471"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:B1J345"
FT                   /protein_id="ACA71051.1"
FT                   /translation="MNDDKPILRYNANERTNHWIVAILFVLAGLSGLALFHPALFWLSH
FT                   LFGGGPWTRILHPFIGVAMFVFFLFLVVRFWRANFITANDRLWLRRIDRVMLNKEEGVP
FT                   PIGKYNAGQKLLFWTLLVCMLVLLLSGLVIWRAYFSHFFDIGSIRLASLAHALAGFVLI
FT                   LSIIVHIYAGIWIKGSIGAMLHGWVSRAWARKHHQLWYREVTGDKTPSDHGRKEG"
FT   gene            606189..607139
FT                   /locus_tag="PputW619_0547"
FT   CDS_pept        606189..607139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0547"
FT                   /product="formate dehydrogenase accessory protein FdhE"
FT                   /note="TIGRFAM: formate dehydrogenase accessory protein
FT                   FdhE; PFAM: formate dehydrogenase accessory protein; KEGG:
FT                   pen:PSEEN0567 formate dehydrogenase formation protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71052"
FT                   /db_xref="GOA:B1J346"
FT                   /db_xref="InterPro:IPR006452"
FT                   /db_xref="InterPro:IPR024064"
FT                   /db_xref="UniProtKB/TrEMBL:B1J346"
FT                   /protein_id="ACA71052.1"
FT                   /translation="MDVKKDERLSTILEPGQIEASAVMPPFLHLPPANLFELRALRLEQ
FT                   LAAGHALGDYLRLIARLCRIQQQLVDNPPGGLPVADDRQRLCISHGLPPLAADGLVREG
FT                   PWLAWLQALIDHFDGEASGPLAAALQALRGSDDSQRKGWGSALLAGQYDAVPVALVPFL
FT                   GAALQAAWSSWLLALPSHELKPSGSQAQCPACGSPAMAAVVRNRGKHNGLRYLACSLCA
FT                   CEWHVVRVKCVYCESSKGLRYTSLEDDRHAPGKAPLRAECCPGCNTYLKQNYLENDAAA
FT                   EPLADDLASLALDIRLDEEGFHRLAPNLMLAPGGG"
FT   gene            607286..608713
FT                   /locus_tag="PputW619_0548"
FT   CDS_pept        607286..608713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0548"
FT                   /product="L-seryl-tRNA(Sec) selenium transferase"
FT                   /EC_number="2.9.1.1"
FT                   /note="PFAM: Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent protein; L-seryl-tRNA
FT                   selenium transferase; KEGG: pen:PSEEN0568 selenocysteine
FT                   synthase (with SelD)"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71053"
FT                   /db_xref="GOA:B1J347"
FT                   /db_xref="InterPro:IPR004534"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR018319"
FT                   /db_xref="InterPro:IPR025862"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1J347"
FT                   /protein_id="ACA71053.1"
FT                   /translation="MSSSLASNTPRLPSIDTLLRHPACLPLIERHGRDAVLATLRQLLD
FT                   DLREPVRNGQLDAAELGAEILLGRSGERLALQQRSQVRRVFNLTGTVLHTNLGRALLPE
FT                   EAVEAMQTAARYPLNLEFDLATGKRGDRDDLIEGLIRELTGAEAVTVVNNNAAAVLLAL
FT                   NSLGARKEGIISRGELIEIGGAFRIPDIMARAGVRLHEIGTTNRTHARDYEAAIGPRTG
FT                   LLMRVHCSNYSIQGFTTQVPTAELARIAHQHDLPLLEDLGSGSLLDLTRWGLPAEPTVR
FT                   QALADGADIVTFSGDKLLGGPQAGIIVGRKDLIARIKKNPLKRALRVDKITLAALEAVL
FT                   ALYRNPDKLVERLPSLRLLTRSQAEIHAQAERLAPELKARLGGQWAVSVEPALGMIGSG
FT                   SQPVARLPSAALCLRPQVSKKLRGRSLHVLERALRDLAVPVLGRIDDDALWLDLRQLDD
FT                   EAQWLAQLPALQLGPVQ"
FT   gene            608710..610632
FT                   /locus_tag="PputW619_0549"
FT   CDS_pept        608710..610632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0549"
FT                   /product="selenocysteine-specific translation elongation
FT                   factor"
FT                   /note="TIGRFAM: selenocysteine-specific translation
FT                   elongation factor; small GTP-binding protein; PFAM: protein
FT                   synthesis factor GTP-binding; elongation factor Tu domain 2
FT                   protein; Elongation factor SelB winged helix 2; Elongation
FT                   factor SelB winged helix 3; KEGG: pen:PSEEN0569
FT                   selenocysteinyl-tRNA-specific translation factor"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71054"
FT                   /db_xref="GOA:B1J348"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004535"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR015190"
FT                   /db_xref="InterPro:IPR015191"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1J348"
FT                   /protein_id="ACA71054.1"
FT                   /translation="MIIGTAGHIDHGKTALLQALTGQAGDHRQEERERGMTIDLGYRYA
FT                   ALAEGAPLTGFIDVPGHERFIHNMLAGAHGIDLVLLVVAADDGVMPQTREHLAIIELLG
FT                   IPLALVAISKCDRVAPVRVAEVQVQIAQLLAPGPYAGAAQFPLSSVTGEGVEALRHALL
FT                   AAGEGLKQRSVRGGFRLAIDRAFAVTGAGLVVTGTALAGRVSAGDTLLLGKAGKAVRVR
FT                   GLHAQNQAALVAEAGQRVALNIAAERLAVEQVRRGDWLVSQWLHAPSTRVDIELQLLAG
FT                   ESRPFEHFSAVHVHLGTQDVTARVALLEGERLPAGQRMFAQLLLNAPLQAVHGDRLVLR
FT                   DQRAQRTLGGGTVLDPFAPSRQRRSEARLCQLKVLRDAKGLEQALMALLDTAPGGLDPQ
FT                   RLERQFNRLREGWQLPADVLVVATRQGQLLFAKAQWQALKHQVREQLALFHEQEPDQLG
FT                   PDRDRLRRFAALPVERPAFVSLLEEMLGEGTIASSGPWLHLPGHKVQLSEADSALWSRL
FT                   QPRLLEGRFDPPWVRTLASEEKCAEADVRLLLRKLARLGVVHQVVRDLFYPEATLQRMA
FT                   ELLLGQANETPIVQVAAFRDMLGIGRKRSVQILEYFDRIGLTRRVADQRHIRADSALAQ
FT                   QQARH"
FT   gene            610639..610734
FT                   /locus_tag="PputW619_R0002"
FT                   /note="tRNA-SeC1"
FT   tRNA            610639..610734
FT                   /locus_tag="PputW619_R0002"
FT                   /product="tRNA-Sec"
FT   gene            complement(610744..611742)
FT                   /locus_tag="PputW619_0550"
FT   CDS_pept        complement(610744..611742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0550"
FT                   /product="Asparaginase"
FT                   /EC_number="3.5.1.1"
FT                   /note="PFAM: Asparaginase/glutaminase; KEGG: pen:PSEEN0570
FT                   L-asparaginase, type I"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71055"
FT                   /db_xref="GOA:B1J349"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR020827"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR027475"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="InterPro:IPR041725"
FT                   /db_xref="UniProtKB/TrEMBL:B1J349"
FT                   /protein_id="ACA71055.1"
FT                   /translation="MLSMRAVTNLLVLYTGGTIGMLETAEGLAPAGGFDARMREHFAQL
FT                   SDAPQVQWTLQEMNPLLDSANMQQHNWLAMRDAIVRAVDNDGHDGVLVLHGTDTLAHSA
FT                   AALSFLLLGLPVPVLLTGSMLPAGAPGSDAWDNLCGALRQFEQGLEAGVQLYFHGQLLQ
FT                   GCRASKLRSEAFDAFAALPRHREGERAKDIPATLGYRQQRQPVNLAVMPVFPGLQAEHL
FT                   RAVLDTGVQGLLLECYGSGTGPSDDQALLDVLRSARQRGVMLVAISQCPEGSVVFDTYA
FT                   AGNRLRGAGLVSGGGMTREAALGKMFALLGAGLDADAAEQWFALDLCGERA"
FT   gene            complement(611806..613248)
FT                   /locus_tag="PputW619_0551"
FT   CDS_pept        complement(611806..613248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0551"
FT                   /product="amino acid carrier protein"
FT                   /note="TIGRFAM: amino acid carrier protein; PFAM:
FT                   sodium:alanine symporter; KEGG: pen:PSEEN0571
FT                   sodium/alanine symporter"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71056"
FT                   /db_xref="GOA:B1J350"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:B1J350"
FT                   /protein_id="ACA71056.1"
FT                   /translation="MLEALNDFLSGKLLIVLIVGLGGYFTIRSRFVQFRHFAHMFSVFK
FT                   ESLRGQAGQLSSFQALMLSLAGRVGAGNIAGVGIAVTLGGPGAVFWMWVTALVGMASSF
FT                   FECTLAQVYKRADGDGLYRGGPAYYILHGLKLRSMAIVFSILLLVTYGFAFMGLQSYTV
FT                   THSLQNAFGFDPSHTGIALAVLLAIVFLGGIKRIAAVSDLLVPVKTLAYIGVTLYVIGT
FT                   QIEHVPAMLETIFKSAFGLDPAFAGLLGSAIVMGVKRGVFANEAGLGSAPNVAAVAAVK
FT                   HPGAQGVVQAFSVFLDTFLICTCTALLILLSGFYTPGFEGDGIVLTQNSLAAVVGDWGR
FT                   LFVSVALSLFVFTCILYNYYLGENSLQFLSRNRLVLLVFRGLVLALVVWGSVQDLSTVF
FT                   AFADITMTCLAFVNLVALALLFKVGLRVMRDYDDQRKAGIKQPVFDSSKFADLDLDRNA
FT                   WPANPQAETAVDKAVGEVQPQR"
FT   gene            613427..614236
FT                   /locus_tag="PputW619_0552"
FT   CDS_pept        613427..614236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0552"
FT                   /product="transcriptional regulator, Cro/CI family"
FT                   /note="KEGG: pen:PSEEN0572 transcriptional regulator,
FT                   Cro/CI family"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71057"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="UniProtKB/TrEMBL:B1J351"
FT                   /protein_id="ACA71057.1"
FT                   /translation="MSDHFATNLKLACSHYRSISEVCRQLSINRAQFNKYLSGQSRPTA
FT                   FNLKRIGDFFGVEDYELNLPPEQFARLIGARVSAVADQPSDPISELFRPLHEHAGNLSR
FT                   YCGYYFEYSNCMSVPGTILVSLVHLREERGRFLFERQERQERSTATDLHAEVRCRYLGA
FT                   AFQLQDRMFLIDYESLTLNEMSQTILIPSFKSRITRLNGLKTGVSSGDRRNPACTRVVW
FT                   EYLGEEINRINAYRQVKLYQPDDPRIDDDVRERLSVGPLSNGLFEIE"
FT   gene            614448..615332
FT                   /locus_tag="PputW619_0553"
FT   CDS_pept        614448..615332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0553"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /note="PFAM: dTDP-4-dehydrorhamnose reductase; KEGG:
FT                   pen:PSEEN0574 dTDP-4-rhamnose reductase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71058"
FT                   /db_xref="GOA:B1J352"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1J352"
FT                   /protein_id="ACA71058.1"
FT                   /translation="MRMRLMLLGGGNALGQALIRLGAEEDIAFLAPRPPEDGWTPASLT
FT                   QLLDDHRPDALVNLAYYFDWFQAESVSEPRLAQQERSVERLAELCQHHQITLVQPSSYR
FT                   VFDGSRATAYSEKDEPVPLGLRGQALWRIEQSVRAACPQHVLLRFGWLLDESIDGALGR
FT                   FLTRAEQPQELLLADDRRGNPTPVDDAARVILSVLKQLDCTAPLWGTYHYAGNEATTPL
FT                   ALGQAILAEAGQHRQLAVQAPTAQAHAARPDASEEPQNAVLACKKILHTFGIKPRAWRA
FT                   GLPPLLDRFYRHG"
FT   gene            615325..616257
FT                   /locus_tag="PputW619_0554"
FT   CDS_pept        615325..616257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0554"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; dTDP-4-dehydrorhamnose
FT                   reductase; Male sterility domain; KR domain protein; KEGG:
FT                   pen:PSEEN0575 NAD-dependent epimerase/dehydratase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71059"
FT                   /db_xref="GOA:B1J3H8"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3H8"
FT                   /protein_id="ACA71059.1"
FT                   /translation="MADAPILITGGAGFIGSHLCDALLAKGYAVRVLDDLSTGKRDNLQ
FT                   LGNPRLELVEGDVADAALVQRAAAGCSAVVHLAAVASVQASVEDPVKTHQSNFIGTLNV
FT                   CEAMRLQGVRRVVFASSAAVYGNNGEGQSIAEDTPKAPLTPYAVDKLASEQYLDFYRRQ
FT                   HGLEPVVFRFFNIFGPRQDPSSPYSGVISIFSERATQGLPITVFGDGEQTRDFLYVGDL
FT                   VQVMVQALEQPQVEEGAVNIGLNQATSLNQLLKALETVVGSLPPVSYGEARSGDIRHSR
FT                   ADNQRLLARFDFPQPTSMVEGLAHLLGKA"
FT   gene            complement(616305..616748)
FT                   /locus_tag="PputW619_0555"
FT   CDS_pept        complement(616305..616748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0555"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG:
FT                   pen:PSEEN0576 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71060"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3H9"
FT                   /protein_id="ACA71060.1"
FT                   /translation="MLDDVNAQCPVARALEVLGDRWALMILRDAFDGLRRFSEFQKNLG
FT                   LAKNILASRLKLLLESGMLQLQPASDGSAYKEYVLTDKGRSVFPIVVGLRQWGERFLFE
FT                   AGEARSQLLDSASGKPIETLLVRAQDGRVVGPEDCRRRVINHG"
FT   gene            616853..618058
FT                   /locus_tag="PputW619_0556"
FT   CDS_pept        616853..618058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0556"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   pen:PSEEN0577 transport protein, MFS superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71061"
FT                   /db_xref="GOA:B1J3I0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3I0"
FT                   /protein_id="ACA71061.1"
FT                   /translation="MNDLLTRGITLLLAATCAMAVATVYFAQPLLESIAADLGVPQARI
FT                   GWVVGATQAGYALGLILIVPLGDLFDRKRLVLGQLLVAALALAAVGLAHSWAVMLAALA
FT                   LVGLMAVMVQVMVAHAAILASPARQGQAVGTVTSGVVLGILLARLVSGALADVAGWRSV
FT                   YFVAAGLLLLMTLVLCHCLPAGRRPQHRSGYLALIGSLFSLYRQDRLLRRRGLFGLLIF
FT                   AAFSVLWSSMVLPLGAAPLALSHSEIGLFGLAGIAGTLAASRAGRLADQGLAERTTGLA
FT                   LALLTLSWLPTAFVGQSLMAFTLGVLMLDFAVQAVHVTNQSLLLAGRGELASRLIGAYM
FT                   CSYAIGSGLGAVLASWAYARWGWGAVCALGMSFSALALGYWLWLQTERAASAALHRSGQ
FT                   NL"
FT   sig_peptide     616853..616936
FT                   /locus_tag="PputW619_0556"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.768 at
FT                   residue 28"
FT   gene            complement(618046..618729)
FT                   /locus_tag="PputW619_0557"
FT   CDS_pept        complement(618046..618729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0557"
FT                   /product="OmpW family protein"
FT                   /note="PFAM: OmpW family protein; KEGG: pen:PSEEN0578 outer
FT                   membrane protein OprG"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71062"
FT                   /db_xref="GOA:B1J3I1"
FT                   /db_xref="InterPro:IPR000758"
FT                   /db_xref="InterPro:IPR005618"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3I1"
FT                   /protein_id="ACA71062.1"
FT                   /translation="MNKSLLGASLVALALAAPAAHAYQAGDMILRAGAITTAPNESSGD
FT                   LKFDGNKVSGTKATLDSDTQLGLTFAYMLTDHVGLELLAATPFQHTVGVKGLGGGLDGK
FT                   LADIKQLPPTLSLQYYPMAPNSRFQPYAGIGINYTLFFDEDLSSARKQQGFSNLKLQDS
FT                   VGIAGQLGMDYMLTDNLLVNASVWYVDIDTKATVDGPSALGYSKTKVNVEVDPWVYMVG
FT                   LGYKF"
FT   sig_peptide     complement(618661..618729)
FT                   /locus_tag="PputW619_0557"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 23"
FT   gene            complement(618839..619354)
FT                   /locus_tag="PputW619_0558"
FT   CDS_pept        complement(618839..619354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0558"
FT                   /product="lipoprotein"
FT                   /note="KEGG: pen:PSEEN0579 lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71063"
FT                   /db_xref="InterPro:IPR021727"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3I2"
FT                   /protein_id="ACA71063.1"
FT                   /translation="MLRALFLSLMMLAAPTWAAEPRELDWPALIPEGAPIIPPQLAPLH
FT                   DMSQLSSALSAESAPAARQQAPDAPVVKGLDGQQIKLPGYIVPLEVSEEGRTTEFLLVP
FT                   YYGACIHVPPPPSNQIVHIFSEMGVRVEDLYQPYWIEGKLHVRASSSELADAGYQMEAE
FT                   KIYVYELK"
FT   sig_peptide     complement(619298..619354)
FT                   /locus_tag="PputW619_0558"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 19"
FT   gene            complement(619364..620629)
FT                   /locus_tag="PputW619_0559"
FT   CDS_pept        complement(619364..620629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0559"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   pen:PSEEN0580 ABC efflux transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71064"
FT                   /db_xref="GOA:B1J3I3"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3I3"
FT                   /protein_id="ACA71064.1"
FT                   /translation="MYLLRLALASLANRRFTAFLTAFAIALSVCLLLAVERVRTEARAS
FT                   FASTISGTDLIVGARSGSVNLLLYSVFRIGNATNNIRWDSYQHYAQDPRVKWAIPISLG
FT                   DSHRGYRVMGTTAEYFSHYQYGRRQHLELSQGREFAGDPFEVVLGAEVAEALHYRLGDK
FT                   LVLAHGVAAISLVKHDDKPFTVVGVLKRTGTPVDRTLHISLAGMEAIHVDWHNGVPARG
FT                   AGRISAEQARAMDLQPAAITAFMLGLNSKIATFSLQREINEYRSEPLLAILPGVALQEL
FT                   WSLMGTAEQALFVVSLFVVLTGLIGMLTAILTSLNERRREMAILRSVGARPWHIAGLLV
FT                   LEALALASAGIVAGLGLLYGGIALAQGYVQANYGLYLPLAWPSTHEWTLLAIILGAALL
FT                   MGSVPAWRAYRQSLADGLSIHL"
FT   sig_peptide     complement(620525..620629)
FT                   /locus_tag="PputW619_0559"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.915 at
FT                   residue 35"
FT   gene            complement(620629..621339)
FT                   /locus_tag="PputW619_0560"
FT   CDS_pept        complement(620629..621339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0560"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pen:PSEEN0581 ABC transporter, ATP binding component"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71065"
FT                   /db_xref="GOA:B1J3E5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3E5"
FT                   /protein_id="ACA71065.1"
FT                   /translation="MSLPLIALQDLLFAWPGQPPLLDIPAFRLEAGEALFLKGPSGSGK
FT                   TTLLGLLGGVNVPAQGHIQLLGQDLGSLGQGARDRFRVDHTGYIFQQFNLLPFLSVREN
FT                   VELPCRFSHSRADRARQRHGSVDQAASELLAHLGLNDPALLARRADSLSIGQQQRVAAA
FT                   RALIGQPELVIADEPTSALDADTREAFIRLLFDECRAAGSSLLFVSHDQSLAPLFDRHL
FT                   SLAELNRAAKPREA"
FT   gene            complement(621340..621924)
FT                   /locus_tag="PputW619_0561"
FT   CDS_pept        complement(621340..621924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0561"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN0582 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71066"
FT                   /db_xref="InterPro:IPR021253"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3E6"
FT                   /protein_id="ACA71066.1"
FT                   /translation="MRRLLLALPFALLPLAVANAHEDHDHDHDHDHAHGTLGAHEHGVA
FT                   KLNVVLDGNTLELELESPAMNLVGFEHSASSDADKAKVAAVRQQLEQPLKLFGLAAAAG
FT                   CKEDAQELESPLFGDAAKDDDGDEHEHGHQHSDISAHYQLKCSAPDKLSQLDLTPLFKT
FT                   FPATQKINVQLIGPSGQKGLDISPAKAVVAF"
FT   sig_peptide     complement(621862..621924)
FT                   /locus_tag="PputW619_0561"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.986 at
FT                   residue 21"
FT   gene            622058..622402
FT                   /locus_tag="PputW619_0562"
FT   CDS_pept        622058..622402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0562"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN0583 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71067"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3E7"
FT                   /protein_id="ACA71067.1"
FT                   /translation="MRIRGQIGDWPVDLTIELEPAEWAQLGRQLAVPVVAEAASPAMAA
FT                   ASRQDDGQWTAAREVLRQAGQMNGPELLDRLEGLAGSTAAGKRLLVRLRHSSEVKVESG
FT                   ADAPVYHWVG"
FT   gene            complement(622461..623333)
FT                   /locus_tag="PputW619_0563"
FT   CDS_pept        complement(622461..623333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0563"
FT                   /product="thioredoxin"
FT                   /note="TIGRFAM: thioredoxin; PFAM: Thioredoxin domain;
FT                   KEGG: pen:PSEEN0584 thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71068"
FT                   /db_xref="GOA:B1J3E8"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3E8"
FT                   /protein_id="ACA71068.1"
FT                   /translation="MSQETPFIFDATDANFQQLVIENSFHKPVLVDFWAEWCAPCKALM
FT                   PLLAKIAEGYQGELLLAKINCDVEQQVVAQFGIRSLPTVVLFKDGQPVDGFAGAQPESA
FT                   IRAMLEPHVQMPAAPAASPLEQAKGLFAESRFAEAEALLQALLGEDNSNAEALILYARC
FT                   LAERGELGEAQIVLDAVKTDEHKAALAGAKAQLTFLRQAASLPEVADLKSRLAQNPQDD
FT                   EAAYQLCIQQLARQQYEAALDGLLKLFQRNRAYENGLPQKAMLQVFDLLGGDHPLVAVY
FT                   RRRLSSAMF"
FT   gene            complement(623365..624024)
FT                   /locus_tag="PputW619_0564"
FT   CDS_pept        complement(623365..624024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0564"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: methyltransferase small; Methyltransferase
FT                   type 12; KEGG: pen:PSEEN0585 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71069"
FT                   /db_xref="GOA:B1J3E9"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3E9"
FT                   /protein_id="ACA71069.1"
FT                   /translation="MAPLALQQALSGLIGEARLVVSELPGCALKLWLIDDQNMDRAFSI
FT                   EETRRILEDPPYWSFCWASGLAMARYLAEHPEWVAGKRVLDFGSGSGIAGIAAARAGAL
FT                   EVVACDLDPLALDASRANAELNGVELSYSNDFFAEDDRFDLILVADVLYDRANLPLLDA
FT                   FLGRGRQALVADSRVRDFSHPLYQQLGVLEALTLPDLAEPHEFRRVSLYHASREPL"
FT   gene            complement(624025..624477)
FT                   /locus_tag="PputW619_0565"
FT   CDS_pept        complement(624025..624477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0565"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN0586 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71070"
FT                   /db_xref="InterPro:IPR039366"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3F0"
FT                   /protein_id="ACA71070.1"
FT                   /translation="MHYRALVVLGCAALLAACGSDRPKTEPAPAPAPAKVAKKAEPLGP
FT                   LPAYQRELSGTLLEIPRGADVELALLVIDERDRPQQLLASSTLTGTGQALPYRLRFNPE
FT                   VFPAGARVELRGRASQSGQLIMHLPPVRITQAQTQATGPLRFKKAP"
FT   sig_peptide     complement(624418..624477)
FT                   /locus_tag="PputW619_0565"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.976) with cleavage site probability 0.898 at
FT                   residue 20"
FT   gene            624584..625048
FT                   /locus_tag="PputW619_0566"
FT   CDS_pept        624584..625048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0566"
FT                   /product="ATP-cone domain protein"
FT                   /note="PFAM: ATP-cone domain protein; KEGG: pen:PSEEN0587
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71071"
FT                   /db_xref="GOA:B1J3F1"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1J3F1"
FT                   /protein_id="ACA71071.1"
FT                   /translation="MHCPFCGANDTKVIDSRLVAEGEQVRRRRECVACGERFTTFETAE
FT                   LVLPRLIKQDGTRQPFDEEKLRAGMQRALEKRPVSVERLEAALAHIKSRLRATGEREVK
FT                   SLVVGELVMAELRKLDEVAYIRFASVYRRFQDLDEFREEIDRLAREPAKE"
FT   gene            625051..626181
FT                   /locus_tag="PputW619_0567"
FT   CDS_pept        625051..626181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0567"
FT                   /product="riboflavin biosynthesis protein RibD"
FT                   /EC_number="3.5.4.26"
FT                   /EC_number="1.1.1.193"
FT                   /note="KEGG: pen:PSEEN0588 riboflavin biosynthesis protein
FT                   RibD; TIGRFAM: riboflavin biosynthesis protein RibD; PFAM:
FT                   CMP/dCMP deaminase zinc-binding; bifunctional
FT                   deaminase-reductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71072"
FT                   /db_xref="GOA:B1J3F2"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR011549"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3F2"
FT                   /protein_id="ACA71072.1"
FT                   /translation="MPSETAILDAHYMARALELARKGIYTTHPNPRVGCVIVRDGEVVG
FT                   EGWHVRAGEPHAEVHALRQAGERARGACAYVTLEPCSHHGRTPPCAEALVQAGVARVVA
FT                   AMQDPNPQVAGQGLRRLAEAGIEVASGVLEAQARALNPGFLKRMEHGLPFVRAKLAMSL
FT                   DGRTAMASGESQWITGPAARSAVQRLRASASVVLTSAASVLADNARMTVRGAELGLDPD
FT                   ATALALSRTPLRVLIDGRLRLPLDAPFFQAGPALVVTAMGDDTRYGQAGHELLSLPGSN
FT                   GQVDLLALMQALAARGVNDILLEAGAGLVGAFAQLGLIDEYQLFVAGTFLGSQARPLLD
FT                   WPLSKMSEAPRLKITEMRAVGDDWRVTAIPLPAPGV"
FT   gene            626224..626889
FT                   /locus_tag="PputW619_0568"
FT   CDS_pept        626224..626889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0568"
FT                   /product="riboflavin synthase, alpha subunit"
FT                   /note="TIGRFAM: riboflavin synthase, alpha subunit; PFAM:
FT                   Lumazine-binding protein; KEGG: pen:PSEEN0589 riboflavin
FT                   synthase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71073"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3F3"
FT                   /protein_id="ACA71073.1"
FT                   /translation="MFTGIIESIGTIRSLTPKGGDVRVYVETGKLDLGDVKLGDSIAVN
FT                   GVCLTAVELPGDGFWADVSVETLKRTAFIDLKSGSKVNLEKALTPTTRLGGHLVSGHVD
FT                   GVGEIISRSDSARAIQFRVRAPKELAKYIAHKGSITVDGTSLTVNEVNGAEFELTIVPH
FT                   TLSETIMADYRAGRRVNLEVDLLARYLERLLLGDKAAEPSKGSGITESFLAANGFLKS"
FT   gene            626908..627999
FT                   /locus_tag="PputW619_0569"
FT   CDS_pept        626908..627999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0569"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /note="TIGRFAM: 3,4-dihydroxy-2-butanone 4-phosphate
FT                   synthase; PFAM: 34-dihydroxy-2-butanone 4-phosphate
FT                   synthase; GTP cyclohydrolase II; KEGG: pen:PSEEN0590
FT                   3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP
FT                   cyclohydrolase II"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71074"
FT                   /db_xref="GOA:B1J3F4"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:B1J3F4"
FT                   /protein_id="ACA71074.1"
FT                   /translation="MALNSIEELVEDIRQGKMVILMDDEDRENEGDIIMAAECCLPEHI
FT                   NFMAKHARGLICMPMTRERCETLKLPLMAPRNGSGFGTKFTVSIEAAEGVTTGISAADR
FT                   ARTVQAAAAKDAKAEDIVSPGHIFPLMAQPGGTLARAGHTEAACDLARMAGFEPSGVIC
FT                   EVMNDDGTMSRRAELEVFAAEHGLKIGTIADLIHYRMIHERTVQRVSEQPIESELGEFN
FT                   LVTYRDAVEGDVHMALTLGKVCAEEPTLVRVHNMDPLRDLLLVKQPGRWSLRAAMAAVA
FT                   EAGSGVVLLLGHPLDGDVLLAHIRESAGDAPTKAPTTYSTVGAGSQILRDLGVRKMRLM
FT                   SSPMKFNAISGFDLEVVEYVPSE"
FT   gene            628055..628567
FT                   /locus_tag="PputW619_0570"
FT   CDS_pept        628055..628567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PputW619_0570"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase"
FT                   /EC_number="2.5.1.9"
FT                   /note="KEGG: pen:PSEEN0591 6,7-dimethyl-8-ribityllumazine
FT                   synthase (lumazine synthase)(riboflavin synthase beta
FT                   chain); TIGRFAM: 6,7-dimethyl-8-ribityllumazine synthase;
FT                   PFAM: 67-dimethyl-8-ribityllumazine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PputW619_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACA71075"
FT                   /db_xref="GOA:B1J3F5"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniP