(data stored in ACNUC7421 zone)

EMBL: CP000950

ID   CP000950; SV 1; circular; genomic DNA; STD; PRO; 4689441 BP.
XX
AC   CP000950;
XX
PR   Project:PRJNA28743;
XX
DT   12-MAR-2008 (Rel. 95, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 9)
XX
DE   Yersinia pseudotuberculosis YPIII, complete genome.
XX
KW   .
XX
OS   Yersinia pseudotuberculosis YPIII
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Yersiniaceae; Yersinia.
XX
RN   [1]
RP   1-4689441
RG   US DOE Joint Genome Institute
RA   Challacombe J.F., Bruce D., Detter J.C., Green L., Land M., Munk C.,
RA   Lindler L.E., Nikolich M.P., Brettin T.;
RT   "Complete sequence of Yersinia pseudotuberculosis YPIII";
RL   Unpublished.
XX
RN   [2]
RP   1-4689441
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Munk A.C., Brettin T., Detter J.C.,
RA   Han C., Tapia R., Schmutz J., Larimer F., Land M., Hauser L.,
RA   Challacombe J.F., Green L., Lindler L.E., Nikolich M.P., Richardson P.;
RT   ;
RL   Submitted (14-FEB-2008) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 9afed51150a95c4cbab668f82fd2137c.
DR   BioSample; SAMN02598457.
DR   EnsemblGenomes-Gn; EBG00001019798.
DR   EnsemblGenomes-Gn; EBG00001019799.
DR   EnsemblGenomes-Gn; EBG00001019800.
DR   EnsemblGenomes-Gn; EBG00001019801.
DR   EnsemblGenomes-Gn; EBG00001019802.
DR   EnsemblGenomes-Gn; EBG00001019803.
DR   EnsemblGenomes-Gn; EBG00001019804.
DR   EnsemblGenomes-Gn; EBG00001019805.
DR   EnsemblGenomes-Gn; EBG00001019806.
DR   EnsemblGenomes-Gn; EBG00001019807.
DR   EnsemblGenomes-Gn; EBG00001019808.
DR   EnsemblGenomes-Gn; EBG00001019809.
DR   EnsemblGenomes-Gn; EBG00001019810.
DR   EnsemblGenomes-Gn; EBG00001019811.
DR   EnsemblGenomes-Gn; EBG00001019812.
DR   EnsemblGenomes-Gn; EBG00001019814.
DR   EnsemblGenomes-Gn; EBG00001019815.
DR   EnsemblGenomes-Gn; EBG00001019816.
DR   EnsemblGenomes-Gn; EBG00001019817.
DR   EnsemblGenomes-Gn; EBG00001019818.
DR   EnsemblGenomes-Gn; EBG00001019819.
DR   EnsemblGenomes-Gn; EBG00001019820.
DR   EnsemblGenomes-Gn; EBG00001019821.
DR   EnsemblGenomes-Gn; EBG00001019822.
DR   EnsemblGenomes-Gn; EBG00001019823.
DR   EnsemblGenomes-Gn; EBG00001019824.
DR   EnsemblGenomes-Gn; EBG00001019825.
DR   EnsemblGenomes-Gn; EBG00001019826.
DR   EnsemblGenomes-Gn; EBG00001019827.
DR   EnsemblGenomes-Gn; EBG00001019828.
DR   EnsemblGenomes-Gn; EBG00001019829.
DR   EnsemblGenomes-Gn; EBG00001019830.
DR   EnsemblGenomes-Gn; EBG00001019831.
DR   EnsemblGenomes-Gn; EBG00001019833.
DR   EnsemblGenomes-Gn; EBG00001019835.
DR   EnsemblGenomes-Gn; EBG00001019836.
DR   EnsemblGenomes-Gn; EBG00001019837.
DR   EnsemblGenomes-Gn; EBG00001019838.
DR   EnsemblGenomes-Gn; EBG00001019839.
DR   EnsemblGenomes-Gn; EBG00001019840.
DR   EnsemblGenomes-Gn; EBG00001019841.
DR   EnsemblGenomes-Gn; EBG00001019842.
DR   EnsemblGenomes-Gn; EBG00001019843.
DR   EnsemblGenomes-Gn; EBG00001019844.
DR   EnsemblGenomes-Gn; EBG00001019845.
DR   EnsemblGenomes-Gn; EBG00001019846.
DR   EnsemblGenomes-Gn; EBG00001019847.
DR   EnsemblGenomes-Gn; EBG00001019848.
DR   EnsemblGenomes-Gn; EBG00001019849.
DR   EnsemblGenomes-Gn; EBG00001019850.
DR   EnsemblGenomes-Gn; EBG00001019851.
DR   EnsemblGenomes-Gn; EBG00001019852.
DR   EnsemblGenomes-Gn; EBG00001019853.
DR   EnsemblGenomes-Gn; EBG00001019854.
DR   EnsemblGenomes-Gn; EBG00001019855.
DR   EnsemblGenomes-Gn; EBG00001019856.
DR   EnsemblGenomes-Gn; EBG00001019857.
DR   EnsemblGenomes-Gn; EBG00001019858.
DR   EnsemblGenomes-Gn; EBG00001019859.
DR   EnsemblGenomes-Gn; EBG00001019860.
DR   EnsemblGenomes-Gn; EBG00001019861.
DR   EnsemblGenomes-Gn; EBG00001019862.
DR   EnsemblGenomes-Gn; EBG00001019863.
DR   EnsemblGenomes-Gn; EBG00001019864.
DR   EnsemblGenomes-Gn; EBG00001019865.
DR   EnsemblGenomes-Gn; EBG00001019866.
DR   EnsemblGenomes-Gn; EBG00001019867.
DR   EnsemblGenomes-Gn; EBG00001019868.
DR   EnsemblGenomes-Gn; EBG00001019869.
DR   EnsemblGenomes-Gn; EBG00001019870.
DR   EnsemblGenomes-Gn; EBG00001019871.
DR   EnsemblGenomes-Gn; EBG00001019873.
DR   EnsemblGenomes-Gn; EBG00001019875.
DR   EnsemblGenomes-Gn; EBG00001019876.
DR   EnsemblGenomes-Gn; EBG00001019877.
DR   EnsemblGenomes-Gn; EBG00001019878.
DR   EnsemblGenomes-Gn; EBG00001019879.
DR   EnsemblGenomes-Gn; EBG00001019880.
DR   EnsemblGenomes-Gn; EBG00001019881.
DR   EnsemblGenomes-Gn; EBG00001019882.
DR   EnsemblGenomes-Gn; EBG00001019883.
DR   EnsemblGenomes-Gn; EBG00001019884.
DR   EnsemblGenomes-Gn; EBG00001019885.
DR   EnsemblGenomes-Gn; EBG00001019886.
DR   EnsemblGenomes-Gn; EBG00001019887.
DR   EnsemblGenomes-Gn; EBG00001019888.
DR   EnsemblGenomes-Gn; EBG00001019889.
DR   EnsemblGenomes-Gn; EBG00001019890.
DR   EnsemblGenomes-Gn; EBG00001019891.
DR   EnsemblGenomes-Gn; EBG00001019892.
DR   EnsemblGenomes-Gn; EBG00001019893.
DR   EnsemblGenomes-Gn; EBG00001019894.
DR   EnsemblGenomes-Gn; EBG00001019895.
DR   EnsemblGenomes-Gn; EBG00001019896.
DR   EnsemblGenomes-Gn; EBG00001019897.
DR   EnsemblGenomes-Gn; EBG00001019898.
DR   EnsemblGenomes-Gn; EBG00001019899.
DR   EnsemblGenomes-Gn; EBG00001019901.
DR   EnsemblGenomes-Gn; EBG00001019902.
DR   EnsemblGenomes-Gn; EBG00001019903.
DR   EnsemblGenomes-Gn; EBG00001019904.
DR   EnsemblGenomes-Gn; EBG00001019905.
DR   EnsemblGenomes-Gn; EBG00001019907.
DR   EnsemblGenomes-Gn; EBG00001019908.
DR   EnsemblGenomes-Gn; EBG00001019910.
DR   EnsemblGenomes-Gn; EBG00001019912.
DR   EnsemblGenomes-Gn; EBG00001019914.
DR   EnsemblGenomes-Gn; EBG00001019916.
DR   EnsemblGenomes-Gn; EBG00001019918.
DR   EnsemblGenomes-Gn; EBG00001019920.
DR   EnsemblGenomes-Gn; EBG00001019922.
DR   EnsemblGenomes-Gn; EBG00001019924.
DR   EnsemblGenomes-Gn; EBG00001019926.
DR   EnsemblGenomes-Gn; EBG00001019928.
DR   EnsemblGenomes-Gn; EBG00001019931.
DR   EnsemblGenomes-Gn; EBG00001019933.
DR   EnsemblGenomes-Gn; EBG00001019935.
DR   EnsemblGenomes-Gn; EBG00001019937.
DR   EnsemblGenomes-Gn; EBG00001019939.
DR   EnsemblGenomes-Gn; EBG00001019941.
DR   EnsemblGenomes-Gn; EBG00001019943.
DR   EnsemblGenomes-Gn; EBG00001019945.
DR   EnsemblGenomes-Gn; EBG00001019947.
DR   EnsemblGenomes-Gn; EBG00001019950.
DR   EnsemblGenomes-Gn; EBG00001019952.
DR   EnsemblGenomes-Gn; EBG00001019955.
DR   EnsemblGenomes-Gn; EBG00001019957.
DR   EnsemblGenomes-Gn; EBG00001019960.
DR   EnsemblGenomes-Gn; EBG00001019964.
DR   EnsemblGenomes-Gn; EBG00001019966.
DR   EnsemblGenomes-Gn; EBG00001019968.
DR   EnsemblGenomes-Gn; EBG00001019970.
DR   EnsemblGenomes-Gn; EBG00001019971.
DR   EnsemblGenomes-Gn; EBG00001019974.
DR   EnsemblGenomes-Gn; EBG00001019976.
DR   EnsemblGenomes-Gn; EBG00001019978.
DR   EnsemblGenomes-Gn; EBG00001019980.
DR   EnsemblGenomes-Gn; EBG00001019982.
DR   EnsemblGenomes-Gn; EBG00001019983.
DR   EnsemblGenomes-Gn; EBG00001019985.
DR   EnsemblGenomes-Gn; EBG00001019987.
DR   EnsemblGenomes-Gn; EBG00001019990.
DR   EnsemblGenomes-Gn; EBG00001019994.
DR   EnsemblGenomes-Gn; EBG00001019996.
DR   EnsemblGenomes-Gn; EBG00001019998.
DR   EnsemblGenomes-Gn; EBG00001019999.
DR   EnsemblGenomes-Gn; EBG00001020001.
DR   EnsemblGenomes-Gn; EBG00001020003.
DR   EnsemblGenomes-Gn; EBG00001020004.
DR   EnsemblGenomes-Gn; EBG00001020005.
DR   EnsemblGenomes-Gn; EBG00001020006.
DR   EnsemblGenomes-Gn; EBG00001020007.
DR   EnsemblGenomes-Gn; EBG00001020008.
DR   EnsemblGenomes-Gn; EBG00001020009.
DR   EnsemblGenomes-Gn; EBG00001020010.
DR   EnsemblGenomes-Gn; EBG00001020011.
DR   EnsemblGenomes-Gn; EBG00001020012.
DR   EnsemblGenomes-Gn; EBG00001020013.
DR   EnsemblGenomes-Gn; EBG00001020014.
DR   EnsemblGenomes-Gn; EBG00001020015.
DR   EnsemblGenomes-Gn; EBG00001020016.
DR   EnsemblGenomes-Gn; EBG00001020017.
DR   EnsemblGenomes-Gn; EBG00001020018.
DR   EnsemblGenomes-Gn; EBG00001020020.
DR   EnsemblGenomes-Gn; EBG00001020022.
DR   EnsemblGenomes-Gn; EBG00001020024.
DR   EnsemblGenomes-Gn; EBG00001020026.
DR   EnsemblGenomes-Gn; EBG00001020028.
DR   EnsemblGenomes-Gn; EBG00001020030.
DR   EnsemblGenomes-Gn; EBG00001020032.
DR   EnsemblGenomes-Gn; EBG00001020034.
DR   EnsemblGenomes-Gn; EBG00001020036.
DR   EnsemblGenomes-Gn; EBG00001020038.
DR   EnsemblGenomes-Gn; EBG00001020040.
DR   EnsemblGenomes-Gn; EBG00001020042.
DR   EnsemblGenomes-Gn; EBG00001020044.
DR   EnsemblGenomes-Gn; EBG00001020046.
DR   EnsemblGenomes-Gn; EBG00001020048.
DR   EnsemblGenomes-Gn; EBG00001020051.
DR   EnsemblGenomes-Gn; EBG00001020053.
DR   EnsemblGenomes-Gn; EBG00001020055.
DR   EnsemblGenomes-Gn; EBG00001020057.
DR   EnsemblGenomes-Gn; EBG00001020059.
DR   EnsemblGenomes-Gn; EBG00001020061.
DR   EnsemblGenomes-Gn; EBG00001020064.
DR   EnsemblGenomes-Gn; EBG00001020066.
DR   EnsemblGenomes-Gn; EBG00001020068.
DR   EnsemblGenomes-Gn; EBG00001020070.
DR   EnsemblGenomes-Gn; EBG00001020072.
DR   EnsemblGenomes-Gn; EBG00001020074.
DR   EnsemblGenomes-Gn; EBG00001020076.
DR   EnsemblGenomes-Gn; EBG00001020078.
DR   EnsemblGenomes-Gn; EBG00001020079.
DR   EnsemblGenomes-Gn; EBG00001020081.
DR   EnsemblGenomes-Gn; EBG00001020083.
DR   EnsemblGenomes-Gn; EBG00001020085.
DR   EnsemblGenomes-Gn; EBG00001020087.
DR   EnsemblGenomes-Gn; EBG00001020089.
DR   EnsemblGenomes-Gn; EBG00001020092.
DR   EnsemblGenomes-Gn; EBG00001020094.
DR   EnsemblGenomes-Gn; EBG00001020096.
DR   EnsemblGenomes-Gn; EBG00001020098.
DR   EnsemblGenomes-Gn; EBG00001020101.
DR   EnsemblGenomes-Gn; EBG00001020103.
DR   EnsemblGenomes-Gn; EBG00001020105.
DR   EnsemblGenomes-Gn; EBG00001020107.
DR   EnsemblGenomes-Gn; EBG00001020109.
DR   EnsemblGenomes-Gn; EBG00001020111.
DR   EnsemblGenomes-Gn; EBG00001020113.
DR   EnsemblGenomes-Gn; EBG00001020116.
DR   EnsemblGenomes-Gn; EBG00001020117.
DR   EnsemblGenomes-Gn; EBG00001020119.
DR   EnsemblGenomes-Gn; EBG00001020121.
DR   EnsemblGenomes-Gn; EBG00001020122.
DR   EnsemblGenomes-Gn; EBG00001020125.
DR   EnsemblGenomes-Gn; EBG00001020127.
DR   EnsemblGenomes-Gn; EBG00001020129.
DR   EnsemblGenomes-Gn; EBG00001020131.
DR   EnsemblGenomes-Gn; EBG00001020133.
DR   EnsemblGenomes-Gn; EBG00001020135.
DR   EnsemblGenomes-Gn; EBG00001020137.
DR   EnsemblGenomes-Gn; EBG00001020139.
DR   EnsemblGenomes-Gn; EBG00001020141.
DR   EnsemblGenomes-Gn; EBG00001020144.
DR   EnsemblGenomes-Gn; EBG00001020146.
DR   EnsemblGenomes-Gn; EBG00001020149.
DR   EnsemblGenomes-Gn; EBG00001020150.
DR   EnsemblGenomes-Gn; EBG00001020151.
DR   EnsemblGenomes-Gn; EBG00001020152.
DR   EnsemblGenomes-Gn; EBG00001020153.
DR   EnsemblGenomes-Gn; EBG00001020154.
DR   EnsemblGenomes-Gn; EBG00001020155.
DR   EnsemblGenomes-Gn; EBG00001020156.
DR   EnsemblGenomes-Gn; EBG00001020157.
DR   EnsemblGenomes-Gn; EBG00001020158.
DR   EnsemblGenomes-Gn; EBG00001020159.
DR   EnsemblGenomes-Gn; EBG00001020160.
DR   EnsemblGenomes-Gn; EBG00001020161.
DR   EnsemblGenomes-Gn; EBG00001020162.
DR   EnsemblGenomes-Gn; EBG00001020163.
DR   EnsemblGenomes-Gn; EBG00001020164.
DR   EnsemblGenomes-Gn; EBG00001020165.
DR   EnsemblGenomes-Gn; EBG00001020166.
DR   EnsemblGenomes-Gn; EBG00001020167.
DR   EnsemblGenomes-Gn; EBG00001020168.
DR   EnsemblGenomes-Gn; EBG00001020169.
DR   EnsemblGenomes-Gn; EBG00001020170.
DR   EnsemblGenomes-Gn; EBG00001020171.
DR   EnsemblGenomes-Gn; YPK_R0001.
DR   EnsemblGenomes-Gn; YPK_R0002.
DR   EnsemblGenomes-Gn; YPK_R0003.
DR   EnsemblGenomes-Gn; YPK_R0004.
DR   EnsemblGenomes-Gn; YPK_R0005.
DR   EnsemblGenomes-Gn; YPK_R0006.
DR   EnsemblGenomes-Gn; YPK_R0007.
DR   EnsemblGenomes-Gn; YPK_R0008.
DR   EnsemblGenomes-Gn; YPK_R0009.
DR   EnsemblGenomes-Gn; YPK_R0010.
DR   EnsemblGenomes-Gn; YPK_R0011.
DR   EnsemblGenomes-Gn; YPK_R0012.
DR   EnsemblGenomes-Gn; YPK_R0013.
DR   EnsemblGenomes-Gn; YPK_R0014.
DR   EnsemblGenomes-Gn; YPK_R0015.
DR   EnsemblGenomes-Gn; YPK_R0016.
DR   EnsemblGenomes-Gn; YPK_R0017.
DR   EnsemblGenomes-Gn; YPK_R0018.
DR   EnsemblGenomes-Gn; YPK_R0019.
DR   EnsemblGenomes-Gn; YPK_R0020.
DR   EnsemblGenomes-Gn; YPK_R0021.
DR   EnsemblGenomes-Gn; YPK_R0022.
DR   EnsemblGenomes-Gn; YPK_R0023.
DR   EnsemblGenomes-Gn; YPK_R0024.
DR   EnsemblGenomes-Gn; YPK_R0025.
DR   EnsemblGenomes-Gn; YPK_R0026.
DR   EnsemblGenomes-Gn; YPK_R0027.
DR   EnsemblGenomes-Gn; YPK_R0028.
DR   EnsemblGenomes-Gn; YPK_R0029.
DR   EnsemblGenomes-Gn; YPK_R0030.
DR   EnsemblGenomes-Gn; YPK_R0031.
DR   EnsemblGenomes-Gn; YPK_R0032.
DR   EnsemblGenomes-Gn; YPK_R0033.
DR   EnsemblGenomes-Gn; YPK_R0034.
DR   EnsemblGenomes-Gn; YPK_R0035.
DR   EnsemblGenomes-Gn; YPK_R0036.
DR   EnsemblGenomes-Gn; YPK_R0037.
DR   EnsemblGenomes-Gn; YPK_R0038.
DR   EnsemblGenomes-Gn; YPK_R0039.
DR   EnsemblGenomes-Gn; YPK_R0040.
DR   EnsemblGenomes-Gn; YPK_R0041.
DR   EnsemblGenomes-Gn; YPK_R0042.
DR   EnsemblGenomes-Gn; YPK_R0043.
DR   EnsemblGenomes-Gn; YPK_R0044.
DR   EnsemblGenomes-Gn; YPK_R0045.
DR   EnsemblGenomes-Gn; YPK_R0046.
DR   EnsemblGenomes-Gn; YPK_R0047.
DR   EnsemblGenomes-Gn; YPK_R0048.
DR   EnsemblGenomes-Gn; YPK_R0049.
DR   EnsemblGenomes-Gn; YPK_R0050.
DR   EnsemblGenomes-Gn; YPK_R0051.
DR   EnsemblGenomes-Gn; YPK_R0052.
DR   EnsemblGenomes-Gn; YPK_R0053.
DR   EnsemblGenomes-Gn; YPK_R0054.
DR   EnsemblGenomes-Gn; YPK_R0055.
DR   EnsemblGenomes-Gn; YPK_R0056.
DR   EnsemblGenomes-Gn; YPK_R0057.
DR   EnsemblGenomes-Gn; YPK_R0058.
DR   EnsemblGenomes-Gn; YPK_R0059.
DR   EnsemblGenomes-Gn; YPK_R0060.
DR   EnsemblGenomes-Gn; YPK_R0061.
DR   EnsemblGenomes-Gn; YPK_R0062.
DR   EnsemblGenomes-Gn; YPK_R0063.
DR   EnsemblGenomes-Gn; YPK_R0064.
DR   EnsemblGenomes-Gn; YPK_R0065.
DR   EnsemblGenomes-Gn; YPK_R0066.
DR   EnsemblGenomes-Gn; YPK_R0067.
DR   EnsemblGenomes-Gn; YPK_R0068.
DR   EnsemblGenomes-Gn; YPK_R0069.
DR   EnsemblGenomes-Gn; YPK_R0070.
DR   EnsemblGenomes-Gn; YPK_R0071.
DR   EnsemblGenomes-Gn; YPK_R0072.
DR   EnsemblGenomes-Gn; YPK_R0073.
DR   EnsemblGenomes-Gn; YPK_R0074.
DR   EnsemblGenomes-Gn; YPK_R0075.
DR   EnsemblGenomes-Gn; YPK_R0076.
DR   EnsemblGenomes-Gn; YPK_R0077.
DR   EnsemblGenomes-Gn; YPK_R0078.
DR   EnsemblGenomes-Gn; YPK_R0079.
DR   EnsemblGenomes-Gn; YPK_R0080.
DR   EnsemblGenomes-Gn; YPK_R0081.
DR   EnsemblGenomes-Gn; YPK_R0082.
DR   EnsemblGenomes-Gn; YPK_R0083.
DR   EnsemblGenomes-Gn; YPK_R0084.
DR   EnsemblGenomes-Gn; YPK_R0085.
DR   EnsemblGenomes-Gn; YPK_R0086.
DR   EnsemblGenomes-Gn; YPK_R0087.
DR   EnsemblGenomes-Gn; YPK_R0088.
DR   EnsemblGenomes-Gn; YPK_R0089.
DR   EnsemblGenomes-Gn; YPK_R0090.
DR   EnsemblGenomes-Gn; YPK_R0091.
DR   EnsemblGenomes-Gn; YPK_R0092.
DR   EnsemblGenomes-Gn; YPK_R0093.
DR   EnsemblGenomes-Gn; YPK_R0094.
DR   EnsemblGenomes-Gn; YPK_R0095.
DR   EnsemblGenomes-Gn; YPK_R0096.
DR   EnsemblGenomes-Gn; YPK_R0097.
DR   EnsemblGenomes-Gn; YPK_R0098.
DR   EnsemblGenomes-Tr; EBT00001623006.
DR   EnsemblGenomes-Tr; EBT00001623007.
DR   EnsemblGenomes-Tr; EBT00001623008.
DR   EnsemblGenomes-Tr; EBT00001623009.
DR   EnsemblGenomes-Tr; EBT00001623010.
DR   EnsemblGenomes-Tr; EBT00001623011.
DR   EnsemblGenomes-Tr; EBT00001623012.
DR   EnsemblGenomes-Tr; EBT00001623013.
DR   EnsemblGenomes-Tr; EBT00001623014.
DR   EnsemblGenomes-Tr; EBT00001623015.
DR   EnsemblGenomes-Tr; EBT00001623016.
DR   EnsemblGenomes-Tr; EBT00001623017.
DR   EnsemblGenomes-Tr; EBT00001623018.
DR   EnsemblGenomes-Tr; EBT00001623019.
DR   EnsemblGenomes-Tr; EBT00001623020.
DR   EnsemblGenomes-Tr; EBT00001623021.
DR   EnsemblGenomes-Tr; EBT00001623022.
DR   EnsemblGenomes-Tr; EBT00001623023.
DR   EnsemblGenomes-Tr; EBT00001623024.
DR   EnsemblGenomes-Tr; EBT00001623025.
DR   EnsemblGenomes-Tr; EBT00001623026.
DR   EnsemblGenomes-Tr; EBT00001623027.
DR   EnsemblGenomes-Tr; EBT00001623028.
DR   EnsemblGenomes-Tr; EBT00001623029.
DR   EnsemblGenomes-Tr; EBT00001623030.
DR   EnsemblGenomes-Tr; EBT00001623031.
DR   EnsemblGenomes-Tr; EBT00001623032.
DR   EnsemblGenomes-Tr; EBT00001623033.
DR   EnsemblGenomes-Tr; EBT00001623034.
DR   EnsemblGenomes-Tr; EBT00001623035.
DR   EnsemblGenomes-Tr; EBT00001623036.
DR   EnsemblGenomes-Tr; EBT00001623037.
DR   EnsemblGenomes-Tr; EBT00001623038.
DR   EnsemblGenomes-Tr; EBT00001623039.
DR   EnsemblGenomes-Tr; EBT00001623040.
DR   EnsemblGenomes-Tr; EBT00001623041.
DR   EnsemblGenomes-Tr; EBT00001623042.
DR   EnsemblGenomes-Tr; EBT00001623043.
DR   EnsemblGenomes-Tr; EBT00001623044.
DR   EnsemblGenomes-Tr; EBT00001623045.
DR   EnsemblGenomes-Tr; EBT00001623046.
DR   EnsemblGenomes-Tr; EBT00001623047.
DR   EnsemblGenomes-Tr; EBT00001623048.
DR   EnsemblGenomes-Tr; EBT00001623049.
DR   EnsemblGenomes-Tr; EBT00001623050.
DR   EnsemblGenomes-Tr; EBT00001623051.
DR   EnsemblGenomes-Tr; EBT00001623052.
DR   EnsemblGenomes-Tr; EBT00001623053.
DR   EnsemblGenomes-Tr; EBT00001623054.
DR   EnsemblGenomes-Tr; EBT00001623055.
DR   EnsemblGenomes-Tr; EBT00001623056.
DR   EnsemblGenomes-Tr; EBT00001623057.
DR   EnsemblGenomes-Tr; EBT00001623058.
DR   EnsemblGenomes-Tr; EBT00001623059.
DR   EnsemblGenomes-Tr; EBT00001623060.
DR   EnsemblGenomes-Tr; EBT00001623061.
DR   EnsemblGenomes-Tr; EBT00001623062.
DR   EnsemblGenomes-Tr; EBT00001623063.
DR   EnsemblGenomes-Tr; EBT00001623064.
DR   EnsemblGenomes-Tr; EBT00001623065.
DR   EnsemblGenomes-Tr; EBT00001623066.
DR   EnsemblGenomes-Tr; EBT00001623067.
DR   EnsemblGenomes-Tr; EBT00001623068.
DR   EnsemblGenomes-Tr; EBT00001623069.
DR   EnsemblGenomes-Tr; EBT00001623070.
DR   EnsemblGenomes-Tr; EBT00001623071.
DR   EnsemblGenomes-Tr; EBT00001623072.
DR   EnsemblGenomes-Tr; EBT00001623073.
DR   EnsemblGenomes-Tr; EBT00001623074.
DR   EnsemblGenomes-Tr; EBT00001623075.
DR   EnsemblGenomes-Tr; EBT00001623076.
DR   EnsemblGenomes-Tr; EBT00001623077.
DR   EnsemblGenomes-Tr; EBT00001623078.
DR   EnsemblGenomes-Tr; EBT00001623079.
DR   EnsemblGenomes-Tr; EBT00001623080.
DR   EnsemblGenomes-Tr; EBT00001623081.
DR   EnsemblGenomes-Tr; EBT00001623082.
DR   EnsemblGenomes-Tr; EBT00001623083.
DR   EnsemblGenomes-Tr; EBT00001623084.
DR   EnsemblGenomes-Tr; EBT00001623085.
DR   EnsemblGenomes-Tr; EBT00001623086.
DR   EnsemblGenomes-Tr; EBT00001623087.
DR   EnsemblGenomes-Tr; EBT00001623088.
DR   EnsemblGenomes-Tr; EBT00001623089.
DR   EnsemblGenomes-Tr; EBT00001623090.
DR   EnsemblGenomes-Tr; EBT00001623091.
DR   EnsemblGenomes-Tr; EBT00001623092.
DR   EnsemblGenomes-Tr; EBT00001623093.
DR   EnsemblGenomes-Tr; EBT00001623094.
DR   EnsemblGenomes-Tr; EBT00001623095.
DR   EnsemblGenomes-Tr; EBT00001623096.
DR   EnsemblGenomes-Tr; EBT00001623097.
DR   EnsemblGenomes-Tr; EBT00001623098.
DR   EnsemblGenomes-Tr; EBT00001623099.
DR   EnsemblGenomes-Tr; EBT00001623100.
DR   EnsemblGenomes-Tr; EBT00001623101.
DR   EnsemblGenomes-Tr; EBT00001623102.
DR   EnsemblGenomes-Tr; EBT00001623103.
DR   EnsemblGenomes-Tr; EBT00001623104.
DR   EnsemblGenomes-Tr; EBT00001623105.
DR   EnsemblGenomes-Tr; EBT00001623106.
DR   EnsemblGenomes-Tr; EBT00001623107.
DR   EnsemblGenomes-Tr; EBT00001623108.
DR   EnsemblGenomes-Tr; EBT00001623109.
DR   EnsemblGenomes-Tr; EBT00001623110.
DR   EnsemblGenomes-Tr; EBT00001623111.
DR   EnsemblGenomes-Tr; EBT00001623112.
DR   EnsemblGenomes-Tr; EBT00001623113.
DR   EnsemblGenomes-Tr; EBT00001623114.
DR   EnsemblGenomes-Tr; EBT00001623115.
DR   EnsemblGenomes-Tr; EBT00001623116.
DR   EnsemblGenomes-Tr; EBT00001623117.
DR   EnsemblGenomes-Tr; EBT00001623118.
DR   EnsemblGenomes-Tr; EBT00001623119.
DR   EnsemblGenomes-Tr; EBT00001623120.
DR   EnsemblGenomes-Tr; EBT00001623121.
DR   EnsemblGenomes-Tr; EBT00001623122.
DR   EnsemblGenomes-Tr; EBT00001623123.
DR   EnsemblGenomes-Tr; EBT00001623124.
DR   EnsemblGenomes-Tr; EBT00001623125.
DR   EnsemblGenomes-Tr; EBT00001623126.
DR   EnsemblGenomes-Tr; EBT00001623127.
DR   EnsemblGenomes-Tr; EBT00001623128.
DR   EnsemblGenomes-Tr; EBT00001623129.
DR   EnsemblGenomes-Tr; EBT00001623130.
DR   EnsemblGenomes-Tr; EBT00001623131.
DR   EnsemblGenomes-Tr; EBT00001623132.
DR   EnsemblGenomes-Tr; EBT00001623133.
DR   EnsemblGenomes-Tr; EBT00001623134.
DR   EnsemblGenomes-Tr; EBT00001623135.
DR   EnsemblGenomes-Tr; EBT00001623136.
DR   EnsemblGenomes-Tr; EBT00001623137.
DR   EnsemblGenomes-Tr; EBT00001623138.
DR   EnsemblGenomes-Tr; EBT00001623139.
DR   EnsemblGenomes-Tr; EBT00001623140.
DR   EnsemblGenomes-Tr; EBT00001623141.
DR   EnsemblGenomes-Tr; EBT00001623142.
DR   EnsemblGenomes-Tr; EBT00001623143.
DR   EnsemblGenomes-Tr; EBT00001623144.
DR   EnsemblGenomes-Tr; EBT00001623145.
DR   EnsemblGenomes-Tr; EBT00001623146.
DR   EnsemblGenomes-Tr; EBT00001623147.
DR   EnsemblGenomes-Tr; EBT00001623148.
DR   EnsemblGenomes-Tr; EBT00001623149.
DR   EnsemblGenomes-Tr; EBT00001623150.
DR   EnsemblGenomes-Tr; EBT00001623151.
DR   EnsemblGenomes-Tr; EBT00001623152.
DR   EnsemblGenomes-Tr; EBT00001623153.
DR   EnsemblGenomes-Tr; EBT00001623154.
DR   EnsemblGenomes-Tr; EBT00001623155.
DR   EnsemblGenomes-Tr; EBT00001623156.
DR   EnsemblGenomes-Tr; EBT00001623157.
DR   EnsemblGenomes-Tr; EBT00001623158.
DR   EnsemblGenomes-Tr; EBT00001623159.
DR   EnsemblGenomes-Tr; EBT00001623160.
DR   EnsemblGenomes-Tr; EBT00001623161.
DR   EnsemblGenomes-Tr; EBT00001623162.
DR   EnsemblGenomes-Tr; EBT00001623163.
DR   EnsemblGenomes-Tr; EBT00001623164.
DR   EnsemblGenomes-Tr; EBT00001623165.
DR   EnsemblGenomes-Tr; EBT00001623166.
DR   EnsemblGenomes-Tr; EBT00001623167.
DR   EnsemblGenomes-Tr; EBT00001623168.
DR   EnsemblGenomes-Tr; EBT00001623169.
DR   EnsemblGenomes-Tr; EBT00001623170.
DR   EnsemblGenomes-Tr; EBT00001623171.
DR   EnsemblGenomes-Tr; EBT00001623172.
DR   EnsemblGenomes-Tr; EBT00001623173.
DR   EnsemblGenomes-Tr; EBT00001623174.
DR   EnsemblGenomes-Tr; EBT00001623175.
DR   EnsemblGenomes-Tr; EBT00001623176.
DR   EnsemblGenomes-Tr; EBT00001623177.
DR   EnsemblGenomes-Tr; EBT00001623178.
DR   EnsemblGenomes-Tr; EBT00001623179.
DR   EnsemblGenomes-Tr; EBT00001623180.
DR   EnsemblGenomes-Tr; EBT00001623181.
DR   EnsemblGenomes-Tr; EBT00001623182.
DR   EnsemblGenomes-Tr; EBT00001623183.
DR   EnsemblGenomes-Tr; EBT00001623184.
DR   EnsemblGenomes-Tr; EBT00001623185.
DR   EnsemblGenomes-Tr; EBT00001623187.
DR   EnsemblGenomes-Tr; EBT00001623189.
DR   EnsemblGenomes-Tr; EBT00001623190.
DR   EnsemblGenomes-Tr; EBT00001623191.
DR   EnsemblGenomes-Tr; EBT00001623192.
DR   EnsemblGenomes-Tr; EBT00001623195.
DR   EnsemblGenomes-Tr; EBT00001623197.
DR   EnsemblGenomes-Tr; EBT00001623199.
DR   EnsemblGenomes-Tr; EBT00001623202.
DR   EnsemblGenomes-Tr; EBT00001623203.
DR   EnsemblGenomes-Tr; EBT00001623206.
DR   EnsemblGenomes-Tr; EBT00001623207.
DR   EnsemblGenomes-Tr; EBT00001623209.
DR   EnsemblGenomes-Tr; EBT00001623212.
DR   EnsemblGenomes-Tr; EBT00001623214.
DR   EnsemblGenomes-Tr; EBT00001623217.
DR   EnsemblGenomes-Tr; EBT00001623219.
DR   EnsemblGenomes-Tr; EBT00001623221.
DR   EnsemblGenomes-Tr; EBT00001623223.
DR   EnsemblGenomes-Tr; EBT00001623225.
DR   EnsemblGenomes-Tr; EBT00001623227.
DR   EnsemblGenomes-Tr; EBT00001623228.
DR   EnsemblGenomes-Tr; EBT00001623230.
DR   EnsemblGenomes-Tr; EBT00001623232.
DR   EnsemblGenomes-Tr; EBT00001623234.
DR   EnsemblGenomes-Tr; EBT00001623236.
DR   EnsemblGenomes-Tr; EBT00001623238.
DR   EnsemblGenomes-Tr; EBT00001623240.
DR   EnsemblGenomes-Tr; EBT00001623241.
DR   EnsemblGenomes-Tr; EBT00001623242.
DR   EnsemblGenomes-Tr; EBT00001623243.
DR   EnsemblGenomes-Tr; EBT00001623245.
DR   EnsemblGenomes-Tr; EBT00001623246.
DR   EnsemblGenomes-Tr; EBT00001623248.
DR   EnsemblGenomes-Tr; EBT00001623251.
DR   EnsemblGenomes-Tr; EBT00001623253.
DR   EnsemblGenomes-Tr; EBT00001623254.
DR   EnsemblGenomes-Tr; EBT00001623257.
DR   EnsemblGenomes-Tr; EBT00001623259.
DR   EnsemblGenomes-Tr; EBT00001623260.
DR   EnsemblGenomes-Tr; EBT00001623261.
DR   EnsemblGenomes-Tr; EBT00001623263.
DR   EnsemblGenomes-Tr; EBT00001623264.
DR   EnsemblGenomes-Tr; EBT00001623266.
DR   EnsemblGenomes-Tr; EBT00001623267.
DR   EnsemblGenomes-Tr; EBT00001623269.
DR   EnsemblGenomes-Tr; EBT00001623270.
DR   EnsemblGenomes-Tr; EBT00001623272.
DR   EnsemblGenomes-Tr; EBT00001623274.
DR   EnsemblGenomes-Tr; EBT00001623276.
DR   EnsemblGenomes-Tr; EBT00001623278.
DR   EnsemblGenomes-Tr; EBT00001623280.
DR   EnsemblGenomes-Tr; EBT00001623281.
DR   EnsemblGenomes-Tr; EBT00001623283.
DR   EnsemblGenomes-Tr; EBT00001623285.
DR   EnsemblGenomes-Tr; EBT00001623286.
DR   EnsemblGenomes-Tr; EBT00001623288.
DR   EnsemblGenomes-Tr; EBT00001623291.
DR   EnsemblGenomes-Tr; EBT00001623292.
DR   EnsemblGenomes-Tr; EBT00001623294.
DR   EnsemblGenomes-Tr; EBT00001623296.
DR   EnsemblGenomes-Tr; EBT00001623298.
DR   EnsemblGenomes-Tr; EBT00001623300.
DR   EnsemblGenomes-Tr; EBT00001623302.
DR   EnsemblGenomes-Tr; EBT00001623304.
DR   EnsemblGenomes-Tr; EBT00001623306.
DR   EnsemblGenomes-Tr; EBT00001623308.
DR   EnsemblGenomes-Tr; EBT00001623310.
DR   EnsemblGenomes-Tr; YPK_R0001-1.
DR   EnsemblGenomes-Tr; YPK_R0002-1.
DR   EnsemblGenomes-Tr; YPK_R0003-1.
DR   EnsemblGenomes-Tr; YPK_R0004-1.
DR   EnsemblGenomes-Tr; YPK_R0005-1.
DR   EnsemblGenomes-Tr; YPK_R0006-1.
DR   EnsemblGenomes-Tr; YPK_R0007-1.
DR   EnsemblGenomes-Tr; YPK_R0008-1.
DR   EnsemblGenomes-Tr; YPK_R0009-1.
DR   EnsemblGenomes-Tr; YPK_R0010-1.
DR   EnsemblGenomes-Tr; YPK_R0011-1.
DR   EnsemblGenomes-Tr; YPK_R0012-1.
DR   EnsemblGenomes-Tr; YPK_R0013-1.
DR   EnsemblGenomes-Tr; YPK_R0014-1.
DR   EnsemblGenomes-Tr; YPK_R0015-1.
DR   EnsemblGenomes-Tr; YPK_R0016-1.
DR   EnsemblGenomes-Tr; YPK_R0017-1.
DR   EnsemblGenomes-Tr; YPK_R0018-1.
DR   EnsemblGenomes-Tr; YPK_R0019-1.
DR   EnsemblGenomes-Tr; YPK_R0020-1.
DR   EnsemblGenomes-Tr; YPK_R0021-1.
DR   EnsemblGenomes-Tr; YPK_R0022-1.
DR   EnsemblGenomes-Tr; YPK_R0023-1.
DR   EnsemblGenomes-Tr; YPK_R0024-1.
DR   EnsemblGenomes-Tr; YPK_R0025-1.
DR   EnsemblGenomes-Tr; YPK_R0026-1.
DR   EnsemblGenomes-Tr; YPK_R0027-1.
DR   EnsemblGenomes-Tr; YPK_R0028-1.
DR   EnsemblGenomes-Tr; YPK_R0029-1.
DR   EnsemblGenomes-Tr; YPK_R0030-1.
DR   EnsemblGenomes-Tr; YPK_R0031-1.
DR   EnsemblGenomes-Tr; YPK_R0032-1.
DR   EnsemblGenomes-Tr; YPK_R0033-1.
DR   EnsemblGenomes-Tr; YPK_R0034-1.
DR   EnsemblGenomes-Tr; YPK_R0035-1.
DR   EnsemblGenomes-Tr; YPK_R0036-1.
DR   EnsemblGenomes-Tr; YPK_R0037-1.
DR   EnsemblGenomes-Tr; YPK_R0038-1.
DR   EnsemblGenomes-Tr; YPK_R0039-1.
DR   EnsemblGenomes-Tr; YPK_R0040-1.
DR   EnsemblGenomes-Tr; YPK_R0041-1.
DR   EnsemblGenomes-Tr; YPK_R0042-1.
DR   EnsemblGenomes-Tr; YPK_R0043-1.
DR   EnsemblGenomes-Tr; YPK_R0044-1.
DR   EnsemblGenomes-Tr; YPK_R0045-1.
DR   EnsemblGenomes-Tr; YPK_R0046-1.
DR   EnsemblGenomes-Tr; YPK_R0047-1.
DR   EnsemblGenomes-Tr; YPK_R0048-1.
DR   EnsemblGenomes-Tr; YPK_R0049-1.
DR   EnsemblGenomes-Tr; YPK_R0050-1.
DR   EnsemblGenomes-Tr; YPK_R0051-1.
DR   EnsemblGenomes-Tr; YPK_R0052-1.
DR   EnsemblGenomes-Tr; YPK_R0053-1.
DR   EnsemblGenomes-Tr; YPK_R0054-1.
DR   EnsemblGenomes-Tr; YPK_R0055-1.
DR   EnsemblGenomes-Tr; YPK_R0056-1.
DR   EnsemblGenomes-Tr; YPK_R0057-1.
DR   EnsemblGenomes-Tr; YPK_R0058-1.
DR   EnsemblGenomes-Tr; YPK_R0059-1.
DR   EnsemblGenomes-Tr; YPK_R0060-1.
DR   EnsemblGenomes-Tr; YPK_R0061-1.
DR   EnsemblGenomes-Tr; YPK_R0062-1.
DR   EnsemblGenomes-Tr; YPK_R0063-1.
DR   EnsemblGenomes-Tr; YPK_R0064-1.
DR   EnsemblGenomes-Tr; YPK_R0065-1.
DR   EnsemblGenomes-Tr; YPK_R0066-1.
DR   EnsemblGenomes-Tr; YPK_R0067-1.
DR   EnsemblGenomes-Tr; YPK_R0068-1.
DR   EnsemblGenomes-Tr; YPK_R0069-1.
DR   EnsemblGenomes-Tr; YPK_R0070-1.
DR   EnsemblGenomes-Tr; YPK_R0071-1.
DR   EnsemblGenomes-Tr; YPK_R0072-1.
DR   EnsemblGenomes-Tr; YPK_R0073-1.
DR   EnsemblGenomes-Tr; YPK_R0074-1.
DR   EnsemblGenomes-Tr; YPK_R0075-1.
DR   EnsemblGenomes-Tr; YPK_R0076-1.
DR   EnsemblGenomes-Tr; YPK_R0077-1.
DR   EnsemblGenomes-Tr; YPK_R0078-1.
DR   EnsemblGenomes-Tr; YPK_R0079-1.
DR   EnsemblGenomes-Tr; YPK_R0080-1.
DR   EnsemblGenomes-Tr; YPK_R0081-1.
DR   EnsemblGenomes-Tr; YPK_R0082-1.
DR   EnsemblGenomes-Tr; YPK_R0083-1.
DR   EnsemblGenomes-Tr; YPK_R0084-1.
DR   EnsemblGenomes-Tr; YPK_R0085-1.
DR   EnsemblGenomes-Tr; YPK_R0086-1.
DR   EnsemblGenomes-Tr; YPK_R0087-1.
DR   EnsemblGenomes-Tr; YPK_R0088-1.
DR   EnsemblGenomes-Tr; YPK_R0089-1.
DR   EnsemblGenomes-Tr; YPK_R0090-1.
DR   EnsemblGenomes-Tr; YPK_R0091-1.
DR   EnsemblGenomes-Tr; YPK_R0092-1.
DR   EnsemblGenomes-Tr; YPK_R0093-1.
DR   EnsemblGenomes-Tr; YPK_R0094-1.
DR   EnsemblGenomes-Tr; YPK_R0095-1.
DR   EnsemblGenomes-Tr; YPK_R0096-1.
DR   EnsemblGenomes-Tr; YPK_R0097-1.
DR   EnsemblGenomes-Tr; YPK_R0098-1.
DR   EuropePMC; PMC2546824; 18678673.
DR   EuropePMC; PMC2570298; 18757572.
DR   EuropePMC; PMC2806259; 20017936.
DR   EuropePMC; PMC3028722; 21131531.
DR   EuropePMC; PMC3322022; 20202457.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00018; CsrB.
DR   RFAM; RF00021; Spot_42.
DR   RFAM; RF00022; GcvB.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00033; MicF.
DR   RFAM; RF00034; RprA.
DR   RFAM; RF00040; rne5.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00057; RyhB.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00078; MicA.
DR   RFAM; RF00079; OmrA-B.
DR   RFAM; RF00081; ArcZ.
DR   RFAM; RF00082; SraG.
DR   RFAM; RF00083; GlmZ_SraJ.
DR   RFAM; RF00101; SraC_RyeA.
DR   RFAM; RF00110; RybB.
DR   RFAM; RF00111; RyeB.
DR   RFAM; RF00112; CyaR_RyeE.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00128; GlmY_tke1.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00368; sroB.
DR   RFAM; RF00369; sroC.
DR   RFAM; RF00382; DnaX.
DR   RFAM; RF00391; RtT.
DR   RFAM; RF00506; Thr_leader.
DR   RFAM; RF00512; Leu_leader.
DR   RFAM; RF00513; Trp_leader.
DR   RFAM; RF00514; His_leader.
DR   RFAM; RF00552; rncO.
DR   RFAM; RF00630; P26.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01317; CRISPR-DR4.
DR   RFAM; RF01396; isrN.
DR   RFAM; RF01405; STnc490k.
DR   RFAM; RF01707; JUMPstart.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01748; nuoG.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01769; greA.
DR   RFAM; RF01770; rimP.
DR   RFAM; RF01796; frnS.
DR   RFAM; RF01830; StyR-44.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01859; Phe_leader.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF02029; sraA.
DR   RFAM; RF02030; tp2.
DR   RFAM; RF02031; tpke11.
DR   RFAM; RF02074; STnc240.
DR   RFAM; RF02194; HPnc0260.
DR   SILVA-LSU; CP000950.
DR   SILVA-SSU; CP000950.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4001789
CC   The authors wish to acknowledge the Intelligence Technology
CC   Innovation Center for funding the sequencing. For more information
CC   about this strain contact Mikeljon Nikolich, Division of
CC   Cummunicable Diseases and Immunology, Department of Bacterial
CC   diseases, Walter Reed Army Institute of Research, Silver Spring, MD
CC   (Mikeljon.Nikolich@NA.AMEDD.ARMY.MIL)
CC   Source DNA and bacteria available from Mikeljon Nikolich
CC   (Mikeljon.Nikolich@NA.AMEDD.ARMY.MIL)
CC   Contacts: Mikeljon Nikolich (Mikeljon.Nikolich@NA.AMEDD.ARMY.MIL)
CC        Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID)
CC   The NIAID funded PathoSystems Resource Integration Center (PATRIC;
CC   http://patricbrc.vbi.vt.edu/) Bioinformatics Resource Center is
CC   responsible for annotation updates of this record.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4689441
FT                   /organism="Yersinia pseudotuberculosis YPIII"
FT                   /strain="YPIII"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:502800"
FT   gene            37..1389
FT                   /locus_tag="YPK_0001"
FT   CDS_pept        37..1389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: ypi:YpsIP31758_4153 chromosomal replication
FT                   initiator protein DnaA; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA domain; Chromosomal replication initiator
FT                   DnaA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66315"
FT                   /db_xref="GOA:A0A0H3AYJ6"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYJ6"
FT                   /protein_id="ACA66315.1"
FT                   /translation="MQDELPATEFSMWIRPLQAELSDNTLALYAPNRFVLDWVRDKYLN
FT                   NINGLLNDFCGTEVPLLRFEVGSKPAARAHNNPVTASVSAPVAPVTRSAPMRPSWDNSP
FT                   AQPELSYRSNVNPKHTFDNFVEGKSNQLARAAARQVADNPGGAYNPLFLYGGTGLGKTH
FT                   LLHAVGNGIMARKANAKVVYMHSERFVQDMVKALQNNAIEEFKRYYRSVDALLIDDIQF
FT                   FANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPE
FT                   LETRVAILMKKADENDIRLPGEVAFFIAKRLRSNVRELEGALNRVIANANFTGRAITID
FT                   FVREALRDLLALQEKLVTIDNIQKTVAEYYKIKVADLLSKRRSRSVARPRQMAMALAKE
FT                   LTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLIRTLSS"
FT   gene            1394..2494
FT                   /locus_tag="YPK_0002"
FT   CDS_pept        1394..2494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: ypi:YpsIP31758_4152 DNA polymerase III, beta
FT                   subunit; TIGRFAM: DNA polymerase III, beta subunit; PFAM:
FT                   DNA polymerase III beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66316"
FT                   /db_xref="GOA:A0A0H3AWC0"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AWC0"
FT                   /protein_id="ACA66316.1"
FT                   /translation="MKFIIEREHLLKPLQQVSSPLGGRPTLPILGNLLLQVTEGSLRLT
FT                   GTDLEMEMVACVALSQSHEPGATTVPARKFFDIWRGLPEGAEITVALDGDRLLVRSGRS
FT                   RFSLSTLPAIDFPNLDDWQSEVEFTLPQATLKRLIESTQFSMAHQDVRYYLNGMLFETE
FT                   GEELRTVATDGHRLAVCSMPIGQTLPSHSVIVPRKGVMELVRLLDGGDTPLRLQIGSNN
FT                   IRAHVGDFIFTSKLVDGRFPDYRRVLPKNPDKMLEAGCDLLKQAFSRAAILSNEKFRGV
FT                   RLYVSHNQLKITANNPEQEEAEEILDVSYEGTEMEIGFNVSYVLDVLNALKCEDVRLLL
FT                   TDSVSSVQIEDSASQAAAYVVMPMRL"
FT   gene            2667..3752
FT                   /locus_tag="YPK_0003"
FT   CDS_pept        2667..3752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: yps:YPTB3941 DNA metabolism
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66317"
FT                   /db_xref="GOA:B1JGD5"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JGD5"
FT                   /protein_id="ACA66317.1"
FT                   /translation="MALTRLLIKDFRNIESADLALAAGFNFLVGPNGSGKTSVLEAVYT
FT                   LGHGRAFRSLQAGRVIRHECAEFVLHGRVDANEREASVGLSKSRQGDTKVRIDGTDGHK
FT                   VAELAQMLPMQLITPEGFTLLNGGPKFRRAFLDWGCFHNEPGFFTAWSNLKRLLKQRNA
FT                   ALRQVSRYTQIRAWDQEIIPLAERISEWRAAYSDAIAADISATCALFLPEFALSFSFQR
FT                   GWDKESDYGELLARQFERDRALTYTAVGPHKADFRIRADGTPVEDLLSRGQLKLLMCAL
FT                   RLAQGEFLTRQSGRRCLYLLDDFASELDTGRRRLLAERLKATQAQVFVSAVSAEQVADM
FT                   VGEKGKMFRVEHGKIEVQPQD"
FT   gene            3772..6186
FT                   /locus_tag="YPK_0004"
FT   CDS_pept        3772..6186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0004"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: ypi:YpsIP31758_4150 DNA gyrase, B subunit;
FT                   TIGRFAM: DNA gyrase, B subunit; PFAM: DNA gyrase subunit B
FT                   domain protein; ATP-binding region ATPase domain protein;
FT                   TOPRIM domain protein; DNA topoisomerase type IIA subunit B
FT                   region 2 domain protein; SMART: DNA topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66318"
FT                   /db_xref="GOA:A0A0H3AY43"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AY43"
FT                   /protein_id="ACA66318.1"
FT                   /translation="MSNTYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVVD
FT                   NAIDEALAGHCKEILVTIHADNSVSVQDDGRGIPTGMHDEEGVSAAEVIMTVLHAGGKF
FT                   DDNSYKVSGGLHGVGVSVVNALSEKLELVIRREGKVHEQTYKMGVPQAPLKVVGETEQT
FT                   GTTVRFWPSFQTFTNNTEFQYEILAKRLRELSFLNSGVSIKLKDKRNDKEDHFHYEGGI
FT                   KAFVEYLNKNKNPIHPKVFYFSTMKDDIGVEVALQWNDGFQENIYCFTNNIPQRDGGTH
FT                   LVGFRTAMTRTLNSYMDKEGYSKKAKISATGDDAREGLIAVVSVKVPDPKFSSQTKDKL
FT                   VSSEVKTAVETLMNEKLVEYLLENPTDAKIVVGKIIDAARAREAARKAREMTRRKGALD
FT                   LAGLPGKLADCQERDPALSELYLVEGDSAGGSAKQGRNRKNQAILPLKGKILNVEKARF
FT                   DKMLSSQEVATLITALGCGIGRDEYNPDKLRYHNIIIMTDADVDGSHIRTLLLTFFYRQ
FT                   MPEIIERGHVFIAQPPLYKVKKGKQEQYIKDDDAMEQYQMTLALDGAALHTNAHAPALA
FT                   GEPLEKLVAEHYSVQKTIARMERRYPRALLNNLIYQPTLQEEDLGNKEVVTQWIDSLVV
FT                   LLNEKEHHGSSYSSVVRENRERQLFEPILRIRTHGVDTDYDLDFDFIHGGEYRKICLLG
FT                   DKLRGLIEDGAFVERGERRVPVSSFEEALDWLVKESRRGLAIQRYKGLGEMNPDQLWET
FT                   TMDPESRRMLRVMVKDAIAADQLFTTLMGDAVEPRRAFIEENALRAANIDI"
FT   gene            6402..7211
FT                   /locus_tag="YPK_0005"
FT   CDS_pept        6402..7211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0005"
FT                   /product="Cof-like hydrolase"
FT                   /note="TIGRFAM: Cof-like hydrolase; HAD-superfamily
FT                   hydrolase, subfamily IIB; PFAM: Haloacid dehalogenase
FT                   domain protein hydrolase; sucrose-6F-phosphate
FT                   phosphohydrolase; Haloacid dehalogenase domain protein
FT                   hydrolase type 3; KEGG: ypi:YpsIP31758_4149 Cof-like
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66319"
FT                   /db_xref="GOA:A0A0H3AZ48"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZ48"
FT                   /protein_id="ACA66319.1"
FT                   /translation="MAIELIAIDMDGTLLNPQHEITPRVKQAIAAARAKGVCVVLATGR
FT                   PYIGVQRYLRELNMENSGDYCISNNGALVQKAATGECILQETLSFEDYLYFEALSRELG
FT                   VSFQAFDFNTLYTANKDISKYTLHEVMLTGIPLKYRAVEEMDPTLRFPKVMMIDEPERL
FT                   DRALAMMPAEVFERFTIMKSAPFYLEILSKRVDKGTGVKMLAEHLGIAQENVMALGDQG
FT                   NDIAMVNYAGVGVAMGNAIPELKEIAQYVTGTNCEDGVATAIEKYIG"
FT   gene            7529..7696
FT                   /locus_tag="YPK_0006"
FT   CDS_pept        7529..7696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0006"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66320"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZV1"
FT                   /protein_id="ACA66320.1"
FT                   /translation="MPSEGRLSRKRIGPVRQRNDESRDPTKWASDSAKARGSKGATLMA
FT                   PLAVGSSEAR"
FT   gene            complement(7806..8759)
FT                   /locus_tag="YPK_0007"
FT   CDS_pept        complement(7806..8759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0007"
FT                   /product="Ornithine cyclodeaminase"
FT                   /EC_number="4.3.1.12"
FT                   /note="PFAM: ornithine cyclodeaminase/mu-crystallin; KEGG:
FT                   ypi:YpsIP31758_4147 ornithine cyclodeaminase/mu-crystallin
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66321"
FT                   /db_xref="GOA:A0A0H3AYK0"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYK0"
FT                   /protein_id="ACA66321.1"
FT                   /translation="MLILNKQKILDKFDADRITLLLKEGFIAFSQQRVQMPPVQHLLFD
FT                   QANGDCCIKSGYLQGDDQFVVKVSGGFYDNPAQGLASNQGLMMAFSAKTGEPQAILLDE
FT                   GWLTALRTALAGRIVAELCAPQHISALGIVGTGIQARLHLMYLKNVMTCRQLWVWGRSE
FT                   TALEEYRQYAQAEGFAVNTTLNAAELAHHSQFIVTTTPSREPILQAEDIQPGTHITAVG
FT                   ADSAGKHELSAELVARADKILVDSIAQCTDFGEVSLAFKQGLLAHHNLTEIGLALAQGI
FT                   PFRENDQQITLADLTGLGIQDVQIVKGILGDKKGVL"
FT   gene            complement(8753..9715)
FT                   /locus_tag="YPK_0008"
FT   CDS_pept        complement(8753..9715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0008"
FT                   /product="Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit"
FT                   /note="PFAM: Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit; KEGG: ypp:YPDSF_0008 pyridoxal-phosphate dependent
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66322"
FT                   /db_xref="GOA:A0A0H3AWC6"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AWC6"
FT                   /protein_id="ACA66322.1"
FT                   /translation="MNTLFDAIREAHQILRPQVRVTPLEHSPLLSQHSGCEIYLKCEHL
FT                   QHTGSFKFRGASNKLRLLNEAQRQQGVITASTGNHGQGVALAAKLAGIKSTIYAPEQAA
FT                   AIKLDVIRALGGQIELVSGDALNAELAAGIAAEQQGKVYISPYNDPQVIAGQGTCGMEM
FT                   VEQQPDLDAVFVAVGGGGLISGIATVLKTLSDKTQVIGCWPANATSLYTCLEKGQIQEV
FT                   AEQETLSDGTSGGIEPGAITFALCQQLIDQKVLVSEQEIKEAMGLIARTDRWMIEGAAG
FT                   VALAAALKLAPQWQGKKVAVVLCGKNIVLEKYLGAVSGC"
FT   gene            9923..11224
FT                   /locus_tag="YPK_0009"
FT   CDS_pept        9923..11224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0009"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: yps:YPTB3902 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66323"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR022223"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AY48"
FT                   /protein_id="ACA66323.1"
FT                   /translation="MNAQKTRFLPEQQLTFDPRGHQLTNINVWTPDSQWLAYDVRPSGG
FT                   TFNGLTIERVNCITGEIEVIYRARQGAHVGVVTVSPDMPARYVFIHGPEHPDSHWHYDF
FT                   HHRRGVIVSEPDRELAVTLDAMDITAPYTPGALRGGSHVHVFSPDGSRLSFTYNDHVLH
FT                   ERDPALDCRNVGVALPLRGVNPPKHHPREHDGSHFCVLISCTTPTPQAGSDQINRAYEE
FT                   GWIGARGYVKADGTRQRWALAFIGDTFSVQGEKVPEIFIADLPEHDRDYARAGTHPLEG
FT                   TENTLPAPPVGVSQRRLTYTTERPFPGLATRPRHWLRSSPDGSAIACLMNDDNGVVQLW
FT                   LISPNGGELRQLTASQWGIQSAFSWSPQGEHLAFICDNSVMLCDSLTGHLRRLTARSVV
FT                   APLADAVVFSPNGKKIAFMREIDGWAQIFTVHAD"
FT   gene            complement(11264..11602)
FT                   /locus_tag="YPK_0010"
FT   CDS_pept        complement(11264..11602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0010"
FT                   /product="protein of unknown function DUF1375"
FT                   /note="PFAM: protein of unknown function DUF1375; KEGG:
FT                   yps:YPTB3903 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66324"
FT                   /db_xref="InterPro:IPR010780"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZ56"
FT                   /protein_id="ACA66324.1"
FT                   /translation="MRNIVIPFATGCSLLLTSGCSSILTHTSSSQGYYSGTEANIAMLK
FT                   DDDTGWALRPLLAVDLPFSAVMDTLFLPYDYLRSDNEDKVTSSPRERVRQSEMQNQQTN
FT                   QTGDTPKQ"
FT   sig_peptide     complement(11510..11602)
FT                   /locus_tag="YPK_0010"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.383 at
FT                   residue 31"
FT   gene            11970..12383
FT                   /locus_tag="YPK_0011"
FT   CDS_pept        11970..12383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0011"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG:
FT                   ypi:YpsIP31758_4143 small heat shock protein IbpA"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66325"
FT                   /db_xref="GOA:B1JGZ5"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR023728"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JGZ5"
FT                   /protein_id="ACA66325.1"
FT                   /translation="MRNSDLAPLYRSAIGFDRLFNLLESGQNQSNGGYPPYNVELVDEN
FT                   NYRIAIAVAGFAEQELEITTQDNLLIVRGSHANEPAQRTYLYQGIAERNFERKFQLAEH
FT                   IKIKGANLVNGLLYIDLERLVPESLKPRRIEIK"
FT   gene            12664..13128
FT                   /locus_tag="YPK_0012"
FT   CDS_pept        12664..13128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0012"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG:
FT                   ypi:YpsIP31758_4142 small heat shock protein IbpB"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66326"
FT                   /db_xref="GOA:B1JGZ6"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR022848"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JGZ6"
FT                   /protein_id="ACA66326.1"
FT                   /translation="MRNYDLSPLLRQWIGFDKLASTMQGGQEPQGFPPYNIEKTDDNHY
FT                   RISLALAGFKQSELDIEVEGPRLTVRGKPTPVEKQVEYLHQGLVRKEFSLTFTLAEHLN
FT                   VDNAQFENGLLHIDLLRQVPEALQPQRIAIGSATPQERQVLESPEAPDQQ"
FT   gene            13501..15159
FT                   /locus_tag="YPK_0013"
FT   CDS_pept        13501..15159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0013"
FT                   /product="YidE/YbjL duplication"
FT                   /note="TIGRFAM: YidE/YbjL duplication; PFAM: TrkA-C domain
FT                   protein; YidE/YbjL duplication domain protein; KEGG:
FT                   ypi:YpsIP31758_4141 putative transport protein YidE"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66327"
FT                   /db_xref="GOA:B1JGZ7"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006512"
FT                   /db_xref="InterPro:IPR023018"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JGZ7"
FT                   /protein_id="ACA66327.1"
FT                   /translation="MSAIALTVSMLALVAVLGLWIGNWKIYGVGLGIGGVLFGGIIVGH
FT                   FAQTYQIVLNGDMLHFIQEFGLILFVYTIGIQVGPGFFSSLRVSGLRLNCFAILMVVVG
FT                   GLVTAIIHKLFAVPLPIILGVFSGAVTNTPALGAAQQILTDLGSPPQLVSQMGMGYAMA
FT                   YPFGICGILLVMWLIRLFFKINIDREAKAFDSSYGQNRELLQTMNVAVRNPNLHGLSVQ
FT                   DVPLLNSDEVVCSRLKRGDLLMVPMPATVIEIGDYLHLVGQRDALEKVRLVVGEEVDVT
FT                   LSTAGTALQTARVVVTNEAVLGKKIRDLNLKQKYDVVITRLNRAGIELVASNSANLQFG
FT                   DILNLVGRPEAIEAVSAIVGNAQQKLQQVQMLPVFIGVGLGVLLGSIPLFVPGFPAALR
FT                   LGLAGGPLVVALILGRIGSIGKLYWFMPPSANLALRELGIVLFLSVVGLKSGGDFINTL
FT                   VNGDGLAWIGYGAMITGIPLLTVGILARMLVKMNYLTLCGMLAGSMTDPPALAFANGLH
FT                   PTSGAAALSYATVYPLAMFLRIMSPQILAVLFWTL"
FT   gene            complement(15272..16642)
FT                   /locus_tag="YPK_0014"
FT   CDS_pept        complement(15272..16642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0014"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   yps:YPTB3907 valine--pyruvate transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66328"
FT                   /db_xref="GOA:A0A0H3AZV6"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZV6"
FT                   /protein_id="ACA66328.1"
FT                   /translation="MAIFSRSQKKFFRIASAFICEYGTCSLTDNNTFSFMKFSLFGDKF
FT                   TRYAGITRLMDDLNDGLRTPGSIMLGGGNPAHIPEMDTYFQQLCQEMLTEGKLTEALCN
FT                   YDGPQGKDLLLNALAKMLRDELGWQIEPQNIALTNGSQSAFFYLFNLFAGRYADGSRRR
FT                   VLFPLAPEYLGYADAGLDEDLFVSAKPNIELLPEGQFKYHVDFEHLNITDDIGLICVSR
FT                   PTNPTGNVITDEELIRLDAITQQRNIPLLIDNAYGVPFPGIIFTDATPLWNPNIILCMS
FT                   LSKLGLPGSRCGIVIADEKVISAITNMNGIISLSPGGMGPAIAAEMIERGDLLRLSNEV
FT                   IRPFYFERVQQTIAILRKYLPAERCLIHKPEGAIFLWLWFKDLPISTELLYQRLKKRGV
FT                   LMVPGHYFFPGLGYDWPHTHQCMRMNYVPAPEMIEKGVAILAEEIERAFQEAKQLTD"
FT   gene            complement(16993..17436)
FT                   /locus_tag="YPK_0015"
FT   CDS_pept        complement(16993..17436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0015"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: yps:YPTB3908 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66329"
FT                   /db_xref="GOA:A0A0H3AYK4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYK4"
FT                   /protein_id="ACA66329.1"
FT                   /translation="MKNRIAFLIGPFIIALLIGFNLYYHMIYFLYGSKAILAYDVFTLM
FT                   TSNAVNALLLSISVTNSYLPLLFIKEGAIQNKMVFSFLSLSFYFILLLTLTLSHFMVRT
FT                   SPYANHNVIHGYDLIIACNIILSSIINLFLIRKVINIFSKADN"
FT   gene            complement(17850..19913)
FT                   /locus_tag="YPK_0016"
FT   CDS_pept        complement(17850..19913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0016"
FT                   /product="alpha amylase catalytic region"
FT                   /note="PFAM: alpha amylase catalytic region; SMART: alpha
FT                   amylase catalytic sub domain; KEGG: ypp:YPDSF_0016
FT                   alpha-amylase protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66330"
FT                   /db_xref="GOA:A0A0H3AWD1"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR014635"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AWD1"
FT                   /protein_id="ACA66330.1"
FT                   /translation="MKRLTLPLLLVLSPTAMANWSLQHFPAFTEQDSGIFLSSSSLTKG
FT                   EYPLKFYQDKQCWQPTGPVKLNQMLSLQPCQENIAIPWRLFRDGQYQARIDTRSGTPTL
FT                   TLSVTAPVAEAVQVVTHVCQRWDGNPVTVDVSKTFAEGEIVRDFYSGQTATVSLGKITL
FT                   RPAPESGGLLLLESAQTQQAAPFSWQNATVYFALTDRFNNGNPANDHSYGRHGDGMQEI
FT                   GTFHGGDLAGLTEKLDYLQQLGVNALWISSPLEQIHGWVGGGTKGDFPHYAYHGYYGLD
FT                   WTRLDANMGTEQDLRTLVEQAHKRGIRILFDVVMNHVGYATLADMQNDQFGALYLQGDQ
FT                   QEKTLGKRWSDWTPGSGQTWHSFNDYINFSDKTAWDNWWGKKWIRTDIGDYDTPGYDDL
FT                   TMSLAFLPDIKTESTQPSGLPVFYRNKPDTAAQEIAGATPRDYMTHWLSQWVRDYGIDG
FT                   FRVDTAKHVEKPAWQQLKQQSIAALAEWKAAHPEQALDNLPFWMTGEAWGHGVMKSDYY
FT                   QNGFDAMINFDFQDQANQALACFSSIESTYNQMAEKLQNFNVLSYLSSHDTRLFFKDDA
FT                   QQSLAKQQRAGSLLLLAPGAVQIFYGDESGRKFGPTGSDPLQGTRSDMNWSELSGEKGA
FT                   LLAHWQKVSQFRARHPAIGAGVQQSQQTANYYAFSRQHQGDKVLVVWVGDKN"
FT   sig_peptide     complement(19857..19913)
FT                   /locus_tag="YPK_0016"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 19"
FT   gene            complement(20183..21163)
FT                   /locus_tag="YPK_0017"
FT   CDS_pept        complement(20183..21163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0017"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; D-isomer specific 2-hydroxyacid
FT                   dehydrogenase NAD-binding; KEGG: ypi:YpsIP31758_4137
FT                   2-ketogluconate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66331"
FT                   /db_xref="GOA:B1JH01"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR023756"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JH01"
FT                   /protein_id="ACA66331.1"
FT                   /translation="MKPSIVLYKSIPTDLHQRLAQHFTVNSFDGLTPDNQPELLAALQQ
FT                   AEGLIGSGGKIDQDFLQLAPNLRAASTISVGYDNFDVEALSQRGIALMHTPTVLTETVA
FT                   DTMMALMLSTARRVVELAERVKAGEWQESIGDDWFGVDVHHKTIGILGMGRIGMALAQR
FT                   AHFGFSMPVLYTSRRPHEAAEQRFGARHCSLDTLLAEADFLCITLPMTEQTYHMIGREQ
FT                   LAKIKSSAILINAGRGPVVDEQALIAALQDGTIHAAGLDVFEQEPLPVDSPLLTLRNVV
FT                   AVPHIGSATHETRYNMAACAVDNLINALTGTVKENCVNPQVLITH"
FT   gene            21718..22362
FT                   /locus_tag="YPK_0018"
FT   CDS_pept        21718..22362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0018"
FT                   /product="putative transcriptional regulator"
FT                   /note="KEGG: ypi:YpsIP31758_4136 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66332"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AY52"
FT                   /protein_id="ACA66332.1"
FT                   /translation="MNIDHGARQPQSVGERLLLLLKTHGPLQAGEAGNILGTTGEAARQ
FT                   QFVKLAKKGLVVAEAQTRGVGRPIQLWQLTESGNTHFPDAHGELAVQLLRLIRTQLGDN
FT                   ALELLIDSREQETRDQYCQAMVGVSNVAERVERLVAIRTGEGYMAQSQVEADGTILLIE
FT                   NHCPIWAAAASCQRFCRTELAVFQQALGVPVERVEHILSGAHRCTYRIHPE"
FT   gene            complement(22493..23152)
FT                   /locus_tag="YPK_0019"
FT   CDS_pept        complement(22493..23152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0019"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; 17 kDa surface
FT                   antigen; KEGG: yps:YPTB3912 OmpA-OmpF family porin"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66333"
FT                   /db_xref="GOA:A0A0H3AZ59"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR039567"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZ59"
FT                   /protein_id="ACA66333.1"
FT                   /translation="MKKRILAPVAIVSVALILSACTTNPYTGESQAGKSGYGAGIGAAL
FT                   GAGIGLLSSSKHDRGKGALIGAAAGAALGGGAGYYMDVQEAKLREKMSGTGVSVTRQGE
FT                   NIVLNMPNNVTFDTNSSNLKPAGANTLTGVAMVLKEYDKTAVNVTGYTDSTGARAHNIV
FT                   LSQQRADNVASALIVQGVAANRIRTYGAGPDNPVASNSTAAGKAQNRRVEITLSPL"
FT   sig_peptide     complement(23090..23152)
FT                   /locus_tag="YPK_0019"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.752 at
FT                   residue 21"
FT   gene            complement(23510..23965)
FT                   /locus_tag="YPK_0020"
FT   CDS_pept        complement(23510..23965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0020"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   yps:YPTB3913 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66334"
FT                   /db_xref="GOA:A0A0H3AZW2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZW2"
FT                   /protein_id="ACA66334.1"
FT                   /translation="MIRIYQPDDLNALMQLWLTSTIDAHPFVAEQYWHESAPLIRETYL
FT                   PTARTWVYQQPGAATEENTIIGFISILEEQLVGALFVAQAFHGHGVAKALMDHVQQRYP
FT                   ALSLEVYQQNRRAYRFYRKQGFTVIGRAYHAETQGTILTMHWQHPAH"
FT   gene            complement(23962..24534)
FT                   /locus_tag="YPK_0021"
FT   CDS_pept        complement(23962..24534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0021"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /EC_number="3.2.2.20"
FT                   /note="KEGG: yps:YPTB3914 DNA-3-methyladenine glycosylase;
FT                   TIGRFAM: DNA-3-methyladenine glycosylase I; PFAM:
FT                   methyladenine glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66335"
FT                   /db_xref="GOA:A0A0H3AYL0"
FT                   /db_xref="InterPro:IPR004597"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYL0"
FT                   /protein_id="ACA66335.1"
FT                   /translation="MSLQRCGWVTSDPLYLAYHDTEWGVPLKDSRALFEMICLEGQQAG
FT                   LSWITVLKKREHYRKSFHHFDPVKVAKMGPEEVEIRVQDSGIIRHRGKIQAIITNAQAY
FT                   LAMEANGEDFSRFIWRFVDDEPKINHWWCLAEAPATTAVSDAMSKALKKRGFKFIGSTI
FT                   CYAFMQASGLVNDHMANCFCHPDNAVK"
FT   gene            24881..25795
FT                   /locus_tag="YPK_0022"
FT   CDS_pept        24881..25795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0022"
FT                   /product="glycyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="KEGG: ypi:YpsIP31758_4131 glycyl-tRNA synthetase,
FT                   alpha subunit; TIGRFAM: glycyl-tRNA synthetase, alpha
FT                   subunit; PFAM: glycyl-tRNA synthetase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66336"
FT                   /db_xref="GOA:B1JH06"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JH06"
FT                   /protein_id="ACA66336.1"
FT                   /translation="MQKFDTKTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTC
FT                   LRAIGPEPIAAAYVQPSRRPTDGRYGENPNRLQHYYQFQVIIKPSPDNIQELYLGSLKE
FT                   LGLDPTIHDIRFVEDNWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEI
FT                   TYGLERLAMYIQGVDSVYDLIWCDGPLGTTTYGDIYHQNEVEQSTYNFEYADVDFLFSC
FT                   FEQYEKEAQSLLALETPLPLPAYERILKAGHTFNLLDARKAISVTERQRYILRIRTLTK
FT                   AVAEAYYASREALGFPMCKKNQN"
FT   gene            25805..27874
FT                   /locus_tag="YPK_0023"
FT   CDS_pept        25805..27874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0023"
FT                   /product="glycyl-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="KEGG: ypi:YpsIP31758_4130 glycyl-tRNA synthetase,
FT                   beta subunit; TIGRFAM: glycyl-tRNA synthetase, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66337"
FT                   /db_xref="GOA:B1JH07"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JH07"
FT                   /protein_id="ACA66337.1"
FT                   /translation="MTQQTFLVEIGTEELPPKALRSLAESFAANFTAELDNANLSHGEV
FT                   SWYAAPRRLAVKVANLSAAQADREVEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQ
FT                   AERLVTDKGEWLLYRAHVKGQPAQLLLAGMVNTALSKLPIPKLMRWGDKETQFVRPVHT
FT                   VTLLLGTEVIPGTVLGINSDRVIRGHRFMGEAEFTIDSADQYPQILLERGKVIADYELR
FT                   KSIIKRDAEQAAQQIGGVADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPAEALVYTM
FT                   KGDQKYFPVYDTAGHLMPHFIFVANIESKDPQQIISGNEKVVRPRLADAEFFFKTDRKK
FT                   RLEDNLPRLETVLFQQQLGTLRDKTDRIQALAGWVAAQIGADVNHATRAGLLSKCDLMT
FT                   NMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPSNPVACALAIADKM
FT                   DTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLSLDLQTLTEEAVRLYGSKLTN
FT                   AKVVDDVIEFMLGRFRAWYQDEGHSVDTIQAVLARRPTKPADFDARVKAVTYFRTLDAA
FT                   AALAAANKRVSNILAKSTDTLNDHVHASILKEPAELKLATHLVVLRDQLEPVFAAGQYK
FT                   EALVELAALRETVDEFFESVMVMAEDDAVRVNRLTLLSKLRELFLQVADISLLQ"
FT   gene            28022..28252
FT                   /locus_tag="YPK_0024"
FT   CDS_pept        28022..28252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0024"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66338"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AWD7"
FT                   /protein_id="ACA66338.1"
FT                   /translation="MDVFTASLRSACSLRRGHFVNNLKGSYTLPLRYVFVGLATRPWLT
FT                   LTNRGSFAGSPCNLPCFGYILIKILSNSDFI"
FT   gene            28347..29066
FT                   /locus_tag="YPK_0025"
FT   CDS_pept        28347..29066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0025"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: ypi:YpsIP31758_4129 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66339"
FT                   /db_xref="InterPro:IPR021413"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AY57"
FT                   /protein_id="ACA66339.1"
FT                   /translation="MIFALNTVRNPRWLAPLLAFLVMFLVTACGDKEPEQRKAFIDYLQ
FT                   NTVMRSGMKLPTLSEDQKQKFGPYVSDYAILVTFSQQLSKSVDASLVPAIEQINQIRVA
FT                   QDYLSKRDALQQSAGALNLLVQQIRTAKAQADSAQAALKLPDDLKVVFNRAFDNIVTQP
FT                   ANVLIPAVPVVSSFVQDLVQVGDFLQQQGTQVTFNNGGIQFQTPQQAAQYNTMMSNLVA
FT                   KYPEMMAAQKRVMKVMQ"
FT   sig_peptide     28347..28433
FT                   /locus_tag="YPK_0025"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.854 at
FT                   residue 29"
FT   gene            29548..31479
FT                   /locus_tag="YPK_0026"
FT   CDS_pept        29548..31479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0026"
FT                   /product="PTS system, mannitol-specific IIC subunit"
FT                   /note="TIGRFAM: PTS system, mannitol-specific IIC subunit;
FT                   PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; phosphotransferase system
FT                   EIIC; phosphotransferase system lactose/cellobiose-specific
FT                   IIB subunit; KEGG: ypi:YpsIP31758_4128 PTS system,
FT                   mannitol-specific EIICBA component"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66340"
FT                   /db_xref="GOA:A0A0H3AZ63"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR004718"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR029503"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZ63"
FT                   /protein_id="ACA66340.1"
FT                   /translation="MFSPDAKVRVQNFGRFLSNMVMPNIGAFIAWGIITALFIPTGWLP
FT                   NETLAKLVGPMITYLLPLLIGFTGGRLVGGDRGGVVGAITTMGVIVGADMPMFLGAMIV
FT                   GPLGGWAIKHFDRWVEGKIKSGFEMLVNNFSSGIIGMLLALLAFMAIGPLVEVLSKGLA
FT                   YGVDVMVQNNLLPLASIFVEPAKILFLNNAINHGIFSPLGVQQAAETGKSIFFLIEANP
FT                   GPGLGVLMAYMFFGKGNAKQSAGGAAIIHFFGGIHEIYFPYVLMNPRLLLAVILGGMTG
FT                   VFTLTLLNGGLVSAASPGSILAILAMTPKGAYFANIAAVATAFAVSFVVSAILLKSSKA
FT                   KDDEEGLEGATRRMQDMKAQSKGVQAANAAAAAGDLSTVRKIIVACDAGMGSSAMGAGV
FT                   LRKKVQDAGLKHIAVTNCAINNLPEDVDLVITHRDLTERAMRHAPQAQHISLTNFLDSQ
FT                   LYNSLTAELLQASQLVDNTKVQKVIEKLDDSFEAFEDNLFKLGAENIFLNQHATAKEQA
FT                   IRFAGEQLVKGGYVEPEYVEAMLDREKLSSTYLGESIAVPHGTIEAKDRVLKTGVVFCQ
FT                   YPEGVRFGDEEDDIARLVIGIAARNNEHIQVITSLTNALDDDSVIARLSKTTSVQEVLD
FT                   LLGGKTSA"
FT   gene            31616..32779
FT                   /locus_tag="YPK_0027"
FT   CDS_pept        31616..32779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0027"
FT                   /product="Mannitol dehydrogenase domain"
FT                   /note="PFAM: Mannitol dehydrogenase domain; Mannitol
FT                   dehydrogenase rossman domain; KEGG: ypp:YPDSF_0026
FT                   mannitol-1-phosphate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66341"
FT                   /db_xref="GOA:B1JH11"
FT                   /db_xref="InterPro:IPR000669"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR023027"
FT                   /db_xref="InterPro:IPR023028"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JH11"
FT                   /protein_id="ACA66341.1"
FT                   /translation="MKALHFGAGNIGRGFIGKLLADAGAQLTFADVNQPLLDALNKRKR
FT                   YQVNVVGEQARVEEVKNVSAVNSGSPEVVALIAEADIVTTAVGPQILARIAATVAQGLI
FT                   TRHQQGNTRPLNIIACENMVRGTSQLKQHVFAALSEDEQIWVEQHVGFVDSAVDRIVPP
FT                   SEAGSTDILAVTVETFSEWIVDGTQFKGQPPEIVGMELTDNLMAFVERKLFTLNTGHAI
FT                   TAYLGQLAGHQTIRDAILDPAVRQTVKGAMEESGAVLIKRYAFDPQKHAAYINKILSRF
FT                   ENPYLHDDVERVGRQPLRKLSAGDRLIKPLLGTLEYQLPHDSLVTGIAAAMSYRSEQDP
FT                   QAQELVTLLAQLGPKAALAQISGLPADSEVVEQAVSVYNAMQQKLAH"
FT   gene            32986..33540
FT                   /locus_tag="YPK_0028"
FT   CDS_pept        32986..33540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0028"
FT                   /product="mannitol repressor, MtlR"
FT                   /note="PFAM: Mannitol repressor; KEGG: ypi:YpsIP31758_4126
FT                   mannitol operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66342"
FT                   /db_xref="InterPro:IPR007761"
FT                   /db_xref="InterPro:IPR038026"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZW5"
FT                   /protein_id="ACA66342.1"
FT                   /translation="MIEKKQAFENRVLEHLNAGKTVRSFLMAAVDLLAEALNILVVQIF
FT                   RKDDYAVKYAVEPLLVGDGPLSELSVRLKLVYALGVITRHEYEDAELLMALREELNHDG
FT                   TEYRFTDDEILGPFGELHCVDELPPVPTFLRPDEADASLIAMQRQRYQQMVRSTMVLSI
FT                   TELLSRISVKQVSKLSPLSQG"
FT   gene            33619..33741
FT                   /locus_tag="YPK_0029"
FT   CDS_pept        33619..33741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0029"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66343"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYL7"
FT                   /protein_id="ACA66343.1"
FT                   /translation="MRVGLATCEILPERRGNRGKSQWLSGMHLCLDTQSVLLYL"
FT   gene            33789..34145
FT                   /locus_tag="YPK_0030"
FT   CDS_pept        33789..34145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0030"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ypi:YpsIP31758_4125 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66344"
FT                   /db_xref="InterPro:IPR021230"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AWE1"
FT                   /protein_id="ACA66344.1"
FT                   /translation="MKEHAEIKRLSDMLDALNHKDPTVIQQGNVELITQHMKEKEKLAA
FT                   EIQRLKEVRVKNLSAEAQKLAQLPFSRAITKKEQADMGTLKKAVRGIVVVHPMTALGRE
FT                   MGLKEVTGYAKKAF"
FT   gene            complement(34308..34784)
FT                   /locus_tag="YPK_0031"
FT   CDS_pept        complement(34308..34784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0031"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ypi:YpsIP31758_4124 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66345"
FT                   /db_xref="InterPro:IPR019545"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AY60"
FT                   /protein_id="ACA66345.1"
FT                   /translation="MTNRMKALMLVTHLAVFGAGTGLGIYILPILTAETNATAPEIQAV
FT                   KQSAKYTGEFSRNQKGSDAVHWAEGKLYVSEHEIAFEGEIAPGPDYKIYLTKTQADDKE
FT                   SFLKIKDDAKLIGDLKNFGNFKKTLPAGVNPDDYTTVQIWCETFSQFIGSASYK"
FT   sig_peptide     complement(34728..34784)
FT                   /locus_tag="YPK_0031"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.866) with cleavage site probability 0.604 at
FT                   residue 19"
FT   gene            35145..35240
FT                   /locus_tag="YPK_0032"
FT   CDS_pept        35145..35240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0032"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66346"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZ67"
FT                   /protein_id="ACA66346.1"
FT                   /translation="MFQVFARKGYKAAAISDLAKVPTSHTLSRFG"
FT   gene            complement(35316..35600)
FT                   /locus_tag="YPK_0033"
FT   CDS_pept        complement(35316..35600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0033"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ypi:YpsIP31758_4123 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66347"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZW8"
FT                   /protein_id="ACA66347.1"
FT                   /translation="MKKIIFFIMPFFILLGYSHAAEKYPADITAYLNVADDCQYFSGEW
FT                   DSTLPKERQIEIEKKVNVTCSKARSLQEKLSVKYKKRQDLLDVINDYDF"
FT   sig_peptide     complement(35538..35600)
FT                   /locus_tag="YPK_0033"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 21"
FT   gene            complement(35838..37787)
FT                   /locus_tag="YPK_0034"
FT   CDS_pept        complement(35838..37787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0034"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: ypi:YpsIP31758_4122
FT                   methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66348"
FT                   /db_xref="GOA:A0A0H3AYM3"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR032255"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYM3"
FT                   /protein_id="ACA66348.1"
FT                   /translation="MAVFSKIIGSFDNVKVGKKLGLSFFLMLLLVGVIAGTTAYHFSVI
FT                   EEHAYKVELSYKINNEANQAKYNRALYERTYDLKYITENTQHINNIKNLLTQSANLRWS
FT                   VDNRKNIANINHVVEEYQQQQTNFVNAVTNKDKVRQSWSISESLNNINALQQSLLNEGA
FT                   DTNTQILLAEMSQKLMTVRYNARGLLLDRNKDAETALITSINIANSAANAFMPVLSAEQ
FT                   QKLLAPVAANLALYKDNVLAYLPAYQQELEVGKVMEASANALNTLATQLFTQELQGTHN
FT                   EINNAQYQLAIAAFVALLLGLLIAWRMTRQITVPLRATLDMAERIATGDLTAATTSSRT
FT                   DELGMLMNAVARMNENLRAMIDEIRIGVSQVSHASGEIAAGNTDLSSRTEQQAAAVEET
FT                   AASMEQLNATVKQNTDNAHHANQLATEASQTAQQGGKLVNDVVRTMNDISGSSKRISEI
FT                   TSVINSIAFQTNILALNAAVEAARAGEQGRGFAVVASEVRNLAQRSAQAAKEIEGLIGE
FT                   SVSQVNAGTSLVKNAGNTMEEIVRSVSHVRDIMAEIASASDEQSRGITQVSLAISEMDS
FT                   TTQQNAALVEESAAAADSLAEQAILLAQAVAVFRLSEDEGATDEGRVVTPKASNGRHTP
FT                   EDHRINQQKSWETF"
FT   sig_peptide     complement(37680..37787)
FT                   /locus_tag="YPK_0034"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.714) with cleavage site probability 0.651 at
FT                   residue 36"
FT   gene            complement(38131..38754)
FT                   /locus_tag="YPK_0035"
FT   CDS_pept        complement(38131..38754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0035"
FT                   /product="Superoxide dismutase"
FT                   /EC_number="1.15.1.1"
FT                   /note="PFAM: manganese and iron superoxide dismutase; KEGG:
FT                   ypi:YpsIP31758_4121 superoxide dismutase (Mn)"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66349"
FT                   /db_xref="GOA:A0A0H3AWE6"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AWE6"
FT                   /protein_id="ACA66349.1"
FT                   /translation="MSYSLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANTVLES
FT                   FPELADLSVEDLIKDLDKVPAEKRTFMRNNAGGHANHSLFWKGLKLGTTLAGDLKAAIE
FT                   RDFGSVDSFKEKFEQAAATRFGSGWAWLVLKDDGKLAVVSTANQDSPLMGEAVSGVSGF
FT                   PIVGLDVWEHAYYLKFQNRRPDYIKAFWNVVNWDEAAARFAQAK"
FT   gene            complement(39189..40013)
FT                   /locus_tag="YPK_0036"
FT   CDS_pept        complement(39189..40013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0036"
FT                   /product="formate dehydrogenase family accessory protein
FT                   FdhD"
FT                   /note="TIGRFAM: formate dehydrogenase family accessory
FT                   protein FdhD; PFAM: formate dehydrogenase subunit FdhD;
FT                   KEGG: yps:YPTB3926 putative formate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66350"
FT                   /db_xref="GOA:B1JH20"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JH20"
FT                   /protein_id="ACA66350.1"
FT                   /translation="MSQIKPSRLSSSAEIRGARQLDVLQRHKLAEPQQDWLAEEVPVAL
FT                   VYNGISHVVMMATPKDLAAFALGFSLSEGIISSPQDIYAIEITPGCNGIEVNIELSSRR
FT                   FAGLKERRRAMAGRTGCGVCGIEQLDDIFRPITPLPFTQAFNLEHLDTALAQLKQVQPV
FT                   GQLTGCTHAAAWINPEGELLGGCEDVGRHVALDKLLGIRAKQPWQQGAVLVSSRASYEM
FT                   VQKTAMCGAEILFAVSAATTLAVEVAERCNLTLVGFSKPGRATVYTHPQRIK"
FT   gene            40210..40797
FT                   /locus_tag="YPK_0037"
FT   CDS_pept        40210..40797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0037"
FT                   /product="molybdopterin oxidoreductase Fe4S4 region"
FT                   /note="PFAM: molybdopterin oxidoreductase Fe4S4 region;
FT                   KEGG: yps:YPTB3927 formate dehydrogenase-O, major subunit
FT                   (formate dehydrogenase)"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66351"
FT                   /db_xref="GOA:A0A0H3AY66"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AY66"
FT                   /protein_id="ACA66351.1"
FT                   /translation="MQVSRRQFFKICAGGMAGTTVAALGFAPSVALAETRNYKLLRARE
FT                   TRNTCTYCSVGCGLLMYSLGDGAKNAKESIFHIEGDPDHPVNRGALCPKGAGLVDFIHS
FT                   ESRLKYPEYRAPGSDKWQRITWDDAFTRIAKLMKEDRDANFIQTNDAGVTVNRWLSTGM
FT                   LCASASSNETGYLTQKFSRALGMLAVDNQARV"
FT   sig_peptide     40210..40311
FT                   /locus_tag="YPK_0037"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.967 at
FT                   residue 34"
FT   gene            40846..43257
FT                   /locus_tag="YPK_0038"
FT   CDS_pept        40846..43257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0038"
FT                   /product="formate dehydrogenase, alpha subunit"
FT                   /EC_number="1.2.1.2"
FT                   /note="KEGG: ypi:YpsIP31758_4119 aerobic formate
FT                   dehydrogenase, alpha subunit, proteobacterial-type;
FT                   TIGRFAM: formate dehydrogenase, alpha subunit; PFAM:
FT                   molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66352"
FT                   /db_xref="GOA:A0A0H3AZ76"
FT                   /db_xref="InterPro:IPR006443"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZ76"
FT                   /protein_id="ACA66352.1"
FT                   /translation="MTNHWVDIKNADLIIVMGGNAAEAHPVGFRWAMEAKIHNNAKLLV
FT                   IDPRFTRTASVADFYTPIRSGTDIAFLSGVLLYLISNNKINREYVEAYTNASLLVREDY
FT                   AFDDGLFSGYDAENRKYDKTSWNYQLDEDGFAKRDVTLQHPRCVWNLLKEHVSRYTPEV
FT                   VSNICGTPKDDFLQVCEYLAETSVSNKTATFLYALGWTQHSVGAQNIRTMAMIQLLLGN
FT                   MGMAGGGINALRGHSNIQGLTDLGLLSQSLPGYLNLPSEKQPDIDTYLKANTPKTLLPG
FT                   QVNYWSNYPKFFVSLMKSFYGDNAQKENGWGYDWLPKWDKGYDVLQYFEMMSQGKVNGY
FT                   LCQGFNPIASFPDKNKVTAALSKLKFLVTIDPLNTETANFWQNHGEFNDVDPSKIQTEV
FT                   FRLPSSCFAEENGSIVNSSRWLQWHWKGADSPGEALNDGAILAGIFMRMREMYQREGGA
FT                   VPEQVLNMTWDYLTPENPEPEEVAMESNGRALADLTDADGKVLVKKGEQLSTFAQLRDD
FT                   GTTSSGCWIFAGSWTPAGNQMARRDNADPSGLGNTLGWAWAWPLNRRILYNRASADPQG
FT                   KPWDPKRQLLEWDGAKWAGIDVADYSAAAPGSDVGPFIMQPEGMGRLFAIDKMAEGPFP
FT                   EHYEPFETPLGTNPLHPNVISNPAARVFKDDLAAMGSHEQFPYVGTTYRLTEHFHYWTK
FT                   HALLNAIAQPEQFVEIGEKLAAKKGIKQGDTVKVSSNRGFIKAKAVVTKRIRTLNVHGQ
FT                   EVDTIGIPIHWGYEGVAKKGFLANTLTPYVGDANTQTPEFKAFLVNVEKV"
FT   gene            43270..44241
FT                   /locus_tag="YPK_0039"
FT   CDS_pept        43270..44241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0039"
FT                   /product="formate dehydrogenase, beta subunit"
FT                   /note="TIGRFAM: formate dehydrogenase, beta subunit; PFAM:
FT                   4Fe-4S ferredoxin iron-sulfur binding domain protein;
FT                   Formate dehydrogenase transmembrane domain protein; KEGG:
FT                   ypi:YpsIP31758_4118 putative aerobic formate dehydrogenase,
FT                   iron-sulfur subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66353"
FT                   /db_xref="GOA:A0A0H3AZX2"
FT                   /db_xref="InterPro:IPR006470"
FT                   /db_xref="InterPro:IPR014603"
FT                   /db_xref="InterPro:IPR015246"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR038384"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZX2"
FT                   /protein_id="ACA66353.1"
FT                   /translation="MSLQTQDIIRRSGTNSLTPPPQVRDHQEPVAKLIDVTTCIGCKAC
FT                   QVACSEWNDIRDEVGHNVGVYDNPADLTAKSWTVMRFSEVEDEESGKLEWLIRKDGCMH
FT                   CADPGCLKACPSEGAIIQYANGIVDFQSEHCIGCGYCIAGCPFDVPRMNKDDNRVYKCT
FT                   LCVDRVGVGQEPACVKTCPTGAIHFGTKESMKEVAAGRVAELKTRGFDNAGLYDPAGVG
FT                   GTHVMYVLHHADKPQLYHGLPENPTISPTVTFWKGIWKPLAAVGFAATFAASIFHYVGV
FT                   GPNRVEEEEEDDETTDPTPSETVAKAPEQTTSERSDEGETRK"
FT   gene            44238..44912
FT                   /locus_tag="YPK_0040"
FT   CDS_pept        44238..44912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0040"
FT                   /product="formate dehydrogenase, gamma subunit"
FT                   /note="TIGRFAM: formate dehydrogenase, gamma subunit; PFAM:
FT                   cytochrome B561; KEGG: ypp:YPDSF_0037 formate
FT                   dehydrogenase, cytochrome b556 protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66354"
FT                   /db_xref="GOA:A0A0H3AYN1"
FT                   /db_xref="InterPro:IPR006471"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYN1"
FT                   /protein_id="ACA66354.1"
FT                   /translation="MKKEKPIQRYSAPERINHWIVAFCFILAAISGLGFFFPSFNWLMN
FT                   IFGTPQMARILHPFAGVVMFAAFLIMFFRYWKHNLINKDDLEWAKNIHKIAMNEEVGDT
FT                   GRYNFGQKCVFWAAIISLVLLLVSGVVIWRPYFASSFPIPLIRLALLVHSLAAVGLIIV
FT                   IMVHVYAALWVKGTITAMVEGWVPAAWAKKHHPRWYREVRSKDDARANAKGQPQEKQKE
FT                   KP"
FT   gene            44912..45841
FT                   /locus_tag="YPK_0041"
FT   CDS_pept        44912..45841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0041"
FT                   /product="formate dehydrogenase accessory protein FdhE"
FT                   /note="TIGRFAM: formate dehydrogenase accessory protein
FT                   FdhE; PFAM: formate dehydrogenase accessory protein; KEGG:
FT                   ypi:YpsIP31758_4116 formate dehydrogenase accessory protein
FT                   FdhE"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66355"
FT                   /db_xref="GOA:B1JH25"
FT                   /db_xref="InterPro:IPR006452"
FT                   /db_xref="InterPro:IPR024064"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JH25"
FT                   /protein_id="ACA66355.1"
FT                   /translation="MSIRIVPKDQLGKQREKGTTAGNIPPLLFANLKSLYTRRTERLQQ
FT                   LALDNPLADYLDFAAKITEAQQKALHDHPLVLDMQAELVQSAASGKPPLDGSVFPRTEH
FT                   WRKLLSALIAELRHDAPDHILAVLDNLDKASVHELELYADALLNRDFSQVGSEKAPFIW
FT                   AALSLYWAQMASQIPGKARAEYGEHRQFCPVCGSIPVSSVVHIGTHNGLRYLHCNLCES
FT                   EWHVVRIKCSNCEQTRDLNYWSLDSELAAVKAESCGDCGTYLKILYQEKDPQVEAVADD
FT                   LASLILDAKMEGEGFARSSINPFLFPGE"
FT   gene            46025..47413
FT                   /locus_tag="YPK_0042"
FT   CDS_pept        46025..47413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0042"
FT                   /product="L-seryl-tRNA(Sec) selenium transferase"
FT                   /EC_number="2.9.1.1"
FT                   /note="PFAM: L-seryl-tRNA selenium transferase; KEGG:
FT                   ypp:YPDSF_0039 L-seryl-tRNA selenium transferase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66356"
FT                   /db_xref="GOA:B1JH26"
FT                   /db_xref="InterPro:IPR004534"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR018319"
FT                   /db_xref="InterPro:IPR025862"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JH26"
FT                   /protein_id="ACA66356.1"
FT                   /translation="MSAEPHPLYRQLPAIDRLLNEPEMAPLLAEYGPVLLADTLRQLQA
FT                   EAREYIGQFHTLADWCADWPAALRQRLNQRQPALKPVFNLTGTVLHTNLGRAPLAESAI
FT                   AAVTDAMRSAVTLEYSLEGAGRGHRDRAVADLLCALTGAEDACIVNNNAAAVFLLLTVM
FT                   AAGKQVVVSRGELVEIGGAFRIPDVMRQAGCELVEVGTTNRTHLKDYRQAINENTGLLM
FT                   KVHTSNYSIEGFTAAVSEQQLAALGQECSIPTATDLGSGSLVDMTRYGLPAEPMPQQLI
FT                   AAGVDLVTFSGDKLLGGPQAGIILGKKQWIERLQQHPLKRALRADKMTLAALDATLRLY
FT                   QQPDRLVEQLPSLRLLTRPASEIAACAQRLLAPLIACYGTDFTLDIESCWSQIGSGSLP
FT                   VDRLPSWALTFTPKDGRGSTLEALTARWRTLTKPVIGRVADGRLWLDLRCLEDEAALLR
FT                   ELAS"
FT   gene            47410..49383
FT                   /locus_tag="YPK_0043"
FT   CDS_pept        47410..49383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0043"
FT                   /product="selenocysteine-specific translation elongation
FT                   factor"
FT                   /note="TIGRFAM: selenocysteine-specific translation
FT                   elongation factor; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain 2 protein;
FT                   Elongation factor SelB winged helix 2; Elongation factor
FT                   SelB winged helix 3; KEGG: yps:YPTB3932
FT                   selenocysteine-specific elongation factor EF"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66357"
FT                   /db_xref="GOA:A0A0H3AWF1"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004535"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR015190"
FT                   /db_xref="InterPro:IPR015191"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AWF1"
FT                   /protein_id="ACA66357.1"
FT                   /translation="MIIVTAGHVDHGKTTLLQAITGVNADRLPEEKQRGMTIDLGYAYW
FT                   PLPDGRIMGFIDVPGHEKFLANMLAGVGGIDHALLVVACDDGVMAQTREHLAILRLSGR
FT                   PALTVALTKADRVDDERIAQVHQQILQELVAQGWSAEQISLFVTAAVTERGIGELREHL
FT                   AQCHQQRDPKGRLQRRFRLAIDRVFSVKGAGLVVTGTALAGQVAVGDTLWLTGGDCPVR
FT                   VRGIHAQNQPAQQAQAGQRIALNISGDISKQQINRGDWLLAQPPLPPVDRVLVTVDADT
FT                   PLQHWQPLHLYHGARHITGRFSLLGHQQLIDDQQPLIDDQQPLIGHQQIINNQSTSGGH
FT                   SSQILAELLLDSPLWLVENDRVILRDIGAKKTLGGARVIHLAVPSRGKRQPAYLAWLTA
FT                   LAQATSDREVLDLHLAQGPVSVRTFSWARQLTDNEMAALLAATDTVVAGDIALSHSHAQ
FT                   QAQQTLLHVLALYHQQHGDQLGLGRARLRRMALPTLDEGVVFRLIDNLLAEGALHNTRG
FT                   WLHLPEHGLAFTEQEQIGWQQAAPYFVDDPWWVRDLAAELQAAEGEMRSLLRKAAQLGY
FT                   ITAVVTDRYYLSQRIEQLADLVRELDSRQGSVSAADFRDRLGIGRKLAIQILEFFDRSG
FT                   FTRRRGNGHILRDSGLFSATGS"
FT   gene            50142..50474
FT                   /locus_tag="YPK_0044"
FT   CDS_pept        50142..50474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0044"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: yps:YPTB3934 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66358"
FT                   /db_xref="GOA:A0A0H3AY70"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AY70"
FT                   /protein_id="ACA66358.1"
FT                   /translation="MTELEMEKKLLNNGFTAKNIAHMRKIISRDDQQKETYSSLLIDLK
FT                   KRFFAGCLICAILFTPLIFMMFNDYTSDEIFSYLVALIFGLYMTYYITPLNLAWKSYRY
FT                   LSNKEE"
FT   gene            complement(50488..51036)
FT                   /locus_tag="YPK_0045"
FT   CDS_pept        complement(50488..51036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0045"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: yps:YPTB3935 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66359"
FT                   /db_xref="GOA:A0A0H3AZ80"
FT                   /db_xref="InterPro:IPR025320"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZ80"
FT                   /protein_id="ACA66359.1"
FT                   /translation="MLSLKQAKVYISAKIEEHDKVIGYVIDGIAVIIGGLQMVAGSGIL
FT                   LGSIASGNIVGIIVGAHLILNGASSLSEGVQRLRGNKNATDFMQDAYMGTAEFFGFERK
FT                   TGMLAYYAADLTTSFYGVIKLSLKPDAWRLYKYIPSDYYRKINSMSKLALTIQGVKATN
FT                   KIRVIGSTYLDDNSEYERK"
FT   gene            complement(51024..51209)
FT                   /locus_tag="YPK_0046"
FT   CDS_pept        complement(51024..51209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0046"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ypp:YPDSF_0045 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66360"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZX8"
FT                   /protein_id="ACA66360.1"
FT                   /translation="MDIGLSLQERNNKYFYAMAKIEADKLINLSRRVSFNNIKDVFLRV
FT                   KFENDITFPSKTVCFH"
FT   gene            51330..51533
FT                   /locus_tag="YPK_0047"
FT   CDS_pept        51330..51533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0047"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ypk:y4068 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66361"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYN4"
FT                   /protein_id="ACA66361.1"
FT                   /translation="MFLDTFSFLRVEPRQMGNGRVGRRANQPVLVNQPFCHLAGQARDR
FT                   NSLFDNRPALFLTGNFNEYIDA"
FT   gene            complement(51682..52911)
FT                   /locus_tag="YPK_0048"
FT   CDS_pept        complement(51682..52911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0048"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   yps:YPTB3936 multidrug translocase, MFS family"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66362"
FT                   /db_xref="GOA:A0A0H3AWF8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AWF8"
FT                   /protein_id="ACA66362.1"
FT                   /translation="MQTSFSPATRLGRRALLFPLCLVLFEFAAYIANDMIQPGMLAVVA
FT                   EFNASVEWVPTSMTAYLAGGMFLQWLLGPLSDRRGRRPVMLAGVAFFVVTCLAILLVNS
FT                   IEQFIAMRFLQGIGLCFIGAVGYATIQESFEEAVCIKITALMANVALIAPLLGPLAGAA
FT                   LIHVAPWQTMFVLFAVLGAISFAGLWRAMPETASLKGEKLSVANMWHDYKQVLANRRFL
FT                   CGSLALGFASLPLLAWIAQSPVILISGEQLSTFEYGILQVPIFGALIIGNLTLARLSGK
FT                   TSIPQLIRYGAGPMIVGLMIAAGSTLYSSHAYLWMTAGLSLYAFGIGLANAGLVRLTLF
FT                   ASDISKGTVSAAMGMISMMIFTLGIELAKVAYLWGDSRGFNLFNLMSGLLWLGLVMVFI
FT                   RRQPEAVATE"
FT   gene            53310..53477
FT                   /locus_tag="YPK_0049"
FT   CDS_pept        53310..53477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0049"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66363"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYY8"
FT                   /protein_id="ACA66363.1"
FT                   /translation="MPSEGRLSRKRIGPVRQRNDESREPTQWASDSAKARGSKGATLMA
FT                   PLAVGSSEAR"
FT   gene            53772..54764
FT                   /locus_tag="YPK_0050"
FT   CDS_pept        53772..54764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0050"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: ypp:YPDSF_3787
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66364"
FT                   /db_xref="GOA:A0A0H3AZ82"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="InterPro:IPR032905"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZ82"
FT                   /protein_id="ACA66364.1"
FT                   /translation="MTNKIDWIDNLRAVACIMVVMIHSTTYYVTRGAQVGELNWDIANV
FT                   LNSASRACVPLFFMISGYLFFGEKSAQKKHFMRIGLCLLFYSVIALIYISTLTPIDGWA
FT                   SLRNILQKPVFYHLWFFYAIIVVYLVSPLIKVKPVSGRYLAILILLLAVVANPQTSKFS
FT                   LDDFRLLPANLYIYGDTFYYLLYALLGRAMGMLETQGRMISWGAALLFVVSVICIAIST
FT                   EKQTRINGSFADTFYMYCSPLVFIAAVSLWVWFKNCLNQHIAWLSGLARHSLAIYGFHA
FT                   LIIHFIRTHHYDFTAYPVLDILYVFALTLGLSTLLSMGLQRIDRRRWVS"
FT   gene            55655..56212
FT                   /locus_tag="YPK_0051"
FT   CDS_pept        55655..56212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0051"
FT                   /product="Fimbrial protein"
FT                   /note="PFAM: Fimbrial protein; KEGG: yps:YPTB3896 fimbrial
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66365"
FT                   /db_xref="GOA:A0A0H3AZY0"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZY0"
FT                   /protein_id="ACA66365.1"
FT                   /translation="MSNVKKSTFIIALATLSVIYQALAADAGNGRIKFTGTVINAPCSI
FT                   ALDSTDINVDLGQVANRVLETGNKYSQSVRYNINLQDCSLTAQGSGGATYPALSKVNVT
FT                   FSGIADAAAPALLANTGSAKGVGVRLIGTDDALLKVGDTSPDINLTSGPNQIVFAARIE
FT                   ATSAPVTTGTVVSQATYALNYK"
FT   sig_peptide     55655..55729
FT                   /locus_tag="YPK_0051"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.899 at
FT                   residue 25"
FT   gene            56288..58786
FT                   /locus_tag="YPK_0052"
FT   CDS_pept        56288..58786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0052"
FT                   /product="fimbrial biogenesis outer membrane usher protein"
FT                   /note="PFAM: fimbrial biogenesis outer membrane usher
FT                   protein; KEGG: yps:YPTB3895 outer membrane fimbrial usher
FT                   porin"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66366"
FT                   /db_xref="GOA:A0A0H3AYN9"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR018030"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYN9"
FT                   /protein_id="ACA66366.1"
FT                   /translation="MPYNSKRKKTIFLMVKVLTIILVWLFLPESTAVVKFNTNIIDAKD
FT                   RSNIDLSRFEVDDYTPPGNYLLDILIDDRLLPERYLVTYLAVDEGKSTKLCLTPDLVNL
FT                   FGLSTEVRESMTLWNNDKCVAIDEKKEIKIQYDKEKQYLIISIPQAWLAYNDPNWVPPS
FT                   QWGNGVAGTLLDYNLFGYHYSPNMGGSTTNFSSYGTTGANMGPWRIRADYQYINTETAG
FT                   EHYRNFDWSQVYAFRAIPSIGAKFVGGQTYLNSSIFDSFRFLGTSLSSDERMLPPTLRG
FT                   YAPQVMGIAHTNARVVLSQNGRVLYQTNVAPGPFVIQDISEAVQGNIDVRVEEEDGRVT
FT                   VFQVNAASVPFLTRKGAVRYKAALGRPMLGGNNSASNPTFFSGEFSWGAFNHVSLYGGL
FT                   MTTSQDYTSAALGIGQNLYDFGALSIDITHSRAQLPNEEQQNGESYRVNYSKRFEQTDS
FT                   QISFAGYRFSKKNFMSMSQYLDWLNGNTALQYDKQAYTVAANQYLAWPDITMYLSVTRR
FT                   TYWNAASSNNYSLSMSKIFDIGTFKGISATISANKVNNQYANENQMFFSLSVPIGIGQQ
FT                   ASYDAQRGRNTGYTQNISYFNNQNPKNIWRISAGGGNPELQKGNGVFRGGYQHSSPYGE
FT                   FGLDGSHKNNEYNSINTNWYGSITATAYGVAAHQNKAGNEPRIMVDTGDVAGVSLNNNS
FT                   AVTNRFGVAVVSGATSYQQSDIRVDVQNLPDDIEVYNTVIQKTLTEGAIGYREIRAVKG
FT                   RQMMAIIRLKDGSSPPLGASVITDKTGAEVGIVGDDGLTYLAGLQDTERLTVQWGKKQC
FT                   TLILPKDKGMNSGKVLLPCQ"
FT   sig_peptide     56288..56386
FT                   /locus_tag="YPK_0052"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.741) with cleavage site probability 0.444 at
FT                   residue 33"
FT   gene            58879..59646
FT                   /locus_tag="YPK_0053"
FT   CDS_pept        58879..59646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0053"
FT                   /product="pili assembly chaperone"
FT                   /note="PFAM: pili assembly chaperone; KEGG: yps:YPTB3894
FT                   putative fimbrial chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66367"
FT                   /db_xref="GOA:A0A0H3AWG4"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AWG4"
FT                   /protein_id="ACA66367.1"
FT                   /translation="MKDINSMIWRQQRLWAKTALFGIALWLTALTSQAAINLDRTRIIF
FT                   NSTDKSASVILQNQSPSSPYLAQSWLENTKGQKIESPLVALPPMQRIDAGQKSQVRIMK
FT                   LPDADKLPTDRETLFYFNVREIPPQSEMNNVVQIAIQNRIKLFYRPMAIKANYSDIWQE
FT                   KLQISKQVGGLKINNPTPYYITLAYLSQNEKGNFPGFDSVMIAPFGTEFVKTPGYSGSR
FT                   YNVGYMDDFGGIVIRTFNCLSAECQIQPAEKRR"
FT   sig_peptide     58879..58983
FT                   /locus_tag="YPK_0053"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 35"
FT   gene            59685..60671
FT                   /locus_tag="YPK_0054"
FT   CDS_pept        59685..60671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0054"
FT                   /product="Fimbrial protein"
FT                   /note="PFAM: Fimbrial protein; KEGG: ypp:YPDSF_3782
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66368"
FT                   /db_xref="GOA:A0A0H3AY78"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AY78"
FT                   /protein_id="ACA66368.1"
FT                   /translation="MMQTILNKIGRIGGCIALSFVAMLLSQAAYALDCVEKGTNVVNKP
FT                   GIPIGQLAIPSNIAPGTKIWESRDITVTAYCDNVLGSVYDQVWFYFNPLGQSLGPGLQL
FT                   GVNYLGQDLQANAARLNTNTSPITSGQNVTVTVTFRLYIKVTNDLPSSGNYIGTDSFTV
FT                   FQLDGSGGINVTVGAKNLKYTLSGLSIVRFIPCGADLVISPASQVVNFGSFNQARLLSS
FT                   NNNLSRPFSITAIKQGCLANFSIQAQFLTANPLVGDNAIDLQNGIKLTIYDDKNQAIVY
FT                   NRYADFAQLNNITQVTRNYTARLNAIEGQPIKLGQFDATAIIKINYY"
FT   sig_peptide     59685..59780
FT                   /locus_tag="YPK_0054"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.867 at
FT                   residue 32"
FT   gene            complement(60770..62224)
FT                   /locus_tag="YPK_0055"
FT   CDS_pept        complement(60770..62224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0055"
FT                   /product="xylulokinase"
FT                   /note="TIGRFAM: xylulokinase; PFAM: carbohydrate kinase
FT                   FGGY; KEGG: ypp:YPDSF_3781 xylulose kinase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66369"
FT                   /db_xref="GOA:A0A0H3AZ89"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006000"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZ89"
FT                   /protein_id="ACA66369.1"
FT                   /translation="MYVGIDLGTSGVKAILLAENGRVIASQNAALVVSRPHPLWSEQNP
FT                   ADWWQATDQVMQALAAEHDMQQVKALGLTGQMHGATLLDKQHQVLRPAILWNDGRSFSQ
FT                   CQTLEQAVPASRQITGNLMMPGFTAPKLQWLAEHEPDMFQCIDKVLLPKDYLRFLMSGD
FT                   FATDMSDAAGTMWLNIAQRDWSDEMLAACGLGRQHMPTLFEGNQITGHVSADIAKRWGI
FT                   NRIPIVAGGGDNAAGAVGVGLYQAGQAMLSLGTSGVYFAVSEGFLSNPASAVHSFCHAL
FT                   PNTWHLMSVMLSAASCLDWACQLTGAESVPALIAEVEKTPMAATPVWFLPYLSGERTPH
FT                   NNPKAKGAFWGFTHEHRRPDLARAVLEGVGFALADGMDALHASGLQPKSVTLIGGGARS
FT                   AYWRQMLADISGQTLEYRTGGDVGPALGAARLAQIAMNPDVSLADLLPALVLEQTHLPD
FT                   PQKHHYYTDRRVTFKKLYQQLLPLCE"
FT   gene            complement(62348..63667)
FT                   /locus_tag="YPK_0056"
FT   CDS_pept        complement(62348..63667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0056"
FT                   /product="xylose isomerase"
FT                   /EC_number="5.3.1.5"
FT                   /note="KEGG: ypi:YpsIP31758_4102 xylose isomerase; TIGRFAM:
FT                   xylose isomerase; PFAM: Xylose isomerase domain protein TIM
FT                   barrel"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66370"
FT                   /db_xref="GOA:B1JH40"
FT                   /db_xref="InterPro:IPR001998"
FT                   /db_xref="InterPro:IPR013452"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JH40"
FT                   /protein_id="ACA66370.1"
FT                   /translation="MQSYFNELEQVRYEGSQSTNPLAFHHYNPDEMILGKRMADHLRFA
FT                   ACYWHTFCWGGADMFGANAFDRPWQQPGDALALAKRKAEVAFEFFHKLNVPYYCFHDVD
FT                   VSPEGASLQEYLNNFAVMTDVLAEKQAASGVKLLWGTANCFTHPRYGAGAATNPDPEVF
FT                   SWAATQVFTAMNATRQLGGENYVLWGGREGYETLLNTDLRQEREQIGRFMQMVVEHKHK
FT                   TGFQGTLLIEPKPQEPTKHQYDYDVATVYGFLKQFGLEKEIKVNIEANHATLAGHSFHH
FT                   EIASAIALGIFGSVDANRGDPQLGWDTDQFPNSVEENTLVMFEILKAGGFTTGGLNFDA
FT                   KVRRQSTDKYDLFYGHIGAMDTMALALKFAAKMIEDGQLDQIVAKRYAGWNSELGQQIL
FT                   QGKMSLEELSRYASQHNLNPQHQSGHQELLENKVNRYLFG"
FT   gene            64130..65125
FT                   /locus_tag="YPK_0057"
FT   CDS_pept        64130..65125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0057"
FT                   /product="D-xylose ABC transporter, periplasmic
FT                   substrate-binding protein"
FT                   /EC_number="3.6.3.17"
FT                   /note="KEGG: ypi:YpsIP31758_4101 D-xylose-binding
FT                   periplasmic protein; TIGRFAM: D-xylose ABC transporter,
FT                   periplasmic substrate-binding protein; PFAM: periplasmic
FT                   binding protein/LacI transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66371"
FT                   /db_xref="GOA:A0A0H3AZY3"
FT                   /db_xref="InterPro:IPR013456"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZY3"
FT                   /protein_id="ACA66371.1"
FT                   /translation="MKFKNILLSACAALVMFSQPGFSKEIKIGMAIDDLRLERWQKDRD
FT                   IFVNKAESLGAKVFVQSANGNEETQMAQIENMINRGVDVLVIIPYNGQVLSNVIAEAKR
FT                   EGIKVLAYDRMINNADIDFYISFDNEKVGELQAKNLVERVPQGNYFLMGGSPVDNNAKL
FT                   FRQGQMTVLNPLIKDGKIKIVGDQWVDAWLPENALKIMENALTANNNNIDAVVASNDAT
FT                   AGGAIQALAAQGLAGKVAISGQDADLAAIKRIVAGTQTMTVYKPISKLANDAAEIAVTL
FT                   GNGEQPKANSTLNNGMKDVPAYLLTPIQVDKNNIDSTIIADGFHKKADIY"
FT   sig_peptide     64130..64201
FT                   /locus_tag="YPK_0057"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            65333..66865
FT                   /locus_tag="YPK_0058"
FT   CDS_pept        65333..66865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0058"
FT                   /product="D-xylose ABC transporter, ATPase subunit"
FT                   /note="KEGG: ypi:YpsIP31758_4100 D-xylose transport
FT                   ATP-binding protein XylG; TIGRFAM: D-xylose ABC
FT                   transporter, ATPase subunit; PFAM: ABC transporter related;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66372"
FT                   /db_xref="GOA:A0A0H3AYP4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013455"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYP4"
FT                   /protein_id="ACA66372.1"
FT                   /translation="MPYLLEMKDITKQFGVVKAVDNISLTLEAGQVLSLCGENGSGKST
FT                   LMKVLCGIYPAGSYQGEIIFSGETLQAKNIRETEQKGIAIIHQELALVKQMSVLENMFL
FT                   GSEWGRFGIMDYDAMYLRCQRMLAQVKLVVDPHTPVSELGLGQQQLVEIAKALNKQVRL
FT                   LVLDEPTASLTESETAILLDIIRDLRNHGIACIYISHKLNEVKEISDHICVIRDGRHIG
FT                   TRPASTMSEDDIIAMMVGRELKELYPHEAHHIGEEILRVENLCAWHPVNRHIRRVDDVS
FT                   FSLKRGEILGIAGLVGSGRTETVQCLFGVYPGRWQGDIFIKGQAATIRTCQQAMKLGIA
FT                   MVPEDRKKDGIVPVMGVGANITLAALDDFTGAFSLLDDAKEQSIIVQSLARLKVKTSSS
FT                   ELAIARLSGGNQQKAILAKCLLLNPQILILDEPTRGIDIGAKYEIYKLINQLVQQGIAV
FT                   IVISSELPEVLGLSDRVLVMHQGRIKADLINHNLTQEKVMEAALRSETHVTS"
FT   gene            66852..68036
FT                   /locus_tag="YPK_0059"
FT   CDS_pept        66852..68036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0059"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   ypi:YpsIP31758_4099 putative xylose transport system
FT                   permease protein XylH"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66373"
FT                   /db_xref="GOA:A0A0H3AWH3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AWH3"
FT                   /protein_id="ACA66373.1"
FT                   /translation="MSQANQSEFNSPENGDKKPFFRLKSLNLQVFVMLAAIAIIMLFFT
FT                   FTTEGAYLSARNISNLLRQTAITGILAVGMVFVIISAEIDLSVGSMMGLLGGIAAIFDV
FT                   WLGWPLPLTIVVTLALGLVLGAWNGWWVAYRKVPSFIVTLAGMLAFRGILIGITNGTTV
FT                   SPTSNAMSQIGQSYLPSGIGFGIGAIGLMLFVAWQWRRRNHRIRLGLPVAAPQGDVTRQ
FT                   TITAVIVLGAIYLLNDYRGVPTPVLILTALMLAGVFMATRTAFGRRTYAIGGNIDAARL
FT                   SGINVERTKLAVFAINGLMVAMAGLILSSRLGAGSPSAGNIAELDAIAACVIGGTSLAG
FT                   GVGSVAGAVMGAFIMASLDNGMSMLDVPTFWQYIVKGAILLLAVWMDSATKRRV"
FT   gene            68126..69319
FT                   /locus_tag="YPK_0060"
FT   CDS_pept        68126..69319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0060"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: ypi:YpsIP31758_4098 xylose operon
FT                   regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66374"
FT                   /db_xref="GOA:A0A0H3AY83"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AY83"
FT                   /protein_id="ACA66374.1"
FT                   /translation="MFEKRYRITLLFNANKVYDRQVVEGVGEYLQASQCNWDIFIEEDF
FT                   RCRIDNIKDWLGDGVIADFDDRQIEQLLANVNVPIVGVGGSYHQSEDYPSVDYIATDNK
FT                   ALVNAAFMHLKEKGLNRFAFYGLPASCGMRWAQEREYAFRQLVSAEQYQGVVYQGMATA
FT                   PDNWQYAQNRLADWVQTLPHQTGIIAVTDARARHLLQVCEHLDIAVPEKLSVIGIDNEE
FT                   LTRYLSRVALSSVVQGTRQMGYRAAKLLHQRLKLRQKQQTDPPLQRILVPPVKVMARRS
FT                   TDFRSLRDPAVIQAMHYIRHHACKGIKVEQVLDAVGMSRSNLEKRFKDEVGQTIHGVIH
FT                   EEKLDRARNLLAATSLPINEISQMCGYPSLQYFYSVFKKGYSITPKEHRDKYGEVSY"
FT   gene            69449..69539
FT                   /locus_tag="YPK_R0001"
FT                   /note="tRNA-SeC(p)1"
FT   tRNA            69449..69539
FT                   /locus_tag="YPK_R0001"
FT                   /product="tRNA-Sec"
FT   gene            69706..70896
FT                   /locus_tag="YPK_0061"
FT   CDS_pept        69706..70896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0061"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: plu:plu0125
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66375"
FT                   /db_xref="GOA:A0A0H3AZ92"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZ92"
FT                   /protein_id="ACA66375.1"
FT                   /translation="MKLTVRQIDTAKPKEKPYKLSDGGGLYLEVTTNGSRYWRLKYRYA
FT                   GKEKRLAFGVYPEVSLAQAREKREAAKKLLSAGSDPGELKKAEKIAQKLNYENTFEAIA
FT                   REWHQLRADRWSLRYRDEIIDTFEKDIFPYIGKRPIAEIKPLELLETLRKMEKRGALEK
FT                   MRKVRQRCGEVYRYAIITGRAEYNPAPDLATALTPPKKQHFPFLTAEELPYFLKNLAGY
FT                   TGSVITKTATKIILLTAVRTQELRFTRWQDIDLEKGIWEIPAEVMKMKRPHVVPLSKQV
FT                   IELFNSLKPLSGHYELVFIGRNDHRKPISKESVNQVIELLGYKGRLTGHGFRHTMSTIL
FT                   HEKGYNSAWIETQLAHIDKNAIRGTYNHAQYMDGRREMMQWYADYLDALERVKRSS"
FT   gene            71077..72345
FT                   /locus_tag="YPK_0062"
FT   CDS_pept        71077..72345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0062"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pfo:Pfl_4624 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66376"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZY8"
FT                   /protein_id="ACA66376.1"
FT                   /translation="MNQLSLHNTNVLKYLELDEDAIDFYVLKDMVDLDSIDSELRECLS
FT                   IKEMRESGIFFTGSKLAIFAVSSFRVPITFDSVILDPTCGAGNLLIACSRQLGVEPTLS
FT                   QTLAKWKKVLRGYDIHQSLVDMTKLRIIVEILYRGVYKDCSIHDALLLLDNITCRNALT
FT                   LSENELSKVTHVIFNPPFFNSPSPRKNYWKTGDVNIAGVIFDFYLRLLPPKCQISAILP
FT                   DVLRSGSRYTDFREFVSRSLQAKCEIWGRFNLKTDVDVFVLSGTIVNNSKQDIKWYKEI
FT                   DKYSKLSDRYDVRVGPLVPYRDPEEGCEYPYFHPKNCPTWGVIKINTEMRRFKGTVLKA
FT                   PFVLVKRTSSPSDKFRAAATLVNINGFIAVENHMIVITPKSGKFEECKKLMKILKSQST
FT                   NDFLNDRARMRHLTVGVIKDIPI"
FT   gene            complement(72381..73151)
FT                   /locus_tag="YPK_0063"
FT   CDS_pept        complement(72381..73151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0063"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pcr:Pcryo_2512 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66377"
FT                   /db_xref="InterPro:IPR041519"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYP9"
FT                   /protein_id="ACA66377.1"
FT                   /translation="MAKLTVESFVELINEDLLWRKKEISDLLFLHNNENSLLILKSAIL
FT                   LMYSHWEGYVKNIAKQYIILISDLDLELNKLGFNFEAIDIKGDIRECFKSSDSLNLINE
FT                   INFLKKIYDNNRKVFKISSQFKNEKDKSIINTKDNLNIQVFQSFLKIIGLYEFKSLQTR
FT                   IAYIDEKLLNNRNIISHGSKIHPSSNNFLIDILEVKKMRDFIILIMEYLRDELIYFSEE
FT                   KLFLHSNSNKIISRSDDINLKLEKAIKEIYPHSV"
FT   gene            complement(73144..74259)
FT                   /locus_tag="YPK_0064"
FT   CDS_pept        complement(73144..74259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0064"
FT                   /product="protein of unknown function DUF262"
FT                   /note="PFAM: protein of unknown function DUF262; KEGG:
FT                   pcr:Pcryo_2494 protein of unknown function DUF262"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66378"
FT                   /db_xref="InterPro:IPR004919"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AWH9"
FT                   /protein_id="ACA66378.1"
FT                   /translation="MSEQLTENQKKIKDELEIARQNIKTDGYSMSIGELINLYRDNDLK
FT                   LDPAFQRLFRWDDEQKTKLIESILIGIPIPEVFVAQKSDGTWHVVDGVQRLSTILQLTG
FT                   NLPSKEMLTMTLCKYIPSLNGKTWNDLPIETQREFKRTKLKINIILTQNSDEAQYELFQ
FT                   RLNTGGTSLSDQEVRNCLILMLNPDFFKSINDLKDYPNFKDCLKIEKHQFEKEYHMELI
FT                   LRMFIGYFNKVDYESFGPLSYIKLNEFIDKETINLIRNADIQDFSDKFKKTFDLLKNSL
FT                   GDKSFQKYYPEKNEFSGAFNVSVFEMLTVGISSNIDDVANLGKTQLEKLIRELYNNEEI
FT                   QQALARGVKAISRFRDTTRIARGYFKGEFCG"
FT   gene            complement(74300..75067)
FT                   /locus_tag="YPK_0065"
FT   CDS_pept        complement(74300..75067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0065"
FT                   /product="N4/N6-methyltransferase family protein"
FT                   /note="KEGG: ecw:EcE24377A_0286 N4/N6-methyltransferase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66379"
FT                   /db_xref="GOA:A0A0H3AY87"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AY87"
FT                   /protein_id="ACA66379.1"
FT                   /translation="MTNAEQLFINYPDNKFWKTTDKLRADIDIANYNNLIFGLILPKNI
FT                   SNAFEISQKELTTLFCEIKNPDEICAISHEDYEPNEDDTQAIQEELIVEDHYIEKNIFW
FT                   MPKAARWDIRKNKAIPQIGTALWVNTATEQGVKLRSASWLGNSPLDEIEKTNTKLKSSF
FT                   NHISQYRVGNKVLTTLINAVSDINFNNPEYNNLKSKGIYGYVYEYFLNQFAFDEEKQGG
FT                   QCYTPKKYHCSDCQNAATIQRSCTYLYNGFRTK"
FT   gene            75549..75815
FT                   /locus_tag="YPK_0066"
FT   CDS_pept        75549..75815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0066"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   yps:pYV0018 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66380"
FT                   /db_xref="GOA:A0A0H3AZ97"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZ97"
FT                   /protein_id="ACA66380.1"
FT                   /translation="MKKTRYTEEQIAFALKQAETGTRVEEVCRKMGISEATFYNWKKKF
FT                   GGMGVTELRRLRQLEDENQRLKRLVAYLSLDKEMLQDVIRKKF"
FT   gene            75893..76648
FT                   /locus_tag="YPK_0067"
FT   CDS_pept        75893..76648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0067"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG: yps:pYV0019
FT                   putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66381"
FT                   /db_xref="GOA:A0A0H3AZZ4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZZ4"
FT                   /protein_id="ACA66381.1"
FT                   /translation="MMQSRTVYNYRSHRDDRAITQRIREIAETRIRYGCPRIHILLRRE
FT                   GWLVNHKKTHRIYCLEGLNLRSKRPRRHVTAKHRHARPEVTALEQCWSMDFVADNLFNG
FT                   RRVRALTIVDNFSRECLAIEVGQGLRGDDVVAVMDRLKHSLGRIPQRLQTDNGSEFISK
FT                   SMDRWAYENRVTMDFSRPGKPTDNAFIESFNGSLRDECLNVHGFLSLEDAQEKIEQWRQ
FT                   EYNHFRPHSSLNNLAPAEFARSHQKGPDL"
FT   gene            complement(76836..77594)
FT                   /locus_tag="YPK_0068"
FT   CDS_pept        complement(76836..77594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0068"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ypp:YPDSF_3768 iron ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66382"
FT                   /db_xref="GOA:A0A0H3AYQ6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYQ6"
FT                   /protein_id="ACA66382.1"
FT                   /translation="MIEINDVNKKYQQTTVLNEINERIPSGGITSIIGPNGAGKSTLLS
FT                   IMSRLLAADSGNVLFNGLDVAKTSGDKLATILSVLRQENHFTSRLTVSDLVGFGRYPYS
FT                   RGRLNKNDRQHIDAAMEFLNLMPLKDRYLDELSGGQRQRAYVAMVLCQDTSYILLDEPL
FT                   NNLDMKHCVAMMKQLRRAADELHKTIILVIHDINFASAYSDHIIAMKNGEVIYRGAPAE
FT                   IMQPSILEEIFDIKISIEKVQGQHIAVYYR"
FT   gene            complement(77591..78598)
FT                   /locus_tag="YPK_0069"
FT   CDS_pept        complement(77591..78598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0069"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   yps:YPTB3859 ABC iron siderophore transporter, permease
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66383"
FT                   /db_xref="GOA:A0A0H3AWI6"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AWI6"
FT                   /protein_id="ACA66383.1"
FT                   /translation="MRAEEYSAKNTLFQGINKALTLPAKRLLLLSIIALGAMIIFMTIN
FT                   LSGNIQYILVHRGLILATMLLVAFASGVATVLFQTVTNNRILTPSVMGLEALFILIQTM
FT                   LIFFIDANGFRALGITGKFLCESALLLLFSVFLYRWLLSGVGVNLHKVLLVGLVCGTLF
FT                   RSISNLMQRLLSPGEFAILQGRIFATFTRAAPEIIAVSAGIIVMVGVVIWRQRHCLDVI
FT                   SLGRNTAINLGVAYQKKITVILLLVSLLVAISTALVGPLTFLGLLIANLAYPIVGSYRH
FT                   QYLLPGVFLLGVITLVGGQLILERVLNMAGTLSVVIEFVGGALFIYLLIKKAPV"
FT   gene            complement(78588..79547)
FT                   /locus_tag="YPK_0070"
FT   CDS_pept        complement(78588..79547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0070"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   ypi:YpsIP31758_4092 iron chelate ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66384"
FT                   /db_xref="GOA:A0A0H3AY91"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AY91"
FT                   /protein_id="ACA66384.1"
FT                   /translation="MKNLSFVAGLVILLGLMICSLFIGAGHVTFANLWSDPDMRDIFFI
FT                   SRVPRTLALVLAGSAMSVSGLIMQMLTQNRFVEPSIAGTTQSASLGLLLVMVFSPSASV
FT                   MIKMLVATLFAMGGTVLFMMLLARMRMKSALMVPLTGIMLGAVFSAVTTFLAMEFDLLQ
FT                   SLGSWESGDFSGVLQGRYELLWIVGVLTLVACFIADRFTVAGMGRDFSVNVGLNYQRVM
FT                   LIGMSIIAIISGVVVVVIGVLPFLGLIIPNIVSMAMGDNLRRTIPWVGLCGGGLVVLCD
FT                   IIGRLISYPFEIPASVILGVIGALVFLLLIVRTKRHAG"
FT   sig_peptide     complement(79452..79547)
FT                   /locus_tag="YPK_0070"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.738 at
FT                   residue 32"
FT   gene            complement(79557..80510)
FT                   /locus_tag="YPK_0071"
FT   CDS_pept        complement(79557..80510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0071"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   ypi:YpsIP31758_4091 iron chelate ABC transporter,
FT                   periplasmic iron-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66385"
FT                   /db_xref="GOA:A0A0H3AZA2"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR033870"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZA2"
FT                   /protein_id="ACA66385.1"
FT                   /translation="MRLRLALFSSLLAATFAITGCDQSSETPDNAATISIEHAQGTTLV
FT                   PLNPQKVVILNPSVLDNADALHIKVAGVPQTSTHLPAFLSKYSGPEYMNTGTLFEPDYE
FT                   ALSQAKPDLIIAGGRAQDAYNKLSAIAPTIALDVDTQHFTQSLTQRTEQLASIFGKEEE
FT                   AKTLLGNFSSQVNAIKQKSANAGSAMVLMISGGKMSAYTPGSRFGFIFDELGFTPAATF
FT                   AESGRHGNVVTSEFILNANPDWLFVLDRDNAIGRTEGQSAQQVLDNPLIHKTKAWQNDR
FT                   IVYLDSASLYIAGGVQSYTQLMNKVSAILDKPVSEQ"
FT   sig_peptide     complement(80436..80510)
FT                   /locus_tag="YPK_0071"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.519 at
FT                   residue 25"
FT   gene            complement(81033..82277)
FT                   /locus_tag="YPK_0072"
FT   CDS_pept        complement(81033..82277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0072"
FT                   /product="phosphoribosylglycinamide synthetase"
FT                   /note="PFAM: phosphoribosylglycinamide synthetase; KEGG:
FT                   ypn:YPN_3669 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66386"
FT                   /db_xref="GOA:A0A0H3B001"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B001"
FT                   /protein_id="ACA66386.1"
FT                   /translation="MKKIIVVDGFSSGKFVAMTLYKMGCELIHIASRCDLDSYYYAGFD
FT                   ETIYRQQRINKHIDDTIEFARQLGADAVIAGAESGVLLADRLNHELGLCYRNAFVTSSA
FT                   RRNKYEMINTLANAGLSAARQIDTADWEDASAWLDVHATWPVVLKPLESAGSDGVFICQ
FT                   DKQSAYHAFLAILGTANKLSLVNESVLLQEFLDGTEYVVNFVSLDGEPLVTEIVRYHKR
FT                   RLPSGSVIYDIDELLDCTSPEYQPLVDYTKQAALVLGIKNGPSHAEVMMTSGGPVLVEI
FT                   AARTDGILHPDVAAVTTGFGQLVAFAQSLADPDRFRQTLKKESYRLNAHSFNVCLINQA
FT                   TGVFSAKHFERELQRLPSYKKSVYYVNEGDNIKVTKNVFSQPGTVYLVHKSKEQLWQDY
FT                   TSIRKMESDGFYLLP"
FT   gene            complement(82279..83208)
FT                   /locus_tag="YPK_0073"
FT   CDS_pept        complement(82279..83208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0073"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ypi:YpsIP31758_4089 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66387"
FT                   /db_xref="GOA:A0A0H3AYR0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYR0"
FT                   /protein_id="ACA66387.1"
FT                   /translation="MHAYSGISYGVIFCLISAAFDVYVGYITQSISPAVIILYCFISST
FT                   IVFLLFSILKQGIAVFYKAKANLPLLLLANVAVLLNWGGLIVSLRYLEPAIVGIASVAC
FT                   GPAITTIISRCIDNRSSKNSGLEFIISWLIMVGVILMLCNSLMGKSGVTTTTVDERLIG
FT                   IICVILSALGTVIYTFISRELYQRQWETYEILGFRNMLMLLIAVIYCFYADIPLSINMN
FT                   LAAPMVLLVVIGHLLPIYLIQNTIKRLQPLHVSLVLLLLPVFTLLLQYFDTRVEISFDS
FT                   IAAVSIIAILLFILGINKIIGNPKTKGA"
FT   gene            complement(83291..83839)
FT                   /locus_tag="YPK_0074"
FT   CDS_pept        complement(83291..83839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0074"
FT                   /product="phosphoribosyltransferase"
FT                   /note="PFAM: phosphoribosyltransferase; KEGG:
FT                   ypp:YPDSF_3762 phosphoribosyl transferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66388"
FT                   /db_xref="GOA:A0A0H3AWJ1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AWJ1"
FT                   /protein_id="ACA66388.1"
FT                   /translation="MYKNAQVVNSGKALTTVNEFTDQLPALRPAVLLEVAHKVIQIIDM
FT                   DIDKIVTEEDKGAPLATAVSLLSGKPLAMARWYPYSLSELNNNVVNISSEYFEGVVYLN
FT                   GISAGDRVAIIDDTLSTGGTVIALIKAIQNSGGIVKDVICAVEKIQNNGKKNIFTQTGI
FT                   NVKTLMKISVKPHGVDIIE"
FT   gene            complement(83832..84155)
FT                   /locus_tag="YPK_0075"
FT   CDS_pept        complement(83832..84155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0075"
FT                   /product="pyridoxal-phosphate dependent protein"
FT                   /note="KEGG: ypi:YpsIP31758_4087 pyridoxal-phosphate
FT                   dependent protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66389"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AY95"
FT                   /protein_id="ACA66389.1"
FT                   /translation="MELKDIGNTELIELKNLSINNNSLFSKCEFNNPTGSHKDRTFLHI
FT                   LNILEEENKIIPGMTLIDCSTGNGGAALAWIGQKKGYKIKIFMPEGMTEERKEQIYSFK
FT                   ERV"
FT   gene            84883..86574
FT                   /locus_tag="YPK_0076"
FT   CDS_pept        84883..86574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0076"
FT                   /product="urocanate hydratase"
FT                   /EC_number="4.2.1.49"
FT                   /note="KEGG: ypm:YP_3380 urocanate hydratase; TIGRFAM:
FT                   urocanate hydratase; PFAM: Urocanase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66390"
FT                   /db_xref="GOA:B1JH60"
FT                   /db_xref="InterPro:IPR023636"
FT                   /db_xref="InterPro:IPR023637"
FT                   /db_xref="InterPro:IPR035085"
FT                   /db_xref="InterPro:IPR035400"
FT                   /db_xref="InterPro:IPR035401"
FT                   /db_xref="InterPro:IPR036190"
FT                   /db_xref="InterPro:IPR038364"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JH60"
FT                   /protein_id="ACA66390.1"
FT                   /translation="MTTQNRFRDNEIRAPQGTQLTAKSWLTEAALRMLMNNLDPDVAEN
FT                   PKELVVYGGIGRAARNWECYDKIVESLINLNDDETLLIQSGKPVGIFKTHSNAPRVLIA
FT                   NSNLVPHWANWEHFNELDAKGLAMYGQMTAGSWIYIGSQGIVQGTYETFVEAGRQHFGG
FT                   SLKGRWVLTAGLGGMGGAQPLAATLAGACSLNIECQQSRIDFRLKTRYVDEQATDLDDA
FT                   LARIEKYTATGVAVSIALCGNAAEILPELVRRGVRPDMVTDQTSAHDPLNGYLPKGWNW
FT                   EEYRQRAQHEPALVINAAKISMAEHVEAMLAFHNMGIPTFDYGNNIRQMAHDMGVIRAF
FT                   DFPGFVPAYIRPLFCRGIGPFRWVALSGNPDDIYKTDAKVKALIPDDAHLHHWLDMARE
FT                   RIRFQGLPARICWVGLGQRAKLGLAFNEMVRSGELSAPVVIGRDHLDSGSVASPNRETE
FT                   AMQDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGMGFSQHSGMVVVCDGSDEAAER
FT                   IARVLHNDPATGVMRHADAGYDIAVNCAQEQGLNLPMVAATQGKKS"
FT   gene            86571..88103
FT                   /locus_tag="YPK_0077"
FT   CDS_pept        86571..88103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0077"
FT                   /product="histidine ammonia-lyase"
FT                   /EC_number="4.3.1.3"
FT                   /note="KEGG: yps:YPTB3851 histidine ammonia-lyase; TIGRFAM:
FT                   histidine ammonia-lyase; PFAM: phenylalanine/histidine
FT                   ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66391"
FT                   /db_xref="GOA:A0A0H3AZA7"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR005921"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR022313"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZA7"
FT                   /protein_id="ACA66391.1"
FT                   /translation="MKTITLRPGQMTLADLRHIYQHPVHITLDESAYVPIQQSVDCVQA
FT                   ILAEQRTAYGINTGFGLLASTRIATEDLENLQRSIVLSHAAGVGEANDDAIVRLIMVLK
FT                   INSLARGFSGIRLEVIQALITLVNAGVYPHIPLKGSVGASGDLAPLAHMSLLLLGEGKA
FT                   RYQGEWLPAHTALAQAGLQPLTLAAKEGLALLNGTQVSAAYALRGLFEAEDLYAAASVF
FT                   GCLTVDAALGSRSPFDARIHAVRGQRGQIDAASTYRHLLGERSEISESHKNCDKVQDPY
FT                   SLRCQPQVMGACLGQIRQAAEVLAIESNAVSDNPLVFAEQGDVLSGGNFHAEPVAMAAD
FT                   NLALALAEIGSLSECRISLMMDKHMSQLPPFLVENGGVNSGFMIAQVTAAALTSENKGL
FT                   AFPASVDSIPTSANQEDHVSMAPRAGKRLWEMAENVRNILAIEWLAACQGLDLRKGLRT
FT                   SAILEPARQLLRQHVTYYDKDRFFAPDIEVASQLIAQRHMNELMPAKLLPSL"
FT   gene            88470..89873
FT                   /locus_tag="YPK_0078"
FT   CDS_pept        88470..89873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0078"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   ypi:YpsIP31758_4084 amino acid permease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66392"
FT                   /db_xref="GOA:A0A0H3B006"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B006"
FT                   /protein_id="ACA66392.1"
FT                   /translation="MKNDSSTLKRGLSARHIRFMALGSAIGTGLFYGSAEAIRLAGPAV
FT                   LLAYLIGGAAVFMVMRALGEMAVHDPVAGSFGHYASRYLGPLAGFLTGWTYTFEMVVVA
FT                   LADVTAFGIYMGLWFPDAPQWVWVLSIIFFIGALNLCSVKVFGEMEFWLSLLKVAAIIA
FT                   MIAAGLGIMMFGFGAGHDSTGVSNLWAHQGFMPNGITGVIASFAVVMFAFGGIEIIGVT
FT                   ASEAKDPGKVLPRAINTVPIRILLFYVLTLFVLMAIYPWNSIGQNGSPFVEIFSSLGIN
FT                   SAANILNLVVITAAISAINSDIYGAGRMMYGLAQEGLAPKSFSRLTRNGVPYMTILVMA
FT                   ITLLCGVVLNYLIPKNVFLVIASIATFATVWVWLMILVSQVAMRRSMSKAQVARLAFPV
FT                   PFWPLAPILTILFMAFIIAVLGYFPATRIAMYVGLAWVALMTLAWWIWLRKAPSCVIQE
FT                   RAKSSEMPS"
FT   sig_peptide     88470..88583
FT                   /locus_tag="YPK_0078"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.849) with cleavage site probability 0.502 at
FT                   residue 38"
FT   gene            90341..91804
FT                   /locus_tag="YPK_0079"
FT   CDS_pept        90341..91804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0079"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ypi:YpsIP31758_4082 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66393"
FT                   /db_xref="GOA:A0A0H3AYR5"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYR5"
FT                   /protein_id="ACA66393.1"
FT                   /translation="MPAIAIKRWIKRIVLVLVVISITILAIRIYDTQRGPKLELWHTFV
FT                   PHEMRAAEIDKASWADYIKTENNIFDEVRINVTEKLEPSTQVPLNRYYSGSAIYPPHFK
FT                   NDWNRSYILQPEGEPKGAVVLLHGLTDTPYSLRHIAENYRQRGYVAIGIRLPAHGSVPA
FT                   ALTDVEWQDWLAATRLAVREAKALSGPDLPLHVVGFSNGGALAMKYTLDSMDDPKLAKP
FT                   ARVILISPMIGVTSFARFAGIAGWPAIFPAFAKAAWLGIVPEFNPFKYNSFPVNAARQS
FT                   YLLTSVLQQHIARDARNNKMDELPPILTFQSLMDSTVSTRAVVTALYNHLPNNGSEVVL
FT                   FDLNRAASFGPLLRTSSYTALARLLPPGPRNYSTTVITNVSPQSNETLALTTRAGETNE
FT                   TSVPTGLVYPPDIFSLSHVALPFPMSDSLYGRYPDPRDQYGISLGTFAARGERAVLVVG
FT                   LDSLMRISSNPFYPYMLQRIDDKIDAPVQ"
FT   gene            92315..94006
FT                   /locus_tag="YPK_0080"
FT   CDS_pept        92315..94006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0080"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; KEGG: ypi:YpsIP31758_4081
FT                   phosphoethanolamine transferase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66394"
FT                   /db_xref="GOA:A0A0H3AWJ6"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012549"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR040423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AWJ6"
FT                   /protein_id="ACA66394.1"
FT                   /translation="MDRVKFLSQQSLSLLLAVYIGIFLNISVFYRRFDSFSQGIQGIKV
FT                   VSAITEVIAIILFTFFVMRLISLGGRFFYRVVASLLVLISVAASYYMTFFNVVIGYGIV
FT                   ISVLTTDTDLSKEVIGLHFIIWMVLVSALPLLLIWKNSLRLTLLEQCLTPGQRIKPVLL
FT                   MVAVVALVWLPLRYLDKAQALDEQLKTVDLPSYGGVVAHSYLPSNWLAALGLYAYTQYN
FT                   EKYDAAVLYNPAEHHTYVAPAGIDDTYVVFIIGETTRWDHMGLLGYSRDTTPRLSKEKN
FT                   LAAFRGESCDTSTKLSLRCMFVREGGVEDNAQRTLKEQNVFAVMKSLGFTSELFAMQSE
FT                   MWFYNNVNTNNYSFRELIASEKRNDGKPVDDMLLVDELKESLGRYPVGKHLVVLHTKGS
FT                   HYLYSQRYPRSYARYQPECMGVDEFCSKQQLINAFDNSVLYTDSFIANVIDQMRDKKAL
FT                   VFYAADHGESISDNSHFHGTPREMAPPEQFRVPLMVWASDKFLAQPEHLAAFEQLQVEQ
FT                   RVGKTHRHAELFDSVLGCMGYTSPDGGIDAKNNWCQAPDRHLTPAI"
FT   gene            94122..94712
FT                   /locus_tag="YPK_0081"
FT   CDS_pept        94122..94712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0081"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; response regulator
FT                   receiver; Sigma-70 region 4 type 2; KEGG:
FT                   ypi:YpsIP31758_4080 transcriptional regulatory protein
FT                   UhpA"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66395"
FT                   /db_xref="GOA:A0A0H3AY99"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AY99"
FT                   /protein_id="ACA66395.1"
FT                   /translation="MTYRVVFIDDHDIVRSGFAQLLSLEEDIQVVGEFSSAKQARAGLP
FT                   GLQANICICDISMPDENGLDLLKGLPSGMGVIMLSMHDSPALVETALERGARGFLSKRC
FT                   KPEDLISAVRTVGSGGVYLMPEIAQQLARVAVDPLTRREREVAVLLAEGMEVREIAESL
FT                   GLSPKTVHVHRANLFAKLGISNNVELAKKVLNL"
FT   gene            94709..96238
FT                   /locus_tag="YPK_0082"
FT   CDS_pept        94709..96238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0082"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   MASE1 domain protein; histidine kinase dimerisation and
FT                   phosphoacceptor region; KEGG: yps:YPTB3846 putative sensor
FT                   protein uhpB"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66396"
FT                   /db_xref="GOA:A0A0H3AZB2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR007895"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZB2"
FT                   /protein_id="ACA66396.1"
FT                   /translation="MIQRLVMLLALFFIYFTAAFCLWAIGTQLADRALQSLLLFPFGLR
FT                   MGILLQSPRAYWPGILLGDVLLWWLLADQFDDLYQLWVALPLLLLTTLLALFASPWLLR
FT                   HQQNESEWQWPLMQGGVITVAALIQALGWQIASGQGAMALLLGLVGGFTIAPTCLLLWH
FT                   YLARQIWLPLEPGLIHKPVNLRLRHILWYLLLFAISIWLQYQVTETDLRLFVPFCLAIP
FT                   IVFMAYRYGWQGALAATLLNGVVLLINTPEPLESHRGLLLSLLAQSLTGLLLGSGIQRQ
FT                   RELNDQLQIKLNENRELAKALVVSEEHTRHDVARELHDEVGQTVTVIRTQASIIKRLTT
FT                   QQPVLTSAEMIETAALRVYDGVHDVLAKLWPAALNNLPLSAAIAALMRELIPQDQSVLG
FT                   VLNWQVNDHPMDETLKITLYRICQEGVTNAYRHGAASRIEINARQDNQQIYLTISDNGK
FT                   GIDLASITPGYGLRGIQSRVSAFGGNVSLSVDNGTCLNVTLPTVSLSTKGN"
FT   sig_peptide     94709..94783
FT                   /locus_tag="YPK_0082"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.775 at
FT                   residue 25"
FT   gene            96333..97664
FT                   /locus_tag="YPK_0083"
FT   CDS_pept        96333..97664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0083"
FT                   /product="phosphoglycerate transporter"
FT                   /note="TIGRFAM: phosphoglycerate transporter; PFAM: major
FT                   facilitator superfamily MFS_1; KEGG: yps:YPTB3845 MFS
FT                   family hexose phosphate uptake and regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66397"
FT                   /db_xref="GOA:A0A0H3B011"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B011"
FT                   /protein_id="ACA66397.1"
FT                   /translation="MWFFLKSRDNVPPVTDQTQIDSSYKYWRIQLMWTMYIGYAAFYFT
FT                   RKSFNFIMPAMLTDLGLSMSDVGILGTLFYITYGCSKFVSGMISDRSNPRYFMGIGLVM
FT                   TGIINILFGMSSSLLVLGALWILNAFFQGWGWPPCSKILTSWYSRSERGGWWAIWNTSH
FT                   NFGGALIPLLVGVITLHFSWRYGMIIPGIIGVVIGLLMCWRLRDKPSTMGLPSVGKWRN
FT                   DAMELIQESEGQGLSNKEIVKRYVLTNKYIWLLAVSYVLVYIVRTAINDWGNLYLTQEK
FT                   GYSLLTANSAISLFEVGGFIGSLVAGWGSDKWFRGNRGPMNLIFAIGIFLSVASLWTLP
FT                   SISFVLQAGCFFAIGFFIFGPQMLIGMAAAECSHKDAAGAATGFVGLFAYLGAALSGYP
FT                   IARVMEIWHWNGFFVVISVAACLSAFFLLPFLRAQSPQLKQATT"
FT   gene            97781..97857
FT                   /locus_tag="YPK_R0002"
FT                   /note="tRNA-Pro1"
FT   tRNA            97781..97857
FT                   /locus_tag="YPK_R0002"
FT                   /product="tRNA-Pro"
FT   gene            98170..99561
FT                   /locus_tag="YPK_0085"
FT   CDS_pept        98170..99561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0085"
FT                   /product="filamentous haemagglutinin family outer membrane
FT                   protein"
FT                   /note="TIGRFAM: filamentous haemagglutinin family outer
FT                   membrane protein; adhesin HecA family; PFAM: filamentous
FT                   haemagglutinin domain protein; KEGG: ypp:YPDSF_3371
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66398"
FT                   /db_xref="InterPro:IPR008638"
FT                   /db_xref="InterPro:IPR010069"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYR9"
FT                   /protein_id="ACA66398.1"
FT                   /translation="MKLTYIKTKQGLSILPLSIILSLYGSSVAYADNIIPDIQAPAGQQ
FT                   AEVSIIETPPSTCRALTSYCIGMTETVVNIQAPDENGLSHNKYSKFDVVANGLFDVTTL
FT                   NNRLAQEVNGNSFLQDKSATIILNEVNSSHASLLDGNLRVDGGNAHIIIANPAGINCRG
FT                   CSFTNASHVTLTTGTPSFSDNKLNSFIVEQGNINIEKNPSYYMRTGLRYKGADKTYLDL
FT                   FADTITVSGEINADDGYIVTGKNKVGFSLPGQPLQVSRLGNENTPVPGTVSLDVSEIGG
FT                   MYTNKIRIHATDGTIKNKGAIRANDTLSLSSAANIDNSNGNISGKMVLLSSEGVINNSG
FT                   GTILNNGEYDLLPSQGIKITSRGLNNEGGKIEYKNGSVEIATVNTIKNGKGTIKATSTQ
FT                   GRVRIKLHSNNLNNTGGSIISSGKIEGKVNNIRNNRGAIIGLGGVDLNETVLINDTGKI
FT                   ISDFN"
FT   sig_peptide     98170..98265
FT                   /locus_tag="YPK_0085"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.977 at
FT                   residue 32"
FT   gene            99670..101433
FT                   /locus_tag="YPK_0086"
FT   CDS_pept        99670..101433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0086"
FT                   /product="Polypeptide-transport-associated domain protein
FT                   ShlB-type"
FT                   /note="PFAM: Hemolysin activator HlyB domain protein;
FT                   Polypeptide-transport-associated domain protein ShlB-type;
FT                   KEGG: ypn:YPN_3653 hemolysin activator protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66399"
FT                   /db_xref="GOA:A0A0H3AWK0"
FT                   /db_xref="InterPro:IPR005565"
FT                   /db_xref="InterPro:IPR013686"
FT                   /db_xref="InterPro:IPR027282"
FT                   /db_xref="InterPro:IPR035251"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AWK0"
FT                   /protein_id="ACA66399.1"
FT                   /translation="MTFKINVRWRDKIGDFWWGILCLLYLQIMIGMLPFKVFAEMALPE
FT                   MDLLEMDIAEPQIPNSIIPPLSHAQLASEPVLPENLYNDEVQCVAINNVELINLDAFPN
FT                   AAHLKEKAEEAHGRCLGEQGLSVLVANLQQQLVVDGYITSRVVFVDDSERDGTLMLKLM
FT                   PGRIEDIRHHQDSVGNAHLSSLFPGKRGDLVNLRHLEQGLENLQRLPSVNATLDVELNR
FT                   EDLSSQIIVNRQQSRLWRINAYLDDAGHDAVGRYRTGLILSFDNPLSRYNPLSLSDLLY
FT                   FSVNRDLDSQPDKGHNSYGVHYSVPYGNWLFSMTGNQGERYQSFSFAGKRLAGKKFGYR
FT                   SHWSVLDTQIQHLLTRGVNYKTVGYAGVLIRQSASFWTHREIDIQRFNTTDWQLGIEHL
FT                   HYMPWATFRGGVRYQQGASWFGAQPIPGKMSTAPARLVDITSSLDIPFKIGTQSFQYRP
FT                   AFSQQHTYSDISSLDKFTIGGRSSVRGFNENNALTGSRGWSLKNDISWISPIPGQTFVG
FT                   QQFYIGMDYGEVSEQGQPFLLGERLAGAVVGTRGNYHAFGYDFNVGVPITKPAEFDADP
FT                   LVFGFTLTWQY"
FT   gene            101493..101699
FT                   /locus_tag="YPK_0087"
FT   CDS_pept        101493..101699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0087"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ypm:YP_3366 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66400"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYA3"
FT                   /protein_id="ACA66400.1"
FT                   /translation="MVHLFGKLCGFLGESAWKGEFFSFLTAHPMLDKRGSGDHSNAIYR
FT                   LLRQSFLLFFVKISKKSVQIHLI"
FT   gene            102102..103709
FT                   /locus_tag="YPK_0088"
FT   CDS_pept        102102..103709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0088"
FT                   /product="4-phytase"
FT                   /EC_number="3.1.3.26"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: ypi:YpsIP31758_4075 dipeptide ABC transporter,
FT                   periplasmic dipeptide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66401"
FT                   /db_xref="GOA:A0A0H3AZB6"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZB6"
FT                   /protein_id="ACA66401.1"
FT                   /translation="MTISLRRTGILKFGIGLVALTIAASVQAKTLVYCSEGSPEGFNPQ
FT                   LFTSGTTYDASSVPIYNRLVEFKIGTTEIEPSLAERWEVSEDGKTYTFYLRKGVKWQDN
FT                   KDFKPTRDFNADDVIYSFMRQKDDKNPYHKVSGGSYEYFQGMGMGDLITNVVKVDDNTV
FT                   RFELTRPESPFLADLAMDFASILSAEYADNMLKAGTPEKVDLNPIGTGPFQLQQYQKDS
FT                   RILYKAFPGFWGTKPKIDRLVFSITPDASVRYAKLQKNECQIMPYPNPADIARMKEDKT
FT                   INLMEQPGLNVGYLSFNIEKKPLDNLKVRQALTMAVNKDAIIDAVYQGAGQAAKNLIPP
FT                   TMWGYNDDVKDYAYDPAKAKELLKEAGLPDGFSIDLWAMPVQRPYNPNARRMAEMIQSD
FT                   WAKIGVKAKIVTYEWGEYLKRAKDGEHETVMMGWTGDNGDPDNFFATLFSCDAAKQGSN
FT                   YSKWCYKPFEDLIQPARAEADHDKRVALYKQAQVVMNEQAPALIIAHSTVYEPVRKEVK
FT                   GYVVDPLGKHHFDNVSLD"
FT   sig_peptide     102102..102188
FT                   /locus_tag="YPK_0088"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 29"
FT   gene            103992..105011
FT                   /locus_tag="YPK_0089"
FT   CDS_pept        103992..105011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0089"
FT                   /product="Alkaline phosphatase"
FT                   /EC_number="3.1.3.1"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ypi:YpsIP31758_4074
FT                   dipeptide ABC transporter, permease protein DppB"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66402"
FT                   /db_xref="GOA:A0A0H3B015"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B015"
FT                   /protein_id="ACA66402.1"
FT                   /translation="MLQFILRRLGLVIPTFIGITLLTFAFVHMIPGDPVTIMAGERGIS
FT                   AERHAQVMAEMGLDKPLYQQYFRYVNGVLHGDLGISLKSRIAVWDEFVPRFKATLELGI
FT                   CAMLFAIAVGIPVGVLAAVKRGSIFDHTAVGISLTGYSMPIFWWGIMLIMLVSVQWDLT
FT                   PVSGRVSDTVFLDDSLPLTGFMLIDTLIWGEPDDFKDAVMHMILPAIVLGTIPLAVIVR
FT                   MTRSSMLEVLGEDYIRTARAKGLSRMRVIVVHALRNALLPVITVIGLQVGTMLAGAILT
FT                   ETIFSWPGLGRWLMDALQRRDYPVVQGGVLLVAIMIILVNLLVDVLYGVVNPRIRHKK"
FT   gene            105022..105924
FT                   /locus_tag="YPK_0090"
FT   CDS_pept        105022..105924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0090"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ypi:YpsIP31758_4073
FT                   dipeptide ABC transporter, permease protein DppC"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66403"
FT                   /db_xref="GOA:A0A0H3AYS2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYS2"
FT                   /protein_id="ACA66403.1"
FT                   /translation="MSQLIESAVKSAPKPMTPLQEFWHYFKRNKGAVIGLFYIIIMLVV
FT                   AAGATWLAPHGPAEQFRDALLKPPVWEEGGSWKFILGTDDVGRDVLSRLMYGARLSLLV
FT                   GCLVVVLSLVMGVIFGLLAGYFGGIVDAIIMRVVDIMLALPSLLLALVLVAVFGPSIVN
FT                   ASLALTFVALPHYVRLTRAAVLVEVNRDYVTASRVAGAGAMRQMFINILPNCLAPLIVQ
FT                   ASLGFSNAILDMAALGFLGMGAQPPTPEWGTMLSDVLQFAQSAWWVVTFPGVAILLTVL
FT                   AFNLMGDGLRDALDPKLKQ"
FT   gene            105938..106918
FT                   /locus_tag="YPK_0091"
FT   CDS_pept        105938..106918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0091"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: ypi:YpsIP31758_4072 dipeptide ABC transporter,
FT                   ATP-binding protein DppD; TIGRFAM: oligopeptide/dipeptide
FT                   ABC transporter, ATPase subunit; PFAM: ABC transporter
FT                   related; Oligopeptide/dipeptide ABC transporter domain
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66404"
FT                   /db_xref="GOA:A0A0H3AWK5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AWK5"
FT                   /protein_id="ACA66404.1"
FT                   /translation="MALLNVDKLSVHFGDDAAPFKAVDRISYSIDQGQVVGIVGESGSG
FT                   KSVSSLAIMGLIDYPGKVMADKLEFNGRDLTKISEKERRQLVGAEVAMIFQDPMTSLNP
FT                   CYTVGFQIMEALKVHQGGNRKTRHQRAVDLLTLVGIPDPASRLDVYPHQLSGGMSQRVM
FT                   IAMAIACRPKLLIADEPTTALDVTIQAQIIELLLELQRRENMALLLITHDLALVAEAAH
FT                   QIIVMYAGQVVETGKAAEIFRAPRHPYTQALLRALPEFAQDKARLASLPGVVPGKYDRP
FT                   EGCLLNPRCPYATDRCRDEEPELLGTPGRQVKCHTPLNDAGRPSL"
FT   gene            106915..107991
FT                   /locus_tag="YPK_0092"
FT   CDS_pept        106915..107991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0092"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: yps:YPTB3838 ABC dipeptide transporter,
FT                   ATP-binding subunit; TIGRFAM: oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66405"
FT                   /db_xref="GOA:A0A0H3AYA7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYA7"
FT                   /protein_id="ACA66405.1"
FT                   /translation="MNSNTEAAHKVNMMGETEIKGESLPAETGKKPLLQAIDLKKYYPV
FT                   KKGFFTPERLVKALDGVSFTLERGKTLAVVGESGCGKSTLGRLLTMIEIPTGGELYYQG
FT                   QDLLKPDESAEKLRRQKIQIVFQNPYGSLNPRKKVGQILEEPLQINTQLNRKERREKTL
FT                   AMMAKVGLKTEHYDRYPHMFSGGQRQRIAIARGLMLNPDVVIADEPVSALDVSVRAQVL
FT                   NLMMDLQQELGLSYVFISHDLSVVEHIADDVMVMYLGRCVEKGSKEAIFNNPRHPYTQA
FT                   LLSATPRLNPDMRRERIKLTGELPSPMNPPPGCAFNARCRRAFGTCSQLQPQLKQYGDQ
FT                   MVACFAVDQDEAEKVVSV"
FT   gene            108109..109224
FT                   /locus_tag="YPK_0093"
FT   CDS_pept        108109..109224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0093"
FT                   /product="Cellulase"
FT                   /EC_number="3.2.1.4"
FT                   /note="PFAM: glycoside hydrolase family 8; KEGG:
FT                   ypi:YpsIP31758_4070 endoglucanase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66406"
FT                   /db_xref="GOA:A0A0H3AZC0"
FT                   /db_xref="InterPro:IPR002037"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZC0"
FT                   /protein_id="ACA66406.1"
FT                   /translation="MVVMFKHLASMFLLLASFSLAATSNWPAWQQFKQDYISEGGRIID
FT                   PGSPSKITTSEGQSYGLFFALVADDQPMFERLLAWTENNLAAGDLTSRLPAWLWGQNSQ
FT                   NNWDILDPNSASDADILIAYNLLEAGRLWGNRRYLIMGTLLLQRIAQEEVMDIPGLGQM
FT                   LLPGKIGFNDEDTWRLNPSYLPPQLLARFSSIDGPWEAMVEVNQRMWLETAPNGFSPDW
FT                   VVWQKGKGWQPDTIKPDVGSNDAILVYLWAGMLAMDSPQKAELIARFQPMAVITQQQGL
FT                   PPFTTNSDNGKTNGDGSVGFSAALLPFLASSPEPFNQQTLNLQQRRVQNSPPGADDYYS
FT                   AILTLFGQGWLQHRYHFTHQGELQPSWHRQR"
FT   sig_peptide     108109..108174
FT                   /locus_tag="YPK_0093"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.475 at
FT                   residue 22"
FT   gene            109540..111555
FT                   /locus_tag="YPK_0094"
FT   CDS_pept        109540..111555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0094"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; histidine kinase
FT                   HAMP region domain protein; KEGG: ypn:YPN_3646 membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66407"
FT                   /db_xref="GOA:A0A0H3B019"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033419"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B019"
FT                   /protein_id="ACA66407.1"
FT                   /translation="MRVRRSLTIKQMAAVAVVALVTICIFIILQLFHFVQQRKDDYANQ
FT                   LESIAYSVRQPLSEAILSVDIPQAKKILNSLLPIGILSRAEVILPNQIQVLHANFPTER
FT                   PIPHWAKRVFSLPVQITVPLYALERVPANPQPLAHLVLRADSFRMYQFILSALSAMLST
FT                   YLLLALVLSVSIAWCINRLIIHPLRAMAKELEDIGDHGVLHHQLTLPAHHQDDELGVLV
FT                   RNYNRNQQLLADAYADMGRISHRFPVTELPNRSLFISLLEKEIASSTRTDHFHLLVIGI
FT                   ETLQEVSGAMSEAQHQQLLLTIVQRIEQCIDDSDLLAQLSKTEFAVLARGTRRSFPAMQ
FT                   LARRIMSQVTQPLFFDEITLRPSASIGITRYQAQQDTAESMMRNASTAMMAAHHEGRNQ
FT                   IMVFEPHLIEKTHKRLTQENDLLQAIENHDFTLFLQPQWDMKRQQVIGAEALLRWCQPD
FT                   GSYVLPSGFVHFAEEEGMMVPLGNWVLEEACRILADWKARGVSLPLSVNISGLQVQNKQ
FT                   FLPHLKTLISHYHIDPQQLLLEITETAQIQDLDEALRLLRELQGLGLLIALDDFGIGYS
FT                   SLRYLNHLKSLPIHMIKLDKSFVKNLPEDDAIARIISCVSDVLKVRVMAEGVETEEQRQ
FT                   WLLEHGIQCGQGFLFSPPLPRAEFEAQYFSSAHHVS"
FT   gene            112196..112900
FT                   /locus_tag="YPK_0095"
FT   CDS_pept        112196..112900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0095"
FT                   /product="Oligogalacturonate-specific porin"
FT                   /note="PFAM: Oligogalacturonate-specific porin; KEGG:
FT                   ypi:YpsIP31758_4068 oligogalacturonate-specific porin
FT                   protein KdgM"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66408"
FT                   /db_xref="InterPro:IPR009331"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYS6"
FT                   /protein_id="ACA66408.1"
FT                   /translation="MNIKLLSLAVASLISTSAVAVTIDYRHEMQDQSGNTHKDRLLMSH
FT                   RFANGFGLSLEGKWKGAQDKDKPFNETVSNGTEVVASYVYKINNTFSIEPGFSLDSNST
FT                   SNNYRPYLRGKAVIVDDLSVSLRYRPYYKRTSANINTPKDTSENGYNLTSVISYKIAKD
FT                   YQLDYEIDYKQANKAGVVLADKENYDWSHDLKLTYKWDKNWSPYMALGNVSGSKNTDER
FT                   QTRYRVGVKYSF"
FT   sig_peptide     112196..112258
FT                   /locus_tag="YPK_0095"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 21"
FT   gene            113146..114864
FT                   /locus_tag="YPK_0096"
FT   CDS_pept        113146..114864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0096"
FT                   /product="Pectate lyase"
FT                   /EC_number="4.2.2.2"
FT                   /note="PFAM: periplasmic pectate lyase; KEGG:
FT                   ypi:YpsIP31758_4066 periplasmic pectate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66409"
FT                   /db_xref="GOA:A0A0H3AWL0"
FT                   /db_xref="InterPro:IPR010702"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AWL0"
FT                   /protein_id="ACA66409.1"
FT                   /translation="MKKRALLLSMSVLAMLYIPAGQAAEIDRLTVVKQYVDNVLNKASD
FT                   TYHGDKPSPLLADGVDPRTGQQMEWIFPDGRRAVLSNFSAQQNLMRVMSGLSELSGDPQ
FT                   YQKRAEDIVRYHFQNYQDNSGLLYWGGHRFVDLKTLQPEGPSEKEKVHELKNAYPYYDL
FT                   MFSVDSDATTRFIRGFWNAHVYDWRILETSRHGEYGKPMGALWESTFEQQPPFFATKGL
FT                   SFLNAGNDLIYSASLLYKYQQDQGALVWAKRLADQYVLPRDAKTGLGVYQFTQALKREE
FT                   PTDDADTHSKFGDRAQRQFGPEFGPTALEGNMMLKGRTSTLYSENALMQLQLGKDLGGQ
FT                   GDDLLKWTVDGLKAFAKYGYNEQDNTFRPMIANGQDLSNYTLPRDGYYGKKGSVLKPYK
FT                   AGNEFLISYARAYAVDNDPLLWKVARGIASDQGLGDIGSAPGKEMKVKLDTTNSDPYAL
FT                   FALLDLYNASQVAEYRSLAEKVADNIIKTRYIDGFFMASPDRQYADVDAIEPYALLALE
FT                   ASLRNKPQAVAPFLNGAGFTEGAYLMADGSARISTRDNELFLLNVGETLQPNGRK"
FT   sig_peptide     113146..113217
FT                   /locus_tag="YPK_0096"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 24"
FT   gene            114989..115468
FT                   /locus_tag="YPK_0097"
FT   CDS_pept        114989..115468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0097"
FT                   /product="coagulation factor 5/8 type domain protein"
FT                   /note="PFAM: coagulation factor 5/8 type domain protein;
FT                   KEGG: ypi:YpsIP31758_4065 F5/8 type C domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66410"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYB1"
FT                   /protein_id="ACA66410.1"
FT                   /translation="MKKQILATLLLGALFCVPVYAAQIVAVTASGHDSEKGHVPANIAD
FT                   GDVKTRWAASGDSWIQLELDKAQSIENILIVPFKATERKLKFAIAYSTDGKTWQSLAEG
FT                   LETITTDKKGEKLTFSPINAKYIKLETFGTDVNKWSAINEVAINSLATVPSRAIN"
FT   sig_peptide     114989..115054
FT                   /locus_tag="YPK_0097"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            115940..117229
FT                   /locus_tag="YPK_0098"
FT   CDS_pept        115940..117229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0098"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="PFAM: sodium:dicarboxylate symporter; KEGG:
FT                   yps:YPTB3832 DAACS family C4-dicarboxylate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66411"
FT                   /db_xref="GOA:B1JH81"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR023954"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JH81"
FT                   /protein_id="ACA66411.1"
FT                   /translation="MKVSIFKTLYFQVLTAITIGVLLGHFYPEIGAQMKPLGDGFVKLI
FT                   KMIIAPVIFCTVVTGIAGMESMKAVGRTGAIALLYFEIVSTLALLIGLVVVNVAQPGVG
FT                   MNIDPATLDAKAVALYAEQASQQGIIPFLLDIIPGSVVGAFASGNILQVLLFAVLFGFA
FT                   LHRLGEKGQLIFNVIESFSRVIFGVINMIMRLAPLGAFGAMAFTIGKYGVGSLVQLGQL
FT                   ILCFYLTCILFVVLVLGTIAKFNGFNIFKFIRYIKEELLIVLGTSSSESVLPRMLDKME
FT                   NAGCKKSVVGLVIPTGYSFNLDGTSIYLTMAAVFIAQATNTHMDIMHQVTLLVVLLLSS
FT                   KGAAGVTGSGFIVLAATISAVGHLPLAGLALILGIDRFMSEARALTNLVGNGVATIVVA
FT                   KWCKQLDNDQLQAVLSNKVLPNVKSSVSVS"
FT   gene            complement(117291..117407)
FT                   /locus_tag="YPK_0099"
FT   CDS_pept        complement(117291..117407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0099"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZC8"
FT                   /protein_id="ACA66412.1"
FT                   /translation="MWECTILLDRVLLPMSLISMKNSIDREMNGDIMQRRYQ"
FT   gene            117594..119093
FT                   /locus_tag="YPK_0100"
FT   CDS_pept        117594..119093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0100"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   ypi:YpsIP31758_4063 peptidase, M16 family"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66413"
FT                   /db_xref="GOA:A0A0H3B023"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B023"
FT                   /protein_id="ACA66413.1"
FT                   /translation="MQGTKIRLMVGGLLLAAASNNVQAEALQPDPAWQQGKLDNGFSWQ
FT                   LLATPQRPSDRIELRLIVNTGSLSENTQEVGFAHLLPRLALMSSASFTPAQLQSLWQQG
FT                   IDNERPLPPAITSYDFTLYSLSLPNNRPDLLKDALAWLSDTAGNLAVSEQTVNAALNTA
FT                   TDPIATFPQNIQEPWWRYRLKGSSLIGHDPGQPVTQPVDVEKLKQFYQQWYTPDAMTLY
FT                   VVGNVDSRSIAAQISKAFSELKGKRTAPAAVATLAPLPPEPVSLMNEQAAQDTLSLMWD
FT                   TPWHPIQDSMALSRYWRSDLAREALFWHIKQVLEKNNQKNLKLGFDCRVQYQRAQCAIH
FT                   LNTPVENLTANMTFVARELAALRANGLSQAEFDALMTQKNDQLSKLFATYARTDTDILM
FT                   SQRLRSQQSGVVDIAPEQYQKLRQAFLSGLTLAELNRELKQQLSQDTTLVLMQPKGEPE
FT                   VNVKALQEIYNGIMAPQTVAEEEVAPAEAVETAPVMPTTAQ"
FT   sig_peptide     117594..117668
FT                   /locus_tag="YPK_0100"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 25"
FT   gene            complement(119257..120201)
FT                   /locus_tag="YPK_0101"
FT   CDS_pept        complement(119257..120201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0101"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: ypi:YpsIP31758_4062
FT                   2-dehydro-3-deoxygluconokinase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66414"
FT                   /db_xref="GOA:A0A0H3AYS9"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYS9"
FT                   /protein_id="ACA66414.1"
FT                   /translation="MTSKNIAVIGECMIELSQKGTDLSRGFGGDTLNTAVYIARQVSAP
FT                   DLNVHYVTALGTDSFSEEMLTAWQQENIQTDLIQRMDNKLPGLYFIETDESGERTFYYW
FT                   RNDAAARFWLTSPAADDICQRLETFDYLYLSGISLAILDSASRQRLLKLLRACRAKGGK
FT                   VIFDNNYRPRLWQSKEETQEAYRDMLACTDIAFLTLDDEDMLWGEKPLEQVIDRTQALG
FT                   VSEIIIKRGADSCIVWVKEGSEAQQYDVPAVKLPKEDVVDTTAAGDSFSAGYLAVRLTG
FT                   GNAHDAAVRGHLTASTVIQYRGAIIPLAAMPTA"
FT   gene            complement(120480..120680)
FT                   /locus_tag="YPK_0102"
FT   CDS_pept        complement(120480..120680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0102"
FT                   /product="4-oxalocrotonate tautomerase family enzyme"
FT                   /note="TIGRFAM: 4-oxalocrotonate tautomerase family enzyme;
FT                   PFAM: 4-oxalocrotonate tautomerase; KEGG: yps:YPTB3829
FT                   possible tautomerase enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66415"
FT                   /db_xref="GOA:A0A0H3AWL7"
FT                   /db_xref="InterPro:IPR004370"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="InterPro:IPR018191"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AWL7"
FT                   /protein_id="ACA66415.1"
FT                   /translation="MPYVNIKITREGATAEQKKQLIAGVTQLLVDTLGKNPATTVVVID
FT                   EVETDNWGIGGRSVTDLRQSS"
FT   gene            120899..121744
FT                   /locus_tag="YPK_0103"
FT   CDS_pept        120899..121744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0103"
FT                   /product="diguanylate phosphodiesterase"
FT                   /note="PFAM: EAL domain protein; KEGG: yps:YPTB3828
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66416"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYB6"
FT                   /protein_id="ACA66416.1"
FT                   /translation="MATKLMMTNRISALLAPSFAAIDQTKRLDQTRKFGQIKEIERTKG
FT                   QSFWRQCQRRYTFQPIYRTSGALLAIELLTAVFHPSAPETRLSPEDYFSTISTGARLDV
FT                   VLEQLNMVKQWHQIFVHHSVLVSINIDGQVLVAMQEDHAAKRLIDAMPYIRFELLEHVD
FT                   TSLDTPFARIAEADRLWLDDFGSGLANFTSFISWRYEYIKVARDLFTVLQDSEAGNRLF
FT                   FTLVTLMDRYSKGVIVEGVETSQEWAMVQRSDAVAAQGYYLSRPTSFDGLQALPMLFCG
FT                   "
FT   sig_peptide     120899..120961
FT                   /locus_tag="YPK_0103"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.865) with cleavage site probability 0.848 at
FT                   residue 21"
FT   gene            122049..124268
FT                   /locus_tag="YPK_0104"
FT   CDS_pept        122049..124268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0104"
FT                   /product="AsmA family protein"
FT                   /note="PFAM: AsmA family protein; KEGG: ypi:YpsIP31758_4058
FT                   AsmA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66417"
FT                   /db_xref="InterPro:IPR007844"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZD3"
FT                   /protein_id="ACA66417.1"
FT                   /translation="MTRTGKVLVGVSGFILLSLVAAVIFVASFDWNRLKPTINQKVSAE
FT                   LQRPFAIRGNLSVDWSREGEGPGWRGWIPWPHIHAEDLVLGNPTTLISTQESRDAQSTQ
FT                   GTPLSDAFPTGEGEMVTLKRIDASIAPLSLLNKEVRIPRLWLTQPDIHLQRLANGNNNW
FT                   TFNLTNTSTDSSSWSVDIGDIIFDRGEITLKDAILQADLLAVIDPLAKALPFAQVTGVR
FT                   RGASINSVTSTHSANTTTSSVTTTSVVTTTATATTNPVTEIETVKSTTPDYLFGWKVEG
FT                   QYQGQPLVGSGKIGGMISMNDANVPFPLQADMRYGSTQVAVVGTLTDPGNLAGLDLQLV
FT                   LSGTSLDNLYPLLDVVLPATPPYQTEGHLSARLKQAGGAVYHYENFNGKIGDSDIHGDL
FT                   TYTDSQPRPKLAGQVDSEKLRFTDLAPLIGADSNQEKALRGERNRQPGNKILPTETFDT
FT                   KSWGVMDADVTYTAKRIERDKSLPLSDLYTHVVLKEGTLLLDPLRFGMAEGDLAATLRL
FT                   DSHQTPMHGKVDLHVRRIQLKALLPQVQAMRSSLGRLSGDASFTAAGNSVAGLLATSNG
FT                   NVRLLLSQGQISRSLMELLGLNVGNYLVAKLFGDDTVKINCAAADITLRNGVATPNVFV
FT                   FDTENAIINITGNANFATERLNLSIDPESKGLRILTLRSPLYVKGTFKRPDVGVKTGAL
FT                   IARGAVAAALGVALTPAAALLALISPSEGEENQCAPLLRKMQQKK"
FT   sig_peptide     122049..122129
FT                   /locus_tag="YPK_0104"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.957) with cleavage site probability 0.355 at
FT                   residue 27"
FT   gene            complement(124273..125070)
FT                   /locus_tag="YPK_0105"
FT   CDS_pept        complement(124273..125070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0105"
FT                   /product="CDP-diacylglycerol diphosphatase"
FT                   /EC_number="3.6.1.26"
FT                   /note="PFAM: CDP-diacylglycerol pyrophosphatase; KEGG:
FT                   yps:YPTB3826 CDP-diacylglycerol pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66418"
FT                   /db_xref="GOA:A0A0H3B027"
FT                   /db_xref="InterPro:IPR003763"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="InterPro:IPR038433"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B027"
FT                   /protein_id="ACA66418.1"
FT                   /translation="MIMKKSSVSRSIKWRRYLLTLLILIILAAGLIYKLRFSNADALWK
FT                   IISQQCIPHMTTEDDPRPCAEVNIPASFAVLKDRNGPLQYLLIPTVPISGIESPQLLTA
FT                   TSPNYFADAWQARYFMAEKYGAPIDDTDISLAINSQYGRTQDQLHIHISCLKPQVKTAL
FT                   AAHSADFQQQWQPLPGGLLGHDYWVRRITATELQQPGPFHLLADEMPGAKEQMGRYGLA
FT                   ITALPSGDFLLLADKANLMTQDRASAEELQDHTCQVLPHPPVQ"
FT   sig_peptide     complement(124948..125070)
FT                   /locus_tag="YPK_0105"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.622 at
FT                   residue 41"
FT   gene            complement(125074..126174)
FT                   /locus_tag="YPK_0106"
FT   CDS_pept        complement(125074..126174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0106"
FT                   /product="ribonuclease"
FT                   /note="TIGRFAM: ribonuclease; PFAM: ribonuclease BN; KEGG:
FT                   yps:YPTB3825 putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66419"
FT                   /db_xref="GOA:A0A0H3AYT3"
FT                   /db_xref="InterPro:IPR005274"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYT3"
FT                   /protein_id="ACA66419.1"
FT                   /translation="MPNAPKDKVTPQVSSQSTAPLAVGIKTGKKAISHMARLSDRIRAY
FT                   PAIAHIIRATDRFNDRLGSQFGAAITYFSFLSLIPILMVSFAMVGFVLASNPDLLAELI
FT                   NKIVNSISDPALATTLKNTVNTAIQQRTTVGLTGLAIALYSGISWIGNLREAIRAQSRD
FT                   VWERNPQDKEKFYYRYARDFISLIGLVVALIITLSLTSIAGAAQAAIVNALGLGGIEWL
FT                   RPAMTLIALSISIAANYLLFLWIFWILPRNKPKKKALLRGALIAAIGFEVIKFIMTMML
FT                   PRLASSPSGAAFGSVIGLMAFFYFFARLTLFCAAWIATAHDVADNRVEGKDIIDDKDII
FT                   EDKDIEDKDIEDQNVEDKSLPTRGEK"
FT   gene            126853..130065
FT                   /locus_tag="YPK_0107"
FT   CDS_pept        126853..130065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0107"
FT                   /product="outer membrane autotransporter barrel domain
FT                   protein"
FT                   /note="TIGRFAM: outer membrane autotransporter barrel
FT                   domain protein; PFAM: Pertactin; Autotransporter beta-
FT                   domain protein; KEGG: yps:YPTB3824 putative pertactin
FT                   family virulence factor/autotransporter"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66420"
FT                   /db_xref="GOA:A0A0H3AWM0"
FT                   /db_xref="InterPro:IPR004899"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AWM0"
FT                   /protein_id="ACA66420.1"
FT                   /translation="MKKNRSTLSPCFRKTLIASLLVPLCSPLYSWAVQTASITDGSTMV
FT                   ISGGYDTEANNQTAVFVQGSGSTINGGSDVVIETTGVGAIGANASEGGTLGLTGSTIKT
FT                   ENSVAFGVLNDKGTVNLQGGTITTKGQTAYGVYSSGLGSNTDIHSSEITTSYSLTHAIY
FT                   GAGGTGLTLNNTTLNTSGSGSYGIYLNGPGGSLTGADNTINSTHATNGAGIYISSGGSN
FT                   ATLDNTTLNITKGAVGVNVGEGSSITMDGLIATGNITNLFKVNGNASVSNANIELAAGG
FT                   LLMAQGHSASNQAVIILNNVDAISNGGGTTLVDVNKDADVTINGGAYHSKGNNAKGIWV
FT                   RDNNSSLNVDNVVIITEGVNATAIENRGTAIVKNTTVITQGNNSHGLYSEQSLDATNMA
FT                   ISTAGIGSIGAAAAKGGNLNLNDALIETTGNSGMVLGTFADSSISAKNITGLSTGAGAY
FT                   ALWVDDGSSILLEESQITTQGQGAGGIYASNTGTGSHTAYTQVTLNNSQIHSEQGPGIW
FT                   ANGADINVDVKNGSQLTGGNGLLIYASSNAGAASNVNVNGDNHAVLLGDIHAAENSNIN
FT                   LALNNNSVWTGAATNAKQVDIDSSSIWNLTGDADVESMHVLGQMNFISNSSDTNSRAPY
FT                   DNFSTLTINSNVTGSGSFTFNVQLGDNDSPVDRLYVIGNASGDHGVQVINQGGLGALTT
FT                   GDGINLITVDGETHSGSFTMSNSVSAGAYEYFLYKIDDYRWNLQSNLINPGPGPEPEIE
FT                   PEEIAYRPEVPGYIAAPWLNAFYGFTTLGSLHERRGSAEGAAEGFNQDSWGRIRGQHNN
FT                   FEAGRFSYDSNIWFMQLGHDVYQAKNAAGTQVTGGMMITLGKQNSDTRDRARAINPDLS
FT                   IDTGKIKTEAYGFGGYYTLMTEEGGYLDIVSQATLYRNNYESQHNTKHNGYGVVMSAEV
FT                   GQPYPLAAGWVVEPQGQLKYQYLHLSPKNFNDAISEIGGTDYSVGQVRAGLRLFSDASE
FT                   KRDIKPYLTTDVLHQLGRNPQVTVATVDIRPDFTKTFWQGGAGVTAKVNSQVDLYADAK
FT                   YQKSFDGKLDGYLGNLGVKVSF"
FT   sig_peptide     126853..126951
FT                   /locus_tag="YPK_0107"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.978 at
FT                   residue 33"
FT   gene            130167..131036
FT                   /locus_tag="YPK_0108"
FT   CDS_pept        130167..131036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0108"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: yps:YPTB3823 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66421"
FT                   /db_xref="InterPro:IPR017483"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYC2"
FT                   /protein_id="ACA66421.1"
FT                   /translation="MTEKKAPPKMLPLQFPLCIFKTHNRMDDYGAADMKNGDLTEAELK
FT                   GKFNLRGVSVTLDPYTGEKTPTSFAMDHFNKKPKEKVNKAEVARILFDEFRHLSDTFSF
FT                   SGKYQSIMRKMITHMQINNGAPFRDLLLDSALKEQILSDKSKKSSLVIIQSILEKTINW
FT                   KEGHYSSNDESILSDAVKKSILPRFNRWKDRANGLGITVHAIHATHITIKSLKIDGDMF
FT                   HATVHYRSQDHFGLDDTDMLDSFYSQFRIFHIWFVLQRWKGLGYKPFLTNMEATLEITG
FT                   VRPKNAKK"
FT   gene            131023..131526
FT                   /locus_tag="YPK_0109"
FT   CDS_pept        131023..131526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0109"
FT                   /product="protein of unknown function DUF943"
FT                   /note="PFAM: protein of unknown function DUF943; KEGG:
FT                   yps:YPTB3822 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66422"
FT                   /db_xref="InterPro:IPR010351"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZE1"
FT                   /protein_id="ACA66422.1"
FT                   /translation="MLKNNYKILLGMIAVGVLYAAWEISRPVEIMDIYIDNFSEGYYSN
FT                   HIMVKNFPITDKGKLAWWKDNKTMLKEKYGIPKPYQDGRFSISIWDFSDGYKKMPTGDL
FT                   RLSTDSSDLLCFDEMKTEKNCIDKNWIMDIEKIRDDRIFFSMGNSSYQQPPVEGGEITK
FT                   DAED"
FT   sig_peptide     131023..131085
FT                   /locus_tag="YPK_0109"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.960 at
FT                   residue 21"
FT   gene            131595..132101
FT                   /locus_tag="YPK_0110"
FT   CDS_pept        131595..132101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0110"
FT                   /product="protein of unknown function DUF943"
FT                   /note="PFAM: protein of unknown function DUF943; KEGG:
FT                   ypp:YPDSF_3347 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66423"
FT                   /db_xref="InterPro:IPR010351"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B032"
FT                   /protein_id="ACA66423.1"
FT                   /translation="MKNSKHKILLGMFAVGALYTAWEIARPVEIVDVHIDNFSEGYYSN
FT                   YIIVKNFPVTDKGKISWWENNKFLLKEKYGVPKNYIDGRFSVKILDAGDGYKLNLPKRD
FT                   VFFPDSDTSHLICFEEMKVAKNCIDKNWIMDIEKIRDDRIFFSMGNSSYQQPVEGGEIT
FT                   KDAED"
FT   sig_peptide     131595..131657
FT                   /locus_tag="YPK_0110"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.909) with cleavage site probability 0.451 at
FT                   residue 21"
FT   gene            complement(132347..133483)
FT                   /locus_tag="YPK_0111"
FT   CDS_pept        complement(132347..133483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0111"
FT                   /product="Glycerate kinase"
FT                   /EC_number="2.7.1.31"
FT                   /note="PFAM: glycerate kinase; KEGG: ypi:YpsIP31758_4052
FT                   glycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66424"
FT                   /db_xref="GOA:A0A0H3AYT7"
FT                   /db_xref="InterPro:IPR004381"
FT                   /db_xref="InterPro:IPR018193"
FT                   /db_xref="InterPro:IPR018197"
FT                   /db_xref="InterPro:IPR036129"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYT7"
FT                   /protein_id="ACA66424.1"
FT                   /translation="MKIIIAPDSFKESLTAMQVAEAIEQGFSEIFPQAEYIKLPMADGG
FT                   EGTVESMVAATGGELVNVEVTGPLGAPVKAFYGWMGDGETAVIEMAAASGLHLVAPEQR
FT                   NPLITTSYGTGELILAALNHGARKIILGIGGSATNDGGAGMMQALGVQLSDQQGKALTV
FT                   GGAALVQLVDIDLSQLDDRLAQTDILVACDVDNPLCGAKGASAVFGPQKGATPERVQQL
FT                   DAALQHYGEKIEQVTGKSVINVAGAGAAGGMGAALFGLLNARLQPGIEIVTEALKLAAA
FT                   VQEADLVITGEGRIDSQTIYGKTPVGVARVAKRFDIPVIAIAGSMAPDYEVVHQHGLDA
FT                   VFSVLNHIQTLPEALEEASDNIRITARNVAAVWKMGRS"
FT   gene            complement(133494..134762)
FT                   /locus_tag="YPK_0112"
FT   CDS_pept        complement(133494..134762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0112"
FT                   /product="Gluconate transporter"
FT                   /note="PFAM: Gluconate transporter; Citrate transporter;
FT                   KEGG: ypi:YpsIP31758_4051 transporter, gluconate:H+
FT                   symporter (GntP) family"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66425"
FT                   /db_xref="GOA:A0A0H3AWM6"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AWM6"
FT                   /protein_id="ACA66425.1"
FT                   /translation="MTTVSALGALVALIVSIVLILRKVPPAYGMIAGALAGGLVGGADL
FT                   IQTINLMITGAQGITNAVLRILAAGILAGVLIESGAANTIAETIVRKVGEKRALLALAV
FT                   ATMLLTAVGVFIDVAVITVSPIALAIAHRADISKMAILLAMVGGGKAGNVMSPNPNTIA
FT                   AADSFHVPLTSLMIAGIVPGLFGLALAYFMAKRLKHRGSKVEAHELVVSKNDTALPAFG
FT                   AAMAAPLVAIFLLALRPLAGIAIDPLVALPVGGLMGVVVMGQWRHTNQYMVSGLSRMAP
FT                   VAIMLLGTGTLAGIIANSGLKDVLISGLSASGMPSYLLAPISGALMSMATASTTAGTAV
FT                   ASAVFSSTLIGMGISALAGAAMVHAGATVLDHMPHGSFFHATGGSVNMQVHERLKLLPY
FT                   ETAVGLMIAFVSTLMFGVFNLAG"
FT   gene            complement(134940..136067)
FT                   /locus_tag="YPK_0113"
FT   CDS_pept        complement(134940..136067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0113"
FT                   /product="transcriptional regulator, CdaR"
FT                   /note="PFAM: sugar diacid recognition domain protein; KEGG:
FT                   yps:YPTB3819 putative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66426"
FT                   /db_xref="InterPro:IPR008599"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYC7"
FT                   /protein_id="ACA66426.1"
FT                   /translation="MPTSYLKEDTARQIVQRAMSIIDYSVNVMNEHGVIIASGDPRRLH
FT                   QRHEGAVLALTENRMVMIDEAVAGRLKGVKPGINLPIIFRQRMVGVIGISGEPDKVQAY
FT                   AELVRMAAELILEQAEMLEQNQWEKRYREQLTSQLIAQQGSAASVASMAAYLGLDLTLP
FT                   RIALIVSLREQEHAHQRDLVEILSNHSRETLVTLHGFERVVVLLPLNLAHSDDREVTAR
FT                   KALRKLYALLQPRFSLNMYVGGIFDGLDGLQRSYLSAQAMQETALRQKLTQPVMFYQDH
FT                   FLTVLLNDFAGSWQAGELSSAWQTLRQADSKDVLCHTLRCYFVQNCDLSQTSKQLHIHV
FT                   NTLRYRLQKIEAITALKINELNSILQLYIGMKIES"
FT   gene            complement(136278..137630)
FT                   /locus_tag="YPK_0114"
FT   CDS_pept        complement(136278..137630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0114"
FT                   /product="glutathione-disulfide reductase"
FT                   /note="TIGRFAM: glutathione-disulfide reductase; PFAM:
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; pyridine nucleotide-disulphide
FT                   oxidoreductase dimerisation region; KEGG: ypp:YPDSF_3342
FT                   glutathione reductase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66427"
FT                   /db_xref="GOA:A0A0H3AZE4"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006322"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZE4"
FT                   /protein_id="ACA66427.1"
FT                   /translation="MTKHYDYLAIGGGSGGIASINRAAMYGKKCALIEAKQLGGTCVNV
FT                   GCVPKKVMWHAAQIAEAIHLYGPDYGFDTTVNHFDWKKLIANRTAYIDRIHQSYERGLG
FT                   NNKVDVIQGFARFVDAHTVEVNGETITADHILIATGGRPSHPDIPGAEYGIDSDGFFEL
FT                   DEMPKRVAVVGAGYIAVEIAGVLNGLGTETHLFVRKHAPLRTFDPLIVETLLEVMNTEG
FT                   PKLHTESVPKAVIKNADGSLTLQLENGTEVTVDHLIWAIGREPATDNLNLSVTGVKTND
FT                   KGYIEVDKFQNTNVKGIYAVGDNTGAVELTPVAVAAGRRLSERLFNNKPDEHLDYSNIP
FT                   TVVFSHPPIGTIGLTEPQAREKFGDDQVKVYTSSFTAMYSAVTQHRQPCRMKLVCVGAE
FT                   EKIVGIHGIGFGMDEILQGFAVAMKMGATKKDFDNTVAIHPTAAEEFVTMR"
FT   gene            complement(137798..138640)
FT                   /locus_tag="YPK_0115"
FT   CDS_pept        complement(137798..138640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0115"
FT                   /product="protein of unknown function DUF519"
FT                   /note="PFAM: protein of unknown function DUF519; KEGG:
FT                   ypi:YpsIP31758_4048 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66428"
FT                   /db_xref="GOA:A0A0H3B038"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007473"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B038"
FT                   /protein_id="ACA66428.1"
FT                   /translation="MLSYRHSFHAGNHADVLKHTVQSLIIEAMKEKEKPFLYLDTHAGA
FT                   GRYQLSGEHAERTGEYLDGIGKLWQRDDLPADLAPYMSAINYFNRGEKLRYYPGSPLIA
FT                   RHLLREDDKIHLTELHSSDYPLLRNEFAKDERAKVQRADGYQQLKSQLPPLSRRGFVLI
FT                   DPPYEMKTDYQDVVKGIQEGYKRFATGTYALWYPVVLRQQIKRLLRDLEATGIRRILQI
FT                   ELAVRPDSDQHGMTASGMIVINPPWKLEQQMNSLLPWLHKALVPSGHGHTLVKWIVPE"
FT   gene            138969..141011
FT                   /locus_tag="YPK_0116"
FT   CDS_pept        138969..141011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0116"
FT                   /product="Oligopeptidase A"
FT                   /EC_number="3.4.24.70"
FT                   /note="PFAM: peptidase M3A and M3B thimet/oligopeptidase F;
FT                   KEGG: yps:YPTB3816 oligopeptidase A"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66429"
FT                   /db_xref="GOA:A0A0H3AYU3"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYU3"
FT                   /protein_id="ACA66429.1"
FT                   /translation="MTNPLLTPFSLPPFSAIRPEDIVPAVKSALDECRQAVERVVAQPG
FT                   PFTWDNLCQPLAESDDRLSRIWSPVGHLNSVKNSPELRTAYEQSLPLLSEYGTWVGQHK
FT                   GLYQAYVSLKEGPGFAALTAPQRKAVENALRDFQLSGIGLAPEQQKRYGEIVARLSELG
FT                   STYSNNVLDATMGWSKLITDVEQLKGLPESALAAAKAMAEAKEQDGWLLTLDMPSYLPV
FT                   LTYADNAELREEMYRAFATRASDQGPNAGKWDNSEIMAEILTLRHELAQLLGFNSYADK
FT                   SLATKMAENPQQVLGFLNDLAKRARPQAEEELAQLRAFAKEHYGVSELQAWDITYYSEK
FT                   QKQHLFAISDEQLRPYFPEQRVVEGLFEVVKRIYGITAKERHDVDTWHPDVRFFDLFDA
FT                   DGELRGSFYLDLYARENKRGGAWMDDCVGSLRLANGQLQKPVAYLTCNFNGPVGGKPAL
FT                   FTHNEVTTLFHEFGHGLHHMLTKIDTAGVSGINGVPWDAVELPSQFMENWCWEPEALAF
FT                   ISGHYQTHEPLPQEMLDKLLAAKNYQAALFILRQLEFGLFDFRMHYEFDPLTGAQILPI
FT                   LYEVKKQVAVVPSPEWGRFPHAFSHIFAGGYAAGYYSYLWAEVLSADAFSRFEEEGIFN
FT                   AATGQSFLDNILSQGGSEEPMTLFKRFRGREPQLDAMLRHYGIKG"
FT   gene            141015..141785
FT                   /locus_tag="YPK_0117"
FT   CDS_pept        141015..141785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0117"
FT                   /product="protein of unknown function DUF548"
FT                   /note="PFAM: protein of unknown function DUF548; KEGG:
FT                   ypi:YpsIP31758_4038 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66430"
FT                   /db_xref="GOA:B1JHU7"
FT                   /db_xref="InterPro:IPR007536"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JHU7"
FT                   /protein_id="ACA66430.1"
FT                   /translation="MSHVSICLLSEAGADPGALSILADRWGLVSDDQAVMALVLTAERL
FT                   ELRKRDEPKLGGIYVDFVSGTQAHRRKFGGGRGEAVAKAVGIKKGYLPRVVDATAGLGR
FT                   DAFVLAALGCQVQMLERNPVVAALLDDGLRRGYLDAEIGPWLRERLTLLHASSLTALVA
FT                   IEPCPEVVYLDPMYPHRQKSALVKKEMRVFQSLVGADNDADGLLAPARALATKRVVVKR
FT                   PDYAEPLAGVAAQAAVVTKSHRFDIYPSSVTPPR"
FT   gene            complement(141850..143184)
FT                   /locus_tag="YPK_0118"
FT   CDS_pept        complement(141850..143184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0118"
FT                   /product="Serralysin"
FT                   /EC_number="3.4.24.40"
FT                   /note="KEGG: yps:YPTB3814 metalloprotease; PFAM:
FT                   Hemolysin-type calcium-binding region; peptidase M10A and
FT                   M12B matrixin and adamalysin; Peptidase M10 serralysin;
FT                   SMART: peptidase metallopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66431"
FT                   /db_xref="GOA:A0A0H3AWN0"
FT                   /db_xref="InterPro:IPR006026"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR013858"
FT                   /db_xref="InterPro:IPR016294"
FT                   /db_xref="InterPro:IPR019960"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR034033"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AWN0"
FT                   /protein_id="ACA66431.1"
FT                   /translation="MFMSYSREHSNTIIKNEHVMRRGIHYKNEVKGVIAPQISSHQSWK
FT                   ENTIHNKNTNLTYSFSRAYTLWDYDRTFQQNAYVSLFNPAQIHQAKIAMQSWADVANIS
FT                   FTEASADSSANILFLNFQRPGNVAGYAYHPNPGSFSPIWINYSFSDNQHPSRLNYGGGV
FT                   LTHEIGHALGLGHSHAPHGYTQQMSVMSYLSEQDSGANYGQHYLSTPQMYDIAAIQYLY
FT                   GANLHTRTGDTVYGFNSTSYRDHFTATHASDALIFCVWDAGGNDTFDFSGYKQNQMINL
FT                   NELCFSDVGGLKGNVSIAADVTIENAIGGSGHDDIIGNHTNNILTGNGGSDQLWGNGGN
FT                   NTFRYASARDSMTTSPDTIHDFKSGRDKIDLSQLMPSTDRVIFVDRLSFNGQTEMGQQY
FT                   NEVADITYLMIDFDAQVSECDMMIKFTGRHHFTANDFILSTSLTA"
FT   gene            complement(143432..144775)
FT                   /locus_tag="YPK_0119"
FT   CDS_pept        complement(143432..144775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0119"
FT                   /product="Glutamate dehydrogenase (NADP(+))"
FT                   /EC_number="1.4.1.4"
FT                   /note="PFAM: Glu/Leu/Phe/Val dehydrogenase ;
FT                   Glu/Leu/Phe/Val dehydrogenase dimerisation region; KEGG:
FT                   ypi:YpsIP31758_4036 NADP-specific glutamate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66432"
FT                   /db_xref="GOA:A0A0H3AYD1"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYD1"
FT                   /protein_id="ACA66432.1"
FT                   /translation="MNGLVSLESFLESLQRRDANQPEYLQAVREVFTSLWPFLEQNPHY
FT                   REQSLLERLVEPERVIQFRVAWTDDKGHVQVNRAWRVQFSSAIGPYKGGMRFHPSVNLS
FT                   ILKFLGFEQTFKNALTTLPMGGGKGGSDFNPKGKSQAEVMRFCQALMTELYRHLGPDTD
FT                   VPAGDIGVGGREVAFMAGMMKKLSNNTACVFTGKGLSFGGSLIRPEATGYGLVYFTDAM
FT                   LKRHGLGFEGRKVSVSGAGNVAQYTIEKAMELGAKVVTASDSGGTVVDEVGFTPEKLAH
FT                   LAEIKNKRYGTIEDYARERNLVYLAGQQPWSVPVDIALPCATQNELDLPAALQLIANGV
FT                   KAVAEGANMPTTIQATDAFLEAGVLFAPGKAANAGGVATSGLEMAQNAARMSWKSEKVD
FT                   VRLHHIMLDIHQSCVEYGGEGKQTHYVHGANIAGFVKVADAMLAQGVL"
FT   gene            complement(145022..145468)
FT                   /locus_tag="YPK_0120"
FT   CDS_pept        complement(145022..145468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0120"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: ypi:YpsIP31758_4035
FT                   universal stress protein A"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66433"
FT                   /db_xref="GOA:A0A0H3AZF0"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZF0"
FT                   /protein_id="ACA66433.1"
FT                   /translation="MAYKHILIAVDLSPESKVLVEKAVSMAKPYNAKVSLIHVDVNYSD
FT                   LYTGLIDVNLGDMQKRISEETHNALTELSQNAGYPVEQTLSGSGDLGQVLVDAIKKYDI
FT                   DLVLCGHHQDFWSKLMSSARQLINTVHVDMLIVPLRDDDNGEDD"
FT   gene            146159..146494
FT                   /locus_tag="YPK_0121"
FT   CDS_pept        146159..146494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0121"
FT                   /product="universal stress protein B"
FT                   /note="KEGG: ypi:YpsIP31758_4034 universal stress protein
FT                   B"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66434"
FT                   /db_xref="GOA:B1JHV1"
FT                   /db_xref="InterPro:IPR019598"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JHV1"
FT                   /protein_id="ACA66434.1"
FT                   /translation="MISTVALFWALCVVCVVNMARYYSSLRALLVVLRGCDPLLYQYVD
FT                   GGGFFTSHGQPSKQIRLVGYIFAQRYLDHHDPEFIRRCERLRGQFILTSALCGLVVVSL
FT                   VALMLWY"
FT   gene            complement(146641..148236)
FT                   /locus_tag="YPK_0122"
FT   CDS_pept        complement(146641..148236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0122"
FT                   /product="phosphate transporter"
FT                   /note="PFAM: phosphate transporter; KEGG: ypp:YPDSF_3332
FT                   phosphate transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66435"
FT                   /db_xref="GOA:A0A0H3B041"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B041"
FT                   /protein_id="ACA66435.1"
FT                   /translation="MMLCQKKVIFSFYQPPIVTDNAPRSCPQTGVTLMLHLFAGLDFHT
FT                   GLMLVLALLFVLFYEAINGFHDTANAVATVIYTRAMRSQIAVVMAGVFNFLGVMLGGLS
FT                   VAYAIVHLLPTDLLLNVSSTHGLAMVFSMLLAAIIWNLGTWYFGIPASSSHTLIGAIIG
FT                   IGLTNALMTSTSVVDALNVPKMIQIFLSLILSPIVGLVIAGLMVFLLRRYWSSTKKQQR
FT                   IHLTPAEREKKDGKRKPPFWTRTALILSAIGVSFSHGANDGQKGIGLIMLVLIGVAPAG
FT                   FVVNMNATGYDIARTRDAVTHVQLYYQQHAEALPHAIALKPLVPAPETLPGTPAQFHCD
FT                   TSRAMVAINHAQALLTDLKSYDDLTVDQRSQMRRLLMCVAETAGAVAKLPETSAENRRF
FT                   LNNLRTDLLDTVEYAPTWIIVAVALALSLGTMIGWRRVAVTIGEKIGKKGMTYAQGVSA
FT                   QMTAAVSIGIASYTGMPVSTTQVLSSAVAGTMLVDGGGVQSKTVKNIMLAWVLTLPISI
FT                   FLSGALYWIALKFI"
FT   gene            148262..149644
FT                   /locus_tag="YPK_0123"
FT   CDS_pept        148262..149644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0123"
FT                   /product="HI0933 family protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; HI0933 family protein; FAD
FT                   dependent oxidoreductase; FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; KEGG: ypn:YPN_3615
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66436"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYV1"
FT                   /protein_id="ACA66436.1"
FT                   /translation="MYVISASYLVLPNITFSYYGALPAGDLQSPTANLSAEDNQKYDKQ
FT                   PKAGNFAAMMILFNEASVEQFDVVVIGAGAAGLFCAAQAGQAGCRVLLVDNGKKAGRKI
FT                   LMSGGGRCNFTNIYTEPAAYLSQNPHFCKSALARYTQWDFIDLMNRHNIAWHEKTLGQL
FT                   FCDDSAQQVVDLLLKECELGNVTVRLRSNVLSVEKSDTGFVLHINDLKVSANSLVVASG
FT                   GLSMPGLGASPFGYKLAEQFGLKVLPTRAALVPFTLHKPLLDHVQTLSGVSVPAVVTAE
FT                   NGVSFRESILFTHRGLSGPAILQLSSYWQAGEYVSINLLPDVDLAAFLNTERQAHPNQT
FT                   LKNTLAQLLPKRLVECLQTLEQLPDVTLKQLNVPQQAALIANLQQWRVQPNGTEGYRTA
FT                   EVTLGGVDTQELSSKTMEAHKVPGLYFIGEVVDVTGWLGGYNFQWAWSSAWACAQGLAA
FT                   KK"
FT   gene            complement(149780..152335)
FT                   /locus_tag="YPK_0124"
FT   CDS_pept        complement(149780..152335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0124"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: response
FT                   regulator receiver; ATP-binding region ATPase domain
FT                   protein; histidine kinase HAMP region domain protein;
FT                   histidine kinase A domain protein; PAS fold-4 domain
FT                   protein; KEGG: yps:YPTB3808 putative hybrid two-component
FT                   system regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66437"
FT                   /db_xref="GOA:A0A0H3AWN9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AWN9"
FT                   /protein_id="ACA66437.1"
FT                   /translation="MEQPRLSFFASVRGRLLFFNLLVVAVTLMVSGVAVLGFEQASRLQ
FT                   KQVQERTLRDMSSSLALARDTANVATAAVRLSQVVGALEFQSEAASLQETQLALRSSLT
FT                   HLANAPLASHEPLLVKRIIERSNELETSVARMLNLGHRRHLERNLLLSALYQTQSYLHH
FT                   LQEINQRDGLNKPDAALLKEMDRLLLVAIQTSSPKAAVQQLTEVMQALPAHADSPLVEE
FT                   ILQEFSASLYQLLPLSITLENSDLSITWYMYHVKALVAFLNQGINIYVQKVGEESLQRS
FT                   QQNHKALQSIITSIGLFALLALVITGFAGWYIYHNLGSNLTAISHAMTRLARGEKEVSV
FT                   PAQQRRDELGELARAFNVFARNTASLEQTSRLLKEKSTLLETTFHAMRDGFALFDNEGF
FT                   LVVWNPQYPLLLGLAPEQLQHGQHYLQLLKQMTPLQEHILENLALPLPKTQELRLEDHR
FT                   TIELRFSPVPGRGMVNVVLDRSERKALEEALVHSQKMKAVGQLTGGLAHDFNNLLAVII
FT                   GSLELTATDSSDATRIHRALKAAERGAQLTQRLLAFSRKQSLHPRAVAMKELLDNLDPL
FT                   IRHSLPAHLTLTIEAQQPAWHAWIDVNQLENAIINLVMNARDAMEGRSGEIKIRTWNQR
FT                   VERGEGRKQDMVVLEVADSGHGMTTAVKEQVFEPFFTTKQTGSGSGLGLSMVYGFVRQS
FT                   GGRVQIESEPGKGTRVCLQLPRALTQSLIEVLPALGAVANMADQLVLVLEDEPDVRQTL
FT                   CEQLHQLGYLTLETGDSRQALALMADVPDISIVISDLMLPGDMTGAEVLQQARSVYPHL
FT                   KLLLISGQDLRRSKNFMPEVELLRKPFNQQQLVQALQRV"
FT   sig_peptide     complement(152222..152335)
FT                   /locus_tag="YPK_0124"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.616) with cleavage site probability 0.517 at
FT                   residue 38"
FT   gene            152524..154047
FT                   /locus_tag="YPK_0125"
FT   CDS_pept        152524..154047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0125"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: yps:YPTB3807 ABC ribose transporter, fused
FT                   ATP-binding domains"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66438"
FT                   /db_xref="GOA:A0A0H3AYD7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015861"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYD7"
FT                   /protein_id="ACA66438.1"
FT                   /translation="MNKVPLLEMRNITKSFGKFQALKGVDLAVFSGEIHALMGENGAGK
FT                   STLMKILAGAYTTTSGEILIEGRPWSIKGPKDALNAGISLIYQEMQLAPNLTVAENIFL
FT                   GSELSRGGLVQRKEMVMQTQAVIDRLGAQFKASDLVMGLTIAEQQQVEIARALHRNSRI
FT                   LVMDEPTAALSTRETHRLFELILRLRDEGMAIIYISHRMAEVYELSDRVSVLRDGQYVG
FT                   SLMRANLNANELVRMMVGRPLSDLFNKERDIPLGHSRLNVHHLTDGAKVQAVSLQVRSG
FT                   EIVGLAGLVGAGRSELAQLIFGVRKATGGTIEIDGVPLVIHSPREAIRHGIGFLTENRK
FT                   EQGLFLELAAQDNITMATLERDACYGLLDRKKARAISDDAINRLNIRVPHAQVRAGGLS
FT                   GGNQQKLLISRWVAISPRILILDEPTRGVDVGAKSEIYRIMSQMAREGVAILMISSELP
FT                   EVVGMSDRVYVMHEGRIAGELHHPDITQENIMTLATGVTEDHKKEVYHD"
FT   gene            154040..155032
FT                   /locus_tag="YPK_0126"
FT   CDS_pept        154040..155032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0126"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   ypi:YpsIP31758_4029 ribose ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66439"
FT                   /db_xref="GOA:A0A0H3AZF5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZF5"
FT                   /protein_id="ACA66439.1"
FT                   /translation="MTNSGTPQQVAKSASLKKAFFSDLLQTVGILPILVLIVAVFGFLA
FT                   PNFFTESNLLNIARQSSINIVLAAGMTFIILTGGIDLSVGSILGTTAVTAMAVSLMPGW
FT                   EGLSIPAALLMGTGLGLFNGMLVAWAGLPPFIVTLGTYTALRGVAYLLADGTTIINSNI
FT                   NFEWIGNAYLGPVPWLVVIALLVVAVCWFILRRTTLGVHIYAVGGNMQAARLTGIKVWM
FT                   VLLFVYGMSGLLSGLGGVMSASRLYSANGNLGMGYELDAIAAVILGGTSFVGGVGTITG
FT                   TLVGALIIATLNNGMTLMGVSYFWQLVIKGAVIIIAVLIDKYRTRHHNS"
FT   gene            155063..156007
FT                   /locus_tag="YPK_0127"
FT   CDS_pept        155063..156007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0127"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: ypi:YpsIP31758_4028 ribose
FT                   ABC transporter, periplasmic ribose-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66440"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B048"
FT                   /protein_id="ACA66440.1"
FT                   /translation="MRLKPIMTALIAGAMIASSPALQAKELNSIGVTVGDLANPFFVQI
FT                   TKGVELEARKLAGDKVKVTLVSSGYDLGQQVAQIDNFIAAKVDMIILNAADSKGIGPAV
FT                   KRAKDAGIVVVAVDVAAEGADATITSDNTQAGAMACKYISDRLKEKGNVVIINGPPVSA
FT                   IQNRVEGCESEFKKYPDIKVLSSNQNAKGSREGGLEVMTSLLAVNPKIDGVFAINDPTA
FT                   IGADLAAKQAQRNEFFIVGVDGSPDAEEALKRGGNTLFVATPAQDPQVMASKAVEVGYG
FT                   ILQGNPAPKDPILIPVTLIDKNNISTYKGWTMK"
FT   sig_peptide     155063..155137
FT                   /locus_tag="YPK_0127"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.961 at
FT                   residue 25"
FT   gene            156082..156765
FT                   /locus_tag="YPK_0128"
FT   CDS_pept        156082..156765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0128"
FT                   /product="protein of unknown function DUF1498"
FT                   /note="PFAM: protein of unknown function DUF1498; KEGG:
FT                   ypi:YpsIP31758_4027 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66441"
FT                   /db_xref="InterPro:IPR010864"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYV8"
FT                   /protein_id="ACA66441.1"
FT                   /translation="MKRSEVNQILKQTGHFFARHHIQLPPFARFTPQIWQQLDPKAWQE
FT                   LFDLKLGWDITAFGGNHFFTQGLTLFTLRNGSVSGTPYPKCYAEKIMHVREGQVTPMHF
FT                   HWRKQEDIINRGGGNLIVELWNSDAFEQTEKSDVTVTLDGCRQTHAAGSQLRLSPGESI
FT                   CLVPGVYHSFWGEVGYGEVLVGEVSMVNDDDHDNRFMKPLERFNSIIEDEPAELVLCNE
FT                   YCRFV"
FT   gene            156791..157651
FT                   /locus_tag="YPK_0129"
FT   CDS_pept        156791..157651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0129"
FT                   /product="ketose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /note="KEGG: ypi:YpsIP31758_4026 putative
FT                   fructose-bisphosphate aldolase; TIGRFAM:
FT                   ketose-bisphosphate aldolase; PFAM: ketose-bisphosphate
FT                   aldolase class-II"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66442"
FT                   /db_xref="GOA:A0A0H3AWP4"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AWP4"
FT                   /protein_id="ACA66442.1"
FT                   /translation="MALISLANGLAHARKNGYALGAFNVLDSHFLRALFAAAKQERSPF
FT                   IINIAEVHFKYLSLESLVEAVKFEAAHHDIPVVLNLDHGLHFEAVVRALRLGFSSVMFD
FT                   GSTLEYEENVRQTREVVKMCHAVGVSVEAELGAVGGDEGGALYGEADSNKFTDPAIARD
FT                   FVDRTGIDALAVAIGNAHGKYKGEPKLDFARLAAIHQQTGLPLVLHGGSGISDTDFRRA
FT                   ISLGIHKINFYTGMSQAALAAVEQKMTHRHAIYDEFAELFLGIEEAITDVVAQQMRIFG
FT                   SSEQI"
FT   gene            157661..158668
FT                   /locus_tag="YPK_0130"
FT   CDS_pept        157661..158668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0130"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: ypi:YpsIP31758_4025
FT                   kinase, PfkB family"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66443"
FT                   /db_xref="GOA:A0A0H3AYE1"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYE1"
FT                   /protein_id="ACA66443.1"
FT                   /translation="MIERNGIIAAGNMLVDHVHQIEQWPQRGWLAEIVHSERSTGGAPL
FT                   NVLLTLAKMYTGLPLQAVGLIGDDHDGDYIMAMLDQYQVNRQHVRRTTLAPTSMSQVMT
FT                   DPSGQRTFFHSPGTNRLLDLPAFDGLDTSFKIFHLGYLLLLDSLDVEDTEYGTRSARLL
FT                   ALMSQLGYETSLDLVSREGDPRYHLLVTPTLCWLDYLTINELEAGELSGLEMRLADGTP
FT                   DVHHIAQAAKQLLEAGVRQRVVIHCPEGAWGVDHGQEGVWVPSWKLAQEEIVGSVGAGD
FT                   AFCAGILYGYHERWPLTDCIQLAHACARANLLCANAIDGAKPLAELDVFIRENR"
FT   gene            complement(158743..159480)
FT                   /locus_tag="YPK_0131"
FT   CDS_pept        complement(158743..159480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0131"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: ypi:YpsIP31758_4024
FT                   DNA-binding response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66444"
FT                   /db_xref="GOA:A0A0H3AZG2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZG2"
FT                   /protein_id="ACA66444.1"
FT                   /translation="MKPAILVVDDDTAICEVLRDVLNEHVFDVLLCHSGNEALQITATQ
FT                   PSIALILLDMMLPDINGLLVLQQVQKLRPSLPVVMLTGMGSESDMVVGLEMGADDYIAK
FT                   PFNARVVVARVKAVLRRSEVLAIESSSVIESSSVKACGLQFNGWRLNTDRCQLMNPQQQ
FT                   QIDLTQGEYGLLLSLMQNARKVLSREKLLELTHRESLDVFDRTIDVLIMRLRRKIEVNP
FT                   HQPTLIRTIRGVGYVFAADIIHA"
FT   gene            159903..160115
FT                   /locus_tag="YPK_0132"
FT   CDS_pept        159903..160115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0132"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ypn:YPN_3606 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66445"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B053"
FT                   /protein_id="ACA66445.1"
FT                   /translation="MIIIAVLSDERIKSLGVHIMKARHCSHCFQCLLSQPGAGFFFAFF
FT                   SPRSLLACLCHGFCRNNLPAEWHPL"
FT   gene            160244..160939
FT                   /locus_tag="YPK_0133"
FT   CDS_pept        160244..160939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0133"
FT                   /product="Pirin domain protein"
FT                   /note="PFAM: Pirin domain protein; Cupin 2 conserved barrel
FT                   domain protein; KEGG: ypi:YpsIP31758_4023 YhhW family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66446"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR041602"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYW4"
FT                   /protein_id="ACA66446.1"
FT                   /translation="MIFLRKADDRGHANHGWLDSWHTFSFADYYDPDFMGFSALRVINE
FT                   DVIDAGQGFGTHPHKDMEILTYVLSGTVEHQDSMGNKEQIHAGEFQIMSAGTGIRHSEY
FT                   NGRDDQPLHLYQIWIIPNKLGLEPRYEQRMFDLPQGRQLVLSPDARDGSLKVFQDMTLW
FT                   RWALNRTAQSTYQIQAERRVWIQVVRGKVSINGHHGGASDAFAIWDETALSIQADEDSE
FT                   ILLFDLPPI"
FT   gene            161125..162063
FT                   /locus_tag="YPK_0134"
FT   CDS_pept        161125..162063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0134"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; SMART: regulatory protein LacI;
FT                   KEGG: yps:YPTB3798 gluconate utilization system Gnt-I
FT                   transcriptional repressor"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66447"
FT                   /db_xref="GOA:A0A0H3AWP9"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AWP9"
FT                   /protein_id="ACA66447.1"
FT                   /translation="MTVSRYLRNPEQVSAVLQEKIALALDELGYIPNRAPDILSNATSH
FT                   AIGVLLPSLTNQVFAEVLRGIESVTDAHGYQTMLAHYGYQKEREEQRLTSLLSYNIDGL
FT                   ILSERHHTARTLKMIEVAGIPVIELMDCISPCLDLAVGFNNFEAARQMTQQIIAKGHRY
FT                   VVYFGARQDERTVIKQQGYEQAMRESGLVPMSVMTSRSSSYSAGAELLREAQVSYPQID
FT                   SIFCTNDDLAIGAVFECQRQGLSIPHDMAIAGFHGHDIGQSMVPKLASVLTPRERMGQI
FT                   GAERLLARLRGEVVTPQMVDVGFTILPGGSI"
FT   gene            complement(162155..163471)
FT                   /locus_tag="YPK_0135"
FT   CDS_pept        complement(162155..163471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0135"
FT                   /product="gluconate transporter"
FT                   /note="TIGRFAM: gluconate transporter; PFAM: Gluconate
FT                   transporter; Citrate transporter; KEGG: yps:YPTB3797
FT                   putative indonate/gluconate permease, GntP family"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66448"
FT                   /db_xref="GOA:A0A0H3AYE8"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYE8"
FT                   /protein_id="ACA66448.1"
FT                   /translation="MPLIIVAVGVAMLLLLMIRYKLNGFISLILVALAVGIMQGMPIDK
FT                   VVGSIKAGVGGTLGSLALIMGFGAMLGKLLADCGGAQRIATTLIEKFGQKHIQWAVVLT
FT                   GFTVGFALFYEVGFVLLLPLVFSIAASARIPLLYVGVPMAAALSVTHGFLPPHPGPTAI
FT                   ATIFSADMGKTLLYGTLLAIPTVILAGPVYARFLKGIDKPVPEGLYNPKIFTDKEMPSF
FT                   GVSVSTALVPVILMALRAVAEMILPKGHSLLPYAEFFGDPVIATLIAVLIAIFTFGLNR
FT                   GRSVESVMETLSDSIKIIAMMLLVIGGGGAFKQVLVDSGIEQYIAGMMGNSGASPILMA
FT                   WSIAALLRIALGSATVAAITAGGIVAPLIATTGASPELMVIAVGSGSVIFSHVNDPGFW
FT                   LFKEYFNLTIMETIKSWSVLETIISVCGLIGCLLLSLVI"
FT   gene            163688..164191
FT                   /locus_tag="YPK_0136"
FT   CDS_pept        163688..164191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0136"
FT                   /product="carbohydrate kinase, thermoresistant glucokinase
FT                   family"
FT                   /EC_number="2.7.1.12"
FT                   /note="KEGG: yps:YPTB3796 putative gluconokinase; TIGRFAM:
FT                   carbohydrate kinase, thermoresistant glucokinase family;
FT                   PFAM: shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66449"
FT                   /db_xref="GOA:A0A0H3AZG6"
FT                   /db_xref="InterPro:IPR006001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZG6"
FT                   /protein_id="ACA66449.1"
FT                   /translation="MAGQSIIVMGVSGSGKTTVGEAVARQIHAKFIDGDDLHPRANIQK
FT                   MGSGQPLNDADRMPWLERLSDAAYSLSHKNETGIIVCSALKRCYRDRLREGNQGMVFLY
FT                   LKGNFDVIMARLQARSGHFMPSDLLRSQFDALEEPGPDEPDVICVDIDTDIDEVVRRCV
FT                   GALA"
FT   gene            164373..164606
FT                   /locus_tag="YPK_0137"
FT   CDS_pept        164373..164606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0137"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ypi:YpsIP31758_4019 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66450"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B061"
FT                   /protein_id="ACA66450.1"
FT                   /translation="MSLSLPGIYLYNLSRDNLRPEEYERIVSAYAAWTRVCREYEFNDG
FT                   YHANHYIINMCERQVHHTQASSLGPREKDKLE"
FT   gene            164797..164937
FT                   /locus_tag="YPK_0138"
FT   CDS_pept        164797..164937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0138"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66451"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYX0"
FT                   /protein_id="ACA66451.1"
FT                   /translation="MIFSLFDVVMSDIDMPESGLKKGMKGVISITTRTIKPYMLIRLIP
FT                   G"
FT   gene            164992..165381
FT                   /locus_tag="YPK_0139"
FT   CDS_pept        164992..165381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0139"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ypp:YPDSF_3315 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66452"
FT                   /db_xref="InterPro:IPR040818"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AWQ4"
FT                   /protein_id="ACA66452.1"
FT                   /translation="MTNDTALDYVDRALRLAQKRHHHIKYNVIGGETLEPMYNSIVQQL
FT                   IYLHNVITGEEKDKTKLWKLTFGMYATKEFEATDPIFEDRLGDAFYIASQIRKGLKIKL
FT                   PNQVDPNFQDKQKRLKAAYPDDFDV"
FT   gene            complement(165566..166159)
FT                   /locus_tag="YPK_0140"
FT   CDS_pept        complement(165566..166159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0140"
FT                   /product="multiple antibiotic resistance (MarC)-related
FT                   protein"
FT                   /note="PFAM: multiple antibiotic resistance (MarC)-related
FT                   protein; KEGG: yps:YPTB3791 possible MarC family
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66453"
FT                   /db_xref="GOA:A0A0H3AYF4"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYF4"
FT                   /protein_id="ACA66453.1"
FT                   /translation="MTEMIAATVLLFLIMDPLGNLPIFMSVLKHLEPKRRRVVLIRELL
FT                   IALILMLIFLFAGEKILLFLNLRTETVSISGGIILFLIAIRMIFPSSESNVTGLSAGEE
FT                   PFLVPLAIPLVAGPSILATLMLLSHQYPNQLSHLVLALMIAWGLSAAILLMSNLFLRLL
FT                   GSKGVSALERLMGLILVMLSTQMFLDGVRAYLAI"
FT   gene            166518..167621
FT                   /locus_tag="YPK_0141"
FT   CDS_pept        166518..167621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0141"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /note="KEGG: ypi:YpsIP31758_4013 aspartate-semialdehyde
FT                   dehydrogenase; TIGRFAM: aspartate-semialdehyde
FT                   dehydrogenase; PFAM: Semialdehyde dehydrogenase NAD -
FT                   binding; Semialdehyde dehydrogenase dimerisation region"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66454"
FT                   /db_xref="GOA:A0A0H3AZH2"
FT                   /db_xref="InterPro:IPR000319"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR011534"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZH2"
FT                   /protein_id="ACA66454.1"
FT                   /translation="MKNVGFIGWRGMVGSVLMQRMIEERDFDGIRPVFFSTSQHGQAAP
FT                   AFAGHQGTLQDAYDIDALSALDIIITCQGGDYTNQIYPKLREIGWQGYWIDAASSLRMQ
FT                   DDTIIILDPVNHDVIKQGLDKGIKTFAGGNCTVSLMLMSLGGLFANNLVEWASVATYQA
FT                   ASGGGARHMRELLTQMGMLHAGVAKELQDPASAILDIERKVTSTTRSGTLPTDNFGVPL
FT                   AGSLIPWIDKALDNGQSREEWKGQAETNKILSTSTLIPVDGLCVRVGALRCHSQAFTLK
FT                   LKKDVPLAEIEQMLATHNDWVRVIPNDRELSMRELTPAAVTGTLNTPVGRLRKLNMGPE
FT                   YLSAFTVGDQLLWGAAEPLRRMLRILL"
FT   gene            168356..168664
FT                   /locus_tag="YPK_0142"
FT   CDS_pept        168356..168664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0142"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ypi:YpsIP31758_4011 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66455"
FT                   /db_xref="InterPro:IPR041129"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B065"
FT                   /protein_id="ACA66455.1"
FT                   /translation="MKIMGNFSALEHLIQIYFGQDYYEITGATTIAGVMAFYLQDNPPS
FT                   QIETLISDIAEFTAAYPNTLDDELNTRWGDDFSPELWGTTPQGFLHDVQNLALQHQG"
FT   gene            168671..168958
FT                   /locus_tag="YPK_0143"
FT   CDS_pept        168671..168958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0143"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ypi:YpsIP31758_4010 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66456"
FT                   /db_xref="InterPro:IPR041129"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYX9"
FT                   /protein_id="ACA66456.1"
FT                   /translation="MKAIHLGTLVRVFFGQDYDLFGEGIDEILASYRNTENQQTIQKTI
FT                   DEANMLLTAYPEEKELELEFADLAEGEFSPASWGYNVQSFLEKIVITLSK"
FT   gene            169116..169259
FT                   /locus_tag="YPK_0144"
FT   CDS_pept        169116..169259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0144"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ecp:ECP_3769 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66457"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AWQ9"
FT                   /protein_id="ACA66457.1"
FT                   /translation="MHERRHWADNPELILHVLRLRFDKALSYLVISAQTGVSKAAIFSL
FT                   EK"
FT   gene            170696..186709
FT                   /locus_tag="YPK_0145"
FT   CDS_pept        170696..186709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0145"
FT                   /product="conserved repeat domain protein"
FT                   /note="TIGRFAM: conserved repeat domain protein; PFAM:
FT                   Peptidoglycan-binding LysM; Ig domain protein group 1
FT                   domain protein; KEGG: yps:YPTB3789 possible bacterial
FT                   Ig-like domain (group 1)"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66458"
FT                   /db_xref="GOA:A0A0H3AYF9"
FT                   /db_xref="InterPro:IPR003344"
FT                   /db_xref="InterPro:IPR003535"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR024519"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="InterPro:IPR038177"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYF9"
FT                   /protein_id="ACA66458.1"
FT                   /translation="MLNYFRAILISWKWKLSHHTSRPHDVKEKGHPRKIKVVAWITLFF
FT                   QFAFPLSLSFTPAIAAANTTNSAPTSVITPVNASILPPAARATEPYTLGPGDSIQSIAK
FT                   KYNITVDELKKLNAYRTFSKPFASLTTGDEIEVPRKESSFFSNNPNENNKKDVDDLLAR
FT                   NAMGAGKLLSNDNTSDAASNMARSAVTNEINASSQQWLNQFGTARVQLNVDSDFKLDNS
FT                   ALDLLVPLKDSESSLLFTQLGVRNKDSRNTVNIGAGIRQYQGDWMYGANTFFDNDLTGK
FT                   NRRVGVGAEVATDYLKFSANTYFGLTGWHQSRDFSSYDERPADGFDIRTEAYLPAYPQL
FT                   GGKLMYEKYRGDEVALFGKDDRQKDPHAVTLGVNYTPVPLVTIGAEHREGKGNNNNTSV
FT                   NVQLNYRMGQPWNDQIDQSAVAANRTLAGSRYDLVERNNNIVLDYKKQELIHLVLPDRI
FT                   SGSGGGAITLTAQVRAKYGFSRIEWDATPLENAGGSTSPLTQSSLSVTLPFYQHILRTS
FT                   NTHTISAVAYDAQGNASNRAVTSIEVTRPETMVISHLATTVDNATANGIAANTVQATVT
FT                   DGDGQPIIGQIINFAVNTQATLSTTEARTGANGIASTTLTHTVAGVSAVSATLGSSSRS
FT                   VNTTFVADESTAEITAANLTVTTNDSVANGSDTNAVRAKVTDAYTNAVANQSVIFSASN
FT                   GATVIDQTVITNAEGIADSTLTNTTAGVSAVTATLGSQSQQVDTTFKPGSTAAISLVKL
FT                   ADRAVADGIDQNEIQVVLRDGTGNAVPNVPMSIQADNGAIVVASTPNTGVDGTINATFT
FT                   NLRAGESVVSVTSPALVGMTMTMTFSADQRTAVVSTLAAIDNNAKADGTDTNVVRAWVV
FT                   DANGNSVPGVSVTFDAGNGAVLAQNPVVTDRNGYAENTLTNLAIGTTTVKATTVTDPVG
FT                   QTVNTHFVAGAVDTITLTVLVNGAVANGVNTNSVQAVVSDSGGNPVNGAAVVFSSANAT
FT                   AQITTVIGTTGVDGIATATLTNTVAGTSNVVATIDTVNANIDTTFVAGAVATITLTTLV
FT                   NGAVADGANSNSVQAVVSDSGGNPVTGAAVVFSSANATAQITTVIGTTGVDGIATATLT
FT                   NTVAGTSNVVATIGSITNNIDTAFVAGAVATITLTTPVNGAVADGANSNSVQAVVTDSG
FT                   GNPVNGAAVVFSSANATAQITTVIGTTGADGIATATLTNTVAGTSNVVATVDTVNANID
FT                   TTFVAGAVATITLTTPVNGAVADGADSNSVQAVVSDSGGNPVAGAAVVFSSANATAQVT
FT                   TVIGTTGADGIATATLTNTVAGTSNVVATIGSITNNIDTAFVAGAVATITLSVPVNDAT
FT                   ADGVDTNQVDALVQDANGNAITGAAVVFSSTNGADIIVPTMNTGVNGVASTLLTHTVAG
FT                   TSNVVATVDTVNANIDTAFVPGAVATITLTTPVNGAVADGANSNSVQAVVSDSEGNAVA
FT                   GAAVVFSSANATAQITTVIGTTGADGIATATLTNTVAGTSNVVATIDTVNANIDTAFVP
FT                   GAVATITLSVLVNDATADGADTNQVDALVQDANGNAITGAAVVFSSANGADIIAPTMNT
FT                   GVNGVASTLLTHTQSGVSNVVATIDTVNANIDTTFVAGAVAAITLTTPVDGAVADGTDS
FT                   NSVQAVVSDSEGNAVAGAAVVFSSANATAQITTVIGTTGADGIATATLTNTVAGTSNVA
FT                   ATIGSITDNIDTVFVAGAVATITLSVPVNDATADGADTNQVDALVQDVNGNAITGAAVV
FT                   FSSANGATILSSTVNTGADGIASTTLTHTQSGVSNVVATIDTVNANIDTTFVAGAVATI
FT                   TLSVLVNDATADGADTNQVDALVQDANGNAITGAAVVFSSANGATIIVPTMNTGANGVA
FT                   STLLTHTVAGTSNVVATIGSITNNIDTAFVAGAVATITLTTPVNGAVADGANSNSVQAV
FT                   VSDSEGNAVAGAAVVFSSANATAQITTVIGTTGADGIATATLTNTVAGTSNVVATIGSI
FT                   TDNIDTVFVAGAVATITLTTPVNGAVADGANSNSVQAVVSDSEGNPVTGATVVFSSSNA
FT                   TAQITTVIGTTGADGIATATLTNTVAGTSNVVATIDTVNANIDTTFVPGAVATITLTTP
FT                   VDGAVADGANSNSVQAVVTDSGGNPVTGAAVVFSSANATAQITTVIGTTGADGIATATL
FT                   TNTVAGTSNVVATVDTVNANIDTTFVAGAVATITLTTPVNGAVANGADSNSVQAVVSDS
FT                   EGNAVAGAAVVFSSANATAQITTVIGTTGADGIATATLINTVAGTSNVVATIDTVNANI
FT                   DTTFVAGAVATITLTTPVDGAVANGADSNSVQAVVSDSEGNAVAGAAVVFSSANATAQI
FT                   TTVIGTTGADGIATATLTNTVAGTSNVVATIGSITNNIDTAFVAGAVATITLTTPVNGA
FT                   VADGANSNSVQAVVTDSGGNPVNGAAVVFSSANATAQITTVIGTTGADGIATATLTNTV
FT                   AGTSNVVATVDTVNANIDTTFVAGAVATITLTTPVNGAVADGADSNSVQAVVSDSGGNP
FT                   VAGAAVVFSSANATAQVTTVIGTTGADGIATATLTNTVAGTSNVVATIGSITNNIDTAF
FT                   VAGAVATITLTTPVNGAVADGADSNSVQAVVSDSEGNAVTGAAVVFSSANATAQITTVI
FT                   GTTGADGIATATLTNTVAGTSNVVATIGGITNNIDTAFVAGAVATITLTTPVNGAVADG
FT                   TDSNSVQAVVSDSEGNAVAGAAVVFSSANATAQITTVIGTTGADGIATATLTNTVAGTS
FT                   NVVATIGSITNNIDTAFVAGAVATITLTTLVNGAVANGADSNSVQAVVSDSGGNVVAGA
FT                   TVVFSSTNATAQVTTVIGTTGADGIATATLTNTVAGTSNVVATIDTVNANIDTTFVAGA
FT                   VATITLSVLVNDATADGADTNQVDALVQDANGNAITGAAVVFSSANGATILSSTMNTGV
FT                   NGVASTLLTHTVAGTSNVVATIDTVNANIDTAFVAGAVATITLTTPVNGAVANGADSNS
FT                   VQAVVSDSEGNAVAGAAVVFSSANATAQITTVIGTTGVDGIATATLTNTVAGTSNVVAT
FT                   VDTVNANIDTAFVAGAVATITLTTPVNGAVANGADSNSVQAVVSDSGGNVVAGATVVFS
FT                   STNTTAQVTTVIGTTGADGIATATLTNTVAGTSNVVATVDTVNANIDTTFVAGAVATIT
FT                   LSVLVNDATADGADTNQVDALVQDANGNAITGAAVVFSSANGADIIAPTMNTGVNGVAS
FT                   TLLTHTMAGTSNVIATIDTVNANIDTTFVAGAVATITLSVPVNDATADGADTNQVDALV
FT                   QDANGNAITGAAVVFSSANGATILSSTMNTGVNGVASTLLTHTQSGVSNVVATIDTVNA
FT                   NIDTAFVAGAVATITLTTPVNGAVADGANSNSVQAVVTDSGGNPVNGAAVVFSSANATA
FT                   QITTVIGTTGADGIATATLTNTVAGTSNVAATIDTVNANIDTTFVAGAVATITLTTPVN
FT                   GAVADGANSNSVQAVVSDSEGNPVNGATVVFSSINATAQITTVIGTTGVDGIATATLTN
FT                   TVAGTSNVVATIDTVNANIDTTFVAGAVATITLTTLVNGAVADGANSNSVQAVVSDSGG
FT                   NPVTGAAVVFSSANATAQITTVIGTTGVDGIATATLTNTVAGTSNVVATIGSITNNIDT
FT                   AFVAGAVATITLTTPVNGAVADGANSNSVQAVVTDSGGNPVNGAAVVFSSANATAQITT
FT                   VIGTTGADGIATATLTNTVAGTSNVIATIDTVNANIDTTFVAGAVATITLTTPVNGAVA
FT                   DGADSNSVQAVVSDSEGNAVTGAAVVFSSANATAQITTVIGTTGADGIATATLTNTVAG
FT                   TSNVVATIDTVNANIDTAFVAGELENIVVSIINNNALANGADTNIVEAFVTDRFGNGVA
FT                   NQSLMFGTNGASIVGSSTVTTNIDGRVRVSATHTVAGSSNTVFAISGAHQGYTRVTFVA
FT                   DASTAQLKLTSFLDNQLANGKAGNIAQALVTDAYDNPLANQSVSFALDNGAVIESRGDA
FT                   SSASGIVLMRFNNTLAGMTTVTATLDSTGQTETLEMHFVAGKAASIELTMTKDNAVANN
FT                   IDTNEVQVLVTDADGNAINGAVVNLTSNSGMNITPNSVTTGSDGTATATLTHTLAGSLP
FT                   INARIDQVSKTINATFIADVSTAQIIASDMFIIVNDQVANGQAVNAVQARVTDSYGNPI
FT                   QGQLVEFVLSNTGTIQYKLEETSVEGGVMVTFTNTLAGITNVTATVVSSRSSQNVDTTF
FT                   IADVTTAHIAESDLMVIVDNAVANNSEKNEVHARVTDAKGNVLSGQTVIFTSGNGAAIT
FT                   TVNGISDGDGLTKATLTHTLAGTSVVTARVGNQVQSKDTTFIADRTTATIRASDLTITR
FT                   SNALADGVATNAARVIVTDAYGNPVPSMLVSYTSENGATLTPTLGSTDSSGMLSTTFTH
FT                   TIAGISKVTATIVTMGISQAKDAVFIADRTTAHVSALTVEKNDSLANNSDRNIVQAHIQ
FT                   DAHGNVITGMNVNFSATENVTLAANMVTTNAQGYAENTLRHNAPVTSAVTATVATDLVG
FT                   LTEDVRFVAGAGARIELFRLNDGAVADGIQTNRVEARVYDVSDNLVPNSNVVFSADNGG
FT                   QLVQNDVQTDALGSAYVTVSNINTGVTKVSVTADGVSASTTTTFIADKDTVTLRADLFL
FT                   ITHDNAVANGVTENRVLLQLLDANDNKVSGVEVNFTATNGASINASAITDTNGLAIGVL
FT                   TNTLSGPSDVTVTLVTPGGTESLTVTPQFIADINTARIANGDFVIIDDGAVANSVDANE
FT                   VRARVTDNQGNAIAGYSVTFASQNGATITTSGITGVDGWASAKLTHTKAGESGILARIS
FT                   RPGSMVQVLTPYFIADVSTATLQLFNFNPIPIIADGVMQFFVLGRVFDANQNPVGGQQV
FT                   AFSATNEVTLTESNGSISTPEGSVLLSVTSTQAGVHPITGTLVSNNYTDTFGATFIANK
FT                   NTAQLSTLMVVDNNALADGVTRNQVRAHVVDSTGNSVADIAVTFTANHGAQLSHVTVLT
FT                   DDNGDAVNTLTNSLVGVTVVTAKLGTAGTPLTVDTVFTAGPLATLTLVTMVDNAFADNS
FT                   ATNTVQATLKDATGNPIVGEVVAFAASNGATITATDGGVSNANGIVLATLTNGAAGVST
FT                   VTATIETLTATTETTFIAMKNLDVTVGDTTFDGDAGFPTTGFVGAAFKVNSGGDNSLYD
FT                   WSSSAPALVSVSGEGVVTFNAVFPTGTPAITISATPKGGGSPLSYSFRVNQWFINNNGV
FT                   ALNRADAATYCANAGYTTVSSSQVTNAIVWGMGTRAMGNLWSEWGDFNNYNVPGWEPAE
FT                   FFWLSDNYNATDGLAASLSHGVLTTMGDPMAMIHVMCTRPI"
FT   sig_peptide     170696..170878
FT                   /locus_tag="YPK_0145"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.871) with cleavage site probability 0.457 at
FT                   residue 61"
FT   gene            complement(186934..188631)
FT                   /locus_tag="YPK_0146"
FT   CDS_pept        complement(186934..188631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0146"
FT                   /product="signal transduction histidine kinase, LytS"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase internal region; 5TM Receptors of the
FT                   LytS-YhcK type transmembrane region; KEGG: yps:YPTB3788
FT                   putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66459"
FT                   /db_xref="GOA:A0A0H3AZH3"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR011620"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZH3"
FT                   /protein_id="ACA66459.1"
FT                   /translation="MGISQTELIFSLLQQMCVYLVIAYLLSKTPLFIPLMQVTIRLPHK
FT                   LVCYLTFSMFCIMGTYFGLNIDDSIANTRAIGAVLGGMLGGPSVGFLVGLTGGLHRYSM
FT                   GGMTATACMLSTIAEGLLGGLLHLYLTRKNRLDLLFQPLVVAGITLVAEVLQMMIILAV
FT                   ARPFNEAVELVENIALPMMITNTIGAAMFMRILLDRRAIFEKYTTAFSAKALQIAARAE
FT                   GLLRHGFDQQNSMRVARILYEELGVGAVAITDREKLLAFIGSGADHHQVGSAITSDHTH
FT                   RAIELNQVVYADGNAVPYTCSISPTCKLGSTLVIPLRGEEHRVIGSIKLYEPKSKLFSS
FT                   INRTLGEGIAHLLSAQILAGEFEQQKQLLAQSEIKLLHAQVNPHFLFNALNTLSVVIRR
FT                   NPDHARNLVLSLSTFFRKNLKRSHDVVTLSDEIEHVNAYLEIEKARFADRLTVTVSLPN
FT                   ELMEARLPAFSLQPVVENAIKHGISQMFSNGRVTLRGKLDDNTLVLEVEDNAGLYQPQP
FT                   DGDGLGMSLVDRRIKARSGNEYGITVVSEAEVFTRIIIKLPFITVSEY"
FT   gene            189137..191320
FT                   /locus_tag="YPK_0147"
FT   CDS_pept        189137..191320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0147"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /note="KEGG: yps:YPTB3787 glycogen branching enzyme;
FT                   TIGRFAM: 1,4-alpha-glucan branching enzyme; PFAM: glycoside
FT                   hydrolase family 13 domain protein; alpha amylase catalytic
FT                   region; alpha amylase all-beta; SMART: alpha amylase
FT                   catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66460"
FT                   /db_xref="GOA:A0A0H3B072"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B072"
FT                   /protein_id="ACA66460.1"
FT                   /translation="MSVLPDRQVINQLISGHYGDPFSILGMHETSQGLQICALLPDARE
FT                   VWLVETENGRRIAQLTLEDPRGFFIAQLTRRKKSFRYQFAVTWQESPQIIEDPYRFGPL
FT                   LQDIDSWLLAEGTHLRPYERLGAHLMSLDGVSGVSFAVWAPNAQRVSVVGDFNFWDGRR
FT                   HPMRLRRENGIWELFLPGIEAGQLYKFEIIDCHGQVRLKADPYAFEAQMRPETASLISP
FT                   LPDVVKSSAARQKANDLCSPVSIYEVHLGSWRRHTDNNFWLSYRELADQLVEYVKYMGF
FT                   THVELLPINEHPFDGSWGYQPLGLYAPTRRYGTPEDFKAFVAKFHQAGINVILDWVPGH
FT                   FPSDEHGLSTFDGTALYEYADPREGYHQDWNTLIYNYGRNEVRNYLAGNAFYWMERFGI
FT                   DALRIDAVASMIYRDYSRAEGQWVPNYYGGRENLEAIAFLRYTNKTIGVERPGSVTMAE
FT                   ESTDFPGVTLPPDIGGLGFNYKWNMGWMHDTLNYMQCDPVHRKYHHNLMTFGMLYAYTE
FT                   NFILPLSHDEVVHGKRSILDRMPGDAWQKFANLRAYYAFMWAHPGKKLLFMGCEFAQGR
FT                   EWNFETSLDWHLLDDENGWHSGVQRLVRDLNHCYRQYAPLYEWDYQPAGFEWLVVDDHE
FT                   NSVFAFLRRDAEGHELIAISNFTPVPRYHYRVGIPQGGHYREVLNSDSAFYCGSNLGNQ
FT                   GGIDSHHVRSHNHEHSLLLTLPPLATIYLLREN"
FT   gene            191322..193310
FT                   /locus_tag="YPK_0148"
FT   CDS_pept        191322..193310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0148"
FT                   /product="glycogen debranching enzyme GlgX"
FT                   /note="KEGG: yps:YPTB3786 putative alpha-amylase; TIGRFAM:
FT                   glycogen debranching enzyme GlgX; PFAM: glycoside hydrolase
FT                   family 13 domain protein; alpha amylase catalytic region;
FT                   SMART: alpha amylase catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66461"
FT                   /db_xref="GOA:B1JHX8"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011837"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022844"
FT                   /db_xref="InterPro:IPR040784"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JHX8"
FT                   /protein_id="ACA66461.1"
FT                   /translation="MAVLTHGSPTPSGAYFDGKGINFTLFSAHAEQVTLCLFDEQGQER
FT                   QIAMPARTGDIWHGYLPGGKPGQRYGYRVSGPFDPSRGHRFNPHKLLIDPRTRALEGKV
FT                   GDDPRFTGGVSQPDVRDSAAALPKCLVIHEEYDWQGDKPPAIPWGNTVIYEAHVRGLTQ
FT                   LHPDIPPELRGTYAALAHPALIEHLKTLGITTLELLPVQFHIDEPRLQKMGLSNYWGYN
FT                   VLAPFAVDPDYASGREGISPLRELRDAVKALHNAGIEVILDVVFNHSAELDVFGPTLCQ
FT                   RGIDNASYYWLTPDGEYDNITGCGNALRLSHPYVTQWVIDCLNYWRDSCHVDGFRFDLG
FT                   TVLGRTPAFDQHAPLFAALAADERLSACKLIAEPWDIGLGGYQLGNFPTGFSEWNDQYR
FT                   DAMRGFWLRGEVPRGTFAQHFAASSRLFEQRGRLPSASINQITAHDGFTLLDLLCFNQK
FT                   HNQMNGEENRDGSDNNHSNNFGCEGLVADAAIWQRRKACQRALLTTLLLSQGTPMLLAG
FT                   DEQGHSQQGNNNAYCQNNILTWLDWGSADRALMTFTADLIRLRQQIPALTQDQWWQSGD
FT                   SNVQWLDSQGQALSDAAWEQGCQQQLQILLSQRWLVLINATDHECEMHLPEGEWEGIPP
FT                   FGVSDHAERLTTWRGSAHTICVLIKRD"
FT   gene            193320..194606
FT                   /locus_tag="YPK_0149"
FT   CDS_pept        193320..194606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0149"
FT                   /product="glucose-1-phosphate adenylyltransferase"
FT                   /note="TIGRFAM: glucose-1-phosphate adenylyltransferase;
FT                   PFAM: Nucleotidyl transferase; KEGG: ypi:YpsIP31758_4004
FT                   glucose-1-phosphate adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66462"
FT                   /db_xref="GOA:B1JHX9"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005836"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR011831"
FT                   /db_xref="InterPro:IPR023049"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JHX9"
FT                   /protein_id="ACA66462.1"
FT                   /translation="MVRFESTDSLMLARQLPNKTVALILAGGRGSRLKDLTATRAKPAV
FT                   HFGGKFRIIDFALSNCLNSGVRRIGVITQYQSHTLVQHIQRGWSFLNEEMNEFVDLLPA
FT                   QQRLSTEQWYKGTADAVCQNLDIIRRYDAEYIVILAGDHIYKMDYSRMLLDHVEKGAEC
FT                   TVACIPVPISEGSEFGIMEVTADYQITAFYEKPANPPPIPGDPSNALASMGIYIFNADY
FT                   LFKLLEEDNNTPGSSHDFGKDIIPQLTARKVVWAHPFDLSCVTSNAELPPYWRDVGTLD
FT                   AYWRANLDLASVTPELDMYDRAWPIRTHMEPLPPAKFVQDRSGSHGMTMNSLVSGGCIV
FT                   SGSVVVHSVLFPRVRVNSFCTIDSSLLLPDVHVGRSCRLRRCIIDRACHIPEGMVIGEN
FT                   ADEDSARFYRSEGGVVLVTRDMLAKLEAK"
FT   gene            194817..196247
FT                   /locus_tag="YPK_0150"
FT   CDS_pept        194817..196247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0150"
FT                   /product="glycogen/starch synthase, ADP-glucose type"
FT                   /note="TIGRFAM: glycogen/starch synthase, ADP-glucose type;
FT                   PFAM: glycosyl transferase group 1; Starch synthase
FT                   catalytic domain protein; KEGG: yps:YPTB3784 glycogen
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66463"
FT                   /db_xref="GOA:B1JHY0"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JHY0"
FT                   /protein_id="ACA66463.1"
FT                   /translation="MRVLHVCSELFPLLKTGGLADVIGALPAAQLAEGADVRIILPAFP
FT                   DLRRGIPETVLVREIDTFAGRVALRYGHYRGIGIYLIDAPALYDRAGSPYHDASLYAYS
FT                   DNYLRFALLGWMACELACGLDGYWRPEVVHAHDWHAGLTCAYLAARGRPARSVFTVHNL
FT                   AYQGLFSADHLSELHLPAEFFQIYGLEFYGQISYLKAGLFFADHVTTVSPTYAKEITQP
FT                   AFGYGMEGLLQALARQGRLTGILNGVDSDIWDPQSDTLLPTRYDAENLQAKAINKTHLQ
FT                   TAMGLQLAENKPIFAVVSRLTVQKGLDLVLEALPELLALGGQLVVLGSGDATLQEAFLA
FT                   AAAEHSGQVGVQIGYHEAFSHRIIAGSDVILVPSRFEPCGLTQLYGLKYGTLPLVRHTG
FT                   GLADTVVDCALENLADGSASGFVFNECEAQALVKAIRRAFVLWSRPKHWRHVQRHAMRL
FT                   DFGWQLAAVDYLSLYRRL"
FT   gene            196560..199007
FT                   /locus_tag="YPK_0151"
FT   CDS_pept        196560..199007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0151"
FT                   /product="glycogen/starch/alpha-glucan phosphorylase"
FT                   /EC_number="2.4.1.1"
FT                   /note="KEGG: yps:YPTB3783 glycogen phosphorylase; TIGRFAM:
FT                   glycogen/starch/alpha-glucan phosphorylase; PFAM: glycosyl
FT                   transferase family 35"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66464"
FT                   /db_xref="GOA:A0A0H3AYY3"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYY3"
FT                   /protein_id="ACA66464.1"
FT                   /translation="MTSPFSYTSPVVSVDALKHSIAYKLMFIIGKDPTIATQHDWLNAT
FT                   LFAVRDRMVERWLRSNRAQLSQDVRQVYYLSMEFLLGRTLSNALLSMGIYDEIEQALDE
FT                   MGLSLSELLKEENDPGLGNGGLGRLAACFLDSLATLALPGRGYGIRYEYGMFSQKIVNG
FT                   QQMESPDNWLEYGNAWEFPRHNTRYKVRFGGRIQQEGSKIRWLETEEILACAYDQIIPG
FT                   FDTDATNTLRLWSAQASNEINLGKFNQGDYFAAVEDKNHSENVSRVLYPDDSTYSGREL
FT                   RLRQEYFLVSATVQDILNRHWAMHHTFNNLADKIAIHLNDTHPVLSIPEMMRLLIDEHK
FT                   FTWMDAWDVVQQVFSYTNHTLMSEALETWPVDMIGKILPRHLQIIFDINEHFLKLVEEQ
FT                   YPDDKELLSRVSVIDENNGRRIRMAWLAVIASHKVNGVSALHSELMVQSLFADFARIFP
FT                   NRFCNKTNGVTPRRWLGLANRPLAAVLDDSIGQTWRTDLSQLSELEKNLDYPSFLLALQ
FT                   KAKLENKKRLAVYIAEKLNIVVNPAALFDVQIKRIHEYKRQLLNVLHVITRYNRIIDAP
FT                   DNNWVPRVVIFAGKAASAYYNAKQIIHLINDVAKVINNDPRINNLLKVVFIPNYSVSLA
FT                   QLIIPAADLSEQISLAGTEASGTSNMKFALNGALTIGTLDGANVEIREHVGEENIFIFG
FT                   NTTEQVEALRKSGYNPRKYYDEDPELHQVLTQIATGTFSPEEPHRYTNLFDSLVNLGDH
FT                   YQLLADYRSYVDTQEQVDALYRNRDEWSRKTLLNIANMGYFSSDRTIKEYADEIWHIKP
FT                   IRL"
FT   gene            complement(199169..200683)
FT                   /locus_tag="YPK_0152"
FT   CDS_pept        complement(199169..200683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0152"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   ypi:YpsIP31758_4000 aerobic glycerol-3-phosphate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66465"
FT                   /db_xref="GOA:A0A0H3AWR3"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AWR3"
FT                   /protein_id="ACA66465.1"
FT                   /translation="METKDLIVIGGGINGAGIAADAAGRGLSVLLLEAQDLACATSSAS
FT                   SKLIHGGLRYLEHYEFRLVSEALAEREVLLKLAPHIAFPMRFRLPHQPHLRPAWMIRTG
FT                   LFLYDHLGKRTSLPASKGLRFGPESVLKPELVRGFEYSDCWVDDARLVVLNAQEVVKHG
FT                   GEVRTRTKVTRAWREQGLWMVEALDVNTGKTFTWRAKGLVNATGPWVKQFFDDGLKLKS
FT                   PYGIRLIKGSHIVVPRVHNQPQAYILQNEDHRIVFVIPWLDDYSIIGTTDVEYHGDPKE
FT                   VKIDDQEMTYLLKVYNDHFKKQLGRDDIVWTYSGVRPLCDDESDSPQAVTRDYTLDVAD
FT                   EAGQAPLLSVFGGKLTTYRKLAEHALEKLSAYYPNVGPAWTKTGALPGGDIGGSRDSYT
FT                   VQLRHRYNWLPEGLARRYTRTYGSHSELILANATRLESLGEHFGHGLYEAELRYLVENE
FT                   WVVELDDAIWRRTKLGMALSDEEKQRVAQWLADAHTEKQQALPLVS"
FT   gene            201082..201456
FT                   /locus_tag="YPK_0153"
FT   CDS_pept        201082..201456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0153"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ypn:YPN_3584 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66466"
FT                   /db_xref="GOA:A0A0H3AYG7"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYG7"
FT                   /protein_id="ACA66466.1"
FT                   /translation="MISLSESIYERSAGNMNTAVSTGRINMVHIFSFSTYIICTVFSLL
FT                   LFYYLVSHLLHSKHFILNVVSSFLILGCAKYHFNVAKTGALPIFNITIDSGGVFIAVLI
FT                   PFIFSLSYSVPFYMVYKRYY"
FT   gene            201765..202229
FT                   /locus_tag="YPK_0154"
FT   CDS_pept        201765..202229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0154"
FT                   /product="protein of unknown function DUF943"
FT                   /note="PFAM: protein of unknown function DUF943; KEGG:
FT                   yps:YPTB3781 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66467"
FT                   /db_xref="InterPro:IPR010351"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZH8"
FT                   /protein_id="ACA66467.1"
FT                   /translation="MKVKSKKNLWALLLTGSALLGYVFWLLLHPVEIVSVHQRNDYSDV
FT                   LVRNFPLTDKSKINWWLENRDMLKDKYSIPKPASDGFYTVIFWDFGDGYKEEGKYDRRC
FT                   FDDMKTSKNCIDKNKVFSVENDRNKDILFSVYDGMYRLEKNGKIVKMKRE"
FT   sig_peptide     201765..201830
FT                   /locus_tag="YPK_0154"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.933) with cleavage site probability 0.579 at
FT                   residue 22"
FT   gene            202248..202664
FT                   /locus_tag="YPK_0155"
FT   CDS_pept        202248..202664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0155"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: yps:YPTB3780 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66468"
FT                   /db_xref="GOA:A0A0H3B078"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B078"
FT                   /protein_id="ACA66468.1"
FT                   /translation="MTVFHRAQTRLASSYIFVTLGVIGFFLSFIAAGVNEKSVYTQDDF
FT                   IKYHMLTDRDIEKTPKITRDYYFEYQPGDGYNPSSTIIFNHTFDASPLKNYLNSLGYER
FT                   QSQILVIVKCGHYQAKRHNPLSISGWIRRTIKFG"
FT   sig_peptide     202248..202349
FT                   /locus_tag="YPK_0155"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.616) with cleavage site probability 0.425 at
FT                   residue 34"
FT   gene            203131..203298
FT                   /locus_tag="YPK_0156"
FT   CDS_pept        203131..203298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0156"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66469"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYY8"
FT                   /protein_id="ACA66469.1"
FT                   /translation="MPSEGRLSRKRIGPVRQRNDESREPTQWASDSAKARGSKGATLMA
FT                   PLAVGSSEAR"
FT   gene            complement(203394..204152)
FT                   /locus_tag="YPK_0157"
FT   CDS_pept        complement(203394..204152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0157"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: regulatory protein DeoR; Helix-turn-helix type
FT                   11 domain protein; KEGG: ypi:YpsIP31758_3997
FT                   glycerol-3-phosphate regulon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66470"
FT                   /db_xref="GOA:A0A0H3AWR7"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AWR7"
FT                   /protein_id="ACA66470.1"
FT                   /translation="MKQTQRHDAIIELVRLQGYVSTEELVEHFAVSPQTIRRDLNELAD
FT                   QNKIHRHHGGAALPSSSVNAAYNDRKVMWSEEKARIAQRVASQIPDGATLFIDIGTTPE
FT                   AVAHALMNHKGLRVVTNNLNVATLLTAKEDFRLILAGGEVRTRDGGIIGEATLDFISQF
FT                   RLDYGILGISGIDMDGSLLEFDYHEVRTKRAIIENSRCVMLVTDHSKFGRNAMVNLGNM
FT                   NLIDYLFTDQQPPASVMKIIEQHEVQLELC"
FT   gene            complement(204187..205023)
FT                   /locus_tag="YPK_0158"
FT   CDS_pept        complement(204187..205023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0158"
FT                   /product="Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family protein; KEGG:
FT                   ypi:YpsIP31758_3996 peptidase, S54 (rhomboid) family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66471"
FT                   /db_xref="GOA:B1JHY8"
FT                   /db_xref="InterPro:IPR022732"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR023662"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="InterPro:IPR038236"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JHY8"
FT                   /protein_id="ACA66471.1"
FT                   /translation="MTRVIVISNLRLAQAFVDYMATHHVALEIRPDAQGVEIWLADDEQ
FT                   LSAVQHELEQFLLDPLNPRYQAASWQAGNVNSNLPYQRFSYLQTLRSQAGPLTLSVMVL
FT                   CIAIYILMLITGDMAVMSWLAWPYNSSQYLQIWRWVSHAFLHFSLLHILFNLMWWWYLG
FT                   GQMEKRLGTSKLLVLTIVSAVFSGWGQSLFSGANFGGLSGVVYALMGYVWLTGERAPER
FT                   GISLPRGLMAFSVLWLIAGYFDILGLSIANAAHVSGLIIGLLMAFWDTRNSARTVQ"
FT   gene            complement(205041..205370)
FT                   /locus_tag="YPK_0159"
FT   CDS_pept        complement(205041..205370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0159"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG:
FT                   ypi:YpsIP31758_3995 thiosulfate sulfurtransferase GlpE"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66472"
FT                   /db_xref="GOA:B1JHY9"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR023695"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JHY9"
FT                   /protein_id="ACA66472.1"
FT                   /translation="MEQFEAISVEQAYLRWKEGKTALVDIRDPQSYEAGHAPGAFHLTN
FT                   SSLHTFMQQTDFDQPVMVMCYHGNSSKGAAQYLLQQGFDVVYSIDGGFEAWARSYPQDI
FT                   TSESR"
FT   gene            complement(205745..208456)
FT                   /locus_tag="YPK_0160"
FT   CDS_pept        complement(205745..208456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0160"
FT                   /product="ATP-dependent transcriptional regulator,
FT                   MalT-like, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; KEGG:
FT                   ypi:YpsIP31758_3994 transcriptional regulator MalT"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66473"
FT                   /db_xref="GOA:B1JHZ0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR023768"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041617"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JHZ0"
FT                   /protein_id="ACA66473.1"
FT                   /translation="MLIPSKLSRPVRLQNTVVRDRLLVKLSSAANYRLTLINCPAGYGK
FT                   TTLIAQWAADQSNLGWYSLDESDNQSERFATYLIAAIQLATGGHCSKSEALSQKHQYAN
FT                   LSALFSQLFIELSNWDGPLYLVIDDYHLITNDAIHEAMRFFLRHQPENLTLIILSRTLP
FT                   SLGIANLRVRDQLLELGMQQLAFNHHEAQQFFECRLSSPLEQGDSSRLCDEVEGWVTAL
FT                   QLIALSSRQPNSSAQKSAKRLAGLNASHLSDYLVDEVLDQVDSKARAFLLRCSVLRSMN
FT                   DALIVRLTGEDNGQQLLEELERQGLFIHRMDDSAEWFCFHPLFATFLRQRCQWELALEL
FT                   PELHHAAAEGWMALGYPAEAIHHALAAGDVGMLRDILLQHAWSLFHHSELALLEQCLTA
FT                   LPYPLLVQNPELALLQAWLAQSQHRYSEVNTLLEQAELAMQERKIPVDEILRAEFGALR
FT                   AQVAINAGKPDEAEKLATDALKYLPMAHYYSRIVATSVTGEVHHCKGELARALPMMQQT
FT                   EQMARRHEAYHYALWALLQQSEILIAQGFLQAAYETQEKAFELIREQHLEQLPMHEFLL
FT                   RIRSQVLWSWSRLDEAEEAARKGVEILANYQPQQQLQCLAMLAKCSLARGDLDNANVYI
FT                   QRCEALQHGSQYHLDWITNADKPRVIHWQMTGDKVAAASWLRQTEKPGMADNHFLQGQW
FT                   RNIARVQIILGRFDEAEVVLDELNENARRLRLTSDLNRNLLLSNTLYWQTERKGEAQKA
FT                   LIESLTLANRTGFISHFVIEGEAMAQQLRQLIQLNALPELEQHRAQRILKDINQHHRHK
FT                   FAHFDEIFVDKLLTHPQVPELIRTSPLTQREWQVLGLIYSGYSNDQIANELDVAATTIK
FT                   THIRNLYQKLGVAHRQEAVQQAQRLLQMMGYV"
FT   gene            208774..211179
FT                   /locus_tag="YPK_0161"
FT   CDS_pept        208774..211179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0161"
FT                   /product="glycogen/starch/alpha-glucan phosphorylase"
FT                   /EC_number="2.4.1.1"
FT                   /note="KEGG: ypi:YpsIP31758_3993 maltodextrin
FT                   phosphorylase; TIGRFAM: glycogen/starch/alpha-glucan
FT                   phosphorylase; PFAM: glycosyl transferase family 35"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66474"
FT                   /db_xref="GOA:A0A0H3AYH1"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYH1"
FT                   /protein_id="ACA66474.1"
FT                   /translation="MSQPMLKKDDFLAALTRQWQRFGLTSAQQMTPYQWWEAVSAALAE
FT                   QLSAQPAPSKPKNVQRHVNYISMEFLIGRLTANNLINLGWYDTVDALLAEQQVKLSDLL
FT                   EQETDPALGNGGLGRLAACFLDSMATVEQPATGYGLNYQYGLFRQSFRECKQQEAPDNW
FT                   QRESYPWFRHNAALAVDVGFGGNLVKQADGRQLWRPAFTLRGEAWDLPVLGFRNGVTQP
FT                   LRLWQATHQHPFDLTLFNDGKFLLAEQNGVEAEKLTKVLYPNDNHLAGKRLRLMQQYFQ
FT                   CACSVADILRKHHLAGRKLAELPDYEVIQLNDTHPTIAIPEMLRVLLDEHQLSWDAAWA
FT                   ITSKTFAYTNHTLMPEALECWDEKLVRSLLPRHFVIIKQINAQFKKLVNKQWPGNDEVW
FT                   AKLAVHHNKQVRMANLCVVSGFAVNGVAQLHSDLIIKDLFPEYYQLWPNKFHNVTNGIT
FT                   PRRWLKQCNPALSGLIDDTLKVEWANDLDVLQDLEPYAEDPAFRQRYQQIKYDNKVKLA
FT                   HYVKRVMGLVINPDAIFDVQIKRLHEYKRQHLNLLHILSLYRQIRDNPALDIAPRVFLF
FT                   GAKAAPGYYLAKNIIYAINQVADKINNDPIVQDRLKVVFIPDYRVSVAELMIPAADVSE
FT                   QISTAGKEASGTGNMKMALNGALTVGTLDGANVEIAEQVGDENIFIFGHTVDQVKAILA
FT                   KGYQPKKYVKADPHLKSILDELASGAFSQGDKQAFDMMLHSLLEGGDPYLVLADFASYC
FT                   QAQKQIDALYRDKDEWTRRAILNTARVGMFSSDRSIRDYQQRIWQAKR"
FT   gene            211192..213288
FT                   /locus_tag="YPK_0162"
FT   CDS_pept        211192..213288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0162"
FT                   /product="4-alpha-glucanotransferase"
FT                   /EC_number="2.4.1.25"
FT                   /note="KEGG: ypi:YpsIP31758_3992
FT                   4-alpha-glucanotransferase; TIGRFAM:
FT                   4-alpha-glucanotransferase; PFAM: glycoside hydrolase
FT                   family 77"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66475"
FT                   /db_xref="GOA:A0A0H3AZI2"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZI2"
FT                   /protein_id="ACA66475.1"
FT                   /translation="MDRKSLDQAATLAGIAASYINAHGKPQATLAETKEQLLAAMGRSL
FT                   GAHDTQTANTPLPVVKVFTFGSPMQLPMAGSGDYHWQLQTENGELHQGRISAKKTLTLP
FT                   ASLPLGYHRLILEQDLQQWQCSIIVAPKRCYEPDALLQGKKLWGACVQLYTLRSEHNWG
FT                   IGDFGDLKQMLEQVGERGGSFIGLNPIHALYPANPHSASPYSPSSRRWLNVIYIDINRV
FT                   EEFQQSEAAQRWWHQAETQQALAKSRESEWVDYPLVMQLKLTALRLSFPLFTARKAKDA
FT                   QVQAFRHFVEQGGSSLHQQAVFDALHAHLSEHDPMMWGWPVWPEKYRDGHSSAVADFCR
FT                   EHADEVMFYLWLQWLAASQFDDCFQSSQQRKMPIGLYRDLAVGVAEGGAETWCDRELYC
FT                   LKASVGAPPDILGPLGQNWGLPPMDPHVMVARAYQPFIDLLRANMTSCGALRIDHVMAL
FT                   LRLWWIPYGHTADQGAYVKYPVDDLLAVLALESQRHHCMVIGEDLGTVPVEIVGKLRDS
FT                   GVYSYKVLYFEHDSENIFRAPQSYPVQAMATITTHDLPTLRGYWQADDLTLGNKLGLYP
FT                   DQQILKQLYLDRERAKQGLLEGLHRYDCVPKKVGHKAALLSMSPVLNRGLQRYVADSAS
FT                   ALLGLQPEDWLDMAAPVNIPGTTDEYPNWRRKLSASLEEIFADSQINRLLKDLDKRRKN
FT                   VSVG"
FT   sig_peptide     211192..211266
FT                   /locus_tag="YPK_0162"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.840) with cleavage site probability 0.508 at
FT                   residue 25"
FT   gene            complement(213473..214048)
FT                   /locus_tag="YPK_0163"
FT   CDS_pept        complement(213473..214048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0163"
FT                   /product="IscR-regulated protein YhgI"
FT                   /note="TIGRFAM: IscR-regulated protein YhgI; PFAM:
FT                   HesB/YadR/YfhF-family protein; nitrogen-fixing NifU domain
FT                   protein; KEGG: ypi:YpsIP31758_3990 HesB-like
FT                   domain/NifU-like domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66476"
FT                   /db_xref="GOA:B1JHZ3"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR017726"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JHZ3"
FT                   /protein_id="ACA66476.1"
FT                   /translation="MITITDAAQSHFAKLLANQEEGTQIRVFVINPGTPTAECGVSYCP
FT                   PDAVEATDTELKFEQLSAYVDELSVPYLQDAEIDFVTDQLGSQLTLKAPNAKMRKVDDS
FT                   APLMERVEYVLQSQINPQLAGHGGRVTLMEITPEGLAILQFGGGCNGCSMVDVTLKEGI
FT                   EKELLQKFPELKGVRDLTEHQRGEHSYY"
FT   gene            complement(214108..214809)
FT                   /locus_tag="YPK_0164"
FT   CDS_pept        complement(214108..214809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0164"
FT                   /product="protein GntX"
FT                   /note="KEGG: ypi:YpsIP31758_3989 protein GntX"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66477"
FT                   /db_xref="GOA:A0A0H3B093"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B093"
FT                   /protein_id="ACA66477.1"
FT                   /translation="MLTTVSQCWLCQQPLYHNRHGICCYCQRHLPVLPPCCPCCGLPST
FT                   STFLRCGRCLIAPPRWHHMTFVGDYAPPLSGLIKQLKFGGAPQLAPVLARLLLLRWLRH
FT                   WRETQCRKSDKAIKPQRIVSVPLHHWRCWRRGYNQTDLLARPLAHWLGCDYTPLTLQRI
FT                   HATPPQQQLTAAQRRKNVRGIFRCAESVRGQHIALLDDVVTTGSTLNEIAHLLWAQGIA
FT                   SLQIWSVCRTL"
FT   gene            214896..215672
FT                   /locus_tag="YPK_0165"
FT   CDS_pept        214896..215672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0165"
FT                   /product="bioH protein"
FT                   /EC_number="3.1.1.1"
FT                   /note="KEGG: ypi:YpsIP31758_3988 carboxylesterase BioH;
FT                   TIGRFAM: bioH protein; PFAM: alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66478"
FT                   /db_xref="GOA:B1JHZ5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR010076"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JHZ5"
FT                   /protein_id="ACA66478.1"
FT                   /translation="MKQLYWYTCGEGDCDLVLLHGWGLNSGVWHCIIDRLAPHFRLHLV
FT                   DLPGYGRSQDYGAMSLADMAERVAQQAPKQALWLGWSMGGLVASQIALSQPECVRGLIT
FT                   VSSSPCFTARDEWPGIKPEVLAGFQHQLSDDFHRTVERFLALQTLGTESSRQDARLLKS
FT                   VVLQHQMPDVEVLTGGLAILRTADLRTALAGFTLPFMRVYGHLDSLVPRKVASLLDSAW
FT                   PQTQSVVMQGAAHAPFISHPNDFAKLILNFAEENKK"
FT   gene            215842..216111
FT                   /locus_tag="YPK_0166"
FT   CDS_pept        215842..216111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0166"
FT                   /product="protein of unknown function DUF1471"
FT                   /note="PFAM: protein of unknown function DUF1471; KEGG:
FT                   ypi:YpsIP31758_3987 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66479"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYZ0"
FT                   /protein_id="ACA66479.1"
FT                   /translation="MKLLKNMAVALVISGLSFAAIAAKEITKQEAEANNYEKIGTVSTT
FT                   GEATSPMDVKKALSKLADEKGGKYYVIIAEREKGKFDADAEVYK"
FT   sig_peptide     215842..215910
FT                   /locus_tag="YPK_0166"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.888 at
FT                   residue 23"
FT   gene            complement(216249..216506)
FT                   /locus_tag="YPK_0167"
FT   CDS_pept        complement(216249..216506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0167"
FT                   /product="Protein of unknown function DUF1920"
FT                   /note="PFAM: Protein of unknown function DUF1920; KEGG:
FT                   ypi:YpsIP31758_3986 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66480"
FT                   /db_xref="GOA:B1JHZ7"
FT                   /db_xref="InterPro:IPR015102"
FT                   /db_xref="InterPro:IPR023732"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JHZ7"
FT                   /protein_id="ACA66480.1"
FT                   /translation="MASLLQLRDAIALNGSAEASQLSRQLAIPLPLVNAMLEKLTAMGK
FT                   IERIELDHSGCLTGSCKSCPEGHQHCNTVIYQLKEPHAHQ"
FT   gene            complement(216542..218857)
FT                   /locus_tag="YPK_0168"
FT   CDS_pept        complement(216542..218857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0168"
FT                   /product="ferrous iron transport protein B"
FT                   /note="TIGRFAM: ferrous iron transport protein B; small
FT                   GTP-binding protein; PFAM: GTP-binding protein
FT                   HSR1-related; Ferrous iron transport protein B domain
FT                   protein; Ferrous iron transport B domain protein;
FT                   nucleoside recognition domain protein; KEGG:
FT                   ypi:YpsIP31758_3985 ferrous iron transport protein B"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66481"
FT                   /db_xref="GOA:A0A0H3AWS2"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="InterPro:IPR041069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AWS2"
FT                   /protein_id="ACA66481.1"
FT                   /translation="MKALTIGLIGNPNAGKTTLFNQLTGARQRVGNWAGVTVERKEGHF
FT                   NTAQHQVTLVDLPGTYSLTTISEQTSLDEQIACHYILSGEADLLINVIDAVNLERNLYL
FT                   TLQLLELGIPCIVALNMLDIAESQHIEIDINTLSKKLGCPVIPLVSTRGRGIDELKNSI
FT                   DQFQPATCRALVSYPPILLSEVDKLVAAMSDALPMQQRRWLALQILEGDIYSLNRAGVA
FT                   PSMVEQARQQLREQQHEDPALIIADARYQSIAHLCEAVGNSQQAEPNRLTQALDSVILN
FT                   RWLGVPIFLFVMYLMFVLAINIGGALQPIFDIGSAAIFIQGLQWVGHTLHFPPWLTIFL
FT                   AQGVGGGINTVLPLVPQIGMMYLFLSFLEDSGYMARAAFVMDRLMQALGLPGKSFVPLI
FT                   VGFGCNVPSIMGARTLDAQRERLITIMMAPFMSCGARLAIFAVFAAAFFGQDGASIVFS
FT                   LYLLGIAVAILTGLVLKYTIMRGEASPFVMELPVYHVPHLKSLLLQTWQRLKGFVLRAG
FT                   KVIVIASIFIGGLNSFSFNGKPVDSINDSALASVSKVLTPLLMPMGIHADNWQATVGLV
FT                   TGAMAKEVVVGTLNTLYTAEQINNDPFDAENFNLLDELAGAVDETWQGLKDTFSLSVLA
FT                   NPIEASKGDGEMTTGSMGMMSSKFGSSISAYSYLIFVLLYVPCVSVMGAIARETSRGWM
FT                   TFSILWGLNVAYSLATLFYQGATLRDHPQESLSIIALVIVVNALILFGLRRARSRVTVR
FT                   LQNSEPTNCCRSSGSNCH"
FT   gene            complement(218949..219176)
FT                   /locus_tag="YPK_0169"
FT   CDS_pept        complement(218949..219176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0169"
FT                   /product="FeoA family protein"
FT                   /note="PFAM: FeoA family protein; KEGG: ypi:YpsIP31758_3984
FT                   ferrous iron transport protein A"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66482"
FT                   /db_xref="GOA:A0A0H3AYH7"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYH7"
FT                   /protein_id="ACA66482.1"
FT                   /translation="MHLIPQRSYKIIGFSPEISPAYRQKLLSLGMLPGSSFNVVRLAPL
FT                   GDPIQIETRRVSLVVRKKDLDLLTLDLQPQ"
FT   gene            complement(219700..222075)
FT                   /locus_tag="YPK_0170"
FT   CDS_pept        complement(219700..222075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0170"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="PFAM: RNA binding S1 domain protein; SMART:
FT                   Resolvase RNase H domain protein fold; KEGG: yps:YPTB3766
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66483"
FT                   /db_xref="GOA:A0A0H3AZI7"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZI7"
FT                   /protein_id="ACA66483.1"
FT                   /translation="MNEPLSRIIASELQARPEQVISAIRLLDEGNTVPFISRYRKEVTG
FT                   GLDDIQLRQLESRLGYLRELEDRRQTILKSIEDQGKLTDQLAGAINATLSKTELEDLYL
FT                   PYKPKRRTRGQIAIEAGLEPLAERLWQDPQQDPEHTALAYVDADKGVADTKAALDGARY
FT                   ILMERFAEDATLLAKVRQYLWKNAHLVSKVVEGKEQEGAKFRDYFDHHEPIAQVPSHRA
FT                   LAMFRGRNEGVLQLALDPDPQFDEPPRESQGEQIIINHLDLRLNNAPADGWRKAVVNWT
FT                   WRIKVLLHLETELMSTLRERAEDEAINVFARNMQDLLMAAPAGMRATMGLDPGLRTGVK
FT                   VAVVDATGKLVAFDTIYPHTGQAAKAAAVVAALCIKHQVELVAIGNGTASRETERFFLE
FT                   LQQQYPAVTAQKVIVSEAGASVYSASELASQEFPDLDVSIRGAVSIARRLQDPLAELVK
FT                   IDPKSIGVGQYQHDVSQSQLAKKLDAVVEDCVNAVGVDLNTASVPLLTRVAGLTRMMAQ
FT                   NIVNWRDENGRFRNREQLLKVSRLGPKAFEQCAGFLRINHGDNPLDASTVHPEAYPVVE
FT                   RILAATEQALQDLMGNANALRNLNARDFTTERFGVPTVTDILRELEKPGRDPRPEFKTA
FT                   TFAEGVETLNDLTPGMILEGAVTNVTNFGAFVDIGVHQDGLVHISSLADKFVDDPHKVV
FT                   KAGDIVKVKVMEVDLQRKRIALTMRLDEQPGETHSRRSNNGTGSERTNNDNRGVNRPHN
FT                   DAKGHNAPNRAPAKGRSDSSSAGNSAMSDALAAAFKKR"
FT   gene            222609..223124
FT                   /locus_tag="YPK_0171"
FT   CDS_pept        222609..223124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0171"
FT                   /product="transcription elongation factor GreB"
FT                   /note="TIGRFAM: transcription elongation factor GreB; PFAM:
FT                   transcription elongation factor GreA/GreB domain protein;
FT                   KEGG: yps:YPTB3765 transcription elongation factor"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66484"
FT                   /db_xref="GOA:A0A0H3B096"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006358"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B096"
FT                   /protein_id="ACA66484.1"
FT                   /translation="MAKSNYITREGWQALDRELHYLWREERPVVTQAVSEAAAMGDRSE
FT                   NAEYIYGKKRLREIDRRVRFLAKRLEVLKIVDPDPRQEGKVFFGAWVRVENEQEEQRIF
FT                   RLVGPDEFDPAKKWISIDSPVARALIGKQVDDEVTVQTPNGEATYWILEIRYRPFDEDR
FT                   PFNEDIDN"
FT   gene            223260..223979
FT                   /locus_tag="YPK_0172"
FT   CDS_pept        223260..223979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0172"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: yps:YPTB3764
FT                   transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66485"
FT                   /db_xref="GOA:A0A0H3AYZ6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYZ6"
FT                   /protein_id="ACA66485.1"
FT                   /translation="MQENHKILVVDDDMRLRALLERYLTEQGFQVRSVANAEQMDRLLT
FT                   RESFHLMVLDLMLPGEDGLSICRRLRSQSNPMPIIMVTAKGEEVDRIVGLEIGADDYIP
FT                   KPFNPRELLARIRAVLRRQANELPGAPSQEEAIIAFGKFKLNLGTREMFREDEPMPLTS
FT                   GEFAVLKALVSHPREPLSRDKLMNLARGREYSAMERSIDVQISRLRRMVEEDPAHPRYI
FT                   QTVWGLGYVFVPDGNKA"
FT   gene            223976..225328
FT                   /locus_tag="YPK_0173"
FT   CDS_pept        223976..225328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0173"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: yps:YPTB3763 osmolarity
FT                   sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66486"
FT                   /db_xref="GOA:A0A0H3AWS8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AWS8"
FT                   /protein_id="ACA66486.1"
FT                   /translation="MKWWRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQ
FT                   FNKVLAYEVRMLMTDRLQLEDGTLLEVPPAFRREIYRELGISLYTNAAAEESGLRWAQH
FT                   YKFLSDQMAQQLGGPTDVRVEVNKNSPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRY
FT                   TLAIMLLAVGGAWLFIRIQNRPLVELEHAALQVGKGNIPPPLREYGASEVRSVTRAFNQ
FT                   MAAGVKLLSDDRTLLMAGVSHDLRTPLTRIRLATEMMSEDDAYLSESINKDIEECNAII
FT                   EQFIDYLRTGQEMPTEPSDLNSVLGEVIAAESGYERVIETDLAEGEVLVDIHPLSIKRA
FT                   LTNMVVNAARYGNGWIKVSSGKELQRAWFQVEDDGPGIKPEDLKHLLQPFVRGDSARST
FT                   SGTGLGLAIVQRIIDAHAGSLEIGTSKRGGLRIRAYIPLPLDVKPKPPAVA"
FT   sig_peptide     223976..224068
FT                   /locus_tag="YPK_0173"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.971) with cleavage site probability 0.519 at
FT                   residue 31"
FT   gene            complement(225667..227286)
FT                   /locus_tag="YPK_0174"
FT   CDS_pept        complement(225667..227286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0174"
FT                   /product="Phosphoenolpyruvate carboxykinase (ATP)"
FT                   /EC_number="4.1.1.49"
FT                   /note="PFAM: phosphoenolpyruvate carboxykinase (ATP); KEGG:
FT                   yps:YPTB3762 phosphoenolpyruvate carboxykinase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66487"
FT                   /db_xref="GOA:B1JI04"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR015994"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JI04"
FT                   /protein_id="ACA66487.1"
FT                   /translation="MSVKGITPQELAAYGIHNVSEIVYNPSYDLLFEEETKPTLEGYER
FT                   GTLTTTGAIAVDTGIFTGRSPKDKYIVRDAITQDTVWWADQGKGKNDNKPLSQEIWSHL
FT                   KGLVTEQLSGKRLFVVDTFCGANADTRLQVRFITEVAWQAHFVKNMFIRPSDEELARFE
FT                   PDFIVMNGAKCTNPQWKEQGLNSENFVAFNLTERMQLIGGTWYGGEMKKGMFSMMNYLL
FT                   PLKGIASMHCSANVGEKGDVAIFFGLSGTGKTTLSTDPKRKLIGDDEHGWDDDGVFNFE
FT                   GGCYAKTIKLSEEAEPDIYHAIKRDALLENVVVLADGTVDFNDGSKTENTRVSYPIYHI
FT                   DNIVKPVSKAGHATKVIFLTADAFGVLPPVSRLTANQTQYHFLSGFTAKLAGTERGVTE
FT                   PTPTFSACFGAAFLSLHPTQYAEVLVKRMQAVGAQAYLVNTGWNGTGKRISIKDTRAII
FT                   DAILNGEIDKAETFTLPIFDLAVPMALPGVNPDILDPRDTYADKAQWQEKAEDLAKRFA
FT                   TNFDKYTDTPAGAALVSAGPKI"
FT   gene            complement(227483..228364)
FT                   /locus_tag="YPK_0175"
FT   CDS_pept        complement(227483..228364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0175"
FT                   /product="Hsp33 protein"
FT                   /note="PFAM: Hsp33 protein; KEGG: ypi:YpsIP31758_3977
FT                   chaperonin HslO"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66488"
FT                   /db_xref="GOA:B1JI05"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="InterPro:IPR023212"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JI05"
FT                   /protein_id="ACA66488.1"
FT                   /translation="MSNHDQLHRYLFANHAVRGELVSVNETYQQVLANHDYPPAVQKLL
FT                   GEMLVATSLLTATLKFDGDITVQLQGGDSPLTLAVINGNNRQEMRGVARVKGEISDDST
FT                   LQEMVGNGYLVITITPAQGERYQGVVALEGETIAACLENYFMQSEQLPTRLFIRTGHVA
FT                   DKAAAGGMLLQVLPAQERNEDEFDHLAQLTATIKAEELFTLPANEVLYRLYHQEEVTLY
FT                   EPQNVSFRCTCSRQRCADALVTLADDDVTEMLEQDGNIDMHCEYCGNHYLFDAVDIATL
FT                   KNGNSASSEQIH"
FT   gene            complement(228527..228934)
FT                   /locus_tag="YPK_0176"
FT   CDS_pept        complement(228527..228934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0176"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="PFAM: RNA-binding S4 domain protein; KEGG:
FT                   ypi:YpsIP31758_3976 heat shock protein 15"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66489"
FT                   /db_xref="GOA:A0A0H3AYI2"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025708"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYI2"
FT                   /protein_id="ACA66489.1"
FT                   /translation="MKDKISPAESVRLDKWLWAARFYKTRAIARDMVDGGKVHYNGQRS
FT                   KPSKLVELHAEIRLRQGNDERTVRVLALHSQRRGAEEAQTLYEETEASIANREKVAQAR
FT                   KLNALTMPHPDRRPDKKERRNLIKFKQGEPE"
FT   gene            complement(228963..229643)
FT                   /locus_tag="YPK_0177"
FT   CDS_pept        complement(228963..229643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0177"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: ypi:YpsIP31758_3975 HAD hydrolase, IA
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66490"
FT                   /db_xref="GOA:A0A0H3AZJ2"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZJ2"
FT                   /protein_id="ACA66490.1"
FT                   /translation="MPPDFNWQEIDTVLLDMDGTLLDLAFDSHFWLKLVPETLSQRRGI
FT                   PLEQAHKIIHDEYNAVQHTLNWYCFDYWRERLDLDIYAMTTDIGSRARLRQDTVPFLSG
FT                   LRQHGLQTILLTNAHPHSLAVKIEHTALDQHLDLLLSTHTFGYPKEDQRLWQAVTQHTG
FT                   LNPARTLFVDDSEAILDAAQTFGIRYCLGVENPDSSCADKTFHRHPAINDYRKLLPALQ
FT                   LRCE"
FT   gene            complement(229787..231934)
FT                   /locus_tag="YPK_0178"
FT   CDS_pept        complement(229787..231934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0178"
FT                   /product="Intracellular growth attenuator IgaA"
FT                   /note="PFAM: Intracellular growth attenuator IgaA; KEGG:
FT                   ypi:YpsIP31758_3974 intracellular growth attenuator family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66491"
FT                   /db_xref="GOA:A0A0H3B0A0"
FT                   /db_xref="InterPro:IPR010771"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B0A0"
FT                   /protein_id="ACA66491.1"
FT                   /translation="MSTIVLILALLLTSLIAVGLLWWLRFRRPHPITAALPFVKPTHRK
FT                   LTPEERVSIENYLRNQQNKHGFNTQPAFDSHALAASTSSTPMLVLTPQSDNVYSVTRAI
FT                   TRYGVASDEPNKWRYYLDSIEVHLPSAWEQYITQDNDVELIQTQTIPLVISLNGHTLNN
FT                   HQSENTYQPILPSVSKNASIRKEDSEHIELLNIRKETPEEYALHGPNGLKEACAICIAL
FT                   LLLFFALSGPTVTLPWLVIVAVSLTCWACWNLFRPLSEKDLREVHCLNGTPKRWGLFGE
FT                   SNQGQINNISLGIVDLIYPAHWGPYFVHDLGKKTHIDIYLNRQVVRQGAFLSLHDEMKM
FT                   FPLQRWGKNLTLIVGSLLVLVLLLIYVPLGLPLKLSVAWLQGAQSQQVTSVAALDKMPL
FT                   RIGDMLKAQGNGMCYVPPNIQNTRGFVFTPFDCSGIYWNTASPLPQPESETIEKAAALV
FT                   ETINKQLHPQGSDASVNPKLATAIEKSGMILLDDFSDIVLKTQALCSENTDCIRLKNAL
FT                   VNLGNAKNWSALVKRAQSGNLEGMNVLLRPISADVLENLINTAASSFVYRETHLATEAL
FT                   NSPPPGGFLITSDEGKQLVNHPAPTLPLFDYSALEQWRELQRLSALLLDTPFKAEGIIT
FT                   NITTDANGTRHIALHSEPDIVTLGRYLATSLLLLVLIFCLVVNMVLLIQRAMKNRRRMD
FT                   NIQRYYDDCFNQTLTPPPFLR"
FT   sig_peptide     complement(231875..231934)
FT                   /locus_tag="YPK_0178"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.968) with cleavage site probability 0.859 at
FT                   residue 20"
FT   gene            232214..232408
FT                   /locus_tag="YPK_0179"
FT   CDS_pept        232214..232408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0179"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ypm:YP_0144 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66492"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYZ9"
FT                   /protein_id="ACA66492.1"
FT                   /translation="MLKTSKLYLTGIAIKVLINAQCDQVLIYPLSLTLQGCWLRVLTRI
FT                   TDLSQLIGIRVLAAYLQSQ"
FT   gene            232521..233066
FT                   /locus_tag="YPK_0180"
FT   CDS_pept        232521..233066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0180"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: ypi:YpsIP31758_3973 ADP
FT                   compounds hydrolase NudE"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66493"
FT                   /db_xref="GOA:A0A0H3AWT5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AWT5"
FT                   /protein_id="ACA66493.1"
FT                   /translation="MKHLQKPKILKIETVACSRLFNVEAVELEFSNGVQRIYERMRPSN
FT                   REAVMIVPVIGNDLLLIREYAVGIEEYELGFPKGLIDPGEGVLEAANRELMEEVGYGAE
FT                   RFDFLAKLTMAPSYFSSKMNIVIAHGLYPQSLEGDEPEPLPQVRWPIANMMALLNEADF
FT                   REARNVSALFLAHTFLNQ"
FT   gene            complement(233187..233942)
FT                   /locus_tag="YPK_0181"
FT   CDS_pept        complement(233187..233942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0181"
FT                   /product="D12 class N6 adenine-specific DNA
FT                   methyltransferase"
FT                   /note="PFAM: D12 class N6 adenine-specific DNA
FT                   methyltransferase; KEGG: cvi:CV_2111 probable
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66494"
FT                   /db_xref="GOA:A0A0H3AYI7"
FT                   /db_xref="InterPro:IPR012263"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR023095"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYI7"
FT                   /protein_id="ACA66494.1"
FT                   /translation="MSTPIIPWVGGKRRLAKHILPLFPAHTCYIEPFCGGAALYFLKET
FT                   SKVEVINDVNGELINLYRVIKNHLEEFVRQFKWALTSRQVFEWTKATPTEVLTDIQRAA
FT                   RFYYLQTTAFGGKVDGQTFGTSTTRPTGLNLLRLEETLSAAHLRLSRTMIEHMGWADCV
FT                   EKYDRPHSLFYLDPPYWQTCGYGVEFGLDQYTQMAQLARSIKGSMIISVNDIPEMRDVF
FT                   KGLHMDTVSLKYSLGDNKKQVSELIIRNF"
FT   gene            complement(234074..234511)
FT                   /locus_tag="YPK_0182"
FT   CDS_pept        complement(234074..234511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0182"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: yps:YPTB1820 putative phage tail fiber
FT                   assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66495"
FT                   /db_xref="InterPro:IPR003458"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZJ6"
FT                   /protein_id="ACA66495.1"
FT                   /translation="MMIYFSATIGGFIPGEWRVDGTYTDETWPTDAVLLTDIESVEFWK
FT                   RTAPSGKMLGSVKYRPVWVDLPTPTAVEVASQKAGFVAQAKLKKSKLISDARDEIEILK
FT                   DRIELGQDKADELKLWKSYRIALDDIDVSAAPDIMWPQLPE"
FT   gene            complement(234521..235747)
FT                   /locus_tag="YPK_0183"
FT   CDS_pept        complement(234521..235747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0183"
FT                   /product="tail fiber repeat 2 protein"
FT                   /note="PFAM: tail fiber repeat 2 protein; KEGG:
FT                   ypi:YpsIP31758_2198 tail collar domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66496"
FT                   /db_xref="InterPro:IPR005068"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B0A7"
FT                   /protein_id="ACA66496.1"
FT                   /translation="MKNIMPPINTPDNAFHDGNPATGEQGTIVPGAWLNNVQSGVISIQ
FT                   QELLSVLTKAGIEIDETKQDQLVTAITKLITQGIPELPSASLAQKGIVQLSSATNSDSE
FT                   TLAATSKAVKTANDAALKIVNNLSEIAAAGPGAVLAAITNLNLLTTVNRANGSLQSASN
FT                   LSEINLSGPAAMAAAVANLGLTEAAAAVANALKKSANLSDVANPAAALKNIGGFAVRGP
FT                   LDSKNLNLIGNTDEIGVWYQITDAVTENNNYPVRASGTLLVMPSAYGCQQEYTSYSGLK
FT                   FVRGLSAVWSGSGPWQAWQQISAQQPKAVTTSDYIRIPDVPGGLIIQWFAGNTSMGEAS
FT                   MGPLSFPIAFPSACIFSSVSTLGNGTGACDQMFQVTSTNRNSITLFSQVFGSGSVPGTA
FT                   IPLILVIGY"
FT   gene            complement(235750..236319)
FT                   /locus_tag="YPK_0184"
FT   CDS_pept        complement(235750..236319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0184"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cvi:CV_0342 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66497"
FT                   /db_xref="InterPro:IPR018755"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZ04"
FT                   /protein_id="ACA66497.1"
FT                   /translation="MTFSTLLGLLLPPVAYDSQQPKIHAEMQAEGNELDTASLLANAVL
FT                   GGVTPFYANSLIADWERVLDITAEPEASYQQRLQVVLIKLSEFGGLSIPYFKRIAVSAG
FT                   YQITIDELEPFRAGVNRAGDVIMAPEVIWVWRVNVFGSKTQTFRFRAGISAAGERLSSF
FT                   SDTVIENVFNNLKPAHTFCYFTYQES"
FT   gene            complement(236316..237377)
FT                   /locus_tag="YPK_0185"
FT   CDS_pept        complement(236316..237377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0185"
FT                   /product="Baseplate J family protein"
FT                   /note="PFAM: Baseplate J family protein; KEGG: bbr:BB3612
FT                   putative phage tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66498"
FT                   /db_xref="InterPro:IPR006949"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AWU3"
FT                   /protein_id="ACA66498.1"
FT                   /translation="MPHITPTVEAIRSNILRDIRNLLVDADISENSDYYIRASSVASCV
FT                   AGIYQDQGWIVRQIFPDTADIEFLELHCRTRGIVRKPANTATGTIDITGEPNAIVASGL
FT                   TVTRDALSFVTTQRATVGLDGKLTVVAQAAIAGAAGNTTQVMSGTLSSTPDGVDSTVII
FT                   GVMRGGTDQESPEDLLARLLDIIRRPPAGGNKYDYKRWALEVTGVTAAFVYPLRRGLGT
FT                   VDIVITSADGLPSQAIIADTQLHIDDVRPVTAKSSLVMAPTIKVFDIEVKVTLNGITFD
FT                   VAEILIKEALNNYINRLMPGETFIRSQAEMLVSFITGITDRKIITPVDNVTPQVDDSVV
FT                   EWLRVGTITVALL"
FT   gene            complement(237377..237721)
FT                   /locus_tag="YPK_0186"
FT   CDS_pept        complement(237377..237721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0186"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bbr:BB3613 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66499"
FT                   /db_xref="InterPro:IPR010877"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYJ1"
FT                   /protein_id="ACA66499.1"
FT                   /translation="MLIDPSTRDYTGERINTLANAVYLCLMVPLGSWWADISLGSRLHE
FT                   LAREKDVPRVDTLARQYAEQALQRLIDDNRATAITVTATRLMPGWLLLHIVVETASNQS
FT                   ETFRHQVRVA"
FT   gene            complement(237782..238432)
FT                   /locus_tag="YPK_0187"
FT   CDS_pept        complement(237782..238432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0187"
FT                   /product="phage baseplate assembly protein V"
FT                   /note="TIGRFAM: phage baseplate assembly protein V; PFAM:
FT                   Mu Gp45 domain protein; KEGG: cvi:CV_0345 probable
FT                   bacteriophage base plate protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66500"
FT                   /db_xref="InterPro:IPR013046"
FT                   /db_xref="InterPro:IPR014462"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZK0"
FT                   /protein_id="ACA66500.1"
FT                   /translation="MWNSVDGRINTALNRIRKAFRAVLTRVNSGGQVQTVQARALAGEQ
FT                   LQDNELFQHYGFTSNPLPGTMAVILPLGGNTSHGVIIATEHGAYRLAGLQSGEVALYTD
FT                   EGAKIVLKRGRIIDVECDTYRVTCKNYEVNAEEKADFNTPMVTASEQVTAQNKITGNGG
FT                   MAIKGGTGATFEGNINQTSGNYETTGDVKAGSISLLKHHHIDSMSGSTSGAKA"
FT   gene            complement(238422..239645)
FT                   /locus_tag="YPK_0188"
FT   CDS_pept        complement(238422..239645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0188"
FT                   /product="putative phage tail protein"
FT                   /note="KEGG: bbr:BB3615 putative phage tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66501"
FT                   /db_xref="InterPro:IPR026276"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B0C6"
FT                   /protein_id="ACA66501.1"
FT                   /translation="MPTPSEKEQDNRVSILINGKVHSAWSRYQIDSDFLIPADAWSVSL
FT                   GLPDGVFPPGITRGVPVQVNVGADTVMVGRVDSIQRSISRKQCTLSLSGRDGAAILVDC
FT                   AAPIFTSRQLGLEEVIANIVRPLGITKIRINAESAIRNDKVSIEPGERAWDALVRAAAG
FT                   RGLWPWFEPDGTLVVGGPDYTTPPVATLIMQFDGGGNNLLSINDNSSINGSFSELTVLA
FT                   QSHGQGSKSKALGIVDIDDDSTQRATRDNADDSQDDDVNHAIGTAETGQHGLSAVIKDP
FT                   TVPYYRPQIMVVGDADNLDQVRYRGRKAMADARLAGYSLTGVVAGHRNTDGVLWEPGQR
FT                   IHVRSEPHGIDGIFFLMGREFVGGRTEGETTTLRLKEDGVWIPDAFPKKKKGRKKKKTK
FT                   ALGIVDVE"
FT   gene            complement(239629..240948)
FT                   /locus_tag="YPK_0189"
FT   CDS_pept        complement(239629..240948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0189"
FT                   /product="DNA circulation family protein"
FT                   /note="PFAM: DNA circulation family protein; KEGG:
FT                   bvi:Bcep1808_1292 DNA circulation family protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66502"
FT                   /db_xref="InterPro:IPR009826"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZ14"
FT                   /protein_id="ACA66502.1"
FT                   /translation="MAWADSMLDASFRGMIFDVINTRDSWSRDTAQHEYPYIDGADVQD
FT                   MGRKARNIRLSALFWGDDYESRLQAFIAELDKPGAGELIHPVYGSMPNMQAIECQVNHD
FT                   AENVDYCTVELVFLESKTGNPFFSQDYPTAQADVIFNQVKSLMDAEQNLMEDALTPLRD
FT                   AKKMMSKSKALASTALNMLLIFRSEITGFVGSTTDFVQYPGAFMSDLQSATSLTSLNAM
FT                   SSGGSGVSAASAISQTNVTMSDWGESHRQLTAIANMPVAIAAGEKTAPVDMPAGTSAAD
FT                   IAELIAMVTIVVAGELAQDAADIFSDDDINSLLSPTDIERIANDTRQFVQVAIDQHRAQ
FT                   YADATQEVSSSSTALGIAWQPVVEGLKDIALAVQQLATNIITTRPPLIQRRIDSVSNLH
FT                   LVAYRWYGDYRRAVELQRLNPQLRNPNNLQPGDVLYAYAI"
FT   gene            complement(240950..243157)
FT                   /locus_tag="YPK_0190"
FT   CDS_pept        complement(240950..243157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0190"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bbr:BB3617 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66503"
FT                   /db_xref="InterPro:IPR010090"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AWX6"
FT                   /protein_id="ACA66503.1"
FT                   /translation="MARNLQLALTLFAKDTASKVLRKTMQDTINQSKSVAKADNQLGKS
FT                   QKQSADTAIRSSKSLQSEWQRASNARSTLGIRSERDIQREIQLTQAAYNRLTRTGTLSA
FT                   NEQSRAFASMSERVSKLRGELSGASQSLSRFERAKGIGSNAMAIAGGVAAMGAVLAQPV
FT                   RNQMSYDSRVAMMANTAYAERGVEGRIEGKKELSGAIKNAVTIGGGTKESAADTLDKLL
FT                   ASGAVDMDSAKTLLPVIQKYATATGADPTDLANIVISLKRSFGIQNKDVEKALNMSIVG
FT                   GQEGSYELADMAKALPEQLALAKSLGMSGLDDYATLLGVNQGAATTAGTSSQAGTNVIN
FT                   LLAKINSKDAARAAARVEYNGKGIDLPGSLAAAKEKGINPIDAFMGIVDKVVANDPAYQ
FT                   KLEAKLKTAKGEDRKQVLESMSKILEGSAIGSIIADQQALLGLLGYRGNKEYVQGVIKK
FT                   SNEQRELRPGEGAGDINFAVISDTPDFKTDQLKNVRDFAEMDSIKPLSDVLGRLSKELT
FT                   DYAEQYPGLTVAVSGATTGIKALAAGAAAVAGIRILTGGGIPGISKKGGSFNPTDILSG
FT                   DNSNSGVVPVYVTNWQDIGEKNKLVDAFKDLPGAVGKFASYVNVVTALKESFDERRKQN
FT                   QKEADEKGVNVGEYLISKRANQKPLFDFDPASWWSKPSTIGNGDNPDSFGVPAYMKSTQ
FT                   QQGYPSIPIQIQNRMELDGKVLAESTNEVNAAQANRGSTGG"
FT   gene            complement(243157..243291)
FT                   /locus_tag="YPK_0191"
FT   CDS_pept        complement(243157..243291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0191"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66504"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYL5"
FT                   /protein_id="ACA66504.1"
FT                   /translation="MTRSELDSYLDALARLHGKKTSSVGKTKTTRRVKSQRQNSPRRT"
FT   gene            complement(243312..243479)
FT                   /locus_tag="YPK_0192"
FT   CDS_pept        complement(243312..243479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0192"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66505"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZM7"
FT                   /protein_id="ACA66505.1"
FT                   /translation="MSKSEITTDLLLDTLTDDDFDLIDTQISAIKKKRMALNPNLPVTG
FT                   SPSLPSESME"
FT   gene            complement(243595..243792)
FT                   /locus_tag="YPK_0193"
FT   CDS_pept        complement(243595..243792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0193"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66506"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B0D3"
FT                   /protein_id="ACA66506.1"
FT                   /translation="MADKLISLTANSSVMASDILGVEVNCNGYIVVTTSTGKHHADAGY
FT                   GELTYQARDRLINEINTRYS"
FT   sig_peptide     complement(243742..243792)
FT                   /locus_tag="YPK_0193"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.768) with cleavage site probability 0.763 at
FT                   residue 17"
FT   gene            complement(243785..244285)
FT                   /locus_tag="YPK_0194"
FT   CDS_pept        complement(243785..244285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0194"
FT                   /product="Protein of unknown function DUF1804"
FT                   /note="PFAM: Protein of unknown function DUF1804; KEGG:
FT                   nma:NMA1854 hypothetical DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66507"
FT                   /db_xref="InterPro:IPR014926"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZ20"
FT                   /protein_id="ACA66507.1"
FT                   /translation="MAHPQETRDRLRRSYVFGQMSLEIAAAQAAIPFVTARRWKKEAQD
FT                   NGDDWDKLRAAHVIAGGGLEDIARAVLTGLVTQYQTTLEQLNGDSKLPAQKRVELLASL
FT                   ADAFNKAISASKKILPETSQLATALDVLQKLSIFISERHPQHLAAFVEILEPFGDEVEK
FT                   HYG"
FT   gene            complement(244288..244575)
FT                   /locus_tag="YPK_0195"
FT   CDS_pept        complement(244288..244575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0195"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dvu:DVU2703 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66508"
FT                   /db_xref="GOA:A0A0H3AWX9"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AWX9"
FT                   /protein_id="ACA66508.1"
FT                   /translation="MKPRQKRRSRRVNAVKSEVNALNKISSQLDQLFIPGQDLEILTDI
FT                   NLKLDRIETNMTAIQVEATRRGAVAGAIAGGLSGGLIATAIVLIKARLGL"
FT   gene            complement(244572..244814)
FT                   /locus_tag="YPK_0196"
FT   CDS_pept        complement(244572..244814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0196"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nma:NMA1196 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66509"
FT                   /db_xref="GOA:A0A0H3AYM0"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYM0"
FT                   /protein_id="ACA66509.1"
FT                   /translation="MTLDLGFQILLGIVSAVFGLWVKELQKDISNLEKSVETIKTDYQR
FT                   REDAKTNFDLMMATLRDVRIAIDRIDGKLDRKADK"
FT   gene            complement(244811..245398)
FT                   /locus_tag="YPK_0197"
FT   CDS_pept        complement(244811..245398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0197"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cvi:CV_2145 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66510"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZN1"
FT                   /protein_id="ACA66510.1"
FT                   /translation="MALLKLLKAYWQPSLALLVAAVAGFVLAALIYGKQLSDERLTFSE
FT                   AKTTWSEEKTRAANDASAALTAALERLKVAQQLGDKLSAELQAKINALYSDNQRLKRQI
FT                   NDATQQDGATYTGLGPHSLCVYQSALGYPDCDQRVQPTASSAVPTASETQPTHSGLPPE
FT                   DILAHAADYGKWCQQLETQLIQINKYYSGGAK"
FT   sig_peptide     complement(245312..245398)
FT                   /locus_tag="YPK_0197"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 29"
FT   gene            complement(245376..245630)
FT                   /locus_tag="YPK_0198"
FT   CDS_pept        complement(245376..245630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0198"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66511"
FT                   /db_xref="GOA:A0A0H3B0D7"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B0D7"
FT                   /protein_id="ACA66511.1"
FT                   /translation="MSIMKTLKELITNPSSGRLSTSDTTLVGAFIVSSLALLWATIFGQ
FT                   SGDIWFSLYLAAWVTQNQASKYQALKRDKELASGTSETP"
FT   gene            complement(245621..246259)
FT                   /locus_tag="YPK_0199"
FT   CDS_pept        complement(245621..246259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0199"
FT                   /product="putative endolysin"
FT                   /note="KEGG: ecv:APECO1_4061 putative endolysin"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66512"
FT                   /db_xref="GOA:A0A0H3AZ25"
FT                   /db_xref="InterPro:IPR000726"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZ25"
FT                   /protein_id="ACA66512.1"
FT                   /translation="MQISLSQFQLAASLSPALASRWYPHILSAMKEFGIDTPRRQAAFI
FT                   AQIGHESRDFKALVESFNYSVVGLKTTFSSRLTAGQCEMLGRQPGETVVPIERQKAIAN
FT                   LVYSKRYGNNAPGDGWKFRGRGLKQITFLDNYYRCGHALEIDLIINPDLLLQDDYAARS
FT                   AGWFWYVNNCNEYADNGSFVRLTKVINGGTNGLADRQARLLVAERVLCP"
FT   gene            complement(246351..246620)
FT                   /locus_tag="YPK_0200"
FT   CDS_pept        complement(246351..246620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66513"
FT                   /db_xref="GOA:A0A0H3AWY4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AWY4"
FT                   /protein_id="ACA66513.1"
FT                   /translation="MELILGVIFFISGVYVLDDATKRGVSNQLAWAVGTVILWLIVFPL
FT                   YLVRRNALTQTVSNIDGAEKPNSKRLGFVLILLLSFTPYLWDKF"
FT   gene            complement(246632..247069)
FT                   /locus_tag="YPK_0201"
FT   CDS_pept        complement(246632..247069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0201"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_1315 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66514"
FT                   /db_xref="GOA:A0A0H3AYM4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014875"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYM4"
FT                   /protein_id="ACA66514.1"
FT                   /translation="MMDIEQVKALLPESVQQIAELIGYPATARLLDKLGGTTFPIGKGL
FT                   RALGAARATLLRETIGDENAQLLVKHFGGEVLYLPRCDRALRELRNRSFLAEFSELRAL
FT                   GVSSLMVMTQLCPKYGFSDRFAWGLLAERKTSNNELQSSLF"
FT   gene            complement(247066..247467)
FT                   /locus_tag="YPK_0202"
FT   CDS_pept        complement(247066..247467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0202"
FT                   /product="protein of unknown function DUF1018"
FT                   /note="PFAM: protein of unknown function DUF1018; KEGG:
FT                   dvu:DVU2695 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66515"
FT                   /db_xref="InterPro:IPR009363"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZN6"
FT                   /protein_id="ACA66515.1"
FT                   /translation="MDKKLIQLIHVGKSALAWDDETYRDVIYRLTGKTSSAKCSIEQQE
FT                   RIVAYMRAHGFEPKPAPTRGRRPSVPASKKTILSKIEALLTDANRPWSYAESMAQHMFQ
FT                   VRYVDWLPLDKLTKLMQALIIDAKRRGKP"
FT   gene            complement(247452..247925)
FT                   /locus_tag="YPK_0203"
FT   CDS_pept        complement(247452..247925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0203"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66516"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B0E1"
FT                   /protein_id="ACA66516.1"
FT                   /translation="MTNLGLLKDHLALGEDYSEQLLQVLQSALDEITASRARLLELGGY
FT                   SPAVTADLLTGCGKTTQYTTKFERSDLHSAGSSALICVLVAHENQRTVLDQLVTLTCQD
FT                   GVWTAQIALDEFPGHNSPAAAMDKLSDWLIRRGLATRVSDSLRTQLEALWTKN"
FT   gene            complement(247918..248310)
FT                   /locus_tag="YPK_0204"
FT   CDS_pept        complement(247918..248310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0204"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ecv:APECO1_4036 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66517"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZ29"
FT                   /protein_id="ACA66517.1"
FT                   /translation="MTKHNSKEHAAARKRLSRARGKSQFGQHRLEIVLSDRGFKKLLDA
FT                   CQRRNPGRKPYIHSEYIELLLFCDGERLERQEACLGHCNHCKLPLPAGCNTAFIGESAC
FT                   WFYRQSRSLNLTDVTGHAQLDEVQND"
FT   gene            complement(248303..248512)
FT                   /locus_tag="YPK_0205"
FT   CDS_pept        complement(248303..248512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66518"
FT                   /db_xref="GOA:A0A0H3AWY7"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AWY7"
FT                   /protein_id="ACA66518.1"
FT                   /translation="MSIREITLICWAVASYIYLGYCWASILRRLGWMRKDIHWIAFIFT
FT                   MLLWPAGLMIFEARLIEEDYDDND"
FT   gene            complement(248512..249054)
FT                   /locus_tag="YPK_0206"
FT   CDS_pept        complement(248512..249054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0206"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ypi:YpsIP31758_B0087 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66519"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYM8"
FT                   /protein_id="ACA66519.1"
FT                   /translation="MEIEISQSMKMRLSGLERLDPVEVLVDDYEPGKGKITITCYGKAW
FT                   TASWFAMSGQTISQFFRRCGNDYLIGYLSPQLDQQIDGDNDDNIRFVKMEIIKSLRAND
FT                   ISKEKAREYWDESVFSENVKSDICKRLSGPDLSDLLGDDPYYANWPMVENPSYRYLSRI
FT                   VDAVKAGFAQSEWVKGA"
FT   gene            complement(249044..249286)
FT                   /locus_tag="YPK_0207"
FT   CDS_pept        complement(249044..249286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0207"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66520"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZN9"
FT                   /protein_id="ACA66520.1"
FT                   /translation="MSHFLKGMSAEKFNQKYPVGCSFNYFPNRGIPDSVEVVTRTEAWA
FT                   LGHGAVVVSVNGRAGGVSLEHLKPVITRVGEPNGN"
FT   gene            complement(249283..249504)
FT                   /locus_tag="YPK_0208"
FT   CDS_pept        complement(249283..249504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0208"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66521"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B0E4"
FT                   /protein_id="ACA66521.1"
FT                   /translation="MKAHVSSREYQDNGNKRIYTLMDGSVVIEYPNLPGKSRFNFFNHC
FT                   GNTVHKNQQRVAMKQAVEHHKKQWKVKP"
FT   gene            complement(249501..250001)
FT                   /locus_tag="YPK_0209"
FT   CDS_pept        complement(249501..250001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0209"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66522"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZ34"
FT                   /protein_id="ACA66522.1"
FT                   /translation="MESLSKTDSLRQALEILGTATGRELANFTGLPIDRVGSLLASDIS
FT                   KGRIVRGWNGKTRCYGMAGTLTDTGSLAGKSGPRYWKNKSIRTTKANSSKLRCLPLGVT
FT                   NPEFQTLTLKAVALEKQSKYASAGPVWLAAADISMLIVNEQWCLTRAKFCDSAQAKRWG
FT                   GQP"
FT   gene            complement(250001..250699)
FT                   /locus_tag="YPK_0210"
FT   CDS_pept        complement(250001..250699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0210"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0552 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66523"
FT                   /db_xref="InterPro:IPR016868"
FT                   /db_xref="InterPro:IPR024498"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AWZ2"
FT                   /protein_id="ACA66523.1"
FT                   /translation="MNKEKYLAKIKKLLNLAKRSANPNEAANALRQAQNLMREHRLNET
FT                   DVALTEISEASSKGAPSDAVSIPRYMSSLMSIISRAFGVQNYLTWQGNKRTIVFYGPNE
FT                   RPQIAAYAFDVLSRQMMTSRRAFSAKQRNSLKRTTKIGRADSYCEAWVSGAYTVIERFV
FT                   VTTNERELMDTYYQRISNGGAWKAVAMREAKKVRGINDAADAGYRAGKDANLLHAVNGT
FT                   DSQPALIGRS"
FT   gene            complement(250782..250973)
FT                   /locus_tag="YPK_0211"
FT   CDS_pept        complement(250782..250973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0211"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66524"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYN3"
FT                   /protein_id="ACA66524.1"
FT                   /translation="MKAEEFNRRYPVGKVFIHQPCMLLRGGRAVKTVGPASDFNSATVV
FT                   EINKEPYFANTESLTPAG"
FT   gene            complement(250975..251613)
FT                   /locus_tag="YPK_0212"
FT   CDS_pept        complement(250975..251613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0212"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hdu:HD0097 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66525"
FT                   /db_xref="InterPro:IPR021505"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZP2"
FT                   /protein_id="ACA66525.1"
FT                   /translation="MSTENKQFTDKAAPEGYWVDAKGILTPEALVKDIDKMRDTLVGDI
FT                   INRALVVNKMLTEFKLATFADIAAFVDLSANEYNVSLGGKKGNVTLYTFDGKYKIQRAM
FT                   QDRIAFDERLQAAKALIDECLADWVEGARPEIHTLINRAFSSDKEGEINTGAVLALRRY
FT                   DIQDSRWLRAMDAISEAVQVVGSRSYVRVYERIGDSDQYQPIPLDISGV"
FT   gene            complement(251603..251803)
FT                   /locus_tag="YPK_0213"
FT   CDS_pept        complement(251603..251803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0213"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66526"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B0E7"
FT                   /protein_id="ACA66526.1"
FT                   /translation="MAKIIIDITTDSKNRMAVDCRCEATKTDGKDDLAIAKAVSCGLAG
FT                   HISIKAHEALIKTKRGKKHVH"
FT   gene            complement(251810..252043)
FT                   /locus_tag="YPK_0214"
FT   CDS_pept        complement(251810..252043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0214"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66527"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZ38"
FT                   /protein_id="ACA66527.1"
FT                   /translation="MCQLPINNPTLMKPINRLLRAGIKVVELNTRLRRPIIEVDRPFKA
FT                   WEQGAVEITETRNGVRSLVKMTIWRGAHIIWR"
FT   gene            complement(252062..252952)
FT                   /locus_tag="YPK_0215"
FT   CDS_pept        complement(252062..252952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0215"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="KEGG: nmc:NMC1048 putative phage transposase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66528"
FT                   /db_xref="GOA:A0A0H3AX02"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AX02"
FT                   /protein_id="ACA66528.1"
FT                   /translation="MTIKNDLIELMERKSLNQTQVSRAIGMSTATVNQYLQDKYNGDLD
FT                   RVNSEVQAFLERTREKDKAQRVDVKFVATSASKKALEIIRMAHVDGEINVIYGEAGLGK
FT                   TMALKAYASQNSTALLIEVDPSFTARVLLEEICNRLGLSPRGNMHETFELCTNKLRDSG
FT                   YVLLIDEGELLPHRSLEVLRRLHDKSGIGVVLVGMPRLLINLKGKRGEFVQLYSRVAFA
FT                   LNIGNALPKDDVSAIAASVLPAVADDINEALYQESKGNARRLFKLLRGAIRLSHINETP
FT                   MGVGAVRQAAKPPKC"
FT   gene            complement(252995..255049)
FT                   /locus_tag="YPK_0216"
FT   CDS_pept        complement(252995..255049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0216"
FT                   /product="Transposase-like Mu"
FT                   /note="PFAM: Integrase catalytic region; Transposase-like
FT                   Mu; KEGG: sfv:SFV_0328 putative phage transposase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66529"
FT                   /db_xref="GOA:A0A0H3AYN7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR003314"
FT                   /db_xref="InterPro:IPR009004"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR015378"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYN7"
FT                   /protein_id="ACA66529.1"
FT                   /translation="MFLSVNELIGLPGMPGTAPGIRAALNKRAGSSLELKRKRAGTKAF
FT                   EYHIDCLTEQQQNVVRERHLNSLLNAEKKAVKTAFNGDLNPRVKAKHELDLMRQCPALL
FT                   ERSTGSLTKLQRDIADARATLVTEVINLQNAGLSRIRAINYICDQSRSNNLPENLQKAA
FT                   AMANARKGLRTGVSTRTLNGWVVDYERAATPSERLVLLAPGHNKGKPVERIKWMPLFMA
FT                   HYRTTNGLSIAEAYENFEHDWQMQYADQPAMLAAIPSVYAVRRALDKLPTVVKQRGRVT
FT                   GSAMRALNTYVKRDWSQMPVNGVWIGDGHSMKMKVAHPDHGRPFTPEITLVIDGRTRYV
FT                   VGWSLSLAENVIAVADALRHGMQSHGIPLIYYSDNGAGQTANVLDADITGILSRLGVEH
FT                   PTGIPGNPQARGIIERLNREIPARIARKFATYNGKSADRETVRMVSVDLNSAFNAQGKN
FT                   KELSSRQKAAMAKLPSWQQLIDAIEDEIEAYNTTHRHSELPRRDDGKHYTATEYRQLLL
FT                   ASETIDRLSDIELRDMFRPQVKRTAQRGWLSIFNNQYFAEGLIQVDGEEVLVEFDIHDA
FT                   SSVTVRRLDGSFICTAIVNGNTRAAFPVDYVQKVAKDRHSRRMKLVEQKAEEINAELNP
FT                   VLTVDSAPDFGSLIQGDISRINDDREEMFLFQSDRDEYLKTHGNKKAAI"
FT   gene            complement(255051..255296)
FT                   /locus_tag="YPK_0217"
FT   CDS_pept        complement(255051..255296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0217"
FT                   /product="putative transcriptional regulator, Nlp"
FT                   /note="KEGG: plu:plu0944 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66530"
FT                   /db_xref="GOA:A0A0H3AZP5"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR038722"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZP5"
FT                   /protein_id="ACA66530.1"
FT                   /translation="MMNRNEVACSDMHRIDIVASLHKQGVTMRDLSIEAGLAADTLKNA
FT                   LYRPYPKGEKIIAQALGLEPANIWPSRYPALTRRVA"
FT   gene            255478..256041
FT                   /locus_tag="YPK_0218"
FT   CDS_pept        255478..256041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0218"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: plu:plu1095 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66531"
FT                   /db_xref="GOA:A0A0H3B0F2"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B0F2"
FT                   /protein_id="ACA66531.1"
FT                   /translation="MSGSKVKEFTFEAEGKEELKERLRELVGTRSVRAAARDWGLSFST
FT                   LNNYLTKSTEPAFTAMQKIAHKERVSLDWLAYGSASTTTKTTNHDLGEAAKEHKAKGKL
FT                   TSAWLAVLDSLDENEAQALLRVIHKKGVDGIVQVAAANSLDIGLLQLPTEEKERLMALH
FT                   EAKKGASESCVENNSVDESQKKAG"
FT   gene            complement(256387..258942)
FT                   /locus_tag="YPK_0219"
FT   CDS_pept        complement(256387..258942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0219"
FT                   /product="penicillin-binding protein, 1A family"
FT                   /note="TIGRFAM: penicillin-binding protein, 1A family;
FT                   PFAM: glycosyl transferase family 51; penicillin-binding
FT                   protein transpeptidase; KEGG: ypk:y3924 peptidoglycan
FT                   synthetase; penicillin-binding protein 1A"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66532"
FT                   /db_xref="GOA:A0A0H3AZ43"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031376"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZ43"
FT                   /protein_id="ACA66532.1"
FT                   /translation="MKFVKYFLILAVCCILLGAASIFGLYKYIEPQLPDVATLKDIRLQ
FT                   TPMQVYSAEGELIAQFGEKRRIPLTLNQIPPEMVHAFIATEDSRFYDHHGVDPVGILRA
FT                   VSIAMLSGRASQGASTITQQLARNFFLSPERTLMRKIKEAFLAIRIEQMLTKDEILELY
FT                   LNKIYLGYRAYGVGAAAQVYFGKEVHELTLSQIAMIAGLPKAPSTFNPLYSHDRAVARR
FT                   NVVLLRMLDEKYITQAQYDQARSEELVANYHVPQIAFSAPYLAEMVRQEMIKRYGENAY
FT                   TDGYQVYTTITRKLQLAAVDSLRANVLAYDMRHGYRGPSNVLWKVGESAWSREQIIDSL
FT                   KALPVYGPLLPAVVTEADAAQATAMLADGSNVTLPMVGIRWARPFKSDNAQGPVPKKAT
FT                   DVVQPGQQIWVRKVDDNWWLAQVPDVNSALVSIDPNNGAIKALVGGFDFNQSKFNRATQ
FT                   ALRQVGSNIKPFLYTAAMDKGLTLATILNDLPITRWDSGAGTDWRPKNSPPTYDGPIRL
FT                   RQGLGQSKNVVMVRAMRAMGVDYAAEYLQRFGFPAQNIVHSESLALGSASFTPLQLVRG
FT                   YAVLANGGYLVDPYFITKITDDVGNVLFETKPKVVCDNCNLPVIYGDTQRSVVLSDDNI
FT                   ENVATSQNQNASNVPMPELEQVTPAQTTLNSEQQYAPHVISTPLAFLMRDALNSNIFGE
FT                   PGWMGTGWRAGRDLKRKDIGGKTGTTNSSKDAWFSGYGPDTVTSVWIGFDDHRRNLGRS
FT                   TASGAIPDQISGAEGGAKTAQPAWNDFMKVALEGLPEKQVPPPPGIVSVVIDKQTGKLS
FT                   NGGPGSRSEYFIDGTQPTEHTVHEVGTTLMDNGQTHELF"
FT   sig_peptide     complement(258859..258942)
FT                   /locus_tag="YPK_0219"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.975) with cleavage site probability 0.448 at
FT                   residue 28"
FT   gene            259062..259958
FT                   /locus_tag="YPK_0220"
FT   CDS_pept        259062..259958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0220"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ypi:YpsIP31758_3971 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66533"
FT                   /db_xref="InterPro:IPR005883"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AX07"
FT                   /protein_id="ACA66533.1"
FT                   /translation="MYSQYWQVGLDIQMEAIRALAVIRRRNGWQLRYWWHQVLPSGVLR
FT                   EGILHQPDILSEQLKLLRKQLPRHISLRIALPAQRILQHTIHVPDRRLREPERDGFIKA
FT                   SASRLFPVNSQALALDYCRETVASSELLITAARQSEVQQWQACLEQAGLSSQVIDIAPC
FT                   ALRYMATAAGLSGPYWLVHRLANEWLWVSSSDMPFHSGVVAIETECRTQENDIRLLSAL
FT                   LAQLNMRGAGEDGAPLPVYYSSVVKESLPENTRSWSPLTAFAHYQPPLPALPAAFTLAG
FT                   GLAVRAADSLSAAGAGY"
FT   gene            259958..260563
FT                   /locus_tag="YPK_0221"
FT   CDS_pept        259958..260563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0221"
FT                   /product="Fimbrial assembly family protein"
FT                   /note="PFAM: Fimbrial assembly family protein; KEGG:
FT                   ypp:YPDSF_0073 membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66534"
FT                   /db_xref="GOA:A0A0H3AYP2"
FT                   /db_xref="InterPro:IPR007813"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYP2"
FT                   /protein_id="ACA66534.1"
FT                   /translation="MYQVNFLPWRIARQQARYRFWRNTMLIQGIGLALYLVVVLMQARS
FT                   EHKHRQGTAAALSQQQAALSQRQQQVQQAMAQLQRIKQHIQRYHQAHQPARGYSILLQQ
FT                   LSQQIPERCWLMALRQQGDVLSFEVISRDYATINAFLAMLGRQPLLVNVSLQGITQQDE
FT                   GGFRFVVHASWRDENHHVEGHHAEGHDIDGHHVAGDYE"
FT   gene            260511..261137
FT                   /locus_tag="YPK_0222"
FT   CDS_pept        260511..261137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0222"
FT                   /product="membrane protein"
FT                   /note="KEGG: ypp:YPDSF_0074 membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66535"
FT                   /db_xref="GOA:A0A0H3AZQ1"
FT                   /db_xref="InterPro:IPR006052"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZQ1"
FT                   /protein_id="ACA66535.1"
FT                   /translation="MQKAMISTVIMWQGTMNKSLQRCMDRPGWQLCLWQWFFLSLLGVI
FT                   AYGGLLRPTWQQRSEAIAEVTKLQQHVEQQVSALAQLPSQALIRQQINTLLSEKAWWQK
FT                   PEILLAHQVGETIMPFGGQVIRWQRYSGSEEAVVENAIAFRRWEATLRVSFYGLYHLFG
FT                   QLSEIRSPVLVKVISLIGDGNALTVKLILTEYLTDDLGDFDVQDK"
FT   gene            261103..261531
FT                   /locus_tag="YPK_0223"
FT   CDS_pept        261103..261531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0223"
FT                   /product="membrane protein"
FT                   /note="KEGG: ypp:YPDSF_0075 membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66536"
FT                   /db_xref="InterPro:IPR019684"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B0F6"
FT                   /protein_id="ACA66536.1"
FT                   /translation="MTWVILMFKINSYKINSYIAVLAMGLAATRLLVIGLLPSSIFASP
FT                   HLANIERDPFQAVLATSCDSERERLTGWKLHGVVSGGGYQSAWIQRPDATWQRLTLGMR
FT                   LVSEWQVTQISAQWVDFQYENPETPCSGLSVTFSLFQQ"
FT   sig_peptide     261103..261234
FT                   /locus_tag="YPK_0223"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.895) with cleavage site probability 0.842 at
FT                   residue 44"
FT   gene            261722..263104
FT                   /locus_tag="YPK_0224"
FT   CDS_pept        261722..263104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0224"
FT                   /product="type IV pilus secretin PilQ"
FT                   /note="TIGRFAM: type IV pilus secretin PilQ; PFAM: type II
FT                   and III secretion system protein; NolW domain protein;
FT                   KEGG: ypi:YpsIP31758_3967 protein transporter HofQ"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66537"
FT                   /db_xref="GOA:A0A0H3AZ47"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR013355"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZ47"
FT                   /protein_id="ACA66537.1"
FT                   /translation="MGVPSHSRSSNSHLSDSKLSNSASSNSTSSNSVLSNSVLSNSVLS
FT                   NNVSSSNISPNNASSSNASLPRTRSGGPVTLEFQDAPVSVILQALADYRQLNLITTTGV
FT                   GGNLSLRLIEVPWEQALAIILRMGRLKAEREGTVMMVFTEQEIQERQQRTKQQAAPEAL
FT                   ANLTLALQYANAEQVADSLDPLQGGLLSPMGSVVADKRTNTLLIRDTPASLALLKNWLI
FT                   EMDLPLQQVQLSAHIVTISSEDLQELGVRWGMGEGKGNTALRINDFNVNLPLPNSAASV
FT                   GFHVARIGGRLLELELSALEQENQVDIIASPRLITSHQQTASIKQGSDIPYTVSRGKKE
FT                   AAAIEFKEAVLGMEVTPKILRNGKIILDLKISQNMPGITIKRGESEMLLIDKQEIKTQV
FT                   TVNDGETIVLGGIFQQKKRQSVNKVPLLADIPLLGAMFRQDTQQQSRRELVIFITPKLI
FT                   SA"
FT   gene            263453..263974
FT                   /locus_tag="YPK_0225"
FT   CDS_pept        263453..263974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0225"
FT                   /product="Shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="PFAM: shikimate kinase; KEGG: ypi:YpsIP31758_3966
FT                   shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66538"
FT                   /db_xref="GOA:B1JIQ3"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JIQ3"
FT                   /protein_id="ACA66538.1"
FT                   /translation="MAEKRNIFLVGPMGAGKSTIGRQLAQQLNMEFFDSDQEIERRTGA
FT                   DVGWVFDVEGEEGFRDREEKVINELTEKQGIVLATGGGSVKSRETRNRLSARGVVVYLE
FT                   TTIEKQLARTQRDKKRPLLQVDEPPREVLEALAKERNPLYEEIADVTIRTDDQSAKVVA
FT                   NQIINMLESN"
FT   gene            264031..265119
FT                   /locus_tag="YPK_0226"
FT   CDS_pept        264031..265119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0226"
FT                   /product="3-dehydroquinate synthase"
FT                   /EC_number="4.2.3.4"
FT                   /note="PFAM: 3-dehydroquinate synthase; KEGG:
FT                   ypi:YpsIP31758_3965 3-dehydroquinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66539"
FT                   /db_xref="GOA:B1JIQ4"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JIQ4"
FT                   /protein_id="ACA66539.1"
FT                   /translation="MEKITVTLGERSYPITIAAGLFNDPASFKPLKAGDQVMLVTNQTL
FT                   APLYLDSLRAVLEHGGIKVDQVILPDGEQYKSLSVMEQVFSALLEKPHGRDTTLVALGG
FT                   GVVGDLTGFAAACYQRGVRFIQVPTTLLSQVDSSVGGKTAVNHPLGKNMIGAFYQPASV
FT                   VVDLNCLKTLPPRELASGLAEVIKYGIILDAAFFDWLENNIDALLALDMSALAYCIRRC
FT                   CELKADVVAADEREESGARALLNLGHTYGHAIEAEMGYGVWLHGEAVAAGMVMAAQTSR
FT                   RLGQLSVSDVERIKKLLLRAGLPVCGPKEMAPESYLPHMMRDKKVLAGELRLVLPTAIG
FT                   KSEIRGGVAHDMVLASIADCRP"
FT   gene            265373..266362
FT                   /locus_tag="YPK_0227"
FT   CDS_pept        265373..266362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0227"
FT                   /product="Sporulation domain protein"
FT                   /note="PFAM: Sporulation domain protein; KEGG:
FT                   ypi:YpsIP31758_3964 putative DamX protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66540"
FT                   /db_xref="GOA:A0A0H3AX12"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR032899"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AX12"
FT                   /protein_id="ACA66540.1"
FT                   /translation="MDDLKLDDDLKPDSSDRRPTRSRKSPTGPKLAVSRQHMMIGIGIL
FT                   VLLLIIIAIGSALKAPTEHEASQQNPNVNAARDINLSDSSSLTSGNNSQPSIANNTSDG
FT                   HDASGVKNTAPPQDISAPPISPTPTEAAIPPSANSTTQRIELPGNMSDALSQTQGQVDT
FT                   LSQNISDAHTSTLPTAAATVAPSKGAKVPATRETITQPVQKQATKQPAVNHKNTATVAV
FT                   PPATSGTPKSGAASSRALSSAPSSHYTLQLSSASRSDTLNAYAKQQNLTDYHVYETKRD
FT                   GKPWYILVSGNYASSAEAKKAITTLPADVQAKKPWVKPVQQVQQDLKK"
FT   gene            266446..267261
FT                   /locus_tag="YPK_0228"
FT   CDS_pept        266446..267261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0228"
FT                   /product="DNA adenine methylase"
FT                   /EC_number="2.1.1.72"
FT                   /note="KEGG: ypi:YpsIP31758_3963 DNA adenine methylase;
FT                   TIGRFAM: DNA adenine methylase; PFAM: D12 class N6
FT                   adenine-specific DNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66541"
FT                   /db_xref="GOA:A0A0H3AYP5"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR012263"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR023095"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYP5"
FT                   /protein_id="ACA66541.1"
FT                   /translation="MKKNRAFLKWAGGKYPLVDDIRRHLPAGDCLIEPFVGAGSVFLNT
FT                   EFESYILADINNDLINLYNIVKLRTDDFVRDARVLFTGDFNHSELFYQLRQEFNASTDA
FT                   YRRALLFLYLNRHCYNGLCRYNLSGEFNVPFGRYKKPYFPEAELYWFAEKSQNAVFVCE
FT                   HYQETLLKAVQGAVVYCDPPYAPLSATANFTAYHTNNFGIADQQNLARLAYQLSTESKV
FT                   PVLISNHDTELTRNWYHQAASLHVVTARRTISRNILGRSKVNELLALYS"
FT   gene            267564..268241
FT                   /locus_tag="YPK_0229"
FT   CDS_pept        267564..268241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0229"
FT                   /product="Ribulose-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /note="PFAM: ribulose-phosphate 3-epimerase; KEGG:
FT                   ypi:YpsIP31758_3962 ribulose-phosphate 3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66542"
FT                   /db_xref="GOA:A0A0H3AZQ8"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZQ8"
FT                   /protein_id="ACA66542.1"
FT                   /translation="MKKYLIAPSILSADFARLGEDTAKVLAAGADIVHFDVMDNHYVPN
FT                   LTIGPMVCKALRDYGITAPIDVHLMVKPVDRIVPDFAKAGATYITFHPEASEHVDRTLQ
FT                   LIKESGCKAGLVFNPATPLSYLDYVMDKLDVILLMSVNPGFGGQSFIPETLNKLRQVRK
FT                   LIDDSGYDIRLEVDGGVKVENIRQIAAAGADMFVAGSAIFNQPDYAAVIDAMRNELAMA
FT                   ANG"
FT   gene            268234..268932
FT                   /locus_tag="YPK_0230"
FT   CDS_pept        268234..268932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0230"
FT                   /product="phosphoglycolate phosphatase"
FT                   /note="TIGRFAM: phosphoglycolate phosphatase;
FT                   HAD-superfamily hydrolase, subfamily IA, variant 3;
FT                   HAD-superfamily hydrolase, subfamily IA, variant 1; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; KEGG:
FT                   ypi:YpsIP31758_3961 phosphoglycolate phosphatase,
FT                   bacterial"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66543"
FT                   /db_xref="GOA:A0A0H3B0G2"
FT                   /db_xref="InterPro:IPR006346"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR037512"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B0G2"
FT                   /protein_id="ACA66543.1"
FT                   /translation="MVKFKAIRGVAFDLDGTLVDSAPGLARAIDMALAHQGLPAAGEAL
FT                   VSTWIGNGADVLVERALHWAGREHNAQLVAQTRELFDHYYAKTVEQGSQLFPQVKATLA
FT                   QLAANGLPIGLITNKPTPFVAPLLTSLGISDYFSVIIGGDDVVVKKPHPAPLYLLLGKL
FT                   GLHAREMLFVGDSRNDIMAAQAAGCPCIGLTYGYNYGEAIATSHPDCVLAHFADLLPAI
FT                   GLPSLKDQEV"
FT   gene            268934..269974
FT                   /locus_tag="YPK_0231"
FT   CDS_pept        268934..269974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0231"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="KEGG: yps:YPTB3744 tryptophanyl-tRNA synthetase;
FT                   TIGRFAM: tryptophanyl-tRNA synthetase; PFAM: aminoacyl-tRNA
FT                   synthetase class Ib"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66544"
FT                   /db_xref="GOA:A0A0H3AZ53"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZ53"
FT                   /protein_id="ACA66544.1"
FT                   /translation="MSEPMVLSKPTVSSKPIVFSGAQPSGELTIGNYMGALRQWVQMQD
FT                   DYDCIYCIVDLHAITARQDPALLRKRTLDTLALYLACGIDPKKSTIFVQSHVPEHSQLS
FT                   WALNCYTYFGELSRMTQFKDKSARYAENINAGLFDYPVLMAADILLYQTNQVPVGEDQK
FT                   QHLELSRDIASRFNNLYGDIFKIPEPFIPKAGARVMSLQDPTKKMSKSDDNRNNVIELL
FT                   EDPKSVVKKIKRAMTDSDEPALIRYDVEKKAGVSNLLDILSGVTGQSIPELEAQFTGQM
FT                   YGHLKGAVADAVSGMLSELQERYRTYREDEALLQDVMREGAAKARARAQVTLAKVYEAI
FT                   GFVAQP"
FT   gene            complement(270092..271513)
FT                   /locus_tag="YPK_0232"
FT   CDS_pept        complement(270092..271513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0232"
FT                   /product="uroporphyrin-III C-methyltransferase"
FT                   /note="TIGRFAM: uroporphyrin-III C-methyltransferase;
FT                   siroheme synthase; PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG:
FT                   ypi:YpsIP31758_3959 siroheme synthase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66545"
FT                   /db_xref="GOA:A0A0H3AX17"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR006367"
FT                   /db_xref="InterPro:IPR012409"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR019478"
FT                   /db_xref="InterPro:IPR028281"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037115"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AX17"
FT                   /protein_id="ACA66545.1"
FT                   /translation="MDYFPIFCQLQHKACLLVGGGEIAERKARLLLDAGALVTVNACEF
FT                   TPQFHHWADQGQLSLISGEFVPELLADKWLVIAATDQLSVNALVYQSANQQRIFCNVVD
FT                   DPKRTSFIMPSIIDRSPIMIAVSSGGKAPVLARLLREKLEALLPQHLGQLAQLAGNLRQ
FT                   RVKQHFAAMTERRRFWEKLLTHDRLAQSLANNDHVQADQHVEQLFSAPLTDRGEVVLVG
FT                   AGPGDAGLLTLKGLQQIQQADVVVYDRLVSDEVMNLVRRDAERIFVGKQSGHHCVPQEQ
FT                   INQILLQQAQSGKRVVRLKGGDPFIFGRGGEELEELAGYGIPFSVVPGITAASGCSAYS
FT                   GIPLTHRDHAQSVRLVTGHAKKEGQLDWANLAAEKQTLVFYMGLSQAGEIQQQLIQHGM
FT                   PATTQVALVENGTSRHQRVVSGELSQLALLSQQVSSPSLIIVGSVVSLREKLNWFSSRH
FT                   HDDQPKVTECVAHVG"
FT   gene            complement(271576..272382)
FT                   /locus_tag="YPK_0233"
FT   CDS_pept        complement(271576..272382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0233"
FT                   /product="formate/nitrite transporter"
FT                   /note="PFAM: formate/nitrite transporter; KEGG:
FT                   ypi:YpsIP31758_3958 formate/nitrite transporter"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66546"
FT                   /db_xref="GOA:A0A0H3AYQ0"
FT                   /db_xref="InterPro:IPR000292"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="InterPro:IPR024002"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYQ0"
FT                   /protein_id="ACA66546.1"
FT                   /translation="MYTDTINKCAANAARIVKLAKESPLGFWIGSAMAGAYVGLGIILI
FT                   FTLGNLIDPALRPLVMGATFGLALTLVIIAGSELFTGHTMFLTFGVKAGTIKSSQMWAV
FT                   LPQTWLGNLLGSIFVALLYYYGGGNLLSVDTSLVHTAALAKTTAPAMALFFKGVLCNWL
FT                   VCLAIWMAIRVEGAAKFIAIWWCLLAFIASGYEHSVANMTLLALSWFGHHSEAYTLSGI
FT                   GHNLLWVTLGNTLSGAVFMGLGYWYATPRAQRPQPATINAPHSAKS"
FT   gene            complement(272577..272903)
FT                   /locus_tag="YPK_0234"
FT   CDS_pept        complement(272577..272903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0234"
FT                   /product="nitrite reductase (NAD(P)H), small subunit"
FT                   /EC_number="1.7.1.4"
FT                   /note="TIGRFAM: nitrite reductase [NAD(P)H], small subunit;
FT                   KEGG: ypi:YpsIP31758_3957 nitrite reductase [NAD(P)H],
FT                   small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66547"
FT                   /db_xref="GOA:A0A0H3AZR3"
FT                   /db_xref="InterPro:IPR012748"
FT                   /db_xref="InterPro:IPR017881"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZR3"
FT                   /protein_id="ACA66547.1"
FT                   /translation="MSQWIPLCPLNDILPGSGVCGLIKQQQVAVFRPYADEQVFAISNI
FT                   DPFAQASVLSRGLIAEHQGELWVASPLKKQHFRLRDGFCLEDEDRSVTHYDVRVRDGMV
FT                   QVNA"
FT   gene            complement(272900..275446)
FT                   /locus_tag="YPK_0235"
FT   CDS_pept        complement(272900..275446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0235"
FT                   /product="nitrite reductase (NAD(P)H), large subunit"
FT                   /note="TIGRFAM: nitrite reductase [NAD(P)H], large subunit;
FT                   PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; nitrite/sulfite reductase hemoprotein
FT                   beta-component ferrodoxin domain protein; nitrite and
FT                   sulphite reductase 4Fe-4S region; BFD domain protein
FT                   [2Fe-2S]-binding domain protein; KEGG: ypi:YpsIP31758_3956
FT                   nitrite reductase [NAD(P)H], large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66548"
FT                   /db_xref="GOA:A0A0H3B0G6"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR012744"
FT                   /db_xref="InterPro:IPR017121"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041575"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B0G6"
FT                   /protein_id="ACA66548.1"
FT                   /translation="MSKIKIAIIGNGMVGHRFIEDLLDKADKDQFDITVFCEEPRIAYD
FT                   RVHLSSYFSHHTAEELSLVREGFYEKQGVKVLVGERAITINRAEKVIHSNSGRSLYYDK
FT                   LVMATGSYPWIPPIKGSEGQDCFVYRTIEDLNAIEACTRRSKRGAVIGGGLLGLEAAGA
FT                   LKSLGVETHVIEFAPVLMAEQLDPMGGDQLRQKIERMGVRVHTGKNTQEIVHSGQNSRK
FT                   TMLFADGTQLEVDFIVFSTGIRPQDKLANQCGLATARRGGIAINDYCQTSDPDVYAIGE
FT                   CASWQERTFGLVAPGYKMAQVAADHLLGRENAFLGADMSAKLKLLGVDVGGIGDAHGRT
FT                   EGARSYVYLDESKEIYKRLVVSADNKTLLGAVLVGDTTDYGNLLQLALNNITLPENPDS
FT                   LILPAHTGNKPTIGVDSLPDSAQICSCFDVTKGDIIRAIGQGCQTVAALKSATKAGTGC
FT                   GGCIPLVTQVLNAELSKQGIEVNNHLCEHFAYSRQELYHLIRVEGIKTFTELREKYGKG
FT                   YGCEVCKPTVGSLLASCWNEYVLEPQHTPLQDTNDNFLGNIQKDGTYSIIPRSPGGEIT
FT                   PDGLLVVGQIAKEYNLYTKLTGSQRIGMFGAQKDDLPAIWARLIDAGFETGHAYAKALR
FT                   MAKTCVGSTWCRFGVGDSVGFGVALEHRYKGIRAPHKIKFGISGCTRECAEAQGKDVGI
FT                   IATENGWNLYVCGNGGMKPRHADLLAADLDEETLMRYLDRFMMFYIRTADKLQRTSVWL
FT                   ESLEGGIRYLQSVILEDKLGINDQLEAEIARLRDKVACEWKATVENPAAQVRFAHFINS
FT                   SLRDPNVQVVREREQHRPARPDERIPVRVLELEDNA"
FT   gene            complement(275480..275593)
FT                   /locus_tag="YPK_0236"
FT   CDS_pept        complement(275480..275593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0236"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66549"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZ58"
FT                   /protein_id="ACA66549.1"
FT                   /translation="MNKIHNLSKKLKNHLSTTLEVYEKQIDLHQETRLAEG"
FT   gene            275768..277066
FT                   /locus_tag="YPK_0237"
FT   CDS_pept        275768..277066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0237"
FT                   /product="N-isopropylammelide isopropylaminohydrolase"
FT                   /EC_number="3.5.99.4"
FT                   /note="PFAM: amidohydrolase; Amidohydrolase 3; KEGG:
FT                   ypi:YpsIP31758_3955 cytosine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66550"
FT                   /db_xref="GOA:A0A0H3AX20"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AX20"
FT                   /protein_id="ACA66550.1"
FT                   /translation="MAGQSVPNYSLTTVNNVRRIGLAGLWQITIAEGKISLIQPQPEQS
FT                   LTGQGVLDAQGGLALPPFIEPHIHLDTTQTAGQPSWNQSGTLFEGIERWAERKARLTRE
FT                   DVKQRAWQTLKWQIANGIQHVRTHVDVSDPHLTALSAMLEVKEEVSPWVDMQIVAFPQE
FT                   GILSYPDGAALLEEALRLGADAVGAIPHFEFTREYGVESLHIAFALAQKYQRLVDVHCD
FT                   ETDDEQSRFIETVAALALRENMGARVTASHTTAMHSYNGAYTSRLFRLLKLSGINFVAN
FT                   PLVNIHLQGRFDTYPKRRGITRVKEMLAAEINVCFGHDDVFDPWYPLGTANMLQVLHMG
FT                   LHICQLMGYEQINDGLNLITTHSAKTLNLADYGLQPGNRANLIILPAENGFDALRRQVP
FT                   VSYSIRHGVVIAKTQPAESRIYLGQEEIVDFRR"
FT   gene            complement(277151..278335)
FT                   /locus_tag="YPK_0238"
FT   CDS_pept        complement(277151..278335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0238"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   ypp:YPDSF_0090 conserved integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66551"
FT                   /db_xref="GOA:B1JIR6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR023528"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JIR6"
FT                   /protein_id="ACA66551.1"
FT                   /translation="MNNSNRIRLTWISYLSYALTGALVIVTGIVMGNIAEYFNLPIASM
FT                   SNTFTFLNAGILISIFLNAWLMEIIPLKRQLVFGFILMLIAIAGLMVGHNLMIFSISMF
FT                   IFGVVSGITMSIGTFLVTHMYEGRQRGSRLLFTDSFFSMAGMIFPIAAAMLLARHIEWY
FT                   WVYACIGLLYVGIFVLTLCSEFPVLGHKATDQSKPVVKEKWGVGVLFLAIAALCYILGQ
FT                   LGFIQWVPEYATKTFNMNISQAGQLVSNFWISYMIGMWIFSFILRFFDLQRIVTVLAAM
FT                   ATLAMYLFVSTDNPAYLSYYILALGFVSSAIYTTLITLGSLQTKVSSPKLVNFILTCGT
FT                   VGTMLTFVVTGPIVANNGVHAALETANGLYLAVFILCLALGFFTKHRSHGHVTH"
FT   sig_peptide     complement(278237..278335)
FT                   /locus_tag="YPK_0238"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.933) with cleavage site probability 0.923 at
FT                   residue 33"
FT   gene            278821..280866
FT                   /locus_tag="YPK_0239"
FT   CDS_pept        278821..280866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0239"
FT                   /product="TonB-dependent copper receptor"
FT                   /note="TIGRFAM: TonB-dependent copper receptor; PFAM:
FT                   TonB-dependent receptor; TonB-dependent receptor plug;
FT                   KEGG: yps:YPTB3737 putative iron siderophore receptor/tonB
FT                   dependent transporter"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66552"
FT                   /db_xref="GOA:A0A0H3AYQ4"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010100"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYQ4"
FT                   /protein_id="ACA66552.1"
FT                   /translation="MISGKNKVCKKKLLACAVTSAISAFASNAIADTTSLAAMNRSAIN
FT                   ISSTHNSNKKLNDADVITVTAPLYSPLVVATSPKVPRQPVPASDGADYLRTIPGFSLVR
FT                   NGGTNGDVVFRGMFGSRLKILTDGAEILGTCPSRMDAPTSYISPESFDLLTVVKGPQSV
FT                   LWGPGASAGTILFERERPHFDQSGVKGNASVLAGSNGRWDKNLDASLGNEQGYLRMMGN
FT                   QSRAADYKDGNNVRVPSQWDKWNADMALGWTPDTDTLLELSVGKGNGESRYGGRGMDGS
FT                   QFLRESLAARVEKSNIGEVLDKIEAKINYTYVDHIMDNKTLRTPPMMAMSSNLDRRMLG
FT                   GRVMGTWLWQDLKLDAGTDMQTNTHRKNKQGNWDKNARFMNNGVFGELTWAASEQNKLI
FT                   SGARLDRHQVTNYTRAGEPTRSATLPAAFMRVEHNLANAPVMLYAGLGHTERFPDYWEL
FT                   FSPKFGPAGSTSAFEGVKSEKTTQIDIGGQYSGEQFRGWLSAYIGRVNDFILFKYDPKN
FT                   LRISQADNINATIMGGEMGMEYALTPYWKADASLAYAWGENTRDNRPLPQIPPLEARLG
FT                   LTFEAGDWSSSALWRLVNSQHRVAINEGNVVGKDFSSSAGFGVLSANVAYKVNKQVKLS
FT                   SGIDNLLNKAYSEHLNLAGNSGFGYSVNTPLNEPGRTLWAKLNLTF"
FT   sig_peptide     278821..278916
FT                   /locus_tag="YPK_0239"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.981 at
FT                   residue 32"
FT   gene            complement(280963..281949)
FT                   /locus_tag="YPK_0240"
FT   CDS_pept        complement(280963..281949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0240"
FT                   /product="transcriptional regulator, LacI family"
FT                   /EC_number="5.1.1.1"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG:
FT                   ypi:YpsIP31758_3952 sugar-binding transcriptional
FT                   regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66553"
FT                   /db_xref="GOA:A0A0H3AZR5"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZR5"
FT                   /protein_id="ACA66553.1"
FT                   /translation="MVTLEDVAVLAGVSRATVSRVVNGDTNVKALTREKVEQAVAVLGY
FT                   TPHPAARALASSQSNTLGLVTTSYRGGFFGALMDFVQTETESQGKQLLVTQGRDNADKE
FT                   WLAIQRLYNLRCDGLILHVRFLSDERLRQLAAANRPFVLLDRLVPDLEARCVTFDHHHA
FT                   SQMATQVLIDAGHRDIACISGSSQRQSSVLRIQGFLDAMQLAGLEPVACLEGVYDLESG
FT                   YLRADEILKQPRLPTAIYCCNEEMAIGALLAINKHGLQVPQDISLICYDSGERAPFVCP
FT                   ALTSVHFPIVEMAQYATQLLIDPLIPAVNFPPAIIMRDSVMPPKTAC"
FT   gene            complement(282178..283491)
FT                   /locus_tag="YPK_0241"
FT   CDS_pept        complement(282178..283491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0241"
FT                   /product="glycoside hydrolase family 4"
FT                   /note="PFAM: glycoside hydrolase family 4; KEGG:
FT                   ypi:YpsIP31758_3951 6-phospho-beta-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66554"
FT                   /db_xref="GOA:A0A0H3B0G9"
FT                   /db_xref="InterPro:IPR001088"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR019802"
FT                   /db_xref="InterPro:IPR022616"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B0G9"
FT                   /protein_id="ACA66554.1"
FT                   /translation="MSTFKITIIGGGSSYTPELVDGLIQRIEQLPVTELALVDVEQGRQ
FT                   KVEIIAALTQRMLARHGLEQVKVSVHYSLDEAIRGARFVLTQFRVGQLPARAADERLGL
FT                   KYNLLGQETTGIGGFAKALRTIPVMLDIAANVERLAPDAWIINFTNPAGIVTEAVSRYT
FT                   KAKIIGLCNVPISMHHMIAKLLQAPYEDLQLRFAGLNHMVWVHEVLQRGKDVTADVLKM
FT                   LCDGASLSMNNIKEAPWPPEFLQAMGAIPCPYHRYFYQTQDMLAEEMAAAAERGTRAEQ
FT                   VMQVEKELFALYADPHLDTKPEQLSFRGGSFYSEVALELIRAIHNNLGTQLVVNTTNRG
FT                   AIRGLSDDSVVETNCIIDAKGAHPLTFGPLPVSMHGLTQQVKAYERLTIDAAVHGDRRS
FT                   ALLALVTNPLIANASIAQPLLEEVLQVNKPYLPQFSGL"
FT   gene            284007..284576
FT                   /locus_tag="YPK_0242"
FT   CDS_pept        284007..284576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0242"
FT                   /product="peptidyl-prolyl cis-trans isomerase cyclophilin
FT                   type"
FT                   /note="PFAM: peptidyl-prolyl cis-trans isomerase
FT                   cyclophilin type; KEGG: ypi:YpsIP31758_3950 peptidyl-prolyl
FT                   cis-trans isomerase A"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66555"
FT                   /db_xref="GOA:A0A0H3AZ65"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZ65"
FT                   /protein_id="ACA66555.1"
FT                   /translation="MFKRTLVTFIALCSLSAVAPAALAAGEPHVLLTTSAGNIELELNS
FT                   QKAPISTQNFVDYVNNGYYNNTIFHRVIPGFMIQGGGFTADFKEKTPKTPIKNEADNGL
FT                   RNLRGTISMARTADKDSATSQFFLNVADNAFLDHGQRDFGYAVFGKVVKGMDVVEKISQ
FT                   VQTENVGPYQNVPVKPITILSAKVLP"
FT   sig_peptide     284007..284081
FT                   /locus_tag="YPK_0242"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.988 at
FT                   residue 25"
FT   gene            284902..286443
FT                   /locus_tag="YPK_0243"
FT   CDS_pept        284902..286443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0243"
FT                   /product="protein of unknown function DUF853 NPT hydrolase
FT                   putative"
FT                   /note="PFAM: protein of unknown function DUF853 NPT
FT                   hydrolase putative; KEGG: yps:YPTB3733 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66556"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033186"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AX25"
FT                   /protein_id="ACA66556.1"
FT                   /translation="MSNTLLIGKALVTEKTQPASRDLVILSALANRHGLITGATGTGKT
FT                   VTLQKMAEQFSRIGVPVFLADVKGDLSGIGAEGVNSEKLQARLAAIDVTDWQPQACPIV
FT                   PWDIFAEKGHPIRATISDLGPLLLGRLLDLNDVQSGVLQLVFKIADDNGLLLLDMKDLR
FT                   AIVQYVGDNAKQFRTQYGNITSASIGAIQRGLLTLEEQGANQFFGEPMLDIHDLMQTDS
FT                   HGQGVINLLAADRLINQPKLYAIFLLWLLAELFEQLPEVGDVEKPKLVFFFDEAHLLFT
FT                   DAPAALVDKVEQVVRLIRSKGVGIYFVTQNPLDIPDKILGQLGNRVQHALRAFTPRDQK
FT                   AVKAAAQTMRPNPAFSAEQVITELGVGEALISFLDEKGRPNVVERAMVIAPQSKMGALD
FT                   AVARNHAINHSPLYGRYEEMIDRESAYEKLSAGGFSTMGRAAEGEPSVPQQPTNQQGSG
FT                   GGLMGGLNDLLFGSTGPRGGKRDGIVQTAAKSMARDLGRQILRGVLGSITGGRKR"
FT   gene            286686..287261
FT                   /locus_tag="YPK_0244"
FT   CDS_pept        286686..287261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0244"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /note="TIGRFAM: glutamine amidotransferase of anthranilate
FT                   synthase; PFAM: glutamine amidotransferase class-I; KEGG:
FT                   ypi:YpsIP31758_3948 para-aminobenzoate synthase glutamine
FT                   amidotransferase component II"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66557"
FT                   /db_xref="GOA:A0A0H3AYR4"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYR4"
FT                   /protein_id="ACA66557.1"
FT                   /translation="MLLLIDNYDSFTYNLYQYFCELGTEVMVKRNDELQLTDIEQLAPS
FT                   HVVISPGPCTPNEAGISLAVIRHFADKLPILGVCLGHQALGQAFGARVVRARQVMHGKT
FT                   SAICHSGQGVFRGLNQPLTVTRYHSLVIATDSLPGCFELTAWTERGGEMDEIMGIRHRT
FT                   LPLEGVQFHPESILSEQGHQLLDNFLKN"
FT   gene            287394..288611
FT                   /locus_tag="YPK_0245"
FT   CDS_pept        287394..288611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0245"
FT                   /product="succinylornithine transaminase family"
FT                   /note="TIGRFAM: acetylornithine and succinylornithine
FT                   aminotransferase; succinylornithine transaminase family;
FT                   PFAM: aminotransferase class-III; KEGG: ypp:YPDSF_0098
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66558"
FT                   /db_xref="GOA:A0A0H3AZS3"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR017652"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZS3"
FT                   /protein_id="ACA66558.1"
FT                   /translation="MTDKLAVNRNTFDQVILPVYAPAQFIPVKGKGSRVWDQQGTEYID
FT                   FAGGIAVTALGHCHPALVSALHQQGETLWHTSNVFTNEPALRLAQKLIAATFADRVFFA
FT                   NSGAEANEAAFKLARHYAIERHSPYKTKIIAFHNAFHGRTLFTVSVGGQPKYSDGFGPK
FT                   PADIIHVPFNDLAAVKAVMDDHTCAVVLEPIQGEGGITSATPEFLQGVRALCDQHNALL
FT                   VFDEVQSGMGRSGKLFSYMHYGVTPDILTTAKALGGGFPISAMLTTEEIASVMTVGTHG
FT                   TTYGGNPLACAVAEAALDVINTPEVLNGIEQRHGLFVQALQSINSKYDVFSDIRGMGLL
FT                   IGAELTAKYRGQAREFLAAAAANGLMILNAGPDVLRLAPSLVIELEDIQQGMARLEKAM
FT                   ASVIKG"
FT   gene            288750..288854
FT                   /locus_tag="YPK_0246"
FT   CDS_pept        288750..288854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0246"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66559"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B0H2"
FT                   /protein_id="ACA66559.1"
FT                   /translation="MYLRRLYDLPVLSVAGTLSITSEALASLFLRIIP"
FT   sig_peptide     288750..288830
FT                   /locus_tag="YPK_0246"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.793) with cleavage site probability 0.732 at
FT                   residue 27"
FT   gene            complement(288837..290957)
FT                   /locus_tag="YPK_0247"
FT   CDS_pept        complement(288837..290957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0247"
FT                   /product="integral membrane protein, YccS/YhfK family"
FT                   /note="TIGRFAM: integral membrane protein, YccS/YhfK
FT                   family; PFAM: protein of unknown function DUF893 YccS/YhfK;
FT                   KEGG: yps:YPTB3730 possible putative efflux transporter
FT                   (PET) family protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66560"
FT                   /db_xref="GOA:A0A0H3AZ70"
FT                   /db_xref="InterPro:IPR010020"
FT                   /db_xref="InterPro:IPR032692"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZ70"
FT                   /protein_id="ACA66560.1"
FT                   /translation="MKWQRLIYHPEVNYALRQTLVLCLPAALGFAIGDLRLGLMFSLIP
FT                   ACCNIASLDTPHQHFFRRLIIGGVLFTLSSFLTQQLLLWHIPLPVIMLGLALIVGVSGA
FT                   ISPLNGRLLPAVLIAAIFSLSMVGRAPIWQAPLLCAVGTLWYGVFNWLWFRLCKDQPIR
FT                   EPLSQLYHLLADYCDAKYSRLTQHLEPEKAIPPLLDRQQGMMDKVNQLYQQFNLLHNTT
FT                   KKEQKRLLGLFQMALDLQEHITAALNQPEEMQELIKKTPIEAVTQSNAQIISAQMRAIA
FT                   DDILYHRRTVEHFTAGIPLAELETIAQQNPDNPVAQFCYYHISHITQILSDRRPLYNRD
FT                   LMSSQLSQPFWPALVSYLSFKSSALRDAARIGVTLAVGSYIGVLINLPKPYWILLTIML
FT                   VMQNGYNATRVRIHHRALGTLVGLILTAGLLHLQLTEITTLGIMLLITLLSYLVQRKNY
FT                   GLAVVGRTITAVYIVQLLTGEGANFLVPRLLDTLIGCALALGSALWLWPQWQSGLLRKN
FT                   AHQALEAYQTILRLLLTPHPDITQLDYERFNVNKASNTVLSSLNQAMQEPGFNSKYLAD
FT                   MRLWAAHGELIVCHINEMTTLIRENPLTEVDSPSTNGHPLMSTKLAASYLQLCEMAIQL
FT                   CQQRLESDNLEDNDSVVQIPDMAPDTQASELERNLRRVLSHLNVMHTVSAMAWQQQPHH
FT                   GIWRSRKLRDNT"
FT   gene            complement(291043..291675)
FT                   /locus_tag="YPK_0248"
FT   CDS_pept        complement(291043..291675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0248"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="PFAM: cyclic nucleotide-binding; regulatory protein
FT                   Crp; KEGG: yen:YE3955 cAMP-regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66561"
FT                   /db_xref="GOA:A0A0H3AX28"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018335"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AX28"
FT                   /protein_id="ACA66561.1"
FT                   /translation="MVLGKPQTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVK
FT                   GSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFR
FT                   QLIQVNPDILMRLSSQMANRLQITSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDG
FT                   MQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGTR"
FT   gene            292011..292418
FT                   /locus_tag="YPK_0249"
FT   CDS_pept        292011..292418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0249"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: yps:YPTB3728
FT                   putative redox protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66562"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYR8"
FT                   /protein_id="ACA66562.1"
FT                   /translation="MQARVKWVEGLTFLGESASGHQVLMDGNSGDKAPSPMEMLLMSAG
FT                   GCSAIDVVSILQKGRNNVRDCEVKLTSERREEAPRLFTQINLHFIVSGKGLTDKVVERA
FT                   VDLSAEKYCSVALMLGKAATITHSFEVREVA"
FT   gene            292696..292833
FT                   /locus_tag="YPK_0250"
FT   CDS_pept        292696..292833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66563"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZS8"
FT                   /protein_id="ACA66563.1"
FT                   /translation="MEDKIVINMCLLPLLKMADYSLIETKISDGLKLTFSLENKYITQY
FT                   "
FT   gene            292863..293342
FT                   /locus_tag="YPK_0251"
FT   CDS_pept        292863..293342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0251"
FT                   /product="type VI secretion system effector, Hcp1 family"
FT                   /note="TIGRFAM: type VI secretion system effector, Hcp1
FT                   family; PFAM: protein of unknown function DUF796; KEGG:
FT                   plu:plu0404 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66564"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B0I0"
FT                   /protein_id="ACA66564.1"
FT                   /translation="MSYMIYLTLNGEQQGLISAGCSSVESIGNRYQSGHEDQIQVLGLN
FT                   HNITREQHVSHHPINFTKPIDKSSPLLTVSISNNEKVTANFVFYRVNSSGQMEVFYEVK
FT                   LTGASIIDVSSSYPHSISDNESMPYERVLLRYDSITVEHKLAGTSGYSIWDDRVY"
FT   gene            293418..294290
FT                   /locus_tag="YPK_0252"
FT   CDS_pept        293418..294290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0252"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA3675 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66565"
FT                   /db_xref="GOA:A0A0H3AZ74"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZ74"
FT                   /protein_id="ACA66565.1"
FT                   /translation="MSKYNPHLNMVFGGTMVIDEHDGKLKQWNQTEEYKYKDLQRQLDE
FT                   NQEHYALLTIGEAEFFLKNINEPNLNQSWKNTIYSYSDVISSFSGNIYDGAGIIKIVDK
FT                   FKSHGLRAKEFIGKDGNSYIKISGYDGVKKYIIVTKNSMSNKKLLSMGVGSKSMINGIV
FT                   NGAKFCVVFSLAYRAVELMLKDEYDLVDFFGNLTMDAAKLAVSTGVAFGVKSAVTSTLL
FT                   AAGTSVMVLSIGIFILGIGVAFLLYYIDDEFEISQKIIDFIRNKDREVKYYSPHPDEIF
FT                   NTWGVYSRG"
FT   gene            294250..294681
FT                   /locus_tag="YPK_0253"
FT   CDS_pept        294250..294681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0253"
FT                   /product="protein of unknown function DUF1240"
FT                   /note="PFAM: protein of unknown function DUF1240; KEGG:
FT                   yps:YPTB3727 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66566"
FT                   /db_xref="GOA:A0A0H3AX33"
FT                   /db_xref="InterPro:IPR010665"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AX33"
FT                   /protein_id="ACA66566.1"
FT                   /translation="MKYLILGGYTVVANKNKISVACGAISLFVVASFSLFFSLTHYFNF
FT                   FKMNDEVHFSWAVSLLLSGSPLLFYLSVVSGGYIIGYEKIYNDRVGKILAYIAVLGMVF
FT                   SLFFSFYVDSSLKEAGYLKCERKSFIAPNKYVIDLKLCR"
FT   gene            complement(294859..295728)
FT                   /locus_tag="YPK_0254"
FT   CDS_pept        complement(294859..295728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0254"
FT                   /product="Phosphoribulokinase"
FT                   /EC_number="2.7.1.19"
FT                   /note="PFAM: phosphoribulokinase/uridine kinase; KEGG:
FT                   ypm:YP_0177 phosphoribulokinase 1"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66567"
FT                   /db_xref="GOA:A0A0H3AYS4"
FT                   /db_xref="InterPro:IPR006082"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYS4"
FT                   /protein_id="ACA66567.1"
FT                   /translation="MSTKHPVIAVTGSSGAGTTTTSLAFRKIFQQLDIRAAQIEGDSFH
FT                   RYTRPEMDAAIRKARDQGRHISYFGPEANDFGQLEQSVAEYSKHGTGRSRKYLHTYDEA
FT                   VPYNQIPGTFTPWEPLPEPTDVLFYEGLHGGVVTEHHDVAKHVDLLVGVVPIVNLEWIQ
FT                   KLVRDTGERGHSREAVMDSVVRSMDDYINYITPQFSRTHINFQRVPTVDTSNPFAAKAI
FT                   PSLDESFVVIHFRGLDHIDFPYLLAMLQGSFISNINTLVVPGGKMGLAMELIMAPLVQQ
FT                   LLEGKQIA"
FT   sig_peptide     complement(295654..295728)
FT                   /locus_tag="YPK_0254"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.794) with cleavage site probability 0.765 at
FT                   residue 25"
FT   gene            complement(295877..296113)
FT                   /locus_tag="YPK_0255"
FT   CDS_pept        complement(295877..296113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0255"
FT                   /product="protein of unknown function UPF0270"
FT                   /note="PFAM: protein of unknown function UPF0270; KEGG:
FT                   ypi:YpsIP31758_3941 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66568"
FT                   /db_xref="InterPro:IPR010648"
FT                   /db_xref="InterPro:IPR036685"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JIT3"
FT                   /protein_id="ACA66568.1"
FT                   /translation="MIIPWQQVDSETLDNLLEAFVLREGTDYGEHERSLTEKVADVRRQ
FT                   LVSGEAVLVWSELHETINIMPRGSFHAGAEEQQ"
FT   gene            complement(296110..297090)
FT                   /locus_tag="YPK_0256"
FT   CDS_pept        complement(296110..297090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0256"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   ypi:YpsIP31758_3940 hydrolase, alpha/beta fold family"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66569"
FT                   /db_xref="GOA:A0A0H3AZT3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000952"
FT                   /db_xref="InterPro:IPR012020"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZT3"
FT                   /protein_id="ACA66569.1"
FT                   /translation="MHETFRPLAGASNPHLQTLLPRLVRRHVQLSPYWQRLELPDGDFI
FT                   DLAWSENPELAREKPRVVLFHGLEGNFYSPYAHGLLRAWQAAGWLGVVMHFRGCSGEPN
FT                   RKSRIYHSGETEDANFFLHWLQETYGQVPTAAVGISLGGNMLACYLAKKGKNSGLRAAV
FT                   VVSAPLMLEPCADRMDQGFSRVYQRYLLNQLKLNATRKLLQYPNSLPVNLFQLKKLRRV
FT                   RDFDDAITAKIHGFNDAGDYYRRCSALPLLPQIRVPLLIIHAKDDPFMTAEVIPNIETL
FT                   PDNIDYQLTEHGGHVGFVGGSLKHPQMWLEQRIPAWLSPYLEQQS"
FT   gene            297192..297794
FT                   /locus_tag="YPK_0257"
FT   CDS_pept        297192..297794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0257"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   ypi:YpsIP31758_3939 translocator protein, LysE family"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66570"
FT                   /db_xref="GOA:A0A0H3B0I5"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B0I5"
FT                   /protein_id="ACA66570.1"
FT                   /translation="MELSLFLSMVGFLWVAAITPGPNNMLLTSAGANFGFMRSIWLMLG
FT                   IMLGMQSMLLLVAFGVGSLILIYPSLHLALKILGSLYLLWLAWKIATSAYEKLDTNVAP
FT                   AKPLRLYQGWLLQFLNPKAWLMGLGSVASFSMAGAAYNHSILMISLGMFMVNLVAGIIW
FT                   LGFGTLIGRLLGSRRAWFTFNISMGLLTAACVLLIWH"
FT   gene            297997..299058
FT                   /locus_tag="YPK_0258"
FT   CDS_pept        297997..299058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0258"
FT                   /product="taurine ABC transporter, periplasmic binding
FT                   protein"
FT                   /note="KEGG: ypk:y3963 taurine-binding periplasmic protein
FT                   of taurine ABC transport system; TIGRFAM: taurine ABC
FT                   transporter, periplasmic binding protein; PFAM:
FT                   Substrate-binding region of ABC-type glycine betaine
FT                   transport system; SMART: extracellular solute-binding
FT                   protein family 3"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66571"
FT                   /db_xref="GOA:A0A0H3AZ78"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR010068"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZ78"
FT                   /protein_id="ACA66571.1"
FT                   /translation="MAITFSSATLAASRRSFLQLRTILLASLLPASLLLATSAQAVDVI
FT                   VAYQTSAEPAKVAQADNSFAKLSGANVDWRKFDSGSSVVRALASGDVQIGNIGSSPLAV
FT                   AASQNVPIEVFLLASQLGSSEALVVKKEIKTPQDLIGKRIAVPFISTAHYSLLAALKHW
FT                   GIKPGQVTILNLQPPAIAAAWQRGDIDGAYVWAPAVSELAKTGTVLTDSAQVGQWGAPT
FT                   LDVWVVRKDFAKAHPEVVTAFARSALAAQAAYLNNPEQWLQNQAHLAPLSRLSGVPTEQ
FT                   VPALVKGNTYLPVAEQITQLGQPVDQAIRDTAEFLKQQGKIPQVASDYRDFVTDRFVKE
FT                   IQATPQSQATPQS"
FT   sig_peptide     297997..298122
FT                   /locus_tag="YPK_0258"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 42"
FT   gene            299067..299834
FT                   /locus_tag="YPK_0259"
FT   CDS_pept        299067..299834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0259"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ypm:YP_0182 putative taurine transport ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66572"
FT                   /db_xref="GOA:A0A0H3AX37"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015859"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AX37"
FT                   /protein_id="ACA66572.1"
FT                   /translation="MLNVSGLWAEYQGKPALQDVSLQIASGQLVVVLGPSGCGKTTLLN
FT                   LIAGFMTPSAGVITLDNIPVSGPSAERGVVFQNEGLLPWRDVVSNVEFGLQLAGMSKEQ
FT                   RRVTALKMLNRVGLAGFEHHFIWQLSGGMRQRVGIARALAVDPRLLLLDEPFGALDAFT
FT                   REQMQELLLTIWRDTGKQILLITHDIEEAVFLASELLLLSPGPGQVVERLSLNFGQRYA
FT                   EGEPCRAIKSDPEFIARREDVLGKVFQQREVLI"
FT   gene            299831..300685
FT                   /locus_tag="YPK_0260"
FT   CDS_pept        299831..300685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0260"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ypm:YP_0183 putative
FT                   taurine transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66573"
FT                   /db_xref="GOA:A0A0H3AYS8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYS8"
FT                   /protein_id="ACA66573.1"
FT                   /translation="MSLHSTLRNQAINLPAADAPKKTPRRLPANQTLWISIATLASVVA
FT                   LWWAVTALQLIGPLFLPAPQQVLHQLWTIASPQGFMDATLWQHLAASLGRIFVALLAAV
FT                   VLGVPTGIAMGLNSNVRGVLDPLIEIYRPVPPLAYLPLMVIWFGIGETSKILLIYLAIF
FT                   APVTLAAVAGVRSVAHVRVRAARALGASRWQVLWFVVLPSALPEILTGIRIGLGVGWST
FT                   LVAAELIAATRGLGFMVQSAGEFLATDVVIAGISVIAIIAFGMELSLRAIQRRLTPWYG
FT                   EQQ"
FT   gene            300682..301530
FT                   /locus_tag="YPK_0261"
FT   CDS_pept        300682..301530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0261"
FT                   /product="Taurine dioxygenase"
FT                   /EC_number="1.14.11.17"
FT                   /note="PFAM: Taurine catabolism dioxygenase TauD/TfdA;
FT                   KEGG: ypi:YpsIP31758_3935 alpha-ketoglutarate-dependent
FT                   taurine dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66574"
FT                   /db_xref="GOA:A0A0H3AZT5"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZT5"
FT                   /protein_id="ACA66574.1"
FT                   /translation="MNERLIVTPLGPHIGALVENINIAHPLGDSQFEQLYHVLLKHQVL
FT                   FFRNQPITPLQQRDLAGRFGDLHIHPVYPHTQECEEIIVLDTADDNPPDNDNWHTDVTF
FT                   IETPPLGAILAAKQLPTTGGDTLWSSGIAAYDALSAPFKQLLAGLQAEHDFTKSFPEHK
FT                   HRTTPEEHQRWLQGKEKNPPLLHPVIRTHPVSGRQALFVNEGFTTRIIGLSDKESEALL
FT                   GFLFAHTTKPEFQVRWRWQQDDVAIWDNRVTQHYANADYLPQRRVMHRATILGDRPVFR
FT                   P"
FT   gene            complement(301543..302523)
FT                   /locus_tag="YPK_0262"
FT   CDS_pept        complement(301543..302523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0262"
FT                   /product="glycosyl transferase family 9"
FT                   /note="PFAM: glycosyl transferase family 9; KEGG:
FT                   ypi:YpsIP31758_3934 heptosyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66575"
FT                   /db_xref="GOA:A0A0H3B0J0"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B0J0"
FT                   /protein_id="ACA66575.1"
FT                   /translation="MQRILVIRIDFLGDMVCTTALLHALKQRWPAAEIHVLANKYNQSV
FT                   LARNPDVSAVHTYVYSKQCERNQRPGRLMALFDRLALIWRLRRLGFDLLLIPNGGMNKN
FT                   SIQFAKQLNVADRRWHTAETEFDDRNPEHVATRPIRHEALSGFALMPELGRVDIETLKL
FT                   HVYPEPQLQAKWRADLGEKDRPRVGLFISNKSAQRRWSWDKWRQLALKLNAQAELLIFH
FT                   DPAEQPSEQQLAGLTARCLSTPSTDDLMAAMSQLDLVISADSAPVHIGSALQIPVVALF
FT                   ESRPEKYLRWYPLGVRHVLVHAGPQVEDIHVDAVESAARSLLTTD"
FT   gene            complement(302616..303641)
FT                   /locus_tag="YPK_0263"
FT   CDS_pept        complement(302616..303641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0263"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   ypp:YPDSF_0113 glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66576"
FT                   /db_xref="GOA:A0A0H3AZ84"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZ84"
FT                   /protein_id="ACA66576.1"
FT                   /translation="MNSVDISVIVPVYNCANYLTDLLDSLRSQTGVSLEIIAVNDGSTD
FT                   HSLALLEQVAHIDSRLVIINQQNQGLSEARNVGIAKAKGNWVAFADGDDWLAPHALSTW
FT                   LQQVKQQKLDVLIGNGYQFSSNPERKPVTPLLGQQPWGATLNGQQWIILSVKQNGQQWI
FT                   ILSVKQKEWPHYAWLQLIRRDVISTHQLQFIRDMLHEDILWTTQLALVAQRIGFCATPF
FT                   YGYRTNPDSITNSPSMQALLRRASSYVDIINALVKIAASTKPPVRNALLSHANQESGHL
FT                   LGLLRKKLPASPQRTALAIRFITLGLRPALFRGVTNLHELWRAIRCSFLMGSYARQKRA
FT                   E"
FT   gene            complement(303776..305698)
FT                   /locus_tag="YPK_0264"
FT   CDS_pept        complement(303776..305698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0264"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ypm:YP_0187 ATPase components of ABC transporters
FT                   with duplicated ATPase domains"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66577"
FT                   /db_xref="GOA:A0A0H3AX42"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AX42"
FT                   /protein_id="ACA66577.1"
FT                   /translation="MIVFSSLQIRRGTRVLLDNATATINPGQKVGLVGKNGCGKSTLLA
FT                   LLKGELSADGGNVTFPNNWALAWVNQETPALDIPAIEYVIDGDREYRQLEAELQAANEK
FT                   NDGHAIATVHGKLDAIHAWTIQSRAASLLHGLGFSQEKLQQPVRSFSGGWRMRLNLAQA
FT                   LVCRSDLLLLDEPTNHLDLDAVIWLEKWLKSYTGTLVLISHDRDFLDPIIDKILHIEQQ
FT                   TLNEYTGNYSSFERQRATKLSQQQSMYQHQQEKVAHLQSYIDRFRAQATKAKQAQSRIK
FT                   MLERMELIAPAHVDNPFHFSFRTPESLPDPLLRMDKVSAGYGENTVLQSIKLNLVPGSR
FT                   IGLLGRNGAGKSTLIKLLAGTLEPQSGEIALSKGIKLGYFAQHQLEFLRADESPLQHMS
FT                   RLAPKESEQQLRDYLGGYGFQGDQVTDPTARFSGGEKARLVLALIIWQRPNLLLLDEPT
FT                   NHLDLEMRQALTEALIDFEGALVVISHDRHLLRSTTDDLYLVHDGKVEQFDGDLEDYQQ
FT                   WLVDSQRQQSQQDNPAKELSGNSAQQRKDQKRRDAEFRTQTQPLRKQIMTLEKQMDKLS
FT                   TELAAIEAQLADSALYDIARKADLTQCLLQQTQVKSKLEETEMQWLDVQEQLEILTKEF
FT                   SDADI"
FT   gene            305949..306497
FT                   /locus_tag="YPK_0265"
FT   CDS_pept        305949..306497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0265"
FT                   /product="NAD(P)H dehydrogenase (quinone)"
FT                   /note="PFAM: NAD(P)H dehydrogenase (quinone); KEGG:
FT                   yps:YPTB3715 possible NAD(P)H oxidoreductase/ancillary
FT                   protein to KefB"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66578"
FT                   /db_xref="GOA:B1JIU3"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023947"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JIU3"
FT                   /protein_id="ACA66578.1"
FT                   /translation="MLQPPKVLLLYAHPESQDSVANRVLLQPVQQLEHVTVHDLYAHYP
FT                   DFFIDIHHEQQLLRDHQVIVFQHPLYTYSCPALLKEWLDRVLARGFANGVGGHALTGKH
FT                   WRSVITTGEQEGTYRIGGYNRYPMEDILRPFELTAAMCHMHWINPMIIYWARRQKPETL
FT                   ASHAQAYVQWLQSPLTRGL"
FT   gene            306501..308309
FT                   /locus_tag="YPK_0266"
FT   CDS_pept        306501..308309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0266"
FT                   /product="potassium efflux system protein"
FT                   /note="TIGRFAM: potassium efflux system protein; PFAM:
FT                   TrkA-N domain protein; sodium/hydrogen exchanger; KEGG:
FT                   ypm:YP_0189 probable potassium-efflux system protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66579"
FT                   /db_xref="GOA:B1JIU4"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR020884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JIU4"
FT                   /protein_id="ACA66579.1"
FT                   /translation="MEGTGLLTAVLVFLFAAVVAVPIAQRLGIGAVLGYLIAGIAIGPW
FT                   GLGFIRDVDEILHFSELGVVFLMFIIGLELNPAKLWQLRRSIFGVGAGQVVITAAVLGA
FT                   LLYFTQFAWQAAVIGGVGLAMSSTAMALQLMREKGMNRNEGGQLGFSVLLFQDMAVIPA
FT                   LALIPILAGNEGGANDWVKIGLKIAAFAGMLIGGRYLLRPLFRYIVASGVREVFTAAAL
FT                   LVVLGSALFMDALGLSMALGTFIAGILLAESEFQHELEIAIEPFKGLLLGLFFISVGMA
FT                   LDLGVLFTHLLDVLLGVLALVFIKSAILYGLARVFGLRRSVRLQFAGVLSQGGEFAFVL
FT                   FSAAFSQRVLNAEQLALLLVVVTLSMMTTPLLMQVIDRILVRRYNAQEESDEKPFVEDN
FT                   DPQVIIVGFGRFGQVIGRLLMANKMRITVLERDVSAVSMMRKYGYKVYYGDATELELLR
FT                   AAGAEKAKAIVITCNEPEDTMALVHLCQQHFPNLHILARARGRVEAHELLQNGVKDFTR
FT                   ETFSSALELGRKTLLELGMHPHQAYRAQQHFRRLDMRMLRELMPQHHGDVAQISRIKEA
FT                   RRELEDIFQREMLHESRQLDGWDEYE"
FT   sig_peptide     306501..306563
FT                   /locus_tag="YPK_0266"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.963) with cleavage site probability 0.858 at
FT                   residue 21"
FT   gene            308325..308546
FT                   /locus_tag="YPK_0267"
FT   CDS_pept        308325..308546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0267"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   ypm:YP_0190 predicted nucleic-acid-binding protein
FT                   containing a Zn-ribbon domain"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66580"
FT                   /db_xref="InterPro:IPR012658"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYT1"
FT                   /protein_id="ACA66580.1"
FT                   /translation="MTITLNKTVTRKRFIAGAVCPQCNALDTLALWREDQVEVVECVKC
FT                   GHHQRQTDEQVNKHVRPHEQVIGIFPPE"
FT   sig_peptide     308325..308402
FT                   /locus_tag="YPK_0267"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.821) with cleavage site probability 0.817 at
FT                   residue 26"
FT   gene            308641..309222
FT                   /locus_tag="YPK_0268"
FT   CDS_pept        308641..309222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0268"
FT                   /product="peptidylprolyl isomerase FKBP-type"
FT                   /note="PFAM: peptidylprolyl isomerase FKBP-type; KEGG:
FT                   ypm:YP_0191 peptidyl-prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66581"
FT                   /db_xref="GOA:A0A0H3AZT9"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZT9"
FT                   /protein_id="ACA66581.1"
FT                   /translation="MKVTKDLVVSLAYQVRTEDGVLVDESPVSAPLDYLHGHGSLIAGL
FT                   ENALEGHEAGDSFDVRVNADEGYGSYDENLVQRVPKDVFMGVDELEVGMRFLADTDQGP
FT                   VPVEITAVEDEHVVVDGNHMLAGQDLNFHVEVVAVREATEEELQHGHVHGEHDHHHEHG
FT                   DGCCGGHGHDDHEHEHGKGGCGKSGGCGCH"
FT   gene            complement(309423..309641)
FT                   /locus_tag="YPK_0269"
FT   CDS_pept        complement(309423..309641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0269"
FT                   /product="SlyX family protein"
FT                   /note="PFAM: SlyX family protein; KEGG: ypi:YpsIP31758_3927
FT                   SlyX protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66582"
FT                   /db_xref="InterPro:IPR007236"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JIU7"
FT                   /protein_id="ACA66582.1"
FT                   /translation="MEQSLLEQRLEMLESRLAFQEVTIEELNLIVTEHQMEMTKLREHL
FT                   RLLTDKLRESQSSMLASPSEETPPPHY"
FT   gene            309956..310756
FT                   /locus_tag="YPK_0270"
FT   CDS_pept        309956..310756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0270"
FT                   /product="Peptidylprolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="PFAM: FKBP-type peptidyl-prolyl isomerase domain
FT                   protein; peptidylprolyl isomerase FKBP-type; KEGG:
FT                   ypi:YpsIP31758_3926 peptidyl-prolyl cis-trans isomerase,
FT                   FKBP-type"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66583"
FT                   /db_xref="GOA:A0A0H3B0J4"
FT                   /db_xref="InterPro:IPR000774"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR036944"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B0J4"
FT                   /protein_id="ACA66583.1"
FT                   /translation="MKSLFKVTLLATAMTLTLNTSTVFAADATSPVVTNSAFKNNDQQS
FT                   AYALGASLGRYMDNSLKEQEKLGIKLDKDQLIAGVQDAFANKSKLTDEEIEKTLQNFEA
FT                   RVKASAQAKMEQDAKENADKGAKYRDTFAKEKGVKKTASGLLYKVENAGTGDAPKDSDT
FT                   VVVNYKGTLADGTEFDNSYKRGEPLSFRLDGVIPGWTEGLKQIKKGGKITLVIPPELAY
FT                   GKAGVPGIPANSTLIFDVELLDVKAAAKADAQEQQPAVDTKAKK"
FT   sig_peptide     309956..310033
FT                   /locus_tag="YPK_0270"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 26"
FT   gene            311010..311732
FT                   /locus_tag="YPK_0271"
FT   CDS_pept        311010..311732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0271"
FT                   /product="YheO domain protein"
FT                   /note="PFAM: YheO domain protein; KEGG: ypm:YP_0195
FT                   putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66584"
FT                   /db_xref="InterPro:IPR013559"
FT                   /db_xref="InterPro:IPR039445"
FT                   /db_xref="InterPro:IPR039446"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZ90"
FT                   /protein_id="ACA66584.1"
FT                   /translation="MSNSLLCSETSELDLLDERPFSQTDHEILKSYEVVVDGLAMLIGG
FT                   HCEIVLHSLEDLKNSAVRIANGEHTGRQIGSPITDLALRMLHDMAGADSSVSKAYFTRA
FT                   KSGVLMKSVTIAIRNRDQRVIGLLCINMNLDVPFSQIIQTFMPPETQEVPSSVNFASSV
FT                   DDLVAQTLEFTIEEVNADRNVSNNAKNRQVVLNLYEKGIFDIKDAINQVAERLNISKHT
FT                   VYLYIRQFKSGDLVGHER"
FT   gene            311732..312127
FT                   /locus_tag="YPK_0272"
FT   CDS_pept        311732..312127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0272"
FT                   /product="sulfur relay protein TusD/DsrE"
FT                   /note="TIGRFAM: sulfur relay protein TusD/DsrE; PFAM: DsrE
FT                   family protein; KEGG: ypi:YpsIP31758_3924 tRNA
FT                   2-thiouridine synthesizing sulfurtransferase TusD"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66585"
FT                   /db_xref="GOA:B1JIV0"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR017463"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JIV0"
FT                   /protein_id="ACA66585.1"
FT                   /translation="MSALKYCLLVTGPAYGTQQASSAYQFAQAVVGAGHHLVSIFFYRE
FT                   GVLNANQLTAPASDEFDLVRAWQQLAAEQAVTLNVCVAAALRRGITDQHEAEQLNLAAA
FT                   NLQPGFTLSGLGALAEATLTCDRMVQF"
FT   gene            312127..312492
FT                   /locus_tag="YPK_0273"
FT   CDS_pept        312127..312492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0273"
FT                   /product="sulfur relay protein TusC/DsrF"
FT                   /note="TIGRFAM: sulfur relay protein TusC/DsrF; PFAM: DsrE
FT                   family protein; KEGG: ypm:YP_0197 uncharacterized protein
FT                   involved in the oxidation of intracellular sulfur"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66586"
FT                   /db_xref="GOA:B1JIV1"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR017462"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="InterPro:IPR037450"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JIV1"
FT                   /protein_id="ACA66586.1"
FT                   /translation="MARKRIAFIFTQGPHGSSAGREGLDALLATSALSEDIGVFFISDG
FT                   VLQLLPQQQPEKILARNYIATFGVLPLYDVENCYLCERSLQQRGLSKMADWILDVTVLS
FT                   PADLRRELGTYDVVLTF"
FT   gene            312512..312799
FT                   /locus_tag="YPK_0274"
FT   CDS_pept        312512..312799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0274"
FT                   /product="sulfur relay protein TusB/DsrH"
FT                   /note="TIGRFAM: sulfur relay protein TusB/DsrH; PFAM: DsrH
FT                   family protein; KEGG: ypi:YpsIP31758_3922 tRNA
FT                   2-thiouridine synthesizing protein B"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66587"
FT                   /db_xref="GOA:B1JIV2"
FT                   /db_xref="InterPro:IPR007215"
FT                   /db_xref="InterPro:IPR023526"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JIV2"
FT                   /protein_id="ACA66587.1"
FT                   /translation="MLYTVSHSPYHCDLSALLRLATSEDDILLLQDGVIAALKESEILK
FT                   LLLNNPASLFVLEDDVIARGLVGQISDNATLISYTHFVDLTLRHQQQLAW"
FT   gene            312937..313311
FT                   /locus_tag="YPK_0275"
FT   CDS_pept        312937..313311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0275"
FT                   /product="ribosomal protein S12"
FT                   /note="TIGRFAM: ribosomal protein S12; PFAM: ribosomal
FT                   protein S12/S23; KEGG: yen:YE3930 30S ribosomal protein
FT                   S12"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66588"
FT                   /db_xref="GOA:B1JIV3"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JIV3"
FT                   /protein_id="ACA66588.1"
FT                   /translation="MATINQLVRKPRSMKVAKSNVPALEACPQKRGVCTRVYTTTPKKP
FT                   NSALRKVCRVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDC
FT                   SGVKDRKQSRSKYGVKKPKA"
FT   gene            313408..313878
FT                   /locus_tag="YPK_0276"
FT   CDS_pept        313408..313878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0276"
FT                   /product="ribosomal protein S7"
FT                   /note="PFAM: ribosomal protein S7; KEGG: yen:YE3929 30S
FT                   ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66589"
FT                   /db_xref="GOA:B1JIV4"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JIV4"
FT                   /protein_id="ACA66589.1"
FT                   /translation="MPRRRVIGQRKILPDPKFGSELLAKFVNILMVDGKKSTAEAIVYT
FT                   ALETLAQRSGKDFLEAFEVALDNVRPTVEVKSRRVGGSTYQVPVEVRPVRRNALAMRWI
FT                   VDAARKRGDKSMALRLANELSDAAENKGSAVKKREDVHRMAEANKAFAHYRW"
FT   gene            313972..316080
FT                   /locus_tag="YPK_0277"
FT   CDS_pept        313972..316080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0277"
FT                   /product="translation elongation factor G"
FT                   /note="TIGRFAM: translation elongation factor G; small
FT                   GTP-binding protein; PFAM: elongation factor G domain
FT                   protein; protein synthesis factor GTP-binding; elongation
FT                   factor Tu domain 2 protein; elongation factor G domain IV;
FT                   KEGG: ypi:YpsIP31758_3919 translation elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66590"
FT                   /db_xref="GOA:B1JIV5"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JIV5"
FT                   /protein_id="ACA66590.1"
FT                   /translation="MARKTPIERYRNIGISAHIDAGKTTTTERILFYTGVNHKIGEVHD
FT                   GAATMDWMEQEQERGITITSAATTCFWSGMAKQFEPHHVNIIDTPGHVDFTIEVERSMR
FT                   VLDGAVMVYCAVGGVQPQSETVWRQANKYKVPRIAFVNKMDRMGANFLRVVGQLKSRLG
FT                   ANPVPLQLAIGAEEKFTGIIDLVKMKAINWNEADQGVTFEYEEIPADMAELAAEWHQNL
FT                   VESAAEASDELMDKYLGGEELTEEEIKKALRQRVLKSEIILVTCGSAFKNKGVQAMLDA
FT                   VIEYLPAPTDVESINGILDDGKDTPAVRHSDDKEPFSALAFKIATDPFVGNLTFFRVYS
FT                   GIVNSGDTVLNSVKSQRERLGRIVQMHANKREEIKEVHAGDIAAAIGLKDVTTGDTLCD
FT                   PNNPIILERMEFPEPVISVAVEPKTKADQEKMGMALGRLAKEDPSFRVWTDEESGQTII
FT                   AGMGELHLDILVDRMRREFNVEANVGKPQVAYRETIRETVKDVEGKHAKQSGGRGQYGH
FT                   VVIDMSPLPPGGVGYEFVNEIVGGSIPKEFIPAVDKGIQEQLKSGPLAGYPVVDVKVRL
FT                   HYGSYHDVDSSELAFKLAGSIAFKEGFKRAKPVLLEPIMKVEVETPEDYMGDVMGDLNR
FT                   RRGIIEGMEDTATGKTVRVKVPLSEMFGYATDLRSQTQGRASYSMEFLEYAEAPSNVAK
FT                   AVIEARGK"
FT   gene            316152..317336
FT                   /locus_tag="YPK_0278"
FT   CDS_pept        316152..317336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0278"
FT                   /product="translation elongation factor Tu"
FT                   /note="TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain protein;
FT                   elongation factor Tu domain 2 protein; KEGG: ypm:YP_0202
FT                   elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66591"
FT                   /db_xref="GOA:A0A0H3AX45"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AX45"
FT                   /protein_id="ACA66591.1"
FT                   /translation="MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGSAR
FT                   AFDQIDNAPEEKARGITINTSHVEYDTPARHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVAATDGPMPQTREHILLGRQVGVPYIIVFMNKCDMVDDEELLELVEMEVRELLSAYDF
FT                   PGDDLPVVRGSALKALEGEAEWEAKIIELAGYLDSYIPEPERAIDKPFLLPIEDVFSIS
FT                   GRGTVVTGRVERGIVKVGEEVEIVGIKDTVKSTCTGVEMFRKLLDEGRAGENVGVLLRG
FT                   IKREDIERGQVLAKPGSIKPHTTFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTG
FT                   TIELPEGVEMVMPGDNINMIVTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVIA"
FT   gene            317539..317997
FT                   /locus_tag="YPK_0279"
FT   CDS_pept        317539..317997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0279"
FT                   /product="transposase IS200-family protein"
FT                   /note="PFAM: transposase IS200-family protein; KEGG:
FT                   ypi:YpsIP31758_3905 IS1541, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66592"
FT                   /db_xref="GOA:A0A0H3AYT6"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYT6"
FT                   /protein_id="ACA66592.1"
FT                   /translation="MRDEKSLAHTRWNCKYHIVFAPKYRRQVFYREKRRAIGSILRKLC
FT                   EWKNVNILEAECCVDHIHMLLEIPPKMSVSGFMGYLKGKSSLMLYEQFGDLKFKYRNRE
FT                   FWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGSPFTGRK"
FT   gene            318185..318379
FT                   /locus_tag="YPK_0280"
FT   CDS_pept        318185..318379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0280"
FT                   /product="BFD domain protein (2Fe-2S)-binding domain
FT                   protein"
FT                   /note="PFAM: BFD domain protein [2Fe-2S]-binding domain
FT                   protein; KEGG: yps:YPTB3701 putative
FT                   bacterioferritin-associated ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66593"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZU3"
FT                   /protein_id="ACA66593.1"
FT                   /translation="MYVCLCNAVSDKVIRKAVRQHQPHTVKQLRQLVPIGSDCGKCIRQ
FT                   AREILIEELANIPEMNDVA"
FT   gene            318458..318931
FT                   /locus_tag="YPK_0281"
FT   CDS_pept        318458..318931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0281"
FT                   /product="bacterioferritin"
FT                   /note="TIGRFAM: bacterioferritin; PFAM: Ferritin Dps family
FT                   protein; KEGG: ypp:YPDSF_0131 bacterioferritin"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66594"
FT                   /db_xref="GOA:A0A0H3B0J9"
FT                   /db_xref="InterPro:IPR002024"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B0J9"
FT                   /protein_id="ACA66594.1"
FT                   /translation="MKGDKKIIAHLNKLLGNELVAINQYFLHARMFKNWGLMRLNDKEY
FT                   HESIDEMKHADKYIERILFLEGIPNLQELGKLNIGEDVEEMLKSDLALELSGATDLREG
FT                   IAYADSIHDYVSRDLLKEILVDEEEHIDWLETELSLIDRLGIQSYSQAQLAKD"
FT   gene            319345..319656
FT                   /locus_tag="YPK_0282"
FT   CDS_pept        319345..319656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0282"
FT                   /product="ribosomal protein S10"
FT                   /note="PFAM: ribosomal protein S10; KEGG: asu:Asuc_0458
FT                   ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66595"
FT                   /db_xref="GOA:B1JIW0"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JIW0"
FT                   /protein_id="ACA66595.1"
FT                   /translation="MQNQRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTR
FT                   KERFTVLISPHVNKDARDQYEIRTHKRLVDIVEPTEKTVDALMRLDLAAGVDVQISLG"
FT   gene            319689..320318
FT                   /locus_tag="YPK_0283"
FT   CDS_pept        319689..320318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0283"
FT                   /product="ribosomal protein L3"
FT                   /note="PFAM: ribosomal protein L3; KEGG:
FT                   ypi:YpsIP31758_3915 ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66596"
FT                   /db_xref="GOA:B1JIW1"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JIW1"
FT                   /protein_id="ACA66596.1"
FT                   /translation="MIGLVGKKVGMTRIFTEDGVSIPVTVIEIEANRVTQVKSLENDGY
FT                   RAVQVTTGAKKANRVTKPEAGHFAKAGVEAGRGLWEFRLPEGQEFTAGQEISVEIFADV
FT                   KKVDVTGTSKGKGFAGTVKRWNFRTQDATHGNSLSHRVPGSIGQNQTPGKVFKGKKMAG
FT                   HMGDERVTVQSLDVVRVDAERNLLLVKGAVPGATGGNLIVKPAVKA"
FT   gene            320335..320940
FT                   /locus_tag="YPK_0284"
FT   CDS_pept        320335..320940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0284"
FT                   /product="ribosomal protein L4/L1e"
FT                   /note="PFAM: ribosomal protein L4/L1e; KEGG:
FT                   ypi:YpsIP31758_3914 ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66597"
FT                   /db_xref="GOA:B1JIW2"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JIW2"
FT                   /protein_id="ACA66597.1"
FT                   /translation="MELVMKDAPGALTVSETTFGRDFNEALVHQVVVAYAAGARQGTRA
FT                   QKTRAEVTGSGKKPWRQKGTGRARAGSVKSPIWRSGGVTFAAKPQDHSQKVNKKMYRGA
FT                   LKSILSELVRQDRLIIVEKFSVEAPKTKLLAQKLKDMALEDVLIVTGELDENLFLAARN
FT                   LYKVDVRDVAGIDPVSLIAFDKVVMTADAVKQVEEMLA"
FT   gene            320937..321239
FT                   /locus_tag="YPK_0285"
FT   CDS_pept        320937..321239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0285"
FT                   /product="Ribosomal protein L25/L23"
FT                   /note="PFAM: Ribosomal protein L25/L23; KEGG:
FT                   ypi:YpsIP31758_3913 ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66598"
FT                   /db_xref="GOA:A0A0H3AZ95"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZ95"
FT                   /protein_id="ACA66598.1"
FT                   /translation="MIREERLLKVLRSPHVSEKASAAMEKNNTIVLKVAKDATKAEIKA
FT                   AVQKLFEVEVEDVNTLLVKGKSKRHGQRVGRRSDWKKAYVTLKEGQNLDFIGGAE"
FT   gene            321256..322080
FT                   /locus_tag="YPK_0286"
FT   CDS_pept        321256..322080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0286"
FT                   /product="ribosomal protein L2"
FT                   /note="PFAM: ribosomal protein L2; KEGG: ypm:YP_0210 50S
FT                   ribosomal protein l2"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66599"
FT                   /db_xref="GOA:B1JIW4"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JIW4"
FT                   /protein_id="ACA66599.1"
FT                   /translation="MAIVKCKPTSPGRRHVVKVVNPELHKGKPYAPLLEKLSKSGGRNN
FT                   NGRITTRHIGGGHKQHYRLVDFKRNKDGIPAVVERLEYDPNRSANIALVLYKDGERRYI
FT                   LAPKGLKAGDQIQSGVDAAIKAGNTLPMRNIPVGSTVHNVEMKPGKGGQLARSAGAYVQ
FT                   IVARDGSYVTLRLRSGEMRKVQADCRATLGEVGNAEHMLRVLGKAGASRWRGIRPTVRG
FT                   TAMNPVDHPHGGGEGRNFGKHPVTPWGVQTKGKKTRSNKRTDKFIVRRRSKK"
FT   gene            322095..322373
FT                   /locus_tag="YPK_0287"
FT   CDS_pept        322095..322373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0287"
FT                   /product="ribosomal protein S19"
FT                   /note="TIGRFAM: ribosomal protein S19; PFAM: ribosomal
FT                   protein S19/S15; KEGG: ypm:YP_0211 30S ribosomal protein
FT                   S19"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66600"
FT                   /db_xref="GOA:B1JIW5"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JIW5"
FT                   /protein_id="ACA66600.1"
FT                   /translation="MPRSLKKGPFIDLHLLKKVEKAVESGDKKPIRTWSRRSTVFPNMI
FT                   GLTIAVHNGRQHVPVFVSDEMVGHKLGEFAPTRTYRGHAADKKAKKR"
FT   gene            322388..322720
FT                   /locus_tag="YPK_0288"
FT   CDS_pept        322388..322720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0288"
FT                   /product="ribosomal protein L22"
FT                   /note="TIGRFAM: ribosomal protein L22; PFAM: ribosomal
FT                   protein L22/L17; KEGG: ypm:YP_0212 50S ribosomal protein
FT                   L22"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66601"
FT                   /db_xref="GOA:B1JIW6"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JIW6"
FT                   /protein_id="ACA66601.1"
FT                   /translation="METIAKHRHARSSAQKVRLVADLIRGKKVSQALETLTYTNKKAAG
FT                   LVKKVLESAIANAEHNDGADIDDLKVTKIFVDEGPSMKRIMPRAKGRADRILKRTSHIT
FT                   VVVSDR"
FT   gene            322738..323436
FT                   /locus_tag="YPK_0289"
FT   CDS_pept        322738..323436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0289"
FT                   /product="ribosomal protein S3"
FT                   /note="KEGG: yen:YE3917 30S ribosomal protein S3; TIGRFAM:
FT                   ribosomal protein S3; PFAM: ribosomal protein S3- domain
FT                   protein; KH type 2 domain protein; Ribosomal protein S3
FT                   domain; SMART: KH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66602"
FT                   /db_xref="GOA:B1JIW7"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JIW7"
FT                   /protein_id="ACA66602.1"
FT                   /translation="MGQKVHPNGIRLGIVKAWNSTWYANTKEFADNLDSDFKVRQFLTK
FT                   ELAKASVSRIVIERPAKSIRVTIHTARPGIVIGKKGEDVEKLRKVVADIAGVPAQINIA
FT                   EVRKPELDAKLVADSITSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIA
FT                   RTEWYREGRVPLHTLRADIDYNTSEAHTTYGVIGVKVWIFKGEILGGMAAVEQPEPAAQ
FT                   PKKQQRKGRK"
FT   gene            323449..323859
FT                   /locus_tag="YPK_0290"
FT   CDS_pept        323449..323859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0290"
FT                   /product="ribosomal protein L16"
FT                   /note="PFAM: ribosomal protein L16; KEGG: yen:YE3916 50S
FT                   ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66603"
FT                   /db_xref="GOA:B1JIW8"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JIW8"
FT                   /protein_id="ACA66603.1"
FT                   /translation="MLQPKRTKFRKMHKGRNRGLAQGTDVSFGEFGLKACGRCRLTARQ
FT                   IEAARRAMTRAIKRQGKVWIRVFPDKPITEKPLEVRMGKGKGNVEYWVALIQPGKVLFE
FT                   MAGVPEETAREAFKLAAAKLPVGTTFVTKTVM"
FT   gene            323859..324050
FT                   /locus_tag="YPK_0291"
FT   CDS_pept        323859..324050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0291"
FT                   /product="ribosomal protein L29"
FT                   /note="PFAM: ribosomal protein L29; KEGG:
FT                   ypi:YpsIP31758_3907 ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66604"
FT                   /db_xref="GOA:B1JIW9"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JIW9"
FT                   /protein_id="ACA66604.1"
FT                   /translation="MKAQELREKSVEELNTELLNLLREQFNLRMQAASGQLQQTHLLKQ
FT                   VRRNVARVKTLLTEKAGA"
FT   gene            324050..324304
FT                   /locus_tag="YPK_0292"
FT   CDS_pept        324050..324304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0292"
FT                   /product="ribosomal protein S17"
FT                   /note="PFAM: ribosomal protein S17; KEGG: yen:YE3914 30S
FT                   ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66605"
FT                   /db_xref="GOA:B1JIX0"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JIX0"
FT                   /protein_id="ACA66605.1"
FT                   /translation="MTDQIRTLQGRVVSDKMEKSMVVAIERVVKHPIYGKFIRRTTKLH
FT                   VHDENNECGIGDVVEIRECRPLSKTKSWTLVRVVEKAIL"
FT   gene            324485..324856
FT                   /locus_tag="YPK_0293"
FT   CDS_pept        324485..324856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0293"
FT                   /product="ribosomal protein L14"
FT                   /note="TIGRFAM: ribosomal protein L14; PFAM: ribosomal
FT                   protein L14b/L23e; KEGG: yen:YE3913 50S ribosomal protein
FT                   L14"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66606"
FT                   /db_xref="GOA:B1JIX1"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JIX1"
FT                   /protein_id="ACA66606.1"
FT                   /translation="MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGIGDIIKITIKE
FT                   AIPRGKVKKGDVLKAVVVRTKKGVRRPDGSVIRFDGNACVILNNNSEQPIGTRIFGPVT
FT                   RELRNEKFMKIISLAPEVL"
FT   gene            324867..325181
FT                   /locus_tag="YPK_0294"
FT   CDS_pept        324867..325181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0294"
FT                   /product="ribosomal protein L24"
FT                   /note="TIGRFAM: ribosomal protein L24; PFAM: KOW domain
FT                   protein; KEGG: ypm:YP_0218 50S ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66607"
FT                   /db_xref="GOA:B1JIX2"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JIX2"
FT                   /protein_id="ACA66607.1"
FT                   /translation="MAAKIRRDDEVIVLTGKDKGKRGKVKNVLSSGKVIVEGINLVKKH
FT                   QKPVPALNQPGGIVEKEAAIQVSNLALFNATTGKADRVGFRFEDGKKVRFFKSTSETIK
FT                   "
FT   gene            325196..325735
FT                   /locus_tag="YPK_0295"
FT   CDS_pept        325196..325735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0295"
FT                   /product="ribosomal protein L5"
FT                   /note="PFAM: ribosomal protein L5; KEGG:
FT                   ypi:YpsIP31758_3902 ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66608"
FT                   /db_xref="GOA:B1JIX3"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JIX3"
FT                   /protein_id="ACA66608.1"
FT                   /translation="MAKLHDYYKDEVVKQLMSQFGYDSVMQVPRVEKITLNMGVGEAIA
FT                   DKKLLDNAAADLAAISGQKPFITKARKSVAGFKIRQGYPIGCKVTLRGERMWEFFERLI
FT                   TIAVPRIRDFRGLSAKSFDGRGNYSMGVREQIIFPEIDYDKVDRVRGLDITITTTAKSD
FT                   DEGRALLAAFKFPFRK"
FT   gene            325749..326054
FT                   /locus_tag="YPK_0296"
FT   CDS_pept        325749..326054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0296"
FT                   /product="ribosomal protein S14"
FT                   /note="PFAM: ribosomal protein S14; KEGG:
FT                   ypi:YpsIP31758_3901 ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66609"
FT                   /db_xref="GOA:B1JIX4"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JIX4"
FT                   /protein_id="ACA66609.1"
FT                   /translation="MAKQSMKAREVVRVKLANKYRAKREELKAIISGVNSSDEDRWDAV
FT                   LKLQSLPRDSSPSRQRNRCNQTGRPHGFLRKFGLSRIKVRETAMRGEIPGLKKASW"
FT   gene            326088..326480
FT                   /locus_tag="YPK_0297"
FT   CDS_pept        326088..326480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0297"
FT                   /product="ribosomal protein S8"
FT                   /note="PFAM: ribosomal protein S8; KEGG:
FT                   ypi:YpsIP31758_3900 ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66610"
FT                   /db_xref="GOA:B1JIX5"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JIX5"
FT                   /protein_id="ACA66610.1"
FT                   /translation="MSMQDPIADMLTRIRNGQAANKVAVTMPSSKLKVAIANVLKEEGF
FT                   IEDFKIEGDTKPVLELALKYFQGKAVVESIQRISRPGLRIYKKKDELPKVMAGLGIAVI
FT                   STSKGVMTDRAARQAGLGGEIICYVA"
FT   gene            326495..327028
FT                   /locus_tag="YPK_0298"
FT   CDS_pept        326495..327028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0298"
FT                   /product="ribosomal protein L6"
FT                   /note="PFAM: ribosomal protein L6; KEGG:
FT                   ypi:YpsIP31758_3899 ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66611"
FT                   /db_xref="GOA:B1JIX6"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JIX6"
FT                   /protein_id="ACA66611.1"
FT                   /translation="MSRVAKAPVVIPAGVEVKLNGQVISIKGKNGELTRTVHSAVEVKQ
FT                   EENTLTFAPREGAVDGWAQAGTTRALLNSMVIGVTEGFTKKLQLVGVGYRAAVKGNVVN
FT                   LALGFSHPVDHELPAGITAECPTQTEIVLKGADKQVIGQVAADLRAYRRPEPYKGKGVR
FT                   YADEVVRTKEAKKK"
FT   gene            327038..327391
FT                   /locus_tag="YPK_0299"
FT   CDS_pept        327038..327391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0299"
FT                   /product="ribosomal protein L18"
FT                   /note="TIGRFAM: ribosomal protein L18; PFAM: ribosomal
FT                   protein L18P/L5E; KEGG: ypi:YpsIP31758_3898 ribosomal
FT                   protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66612"
FT                   /db_xref="GOA:B1JIX7"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JIX7"
FT                   /protein_id="ACA66612.1"
FT                   /translation="MDKKAARIRRATRARRKLKELGATRLVVHRTPRHIYAQVIAPNGS
FT                   EILVAASTVEKAINEQLKYAGNKDAAAAVGKTIAERALEKGITKVSFDRSGFQYHGRVQ
FT                   ALADAAREAGLQF"
FT   gene            327406..327909
FT                   /locus_tag="YPK_0300"
FT   CDS_pept        327406..327909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0300"
FT                   /product="ribosomal protein S5"
FT                   /note="TIGRFAM: ribosomal protein S5; PFAM: ribosomal
FT                   protein S5 domain protein; Ribosomal protein S5; KEGG:
FT                   ypi:YpsIP31758_3897 ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66613"
FT                   /db_xref="GOA:A0A0H3AX50"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AX50"
FT                   /protein_id="ACA66613.1"
FT                   /translation="MSHIEKQAGELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGR
FT                   VGFGYGKAREVPAAIQKAMEKARRAMINVALNNGTLQHPVKGAHTGSRVFMQPASEGTG
FT                   IIAGGAMRAVLEVAGVHNVLAKAYGSTNPINVVRATIAALEDMKSPEMVAAKRGKSVEE
FT                   ILGK"
FT   gene            327912..328091
FT                   /locus_tag="YPK_0301"
FT   CDS_pept        327912..328091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0301"
FT                   /product="ribosomal protein L30"
FT                   /note="PFAM: ribosomal protein L30; KEGG: yen:YE3905 50S
FT                   ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66614"
FT                   /db_xref="GOA:B1JIX9"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JIX9"
FT                   /protein_id="ACA66614.1"
FT                   /translation="MAKTIKVTQTKSSIGRLPKHKATLIGLGLRRIGHTVEREDTPAVR
FT                   GMVNLVSYMVKVEE"
FT   gene            328095..328529
FT                   /locus_tag="YPK_0302"
FT   CDS_pept        328095..328529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0302"
FT                   /product="ribosomal protein L15"
FT                   /note="PFAM: ribosomal protein L15; KEGG:
FT                   ypi:YpsIP31758_3895 ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66615"
FT                   /db_xref="GOA:B1JIY0"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JIY0"
FT                   /protein_id="ACA66615.1"
FT                   /translation="MRLNTLSPAEGAKHAPKRVGRGIGSGLGKTAGRGHKGQNSRSGGG
FT                   VRRGFEGGQMPLYRRLPKFGFTSRKAMITAEVRLSELALVEGDVIDLNTLKAANVVGIQ
FT                   MEFVKVILSGEVNRAVTLRGLRVTKGARAAIEAAGGKIEE"
FT   gene            328537..329868
FT                   /locus_tag="YPK_0303"
FT   CDS_pept        328537..329868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0303"
FT                   /product="preprotein translocase, SecY subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecY subunit; PFAM:
FT                   SecY protein; KEGG: ypm:YP_0227 preprotein translocase SecY
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66616"
FT                   /db_xref="GOA:A0A0H3AYU0"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYU0"
FT                   /protein_id="ACA66616.1"
FT                   /translation="MAKQPGLDFQSAKGGLGELKRRLLFVIGALIVFRIGSFIPIPGID
FT                   ATVLAKLLEQQRGTIIEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPALAE
FT                   IKKEGEAGRRKISQYTRYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVS
FT                   LVTGTMFLMWLGEQITERGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLHFLLLLL
FT                   VAVLVFAVTFFVVFIERGQRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFAS
FT                   SIILFPATIASWFGGGTGWNWLTTISMYLQPGQPLYVLLYASAIIFFCFFYTALVFNPR
FT                   ETADNLKKSGAFVPGIRPGEQTAKYIDKVMTRLTLIGAMYITFICLIPEFMRDAMKVPF
FT                   YFGGTSLLIVVVVIMDFMAQVQTLMMSSQYESALKKANLKGYNR"
FT   gene            329902..330018
FT                   /locus_tag="YPK_0304"
FT   CDS_pept        329902..330018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0304"
FT                   /product="ribosomal protein L36"
FT                   /note="PFAM: ribosomal protein L36; KEGG: sgl:SG2257 50S
FT                   ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66617"
FT                   /db_xref="GOA:B1JIY2"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JIY2"
FT                   /protein_id="ACA66617.1"
FT                   /translation="MKVRASVKKLCRNCKIVKRNGVVRVICSAEPKHKQRQG"
FT   gene            330166..330522
FT                   /locus_tag="YPK_0305"
FT   CDS_pept        330166..330522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0305"
FT                   /product="ribosomal protein S13"
FT                   /note="PFAM: ribosomal protein S13; KEGG:
FT                   ypi:YpsIP31758_3893 ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66618"
FT                   /db_xref="GOA:B1JIY3"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JIY3"
FT                   /protein_id="ACA66618.1"
FT                   /translation="MARIAGINIPDQKHTVIALTAIFGIGKTRSQAICVAAGIAEHVKI
FT                   SELSEEQIEKLRDEVAKYVVEGDLRREVTLSIKRLMDLGTYRGLRHRRGLPVRGQRTKT
FT                   NARTRKGPRKPIKK"
FT   gene            330539..330928
FT                   /locus_tag="YPK_0306"
FT   CDS_pept        330539..330928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0306"
FT                   /product="ribosomal protein S11"
FT                   /note="PFAM: ribosomal protein S11; KEGG:
FT                   ypi:YpsIP31758_3892 ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66619"
FT                   /db_xref="GOA:B1JJG8"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JJG8"
FT                   /protein_id="ACA66619.1"
FT                   /translation="MAKAPIRARKRVRKTVSDGVAHIHASFNNTIVTITDRQGNALGWA
FT                   TAGGSGFRGSRKSTPFAAQVAAERCAEAVKEYGIKNLEVMVKGPGPGRESTIRALNAAG
FT                   FRITNITDVTPIPHNGCRPPKKRRV"
FT   gene            330959..331579
FT                   /locus_tag="YPK_0307"
FT   CDS_pept        330959..331579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0307"
FT                   /product="ribosomal protein S4"
FT                   /note="PFAM: ribosomal protein S4; RNA-binding S4 domain
FT                   protein; KEGG: ypm:YP_0231 30S ribosomal protein S4"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66620"
FT                   /db_xref="GOA:B1JJG9"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JJG9"
FT                   /protein_id="ACA66620.1"
FT                   /translation="MARYLGPKLKLSRREGTDLFLKSGVRAIDTKCKIEQPPGQHGARK
FT                   PRLSDYGVQLREKQKVRRIYGVLERQFRNYYKEAARLKGNTGANLLQLLEGRLDNVVYR
FT                   MGFGATRAESRQLVSHKAIMVNGRVVNIASYQVSPNDVVSIREKAKKQSRVKAALELAE
FT                   QREKPTWLEVDAVKMEGVFKRIPERTDLSADINEHLIVELYSK"
FT   gene            331605..332594
FT                   /locus_tag="YPK_0308"
FT   CDS_pept        331605..332594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0308"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /note="KEGG: ypi:YpsIP31758_3890 DNA-directed RNA
FT                   polymerase, alpha subunit; TIGRFAM: DNA-directed RNA
FT                   polymerase, alpha subunit; PFAM: RNA polymerase alpha
FT                   subunit domain protein; RNA polymerase dimerisation; RNA
FT                   polymerase insert; SMART: RNA polymerase RpoA/D/Rpb3-type"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66621"
FT                   /db_xref="GOA:A0A0H3AZU6"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZU6"
FT                   /protein_id="ACA66621.1"
FT                   /translation="MQGSVTEFLKPRLVDIEQVSSTHAKVTLEPLERGFGHTLGNALRR
FT                   ILLSSMPGCAVTEVEIDGVLHEYSTKEGVQEDILEILLNLKGLAVRVQGKDEVILTLNK
FT                   SGIGPVTAADITHDGDVEIVKPQHVICHLTDENASINMRIKVQRGRGYVPASARIHSEE
FT                   DERPIGRLLVDACYSPVERIAYNVEAARVEQRTDLDKLVIEMETNGTIDPEEAIRRAAT
FT                   ILAEQLEAFVDLRDVRQPEVKEEKPEFDPILLRPVDDLELTVRSANCLKAEAIHYIGDL
FT                   VQRTEVELLKTPNLGKKSLTEIKDVLASRGLSLGMRLENWPPASIADE"
FT   gene            332635..333024
FT                   /locus_tag="YPK_0309"
FT   CDS_pept        332635..333024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0309"
FT                   /product="ribosomal protein L17"
FT                   /note="PFAM: ribosomal protein L17; KEGG: ypm:YP_0233 50S
FT                   ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66622"
FT                   /db_xref="GOA:B1JJH1"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JJH1"
FT                   /protein_id="ACA66622.1"
FT                   /translation="MRHRKSGRQLNRNSSHRQAMFRNMAGSLVRHEIIKTTLPKAKELR
FT                   RVVEPLITLAKTDNVANRRLAFARTRDNEIVAKLFNELGPRFASRAGGYTRILKCGFRA
FT                   GDNAPMAYIELVDRAASQAEVVAAE"
FT   gene            333471..333896
FT                   /locus_tag="YPK_0310"
FT   CDS_pept        333471..333896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0310"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="TIGRFAM: Zn(II)-responsive transcriptional
FT                   regulator; PFAM: regulatory protein MerR; Transcription
FT                   regulator MerR DNA binding; KEGG: ypm:YP_0234
FT                   zinc-responsive transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66623"
FT                   /db_xref="GOA:A0A0H3B0K2"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011788"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B0K2"
FT                   /protein_id="ACA66623.1"
FT                   /translation="MLKIGQLAKLADVTPDTIRYYEKQGMMDHGERTDGGYRLYTDQDL
FT                   QRLRFIRYAKQLGFTLDTIAELLSIRIDPDHHTCQESKSIVDSRLSDVEGKIRELERMR
FT                   DSLKRLSEACCGTSHATTYCSILEALEQGATEELIKV"
FT   gene            333984..334184
FT                   /locus_tag="YPK_0311"
FT   CDS_pept        333984..334184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0311"
FT                   /product="protein of unknown function DUF331"
FT                   /note="PFAM: protein of unknown function DUF331; KEGG:
FT                   ypi:YpsIP31758_3887 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66624"
FT                   /db_xref="GOA:A0A0H3AZA1"
FT                   /db_xref="InterPro:IPR005589"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZA1"
FT                   /protein_id="ACA66624.1"
FT                   /translation="MTTYRHTKGKIKDNALEALLHDPLFRQRIEKNSKGKGSYQRKEKY
FT                   AKGSNWEASGKQSIDFLLLAF"
FT   gene            complement(334294..334698)
FT                   /locus_tag="YPK_0312"
FT   CDS_pept        complement(334294..334698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0312"
FT                   /product="large conductance mechanosensitive channel
FT                   protein"
FT                   /note="TIGRFAM: large conductance mechanosensitive channel
FT                   protein; PFAM: large-conductance mechanosensitive channel;
FT                   KEGG: ypm:YP_0236 mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66625"
FT                   /db_xref="GOA:A0A0H3AX54"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR019823"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AX54"
FT                   /protein_id="ACA66625.1"
FT                   /translation="MKEFREFAMRGNVVDLAVGVIIGAAFGRIVSSLVADIIMPPLGLL
FT                   LGGVDFKQFHFVLRAAEGTIPAVVMNYGTFIQSIFDFVIVALAIFSAVKLMNKLRREKA
FT                   EEEPATPPAPTTEEILLAEIRDLLKAQHTK"
FT   gene            complement(334846..336222)
FT                   /locus_tag="YPK_0313"
FT   CDS_pept        complement(334846..336222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0313"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; NADP oxidoreductase
FT                   coenzyme F420-dependent; TrkA-C domain protein; KEGG:
FT                   ypm:YP_0237 trk system potassium uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66626"
FT                   /db_xref="GOA:A0A0H3AYU2"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYU2"
FT                   /protein_id="ACA66626.1"
FT                   /translation="MKIIILGAGQVGGTLAENLVGENNDITVVDIDSGRLRQLQDKFDL
FT                   RVVQGYGSHPRVLREAGAEDADMLVAVTNSDETNMIACQIAYSLFNTPNRIARIRSTEY
FT                   IREADKLFLPEAVPIDHLISPEQLVIDYIYKLIEYPGALQVVNFAEGKVSIAAVKAYYG
FT                   GPLVGNALSSLREHMPHIDTRVAAIFRQDRPIRPQGSTIIEAGDEVFFVAASQHIRAVM
FT                   SELQRLEKPYKRIMIVGGGNVGAGLALRLEKDYSVKLIERDQQRAAELAEMLHDTIVFY
FT                   GDASDQELLAEEHIEQVDVFIAITNDDEANIMSAMLAKRMGAKKAMVLIQRSAYVDLVQ
FT                   GSVIDIVISPQQATISALLGHVRKADIVSVSSLRRGVAEAIEAIAHGDESTSKVVGRMV
FT                   EDIKLPPGTTIGAIVRGDEVIIANSNSIIKQGDHVIMFITHKKFVPDVERLFQPSPFFL
FT                   "
FT   gene            complement(336278..337567)
FT                   /locus_tag="YPK_0314"
FT   CDS_pept        complement(336278..337567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0314"
FT                   /product="sun protein"
FT                   /note="TIGRFAM: sun protein; PFAM: Fmu (Sun) domain
FT                   protein; NusB/RsmB/TIM44; KEGG: ypi:YpsIP31758_3884
FT                   ribosomal RNA small subunit methyltransferase B"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66627"
FT                   /db_xref="GOA:B1JJH6"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR023541"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JJH6"
FT                   /protein_id="ACA66627.1"
FT                   /translation="MKNTYNLRSIAAKAISQVLDQGQSLSAVLPELQKNISDKDRALLQ
FT                   ELCFGTLRVLPQLEWCIQQLMARPMTGKQRVFHYLIMVGLYQLIYTRIPPHAALAETVE
FT                   GATVLKRPQLKGLINGVLRQFQRQQVELLERAVNNDSHYLHPSWLLARIKQAYPAQWQQ
FT                   ILDANNQRPPMWLRVNRLHHSRSEYLELLTQADINAEPHPIYRDAVRLITPCAVNHLPG
FT                   FELGWVTVQDASAQGCVDLLDPQNGEQILDLCAAPGGKTTHILEAAPKAHVLAVDIDEQ
FT                   RLSRVKENLQRLQLQAVVRVGDGRAPDTWCGDQQFDRILLDAPCSATGVIRRHPDIKWL
FT                   RRDRDISELAQLQSEIIEAIWPKLKHGGVLVYATCSILPEENQQQIAAFLQRHPEAQLT
FT                   ETGTTAAPGKQNLPHPEDGDGFFYAKIIKK"
FT   gene            complement(337661..338608)
FT                   /locus_tag="YPK_0315"
FT   CDS_pept        complement(337661..338608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0315"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /note="TIGRFAM: methionyl-tRNA formyltransferase; PFAM:
FT                   formyl transferase domain protein; KEGG:
FT                   ypi:YpsIP31758_3883 methionyl-tRNA formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66628"
FT                   /db_xref="GOA:B1JJH7"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JJH7"
FT                   /protein_id="ACA66628.1"
FT                   /translation="MSDSLRIIFAGTPDFAARHLGALLSSQHKIVGVFTQPDRPAGRGN
FT                   KLTPSPVKILAEHHGIPVFQPKSLRPEENQHLVADLNADIMVVVAYGLILPAAVLAMPR
FT                   LGCINVHGSLLPRWRGAAPIQRSVWAGDEKTGITIMQMDIGLDTGAMLHKIECAIQPED
FT                   TSATLYDKLAQLGPQGLLITLQQLAAGTALAEVQNETQATYAEKLSKEEAKLDWTLSAT
FT                   QLERCIRAFNPWPVSYFIVDEQPIKVWQAQVLPAGEDAEPGTIIHADKHGIQVATADGV
FT                   LNITQLQPAGKKAMSAADLLNSRREWFIPGSQLV"
FT   gene            complement(338633..339145)
FT                   /locus_tag="YPK_0316"
FT   CDS_pept        complement(338633..339145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0316"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="KEGG: ypm:YP_0240 polypeptide deformylase; TIGRFAM:
FT                   peptide deformylase; PFAM: formylmethionine deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66629"
FT                   /db_xref="GOA:B1JJH8"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JJH8"
FT                   /protein_id="ACA66629.1"
FT                   /translation="MSVLQVLHYPDERLRKIAAPVKEVNGEIQRIVDDMFETMYAEEGI
FT                   GLAATQVDVHQQIIVIDISENRDQRLVLINPELLEKSGETGIEEGCLSIPEQRALVPRA
FT                   EKVKIRALDRDGKPFELETDGLLAICIQHEMDHLIGKLFVDYLSPLKRQRIRQKLEKMA
FT                   KLNARAN"
FT   gene            339280..340401
FT                   /locus_tag="YPK_0317"
FT   CDS_pept        339280..340401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0317"
FT                   /product="DNA protecting protein DprA"
FT                   /note="TIGRFAM: DNA protecting protein DprA; PFAM: SMF
FT                   family protein; KEGG: yps:YPTB3664 DNA processing protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66630"
FT                   /db_xref="GOA:A0A0H3AZV2"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZV2"
FT                   /protein_id="ACA66630.1"
FT                   /translation="MLAAELWLRMTQVKGLGVVKRSALAKRLLASGDIHPGRLAAYGLD
FT                   SQQCHQFAQLSPRYIADTLEWLSDPNHHLLTYGEPGYPPRLVHIAGAPLVLFVSGELDV
FT                   LYRPQIAMVGSRHFSHYGEQWGRYFASELARTGLVITSGLAVGIDGICHQAALNIQGRT
FT                   IAVLGSGLENIYPQRHSRLAKEIEYQGGALVSEFLTTALPIAAHFPRRNRIISGLSDAV
FT                   LVVEATLKSGSLITARYAMDQGRDVFALPGPLGSASSEGTHWLIQQGAYLATSVKDVSE
FT                   QVSGSLQWLSLPEEVIISSPKEQVELPFADVLANVGDEVTPVDVVAERAGQPVQDIASK
FT                   LLELELAGWIAAVPGGYVRIRRAGHVRRSNLLI"
FT   gene            340373..340846
FT                   /locus_tag="YPK_0318"
FT   CDS_pept        340373..340846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0318"
FT                   /product="protein of unknown function DUF494"
FT                   /note="PFAM: protein of unknown function DUF494; KEGG:
FT                   ypi:YpsIP31758_3880 smg protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66631"
FT                   /db_xref="InterPro:IPR007456"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JJI0"
FT                   /protein_id="ACA66631.1"
FT                   /translation="MFDVLIYLFETYMHNEPEMLVDQDKITDDLADAGFYREDINNALN
FT                   WLEVLADLQEGQKAPYLYTADPQALRIYTVEECRRLGAACRGFILFLEQIQVLQFDTRE
FT                   MVIDRIMALDSPEIDLEDLKWVVLMVLFNIPGYENAYKQMEELLFEVNDGYLH"
FT   gene            340887..341426
FT                   /locus_tag="YPK_0319"
FT   CDS_pept        340887..341426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0319"
FT                   /product="DNA topoisomerase type IA zn finger domain
FT                   protein"
FT                   /note="PFAM: DNA topoisomerase type IA zn finger domain
FT                   protein; KEGG: ypi:YpsIP31758_3879 topoisomerase DNA
FT                   binding C4 zinc finger domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66632"
FT                   /db_xref="GOA:A0A0H3B0K6"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B0K6"
FT                   /protein_id="ACA66632.1"
FT                   /translation="MTKKVITKDNGSCPECGSALVIRSGGHGPFLGCSHYPDCQYIRPL
FT                   KAQADGHVVKTLEGQPCPECGSDMVLRQGRFGMFIGCSQYPQCDHTEVIDKPDETSIDC
FT                   PQCGQGKLLQRKSRFGKVFHACNRYPDCQFTLNQPPIAGKCGYCHYPLLIEKRTARGIK
FT                   RICASKLCGKAVASES"
FT   gene            341428..342000
FT                   /locus_tag="YPK_0320"
FT   CDS_pept        341428..342000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0320"
FT                   /product="SUA5/yciO/yrdC domain"
FT                   /note="PFAM: SUA5/yciO/yrdC domain; KEGG:
FT                   ypi:YpsIP31758_3878 ribosomal modification protein RimN"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66633"
FT                   /db_xref="GOA:B1JJI2"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR023535"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JJI2"
FT                   /protein_id="ACA66633.1"
FT                   /translation="MNQQENNFVLADIVRALRQEEVIAYPTEAVFGLGCDPDSEKAVNT
FT                   LLALKQRPWQKGLILVAANYAQLEPYINDSMLNEIQRETLFSTWPGPITWVIPARVETP
FT                   QWLTGCFDSLAVRVSNHPLVQQLCAEYGKPLVSTSANLSGHEPCRTEEEVRIQFGPSLP
FT                   VLSGHVGGRLNPSEIRDALTGKRFRQG"
FT   gene            342009..342830
FT                   /locus_tag="YPK_0321"
FT   CDS_pept        342009..342830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0321"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /note="TIGRFAM: shikimate 5-dehydrogenase; PFAM:
FT                   Shikimate/quinate 5-dehydrogenase; Shikimate dehydrogenase
FT                   substrate binding domain protein; KEGG: ypm:YP_0245
FT                   shikimate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66634"
FT                   /db_xref="GOA:B1JJI3"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JJI3"
FT                   /protein_id="ACA66634.1"
FT                   /translation="MDQKFAVFGNPISHSKSPRIHTLFSEQTGIEHRYGKVLAPSEAFE
FT                   NTLVSFFADGAQGANITTPFKERAYDQCDELTDRASLAGAVNTIKRLEDGRLLGDNTDG
FT                   IGLLSDLERQNLIRTTDHILLVGAGGAARGVILPLLSYGCTVVVTNRTHTRAQQLAKVF
FT                   NHIGDIDVCEMSELAGQRFDLVINATASGLHGEVPNLPAAILTSQTRCYDMFYQAGTTP
FT                   FLAWAQRLGLADYADGLGMLVGQAAHAFKLWHGVMPEITPVLAQLRSELGK"
FT   gene            complement(342885..343427)
FT                   /locus_tag="YPK_0322"
FT   CDS_pept        complement(342885..343427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0322"
FT                   /product="transferase hexapeptide repeat containing
FT                   protein"
FT                   /note="PFAM: transferase hexapeptide repeat containing
FT                   protein; KEGG: yps:YPTB3659 putative transferase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66635"
FT                   /db_xref="GOA:A0A0H3AZA6"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZA6"
FT                   /protein_id="ACA66635.1"
FT                   /translation="MCDSIRPYLHHSPTLGKRVMIDRSSVIIGNVILGDDVSVWPLVAI
FT                   RGDVNQVIIGARSNIQDGSVLHVTHQSEHNPEGYPLIIGEDVTIGHKAMLHGCTIGNRV
FT                   LVGMGSILLDGTIIEDDVMIGAGSLIAPGKRLVSGYLYVGSPAKQIRPLTPLELEGLLY
FT                   SAGNYVRWKDDYLAESK"
FT   gene            343731..343850
FT                   /locus_tag="YPK_0323"
FT   CDS_pept        343731..343850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0323"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66636"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AX71"
FT                   /protein_id="ACA66636.1"
FT                   /translation="MRTSRYQPSVANALLFNNLSDNLCGHSQDDIDACFGRQK"
FT   gene            343986..345520
FT                   /locus_tag="YPK_R0086"
FT   rRNA            343986..345520
FT                   /locus_tag="YPK_R0086"
FT                   /product="16S ribosomal RNA"
FT   gene            345624..345700
FT                   /locus_tag="YPK_R0003"
FT                   /note="tRNA-Ile1"
FT   tRNA            345624..345700
FT                   /locus_tag="YPK_R0003"
FT                   /product="tRNA-Ile"
FT   gene            345752..345827
FT                   /locus_tag="YPK_R0004"
FT                   /note="tRNA-Ala1"
FT   tRNA            345752..345827
FT                   /locus_tag="YPK_R0004"
FT                   /product="tRNA-Ala"
FT   gene            346046..348952
FT                   /locus_tag="YPK_R0093"
FT   rRNA            346046..348952
FT                   /locus_tag="YPK_R0093"
FT                   /product="23S ribosomal RNA"
FT   gene            349642..350679
FT                   /locus_tag="YPK_0326"
FT   CDS_pept        349642..350679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0326"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /EC_number="1.3.1.98"
FT                   /note="KEGG: ypi:YpsIP31758_3872
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase; TIGRFAM:
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase; PFAM: FAD
FT                   linked oxidase domain protein;
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66637"
FT                   /db_xref="GOA:A0A0H3AYU4"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYU4"
FT                   /protein_id="ACA66637.1"
FT                   /translation="MSNQRSSLKHLNTFALPAYASNVISAGSVETLIAAWHESKAKRQP
FT                   VLLLGEGSNVLFIKNFSGTVLLNRIMGITSTEDSAAWHLHVGAGENWHQLVCHSLQNNM
FT                   PGLENLALIPGCVGSAPIQNIGAYGVELKQVCEYVDLLDMDKGTIQRISAEECQFGYRD
FT                   SIFKHRYGNGFAIVSVGIKLMKSWTPTLGYGDLIHMDPLTVTATDIFNSVCTMRRSKLP
FT                   DPMVTGNAGSFFKNPVVSAAIAEEIVHCYPNAPHYLQPDGSVKLAAGWLIDQCSLKGYQ
FT                   IGGAAVHQQQALVLINQSEATGQDVIHLARYIRQQVAQRFSIWLEPEVRFIADNGEVNA
FT                   VEHLS"
FT   gene            350676..351635
FT                   /locus_tag="YPK_0327"
FT   CDS_pept        350676..351635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0327"
FT                   /product="bifunctional BirA, biotin operon
FT                   repressor/biotin--acetyl-CoA-carboxylase ligase"
FT                   /EC_number="6.3.4.15"
FT                   /note="KEGG: ypm:YP_3289 bifunctional protein BirA;
FT                   TIGRFAM: biotin--acetyl-CoA-carboxylase ligase; biotin
FT                   operon repressor; PFAM: biotin protein ligase domain
FT                   protein; biotin/lipoate A/B protein ligase;
FT                   Helix-turn-helix type 11 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66638"
FT                   /db_xref="GOA:A0A0H3AZV4"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR004409"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR030855"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZV4"
FT                   /protein_id="ACA66638.1"
FT                   /translation="MKDIRVPLRLVSILSDGFFHSGEQLGETLGMSRAAINKHMQTIRD
FT                   WGLDVFTVPGKGYSLPTSIQLLDEQKILSYLPTGHVTVLPVVDSTNQYLLDRITELKSG
FT                   DACVAEYQQAGRGRRGRQWVSPFGANLYLSMYWRLEQGPAAAMGLSLVVGIVMAEVLQN
FT                   LGAEKVRVKWPNDLYLNDKKLAGILVELTGKTGDAAQLVIGAGINLTMRGSETNAINQD
FT                   WINLQDAGVTIDRNKLTAEILSELRLAVVKFENEGLSAFLSRWQKMDNYLNRPVKLIIG
FT                   NQEIFGIARGIDQQGALLLEQDGNIKPYIGGEISLRGV"
FT   gene            complement(351670..352620)
FT                   /locus_tag="YPK_0328"
FT   CDS_pept        complement(351670..352620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0328"
FT                   /product="pantothenate kinase"
FT                   /EC_number="2.7.1.33"
FT                   /note="KEGG: ypi:YpsIP31758_3870 pantothenate kinase;
FT                   TIGRFAM: pantothenate kinase; PFAM:
FT                   phosphoribulokinase/uridine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66639"
FT                   /db_xref="GOA:B1JJI8"
FT                   /db_xref="InterPro:IPR004566"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JJI8"
FT                   /protein_id="ACA66639.1"
FT                   /translation="MTKREQSLATPYLQFDRTQWAALRDSVPLTLTEEEIVKLKGINED
FT                   LSLDEVAQIYLPLSRLLNFYISSNLRRQAVLEQFLGTDGQRIPYVIGIAGSVAVGKSTT
FT                   ARLLQALLSRWPEHRSVELITTDGFLHPNKVLNERGLMKKKGFPESYDMHNLVKFVSEV
FT                   KSGADYVTAPVYSHLIYDVVPDGNKVIKQPDILILEGLNVLQSGMDYPHDPHHVFVSDF
FT                   VDFSIYVDAPEDLLQSWYINRFLKFRQGAFSNPDSYFHNYAKLPETEAIKIATQLWNEI
FT                   NGLNLKQNILPTRERASLIMTKSANHAVESVRLRK"
FT   gene            complement(352831..353382)
FT                   /locus_tag="YPK_0329"
FT   CDS_pept        complement(352831..353382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0329"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   yps:YPTB0275 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66640"
FT                   /db_xref="GOA:A0A0H3B0L3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B0L3"
FT                   /protein_id="ACA66640.1"
FT                   /translation="MKIVLLNAATFPIYRSGLASLLIDAVTYGASVGYNTHTLSQEEAE
FT                   GYFHSLHPAIEREALLLWIARDEIGIIGTIQLVLCQKPNGLNRAEIQKLLVHSRSRRTG
FT                   IGHKLIIAAENTAVQLRRGLIYLDTQSGSSAESFYRAQGYRYVGEIPDYACTPNGNYHP
FT                   TAIYFKRLFTVVQPHTAIQN"
FT   gene            complement(353606..353740)
FT                   /locus_tag="YPK_0330"
FT   CDS_pept        complement(353606..353740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66641"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZB0"
FT                   /protein_id="ACA66641.1"
FT                   /translation="MQQKNCITRVFAHKTTTFYAAEVLSSIISSINTQKIKYCTRLSL"
FT   gene            353778..353853
FT                   /locus_tag="YPK_R0005"
FT                   /note="tRNA-Thr1"
FT   tRNA            353778..353853
FT                   /locus_tag="YPK_R0005"
FT                   /product="tRNA-Thr"
FT   gene            353872..353956
FT                   /locus_tag="YPK_R0006"
FT                   /note="tRNA-Tyr1"
FT   tRNA            353872..353956
FT                   /locus_tag="YPK_R0006"
FT                   /product="tRNA-Tyr"
FT   gene            354106..354180
FT                   /locus_tag="YPK_R0007"
FT                   /note="tRNA-Gly1"
FT   tRNA            354106..354180
FT                   /locus_tag="YPK_R0007"
FT                   /product="tRNA-Gly"
FT   gene            354187..354262
FT                   /locus_tag="YPK_R0008"
FT                   /note="tRNA-Thr2"
FT   tRNA            354187..354262
FT                   /locus_tag="YPK_R0008"
FT                   /product="tRNA-Thr"
FT   gene            354371..355555
FT                   /locus_tag="YPK_0332"
FT   CDS_pept        354371..355555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0332"
FT                   /product="translation elongation factor Tu"
FT                   /note="TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain protein;
FT                   elongation factor Tu domain 2 protein; KEGG: ypm:YP_3117
FT                   elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66642"
FT                   /db_xref="GOA:A0A0H3AX60"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AX60"
FT                   /protein_id="ACA66642.1"
FT                   /translation="MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGSAR
FT                   AFDQIDNAPEEKARGITINTSHVEYDTPARHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVAATDGPMPQTREHILLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDF
FT                   PGDDTPVIRGSALKALEGDAEWEAKIIELAEALDSYIPQPERAIDRPFLLPIEDVFSIS
FT                   GRGTVVTGRVERGIVKVGEEVEIVGIIDTIKTTCTGVEMFRKLLDEGRAGENVGVLLRG
FT                   TKRDDVQRGQVLAKPGSIKPHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTG
FT                   TIELPEGVEMVMPGDNVNMVVNLIAPIAMDDGLRFAIREGGRTVGAGVVAKVIE"
FT   gene            355806..356189
FT                   /locus_tag="YPK_0333"
FT   CDS_pept        355806..356189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0333"
FT                   /product="preprotein translocase, SecE subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecE subunit; PFAM:
FT                   protein secE/sec61-gamma protein; KEGG: ypi:YpsIP31758_3866
FT                   preprotein translocase, SecE subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66643"
FT                   /db_xref="GOA:A0A0H3AYU7"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYU7"
FT                   /protein_id="ACA66643.1"
FT                   /translation="MSANTEAPGSGRGLETAKWLIVAVLLVVAIVGNYYYREYSLPLRA
FT                   LAVVVIIAVAGAVALMTAKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVM
FT                   SLILWGLDGILVRLVSFITGLRF"
FT   gene            356191..356736
FT                   /locus_tag="YPK_0334"
FT   CDS_pept        356191..356736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0334"
FT                   /product="NusG antitermination factor"
FT                   /note="TIGRFAM: transcription termination/antitermination
FT                   factor NusG; PFAM: KOW domain protein; NGN domain protein;
FT                   KEGG: yen:YE0280 transcription antitermination protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66644"
FT                   /db_xref="GOA:A0A0H3AZV9"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZV9"
FT                   /protein_id="ACA66644.1"
FT                   /translation="MSEAPKKRWYVVQAFSGFEGRVAQSLREHIKLHDMEELFGEVMVP
FT                   TEEVVEIRGGQRRKSERKFFPGYVLVQMVMNDASWHLVRSVPRVMGFIGGTSDRPAPIS
FT                   DKEVDAIMNRLQQVGDKPRPKTLFEPGELVRVSDGPFADFNGVVEEVDYEKSRLKVSVS
FT                   IFGRATPVELDFSQVEKG"
FT   gene            356927..357355
FT                   /locus_tag="YPK_0335"
FT   CDS_pept        356927..357355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0335"
FT                   /product="ribosomal protein L11"
FT                   /note="PFAM: ribosomal protein L11; KEGG:
FT                   ypi:YpsIP31758_3864 ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66645"
FT                   /db_xref="GOA:B1JJJ4"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JJJ4"
FT                   /protein_id="ACA66645.1"
FT                   /translation="MAKKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAK
FT                   TESIEKGLPIPVVITVYSDRSFTFVTKTPPAAVLLKKAAGIKSGSGVPNKDKVGKVTSA
FT                   QVREIAETKAADMTGSDVDAMMRSIEGTAHSMGLVVEG"
FT   gene            357359..358063
FT                   /locus_tag="YPK_0336"
FT   CDS_pept        357359..358063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0336"
FT                   /product="ribosomal protein L1"
FT                   /note="PFAM: ribosomal protein L1; KEGG: ypm:YP_3113 50S
FT                   ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66646"
FT                   /db_xref="GOA:B1JJJ5"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JJJ5"
FT                   /protein_id="ACA66646.1"
FT                   /translation="MAKLTKRMRVIRDKVDVTKQYDINEAVALLKELATAKFVESVDVA
FT                   VNLGIDARKSDQNVRGATVLPHGTGRSVRVAVFAQGANAEAAKEAGAELVGMDDLADQI
FT                   KKGEMNFDVVIASPDAMRVVGQLGQILGPRGLMPNPKVGTVTPNVAEAVKNAKAGQVRY
FT                   RNDKNGIIHTTIGKVDFDSDKLKENLESLVVALKKAKPATAKGIYIKKISLSTTMGAGV
FT                   AIDQSGLTAVVN"
FT   gene            358428..358925
FT                   /locus_tag="YPK_0337"
FT   CDS_pept        358428..358925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0337"
FT                   /product="ribosomal protein L10"
FT                   /note="PFAM: ribosomal protein L10; KEGG: ypm:YP_3112 50S
FT                   ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66647"
FT                   /db_xref="GOA:B1JJJ6"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JJJ6"
FT                   /protein_id="ACA66647.1"
FT                   /translation="MALNLQGKQAIVAEVKEVAKGALSAVVADSRGVTVDKMTELRRAG
FT                   REAGVHMQVVRNTLLRRIVEGTPFECLKDTFVGPTLIAFSAEHPGAAARLFKAFAKDNA
FT                   KFEVKAAAFEGELIPAAQIDRLATLPTYEEAIARLMGTMKEAAAGKLVRTLAALRDQKE
FT                   AA"
FT   gene            358992..359360
FT                   /locus_tag="YPK_0338"
FT   CDS_pept        358992..359360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0338"
FT                   /product="ribosomal protein L7/L12"
FT                   /note="TIGRFAM: ribosomal protein L7/L12; PFAM: Ribosomal
FT                   protein L7/L12; KEGG: ypi:YpsIP31758_3861 ribosomal protein
FT                   L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66648"
FT                   /db_xref="GOA:B1JJJ7"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JJJ7"
FT                   /protein_id="ACA66648.1"
FT                   /translation="MSTITKDQILEGVAALSVMEIVELISAMEEKFGVSAAAVAAGPAA
FT                   AVEAAEEQTEFDVVLASFGENKVAVIKAVRGATGLGLKEAKDLVESAPAVLKEGVNKDE
FT                   AETLKKSLEEAGASVEIK"
FT   gene            complement(359506..359643)
FT                   /locus_tag="YPK_0339"
FT   CDS_pept        complement(359506..359643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0339"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66649"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B0L7"
FT                   /protein_id="ACA66649.1"
FT                   /translation="MQHYYFDREVETLPGILFSITLKPFHRVTLTTELPEWVVAENAVY
FT                   "
FT   gene            359703..363731
FT                   /locus_tag="YPK_0340"
FT   CDS_pept        359703..363731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0340"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, beta subunit;
FT                   PFAM: RNA polymerase Rpb2 domain 6; RNA polymerase Rpb2
FT                   domain 7; RNA polymerase Rpb2 domain 2; RNA polymerase beta
FT                   subunit; RNA polymerase Rpb2 domain 3; KEGG:
FT                   ypi:YpsIP31758_3860 DNA-directed RNA polymerase, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66650"
FT                   /db_xref="GOA:B1JJJ9"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JJJ9"
FT                   /protein_id="ACA66650.1"
FT                   /translation="MVYSYTEKKRIRKDFGKRPQVLDIPYLLSIQLDSFQKFIEQDPEG
FT                   QHGLEAAFRSVFPIQSYSGNSELQYVSYRLGEPVFDVKECQIRGVTYSAPLRVKLRLVI
FT                   YEREAPEGTVKDIKEQEVYMGEIPLMTENGTFVINGTERVIVSQLHRSPGVFFDSDKGK
FT                   THSSGKVLYNARIIPYRGSWLDFEFDPKDNLFVRIDRRRKLPATIILRALNFTTAQILD
FT                   LFFEKVVFEIRDNKLQMELVPERLRGETASFDIEANGKVYVEKARRITARHIRQLEKDG
FT                   IDRIEVPVEYIAGKVVAKDYVDASTGELICAANMELSLDLLAKLSQAGHKQIETLFTND
FT                   LDHGAYISETLRVDPTSDRLSALVEIYRMMRPGEPPTREAAENLFENLFFSEDRYDLSA
FT                   VGRMKFNRSLLRDEIEGSGILSKEDITEVMKKLIDIRNGRGEVDDIDHLGNRRIRSVGE
FT                   MAENQFRVGLVRVERAVKERLSLGDLDTLMPQDMINAKPISAAVKEFFGSSQLSQFMDQ
FT                   NNPLSEITHKRRISALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLINSLS
FT                   VYAQTNEYGFLETPYRRVRDGVVTDEINYLSAIEEGNFVIAQANSNLDDEGRFLEDLVT
FT                   CRSKGESSLFSREQVDYMDVSTQQIVSVGASLIPFLEHDDANRALMGANMQRQAVPTLR
FT                   ADKPLVGTGMERAVAVDSGVTSVAKRGGTVQYVDASRIVIKVNEDEMHPGEAGIDIYNL
FT                   TKYTRSNQNTCINQMPCVNLGEPIERGDVLADGPSTDLGELALGQNMRVAFMPWNGYNF
FT                   EDSILVSERVVQEDRFTTIHIQELACVSRDTKLGPEEITADIPNVGEAALSKLDESGIV
FT                   YIGAEVTGGDILVGKVTPKGETQLTPEEKLLRAIFGEKASDVKDSSLRVPNGVSGTVID
FT                   VQVFTRDGVEKDKRALEIEEMQLKQAKKDLTEELQILEAGLFARIHAVLVSGGIEAEKL
FT                   SKLPRERWLELGLTDEDKQNQLEQLAEQYDEMKSEFEKKMDAKRRKITQGDDLAPGVLK
FT                   IVKVYLAVKRQIQPGDKMAGRHGNKGVISKINPIEDMPYDENGTPVDIVLNPLGVPSRM
FT                   NIGQILETHLGMAAKGIGEKINAMLKKQEEVAKLREFIQKAYDLGDNVCQKVDLSTFTD
FT                   DEVLRLAENLKKGMPIATPVFDGATEKEIKELLQLGGLPTSGQITLFDGRTGEQFERQV
FT                   TVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAA
FT                   YTLQEMLTVKSDDVNGRTKMYKNIVDGDHRMEPGMPESFNVLLKEIRSLGINIELEEE"
FT   gene            363860..368080
FT                   /locus_tag="YPK_0341"
FT   CDS_pept        363860..368080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0341"
FT                   /product="DNA-directed RNA polymerase, beta' subunit"
FT                   /note="KEGG: ypp:YPDSF_3744 DNA-directed RNA polymerase
FT                   beta' chain; TIGRFAM: DNA-directed RNA polymerase, beta'
FT                   subunit; PFAM: RNA polymerase alpha subunit; RNA polymerase
FT                   Rpb1 domain 3; RNA polymerase Rpb1 domain 1; RNA polymerase
FT                   Rpb1 domain 5; RNA polymerase Rpb1 domain 4; SMART: RNA
FT                   polymerase I subunit A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66651"
FT                   /db_xref="GOA:B1JJK0"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JJK0"
FT                   /protein_id="ACA66651.1"
FT                   /translation="MKDLLKFLKAQTKTEEFDAIKIALASPDMIRSWSFGEVKKPETIN
FT                   YRTFKPERDGLFCARIFGPVKDYECLCGKYKRLKHRGVICEKCGVEVTQTKVRRERMGH
FT                   IELASPTAHIWFLKSLPSRIGLLLDMPLRDIERVLYFESYVVIEGGMTNLERRQILTEE
FT                   QYLDALEEFGDEFDAKMGAEAIQALLKNMDLEAECEILREELNETNSETKRKKLTKRIK
FT                   LLEAFVQSGNKPEWMILTVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKR
FT                   LLDLAAPDIIVRNEKRMLQEAVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQ
FT                   NLLGKRVDYSGRSVITVGPYLRLHQCGLPKKMALELFKPFIYGKLELRGLATTIKAAKK
FT                   MVEREEAVVWDILDEVIREHPVLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAYN
FT                   ADFDGDQMAVHVPLTLEAQLEARALMMSTNNILSPANGEPIIVPSQDVVLGLYYMTRDC
FT                   VNAKGEGMVLTGPKEAERIYRAGLASLHARVKVRITEEIRNTEGESITRTSIIDTTVGR
FT                   AILWMIVPQGLPYSIVNQPLGKKAISKMLNTCYRILGLKPTVIFADQIMYTGFAYAARS
FT                   GASVGIDDMVIPEAKAGIIEEAETEVAEIQEQFQSGLVTAGERYNKVIDIWAAANERVA
FT                   KAMMDNLSVEDVVNRDGVVEQQVSFNSIFMMADSGARGSAAQIRQLAGMRGLMAKPDGS
FT                   IIETPITANFREGLNVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVAQDLVVTED
FT                   DCGTHNGIVMTPVIEGGDVKEPLRDRVLGRVTAEEVIKPGSADILVPRNTLLDEKWCDL
FT                   LEENSVDSVKVRSVVSCETDFGVCANCYGRDLARGHIINKGEAVGVIAAQSIGEPGTQL
FT                   TMRTFHIGGAASRAAAESSIQVKNKGSLKLSNVKFVTNAAGKLVITSRNTELKLIDEFG
FT                   RTKESYKVPYGAVMAKGDGAEVQGGETVANWDPHIMPVVTEVSGFIRFADMVDGQTITR
FT                   QTDELTGLSSLVVLDSAERTGSGKDLRPALKIVDAKGNDVLIPGTDMPAQYFLPGKAIV
FT                   QLEDGIQIGAGDTLARIPQESSGTKDITGGLPRVADLFEARRPKEPAILAEISGIISFG
FT                   KETKGKRRLVISPLDGSDAYEEMIPKWRQLNVFEGEVVERGDVVSDGPESPHDILRLRG
FT                   VHAVTRYITNEVQEVYRLQGVKINDKHIEVIVRQMLRKGTIVDAGSTDFLEGEQAEMSR
FT                   VKIANRKLAAEGKIEATFTRDLLGITKASLATESFISAASFQETTRVLTEAAVAGKRDE
FT                   LRGLKENVIVGRLIPAGTGYAYHQDRMRRKAQGEAPVVPQVSADEATANLAELLNAGFG
FT                   NNKG"
FT   gene            complement(368387..369517)
FT                   /locus_tag="YPK_0342"
FT   CDS_pept        complement(368387..369517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0342"
FT                   /product="thiazole biosynthesis protein ThiH"
FT                   /note="TIGRFAM: thiazole biosynthesis protein ThiH; PFAM:
FT                   Radical SAM domain protein; biotin and thiamin synthesis
FT                   associated; KEGG: ypm:YP_3107 thiamine biosynthesis protein
FT                   ThiH"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66652"
FT                   /db_xref="GOA:A0A0H3AZB4"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR012726"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034428"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZB4"
FT                   /protein_id="ACA66652.1"
FT                   /translation="MSEDFNQRWQQLDWDDISLTINSKKPADVERALNAIKPTREDLMA
FT                   LISPAALAYLEPMAQKAQQLTRQRFGNTVSFYVPLYLSNLCANDCTYCGFSMSNRIKRK
FT                   TLDEAEIIRECEAIKALGFEHLLLVTGEHQTKVGMDYFRRHLPTIRSRFSSLMMEVQPL
FT                   AEDEYTELKALGLDGVMVYQETYHPATYQQHHLRGHKQDFHWRLATPDRLGRAGIDKIG
FT                   LGALIGLSNSWRTDCYMLAEHLFYLQQTYWQTRYSISFPRLRPCAGGIEPASIMSEPQL
FT                   LQLICAFRLFAPDVELSLSTRESPFFRDNVIPVAINNVSAGSKTQPGGYADDHPELEQF
FT                   APHDNRSPEQVAQALTKAGLQPVWKDWDSHLGRSLR"
FT   gene            complement(369510..370325)
FT                   /locus_tag="YPK_0343"
FT   CDS_pept        complement(369510..370325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0343"
FT                   /product="thiazole biosynthesis family protein"
FT                   /note="PFAM: thiazole biosynthesis family protein; KEGG:
FT                   ypm:YP_3106 thiamine biosynthesis protein ThiG"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66653"
FT                   /db_xref="GOA:B1JJK2"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JJK2"
FT                   /protein_id="ACA66653.1"
FT                   /translation="MLKIADTTFTSRLFTGTGKFSSPELMLEALRASGSQLITMAMKRV
FT                   DLQSGNDAILAPLRQLGVRLLPNTSGAKTAEEAIFAARLAREALNTHWVKLEIHPDVRY
FT                   LLPDPIETLKAAEVLVKEGFVVLPYCGADPVLCKRLEEVGCAAVMPLGSPIGSNLGLRT
FT                   RDFLQIIIEQSKVPVVVDAGIGAPSHALEALELGADAVLVNTAIAVAHSPVQMAHAFRL
FT                   AVESGERARLAGLGASPFNPSQPDTLQLRATATSPLTGFLSQLEEQEHV"
FT   gene            complement(370327..370542)
FT                   /locus_tag="YPK_0344"
FT   CDS_pept        complement(370327..370542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0344"
FT                   /product="thiamine biosynthesis protein ThiS"
FT                   /note="TIGRFAM: thiamine biosynthesis protein ThiS; PFAM:
FT                   thiamineS protein; KEGG: ypm:YP_3105 sulfur transfer
FT                   protein involved in thiamine biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66654"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AX63"
FT                   /protein_id="ACA66654.1"
FT                   /translation="MKTNYIPIMLNDQPLEVECNLTAEMLLNQLKHHQPGTALAINQVI
FT                   IPRADWQNHRLQAGDHILLFQAIAGG"
FT   gene            complement(370539..371336)
FT                   /locus_tag="YPK_0345"
FT   CDS_pept        complement(370539..371336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0345"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein;
FT                   MoeZ/MoeB domain protein; KEGG: ypi:YpsIP31758_3855
FT                   adenylyltransferase ThiF"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66655"
FT                   /db_xref="GOA:A0A0H3AYU8"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYU8"
FT                   /protein_id="ACA66655.1"
FT                   /translation="MKNDQTLSDSEFLRYSRQLLLEDIGPEGQRKLKGASVLIVGLGGL
FT                   GSPAALYLAAAGVGQLLLADDDQLDLTNLQRQILYRTADIGQTLSNPTSSVSHNKARLA
FT                   QRHLQQLNPQIRIVALDTRLTGQVLTDAVANADLVLDCSDNMETRHQVNAACVAAQKPL
FT                   ISGSAVGFSGQLLVIEPPYAQGCYACIYPDKELSQRNCRTAGVLGPVVGVIGTLQALEA
FT                   IKMLAGIPLALSGKLRLFDGKQQSWSTLQLTRAAHCPACGGGL"
FT   gene            complement(371326..372000)
FT                   /locus_tag="YPK_0346"
FT   CDS_pept        complement(371326..372000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0346"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /note="KEGG: ypm:YP_3103 thiamine-phosphate
FT                   pyrophosphorylase; TIGRFAM: thiamine-phosphate
FT                   pyrophosphorylase; PFAM: thiamine monophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66656"
FT                   /db_xref="GOA:A0A0H3AZW0"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZW0"
FT                   /protein_id="ACA66656.1"
FT                   /translation="MSQLDALSPVATPGFPSTEQRLGLYPVVDSLLWIERLLAAGVTTL
FT                   QLRIKNADDAQVEQDIVAAIELGKRYQARLFINDYWQLAVKHGAYGVHLGQEDLETADL
FT                   AAIQQAGLRLGISTHDEHELAVAKTLRPSYIALGHIFPTQTKQMPSSPQGLASLSRQVK
FT                   NTPDYPTVAIGGISIERVPHVLATGVGSVAVVSAITLASDWQRATAQLLHLIEGKELAD
FT                   EK"
FT   gene            complement(371987..374032)
FT                   /locus_tag="YPK_0347"
FT   CDS_pept        complement(371987..374032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0347"
FT                   /product="thiamine biosynthesis protein ThiC"
FT                   /note="PFAM: thiamine biosynthesis protein ThiC; KEGG:
FT                   ypm:YP_3102 thiamine biosynthesis protein ThiC"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66657"
FT                   /db_xref="GOA:A0A0H3B0M0"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR025747"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B0M0"
FT                   /protein_id="ACA66657.1"
FT                   /translation="MSNNTTSLPAENSSHPRKGTPIRKKQREEAQQFINTLQGVTFPNS
FT                   QRIYLQGSRPDIQVPMREIQLSPTQIGGSKNEPRYEDNEAIPVYDTSGPYGDPQAKLDV
FT                   HNGLPKLRAAWVADRQDTEALASVSSGFTQQRLADEGLDHLRFEHLPRPRKAATGQCVT
FT                   QLHYARQGKITPEMEFIALRENMGRERIRGEVLLQQHPGQAFGAHLPENITAEFVRQEV
FT                   AAGRAIIPANINHPESEPMIIGRNFLVKVNANIGNSAVTSSIEEEVEKLVWSTRWGADT
FT                   VMDLSTGRYIHETREWILRNSPVPIGTVPIYQALEKVNGVAENLTWEMFRDTLLEQAEQ
FT                   GVDYFTLHAGVLLRYVPMTAKRLTGIVSRGGSIMAKWCLSHHQENFLYQHFREICQICA
FT                   AYDVSLSLGDGLRPGSIQDANDEAQFAELHTLGELTKIAWEYDVQVMIEGPGHVPMQMI
FT                   RRNMTEELEHCHEAPFYTLGPLTTDIAPGYDHFTSGIGAAMIGWFGCSMLCYVTPKEHL
FT                   GLPNKEDVKQGLITYKIAAHAADLAKGHPGAQIRDNAMSKARFEFRWEDQFNLALDPAT
FT                   ARAYHDETLPQESGKVAHFCSMCGPKFCSMKISQEVRDYAAAQEQAAAQAQAATPTTAA
FT                   QPIDITQPINMLQSGMEKMSAEFRSRGSELYHRPANLSAEANNEPT"
FT   gene            complement(374407..374916)
FT                   /locus_tag="YPK_0348"
FT   CDS_pept        complement(374407..374916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0348"
FT                   /product="regulator of RpoD, Rsd/AlgQ"
FT                   /note="PFAM: regulator of RNA polymerase sigma(70) subunit
FT                   Rsd/AlgQ; KEGG: ypi:YpsIP31758_3852 regulator of sigma D"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66658"
FT                   /db_xref="GOA:B1JJK7"
FT                   /db_xref="InterPro:IPR007448"
FT                   /db_xref="InterPro:IPR023785"
FT                   /db_xref="InterPro:IPR038309"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JJK7"
FT                   /protein_id="ACA66658.1"
FT                   /translation="MLNRLESLTQRVGGSNELIDQWLHARKELLVSYCTVIGIKPQKEK
FT                   HTPLNAKTLENFCHNLVDYLSSGHFHIYDRIIKEVEGASSPKMALTAKIHPALKNNTQT
FT                   IMAFHDRYTNIEIDDDSCTEYQQALSDIGEALDARFKLEDQLIQWAAESWQAAQLADAD
FT                   KKSQVN"
FT   gene            375013..375795
FT                   /locus_tag="YPK_0349"
FT   CDS_pept        375013..375795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0349"
FT                   /product="NAD(+) diphosphatase"
FT                   /EC_number="3.6.1.22"
FT                   /note="PFAM: NUDIX hydrolase; NADH pyrophosphatase-like ;
FT                   Zinc ribbon NADH pyrophosphatase; KEGG: ypi:YpsIP31758_3851
FT                   hydrolase, NUDIX family"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66659"
FT                   /db_xref="GOA:B1JJK8"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015376"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR022925"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JJK8"
FT                   /protein_id="ACA66659.1"
FT                   /translation="MELQLTGKESGWWIVSHENKLWLPKGELPQGNAANWSLQGATARQ
FT                   IGEWQGQPVWLIRQMMPSGMGSVRQLLDVDRGLFQLAGRGVQLAEFYRSHRFCGYCGHE
FT                   MHASRTEWASLCNHCRERYYPQIAPCVIVAIRRGDEILLAQHVRHRGGINTVLAGFVEV
FT                   GETLEQAVSREVLEESNIHIKNLRYVTSQPWPFPHSLMMAFMADYDSGELCHDPKELLN
FT                   AGWYRYDQLPLLPPPGTVARRLIEDTVVLCREHSDLSQ"
FT   gene            375888..376673
FT                   /locus_tag="YPK_0350"
FT   CDS_pept        375888..376673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0350"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ypi:YpsIP31758_3850 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66660"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZB8"
FT                   /protein_id="ACA66660.1"
FT                   /translation="MRPIITQTVQPVTSMYPSLPKAFIQDKVMLSLHNKAALDSTIKGD
FT                   AVRALLLHAYVDIKGNEVERRTTAVGIQKLYEEVLQELLYQDPKCISVMISHTANPPTP
FT                   LSIASPERVMQMMHQNIRQDIASQKTITDRTQTLHNLLSYKNQFQYKAIYDQPRLKPEE
FT                   NYNFKMVNDVHENLHSIQTDSCCKAGALTGATYFLQDSPGEIHVFGIRITQANEESGKV
FT                   ELFQGLKSDVQTNNKLDSLYLLLRGNSHQSPDDISSSVG"
FT   gene            376792..377859
FT                   /locus_tag="YPK_0351"
FT   CDS_pept        376792..377859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0351"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /note="KEGG: ypm:YP_3097 uroporphyrinogen decarboxylase;
FT                   TIGRFAM: uroporphyrinogen decarboxylase; PFAM:
FT                   Uroporphyrinogen decarboxylase (URO-D)"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66661"
FT                   /db_xref="GOA:B1JJL0"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JJL0"
FT                   /protein_id="ACA66661.1"
FT                   /translation="MNELKNDRYLRALLRQPVDMTPVWMMRQAGRYLPEYKATRAIAGD
FT                   FMSLCKNAELACEVTMQPLRRYPLDAAILFSDILTIPDAMGLGLYFETGEGPRFQSPIT
FT                   CRADVEKLPIPDPEQELGYVMNAVRTIRRELAGSVPLIGFSGSPWTLATYMVEGGSSKA
FT                   FTKLKKMMYAEPQTLHLLLDKLADSVILYLNAQIKAGAQSVMIFDTWGGVLTGRDYHEF
FT                   SLNYMHKIVDGLIRENEGRRVPVTLFTKGGGPWLEAMAATGCDALGLDWTTDIADARRR
FT                   VGDKVALQGNMDPSVLYAPPARIEQEVSTILASFGQGEGHVFNLGHGIHQDVPPAHAGA
FT                   FVNAVHALSRPYHQK"
FT   gene            377889..378629
FT                   /locus_tag="YPK_0352"
FT   CDS_pept        377889..378629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0352"
FT                   /product="Deoxyribonuclease V"
FT                   /EC_number="3.1.21.7"
FT                   /note="PFAM: Endonuclease V; KEGG: ypm:YP_3096 endonuclease
FT                   V (deoxyinosine 3'endoduclease)"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66662"
FT                   /db_xref="GOA:A0A0H3AX67"
FT                   /db_xref="InterPro:IPR007581"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AX67"
FT                   /protein_id="ACA66662.1"
FT                   /translation="MVKTKSRVETKSMFDTKALQAEQRQRASEISLHDGIDNQSVRFIA
FT                   GADVGFEQHGEITRAAIAILRYPSLALVEYQVARVATSLPYIPGLLSFREYPALLAAWA
FT                   QLQQRPDLILVDGQGIAHPRRLGVASHFGLLVDVPTIGVAKSRLCGDFLPLHQDVGAVQ
FT                   PLFDNDEQLGWVWRSKIRCNPLFISPGHRVSVGSALAWVQRCMAGYRLPEPTRWADAIA
FT                   SNRPQFQRWLRKNPDFLGKRRDMI"
FT   gene            378675..379265
FT                   /locus_tag="YPK_0353"
FT   CDS_pept        378675..379265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0353"
FT                   /product="protein of unknown function DUF416"
FT                   /note="PFAM: protein of unknown function DUF416; KEGG:
FT                   ypi:YpsIP31758_3847 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66663"
FT                   /db_xref="InterPro:IPR007338"
FT                   /db_xref="InterPro:IPR023381"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYV4"
FT                   /protein_id="ACA66663.1"
FT                   /translation="MLRNPIHLRLEKLESWQHLTFMACLCERMYPNYQQFCLETGFGDP
FT                   AVYRRILDLIWETLVVKDAKVNFDSQLEKLEEAIPSSDDYAIYGVYPAIDACIALSEAI
FT                   HSRLSGETLEHAIAISEASIRTVAMLEMTLAGKEMTDEELKILPAIEEEWDIQWEIFRL
FT                   LADCEERDLDLIKGLRSDLREAAVSNIGINLTQ"
FT   gene            379454..379729
FT                   /locus_tag="YPK_0354"
FT   CDS_pept        379454..379729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0354"
FT                   /product="histone family protein DNA-binding protein"
FT                   /note="PFAM: histone family protein DNA-binding protein;
FT                   KEGG: ypm:YP_3094 DNA-binding protein HU-alpha"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66664"
FT                   /db_xref="GOA:A0A0H3AZW6"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZW6"
FT                   /protein_id="ACA66664.1"
FT                   /translation="MNKTQLIDVIADKADLSKVQAKAALESTLAAITESLKEGDPVQLV
FT                   GFGTFKVNHRNERTGRNPQTGKEIKIAAANVPAFVSGKALKDAVKS"
FT   gene            379779..380432
FT                   /locus_tag="YPK_0355"
FT   CDS_pept        379779..380432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0355"
FT                   /product="protein of unknown function DUF1481"
FT                   /note="PFAM: protein of unknown function DUF1481; KEGG:
FT                   ypi:YpsIP31758_3845 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66665"
FT                   /db_xref="InterPro:IPR010858"
FT                   /db_xref="InterPro:IPR016500"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B0M6"
FT                   /protein_id="ACA66665.1"
FT                   /translation="MRRVLITFGLTLGLSACSSLSDPPQFSASGYIADSGVVRLWRQDN
FT                   AQQQPQVLMSVYSPYFGGNTRVTFYEYQNGILREIRRNDLGATPQSVQLRFDEQGQVSF
FT                   MQRQLASRRESLSADDIAVYQLEAKRILELSRVLRAGDVRLIQGRWQDGMLTTCAGKTL
FT                   RLNLDDNSQAWLTTRGEKNTQPLGVAWLDSSEGQQLLLVANQDFCRWEPQAGSL"
FT   sig_peptide     379779..379844
FT                   /locus_tag="YPK_0355"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.963 at
FT                   residue 22"
FT   gene            complement(380599..381885)
FT                   /locus_tag="YPK_0356"
FT   CDS_pept        complement(380599..381885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0356"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="KEGG: yps:YPTB0299 phosphoribosylamine--glycine
FT                   ligase; TIGRFAM: phosphoribosylamine--glycine ligase; PFAM:
FT                   phosphoribosylglycinamide synthetase; protein of unknown
FT                   function DUF201"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66666"
FT                   /db_xref="GOA:A0A0H3AZC3"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZC3"
FT                   /protein_id="ACA66666.1"
FT                   /translation="MNILIIGNGGREHALGWKAAQSPLADKIYVAPGNAGTALEPTLEN
FT                   VDIAATDIAGLLAFAQSHDIGLTIVGPEAPLVIGVVDAFRAAGLAIFGPTQAAAQLEGS
FT                   KAFTKDFLARHNIPSAEYQNFTDVEAALAYVRQKGAPIVIKADGLAAGKGVIVAMTLEE
FT                   AETAVNDMLAGNAFGDAGHRIVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDGD
FT                   TGPNTGGMGAYSPAPVVTDDVHQRVMDQVIWPTVRGMAAEGNIYTGFLYAGLMISADGQ
FT                   PKVIEFNCRFGDPETQPIMLRMRSDLVELCLAGTQGKLNEKTSDWDERPSLGVVLAAGG
FT                   YPADYRQGDVIHGLPQQEVKDGKVFHAGTKLNGNHEVVTNGGRVLCVTALGETVAQAQQ
FT                   YAYQLAEGIQWEGVFCRKDIGYRAIARGK"
FT   gene            complement(381945..383534)
FT                   /locus_tag="YPK_0357"
FT   CDS_pept        complement(381945..383534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0357"
FT                   /product="phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase"
FT                   /EC_number="2.1.2.3"
FT                   /note="KEGG: yps:YPTB0300
FT                   phosphoribosylaminoimidazolecarboxamide formyltransferase;
FT                   TIGRFAM: phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase; PFAM: MGS domain
FT                   protein; AICARFT/IMPCHase bienzyme formylation region"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66667"
FT                   /db_xref="GOA:B1JJL6"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JJL6"
FT                   /protein_id="ACA66667.1"
FT                   /translation="MQQRRPIRRALLSVSDKAGIIEFAQALSQRGIELLSTGGTARLLA
FT                   DAGLPVTEVSDYTGFPEMMDGRVKTLHPKVHGGILGRRGQDDGIMAQHGIQPIDIVVVN
FT                   LYPFAQTVARPDCSLEDAVENIDIGGPTMVRSAAKNHKDVAIVVKSSDYPAIITELDNN
FT                   DGSLTYPTRFNLAIKAFEHTAAYDSMIANYFGTLVPPYHGDTEQPSGHFPRTLNLNYIK
FT                   KQDMRYGENSHQQAAFYIEEDVKEASVATAQQLQGKALSYNNIADTDAALECVKEFSEP
FT                   ACVIVKHANPCGVAIGDSILAAYERAYQTDPTSAFGGIIAFNRELDAATANAIISRQFV
FT                   EVIIAPTVSSDALALLAAKQNVRVLTCGQWQARSAGLDFKRVNGGLLVQERDLGMVTAA
FT                   DLRVVSKRQPTEQELRDALFCWKVAKFVKSNAIVYARDNMTIGIGAGQMSRVYSAKIAG
FT                   IKAADEGLEVAGSAMASDAFFPFRDGIDAAAAVGITCVIQPGGSIRDDEVIAAADEHGI
FT                   AMIFTDMRHFRH"
FT   gene            383945..384064
FT                   /locus_tag="YPK_0358"
FT   CDS_pept        383945..384064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0358"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66668"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AX71"
FT                   /protein_id="ACA66668.1"
FT                   /translation="MRTSRYQPSVANALLFNNLSDNLCGHSQDDIDACFGRQK"
FT   gene            384200..385734
FT                   /locus_tag="YPK_R0087"
FT   rRNA            384200..385734
FT                   /locus_tag="YPK_R0087"
FT                   /product="16S ribosomal RNA"
FT   gene            385872..385947
FT                   /locus_tag="YPK_R0009"
FT                   /note="tRNA-Glu1"
FT   tRNA            385872..385947
FT                   /locus_tag="YPK_R0009"
FT                   /product="tRNA-Glu"
FT   gene            386199..389105
FT                   /locus_tag="YPK_R0094"
FT   rRNA            386199..389105
FT                   /locus_tag="YPK_R0094"
FT                   /product="23S ribosomal RNA"
FT   gene            389351..389426
FT                   /locus_tag="YPK_R0010"
FT                   /note="tRNA-Thr3"
FT   tRNA            389351..389426
FT                   /locus_tag="YPK_R0010"
FT                   /product="tRNA-Thr"
FT   gene            complement(389982..390254)
FT                   /locus_tag="YPK_0362"
FT   CDS_pept        complement(389982..390254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0362"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66669"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYV6"
FT                   /protein_id="ACA66669.1"
FT                   /translation="MKSRANCNNLKMFHRGSEFITVSLYKAGKGALENSFKLLIVYNVA
FT                   YRIYCLGKAINFRTLISINTSIRCLLNSLNFKLISDIFIGIILPI"
FT   gene            390322..391251
FT                   /locus_tag="YPK_0363"
FT   CDS_pept        390322..391251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0363"
FT                   /product="Homoserine O-succinyltransferase"
FT                   /EC_number="2.3.1.46"
FT                   /note="PFAM: homoserine O-succinyltransferase; KEGG:
FT                   ypi:YpsIP31758_0292 homoserine O-succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66670"
FT                   /db_xref="GOA:B1JJL9"
FT                   /db_xref="InterPro:IPR005697"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033752"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JJL9"
FT                   /protein_id="ACA66670.1"
FT                   /translation="MPIRVPDELPAVSFLRNENVFVMASSRAKTQEIRPLKVLILNLMP
FT                   KKIETENQFLRLLSNSPLQVDIQLLRVDSRESKNTPTEHLNNFYCDFEDIQDQNFDGLI
FT                   VTGAPLGLVDFCDVAYWPQIERIIAWAKEHVTSTLFVCWAVQAALNILYGIPKMTREVK
FT                   LSGIYQHQTLEPLALLTRGFDETFLAPHSRYADFPVEVLQQYTDLDILVSSEEAGAYLF
FT                   ASKDKRVAFVTGHPEYDVDTLAGEYQRDLAAGLNPQVPLNYFPSDDASLRPKASWRSHG
FT                   HLLFANWLNYYVYQITPFDLRHMNPTLD"
FT   gene            391672..393270
FT                   /locus_tag="YPK_0364"
FT   CDS_pept        391672..393270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0364"
FT                   /product="malate synthase A"
FT                   /EC_number="2.3.3.9"
FT                   /note="KEGG: ypi:YpsIP31758_0294 malate synthase A;
FT                   TIGRFAM: malate synthase A; PFAM: malate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66671"
FT                   /db_xref="GOA:A0A0H3AZX0"
FT                   /db_xref="InterPro:IPR001465"
FT                   /db_xref="InterPro:IPR006252"
FT                   /db_xref="InterPro:IPR011076"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZX0"
FT                   /protein_id="ACA66671.1"
FT                   /translation="MRQQLAGTELVFTQPFNAAERQVLPDKAIEFLTELVVKFSESRNK
FT                   LLATRASWQQTIDQGALPDFILETNSIRDGDWKIQGIPADLRDRRVEITGPVERKMVIN
FT                   ALNANVKVFMADFEDSLAPSWDKVIDGQINLHDAVKGTISYTNESGKVYQLKPNPAVLI
FT                   ARVRGLHLPEKHVKWQDEAIPGGLFDFALYFYHNYQQLLAKGSGPYFYLPKMQSYQEAA
FT                   WWSDVFNFTEQRFGLSQGTIKATVLIETLPAVFQMDEILYHLRHHIVGLNCGRWDYIFS
FT                   YIKTLKNHPDRVLPDRQSVTMNKPFLSAYSRLLIKTCHKRGALAMGGMAAFIPDKDAEK
FT                   NKLVLDKVRADKELEASNGHDGTWVAHPGLADTVMDVFNKVLGSRPNQLEVSREQDKPI
FT                   TAAELLEPCSGERTEAGMRANIRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIW
FT                   QWIHHQKSLSNGQTVTKELFRSMLSEEIQVVKLELGAERFDRGRFEEAARLMERITTQD
FT                   ELIDFLTLPGYALLA"
FT   gene            393317..394624
FT                   /locus_tag="YPK_0365"
FT   CDS_pept        393317..394624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0365"
FT                   /product="isocitrate lyase"
FT                   /note="TIGRFAM: isocitrate lyase; PFAM: isocitrate lyase
FT                   and phosphorylmutase; KEGG: ypi:YpsIP31758_0295 isocitrate
FT                   lyase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66672"
FT                   /db_xref="GOA:A0A0H3B0N0"
FT                   /db_xref="InterPro:IPR006254"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B0N0"
FT                   /protein_id="ACA66672.1"
FT                   /translation="MTISRTQQIQQLEQEWTSPRWKNITRPYSAEDVIKLRGSVNPECT
FT                   FAQNGAKKLWELLHGGSRKGYINCLGALTGGQALQQAKAGVEAIYLSGWQVAADANTAS
FT                   SMYPDQSLYPVDSVPAVVKRINNSFRRADQIQWSNNIEPGSKGYTDYFLPIVADAEAGF
FT                   GGVLNAFELMKAMIEAGAAGVHFEDQLAAVKKCGHMGGKVLVPTQEAIQKLVAARLAAD
FT                   VLGVPTLLIARTDADAADLLTSDCDPYDREFITGDRTAEGFFRTRAGIEQAISRGLAYA
FT                   PYADLVWCETSTPDLALAKRFADAVHAQFPGKLLAYNCSPSFNWKKNLTDQQIASFQDE
FT                   LSAMGYKYQFITLAGIHSMWFNMFDLAHAYAQGEGMKHYVEKVQQPEFASVDRGYTFAS
FT                   HQQEVGTGYFDKVTNIIQGGASSVTALTGSTEEQQF"
FT   gene            394769..396607
FT                   /locus_tag="YPK_0366"
FT   CDS_pept        394769..396607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0366"
FT                   /product="(Isocitrate dehydrogenase (NADP(+))) kinase"
FT                   /EC_number="2.7.11.5"
FT                   /note="PFAM: Isocitrate dehydrogenase kinasephosphatase;
FT                   KEGG: yps:YPTB3655 bifunctional isocitrate dehydrogenase
FT                   kinase/phosphatase protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66673"
FT                   /db_xref="GOA:A0A0H3AZC6"
FT                   /db_xref="InterPro:IPR010452"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZC6"
FT                   /protein_id="ACA66673.1"
FT                   /translation="MDVFTASLRSACSLRRGHFVNNLSLLMQAPFCTVGGSMVAKLEQL
FT                   IAQTILQGFDAQYGRFLEVTAGAQHRFEQADWHAVQQAMKKRIHLYDHHVGLVVEQLKY
FT                   ITDQRHFDVEFLARVKEIYTGLLPDYPRFEIAESFFNSVYCRLFKHRDLTPDKLFVFSS
FT                   QPERRFREIPRPLARDFIPKGDLSGMLQMVLNDLSLRLPWENLSRDIDYIVMAIRQAFT
FT                   DEQLASAHFQIANELFYRNKAAWLVGKLRLNGDIYPFLLPIHHNESGELFIDTCLTSKA
FT                   EASIVFGFARSYFMVYVPLPAAMVEWLREILPGKSTAELYTAIGCQKHGKTESYREYLA
FT                   FIHQSSEQFIIAPGVKGMVMLVFTLPSFDRVFKVIKDQFAPQKEVTQARVLECYQLVKE
FT                   HDRVGRMADTQEYENFVIDKHRISPELLAELQHEVPEKLEDLGDKIVIKHLYMERRMTP
FT                   LNLYMEQADDQQLKDAIEEYGNAIKQLAAANIFPGDMLFKNFGVTRHGRVVFYDYDEIC
FT                   YMTEVNFRDIPPPRYPEDEMASEPWYSVSPNDVFPEEFRHFLCSDRKVRHFFEEMHGDL
FT                   FQASYWRGLQQRIRDGHVEDVFAYRRKQRFSQRALN"
FT   gene            complement(396727..397569)
FT                   /locus_tag="YPK_0367"
FT   CDS_pept        complement(396727..397569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0367"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; KEGG: ypm:YP_3085 transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66674"
FT                   /db_xref="GOA:A0A0H3AX75"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AX75"
FT                   /protein_id="ACA66674.1"
FT                   /translation="MALPIPIKRGKKPKAATQNTPAATGQVQSLTRGLKLLEYISESDG
FT                   NVALTDLAQQAGLPNSTTHRLLTTMQQQGFVRQVGDLGLWTMGAHAFIVGSSFLQSRNL
FT                   LAMVHPMLRRLMDESGETVNLAVLDHSDYQAIIIDQVQCTALMRMSAPIGGKLPMHASG
FT                   AGKAFLSTLPDDQLVQLLHKKGLHAYTQHTRTNPTSLKENLALIRKQGYSFDDEEHALG
FT                   LRCIAACLFDEHHEAFAAISISGPISRITDDRVTELGALVIHAAKEITQSYGGGTGVK"
FT   gene            397784..401479
FT                   /locus_tag="YPK_0368"
FT   CDS_pept        397784..401479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0368"
FT                   /product="methionine synthase"
FT                   /note="TIGRFAM: methionine synthase; PFAM: dihydropteroate
FT                   synthase DHPS; homocysteine S-methyltransferase; Methionine
FT                   synthase B12-binding module cap domain protein; Vitamin B12
FT                   dependent methionine synthase activation region; cobalamin
FT                   B12-binding domain protein; KEGG: yps:YPTB3653
FT                   B12-dependent methionine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66675"
FT                   /db_xref="GOA:A0A0H3AYW1"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR033706"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYW1"
FT                   /protein_id="ACA66675.1"
FT                   /translation="MVDTVIDNKVKELHQQLAQRILVLDGGMGTMIQSYRLEEADYRGA
FT                   RFADWASDLKGNNDLLVLSKPEVITTIHNAYLEAGADILETNTFNSTSIAMADYQMASL
FT                   SAEINYEAARLARICADEWSARTPEKPRYVAGVLGPTNRTASISPKVNDPAFRNVSFDQ
FT                   LVEAYRESTRALIEGGVDLIMIETVFDTLNAKAATFAVESEFEAMGVLLPVMISGTITD
FT                   ASGRTLSGQTTEAFYNSLRHVKPLSFGLNCALGPDELRQYVAELSRISEYYVSAHPNAG
FT                   LPNAFGEYDLEAKEMAEQIGEWARAGFLNIVGGCCGTTPRHIAAMVNAVAGVPPRPLPD
FT                   IPVACRLAGLEPLTIDANTLFVNVGERTNVTGSARFKRLIKEEKYGEALDVARQQVESG
FT                   AQIIDINMDEGMLDAEAAMVRFLNLIAGEPDIARVPIMIDSSRWDVIEKGLKCIQGKGI
FT                   VNSISMKEGVDAFIHHAKLVRRYGAAMVVMAFDETGQADTRARKIEICRRAYKILTETV
FT                   GFPPEDIIFDPNIFAVATGIEEHNNYAVDFIEACADIKAELPHALISGGVSNVSFSFRG
FT                   NDPVREAIHAVFLYYAIRNGMDMGIVNAGQLAIYDDLSDELRDAVEDVILNRRDDSTER
FT                   LLDLAEKYRDSKSGEVAIQQAEWRGWPVVKRLEYSLVKGITEFIELDTEEARQQADRPI
FT                   EVIEGPLMSGMNVVGDLFGEGKMFLPQVVKSARVMKQAVAYLEPYIEASKQKGTTAGKI
FT                   LLATVKGDVHDIGKNIVGVVLQCNNYEIIDLGVMVPTEKILRTAREEKVDIIGLSGLIT
FT                   PSLDEMVNVAKEMERQGFTLPLLIGGATTSKAHTAVKIEQNYSGSTTYVSNASRSVGVV
FT                   SALLSDTQREAFVAKTRKEYETVRIQHARKKPRTPPVSLQAARNNPTVIDWENYTPPVA
FT                   HKLGVQVVEASIETLRNYIDWTPFFMTWSLAGKYPRILEDEVVGEEAKRLLADANALLD
FT                   KLSAEDLLHPKGVVGLFPANSVGDDIEIYRDERRDEVLAISYHLRQQTEKTDFPNYCLA
FT                   DYVAPKSSGKADYFGAFAVTGGLEEDALADAYDAQHDDYNKIMIKALSDRLAEAFAEYL
FT                   HERVRKVYWGFAPNENLSNEELVRENYQGIRPAPGYPACPEHTEKGQIWQLLDVETHTG
FT                   MKLTESYAMWPGASVSGWYFSHPDSKYFAIAQIQRDQVEDYAARKGMPTAEVERWLAPN
FT                   LGYDAD"
FT   gene            complement(401575..402360)
FT                   /locus_tag="YPK_0369"
FT   CDS_pept        complement(401575..402360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0369"
FT                   /product="hemolysin"
FT                   /note="KEGG: yps:YPTB3652 hemolysin"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66676"
FT                   /db_xref="InterPro:IPR025157"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZX3"
FT                   /protein_id="ACA66676.1"
FT                   /translation="MAGAVLQANQISGQIGGDLNVISRENRLNKVNVSAALGGSHSNAK
FT                   QDSLISQVANASPIMSDKIKNKLEEKSTKIFDKVENKFNTLGKEKDDSVQTISYTKDGQ
FT                   TVKISEADEKKETKDKWWQKGAKSVGKKIKSAVQDEQVVGGNGSVKANVEVVESQGVEE
FT                   QSAIRGTQNVDLTVKGKTDLVGGKISSKNSDVKLKTNGLETQDINGKYTEGGARLNASS
FT                   SVMDMISDGAKDVMDGKAPLVSGHGKSEQKNATGGITRE"
FT   gene            complement(402371..404834)
FT                   /pseudo
FT                   /locus_tag="YPK_0370"
FT                   /note="Hemolysin activator HlyB domain protein"
FT   gene            complement(405295..406680)
FT                   /locus_tag="YPK_0372"
FT   CDS_pept        complement(405295..406680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0372"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /note="KEGG: ypi:YpsIP31758_0301 asparate kinase,
FT                   monofunctional class; TIGRFAM: aspartate kinase; aspartate
FT                   kinase, monofunctional class; PFAM:
FT                   aspartate/glutamate/uridylate kinase; amino acid-binding
FT                   ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66677"
FT                   /db_xref="GOA:A0A0H3B0N3"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041745"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B0N3"
FT                   /protein_id="ACA66677.1"
FT                   /translation="MIQVAPQQTRDAPSATVVAKFGGTSVASFDAMSRSADVVLSNPDV
FT                   RLVILSASAGITNLLVALADGSEPEKRADHLEEIRHIQYDIIARLTDSTVIREEIDRML
FT                   ENIAMLSEAASLATSPALTDELVSHGELMSTLLFVELLRQRQVAVEWFDVRKVMRTNDR
FT                   FGRAEPDTSALAKLAQTLLAPRIEDAIVVTQGFIGSEGKGRTTTLGRGGSDYTAALLGE
FT                   ALNVSRIDIWTDVPGIYTTDPRVVPAAKRIDKIAFEEAAEMATFGAKILHPATLLPAVR
FT                   SDIPVFVGSSKDPAAGGTLVCNETYNPPLFRALALRRKQTLLTLHSLNMLHARGFLAEV
FT                   FNILARHSISVDLITTSEVSVALTLDTTGSTSTGDSLLTTSLLTELSSLCRVEVEEDLA
FT                   LVAIIGNNLSQACGVGKEVFGVLDPFNIRMICYGASSHNLCFLVPGNDADKVVQTLHYN
FT                   LFE"
FT   gene            407050..408696
FT                   /locus_tag="YPK_0373"
FT   CDS_pept        407050..408696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0373"
FT                   /product="Glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /note="PFAM: phosphoglucose isomerase (PGI); KEGG:
FT                   ypi:YpsIP31758_0302 glucose-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66678"
FT                   /db_xref="GOA:B1JJM7"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JJM7"
FT                   /protein_id="ACA66678.1"
FT                   /translation="MKNINPSQTAAWKALQQHFEQMKDVTISSLFAKDDQRFNRFSATF
FT                   DDQMLVDFSKNRITSETLEKLQDLAKETDLAGAIKSMFSGEKINRTEDRAVLHIALRNR
FT                   SNTPIVVDGKDVMPEVNAVLAKMKQFCDRVISGDWKGYTGKAITDVVNIGIGGSDLGPY
FT                   MVTEALRPYKNHLNMHFVSNVDGTHIAEALKPLNPETTLFLVASKTFTTQETMTNAHSA
FT                   RDWFLSAAGDPAHVAKHFAALSTNAKAVGEFGIDTNNMFEFWDWVGGRYSLWSAIGLSI
FT                   ALSVGFEHFEQLLSGAHAMDKHFAETPAEKNLPVLLALIGIWYNNFFGAETEAILPYDQ
FT                   YMHRFPAYFQQGNMESNGKYVDRNGHPVDYQTGPIIWGEPGTNGQHAFYQLIHQGTKLI
FT                   PCDFIAPAISHNPLSDHHAKLLSNFFAQTEALAFGKSLEDVEAEFAAAGKTPEQVAHVA
FT                   PFKVFEGNRPTNSILLREITPFSLGALIALYEHKIFTQGVILNIYTFDQWGVELGKQLA
FT                   NRILPELADDQEVTSHDSSTNALINRFKNWR"
FT   gene            complement(408693..408809)
FT                   /locus_tag="YPK_0374"
FT   CDS_pept        complement(408693..408809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0374"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66679"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZD0"
FT                   /protein_id="ACA66679.1"
FT                   /translation="MKQPEPIIAMLHSSQKKGPLQNKRPNKVQIKELKSLLA"
FT   gene            408831..409238
FT                   /locus_tag="YPK_0375"
FT   CDS_pept        408831..409238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0375"
FT                   /product="phosphate-starvation-inducible E"
FT                   /note="PFAM: phosphate-starvation-inducible E; KEGG:
FT                   ypi:YpsIP31758_0303 protein PsiE"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66680"
FT                   /db_xref="GOA:B1JJM9"
FT                   /db_xref="InterPro:IPR009315"
FT                   /db_xref="InterPro:IPR020948"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JJM9"
FT                   /protein_id="ACA66680.1"
FT                   /translation="MAKNSRSQWIAKNLQRLLNVGLIMLAAILVVFLVKETIHLGKVLF
FT                   LSNQETSSYMLIEGIVIYFLYFEFIALIVKYFESGYHFPLRYFIYIGITAIIRLIIVDH
FT                   ENPIDTLIYSGSILVLVVTLYLANTERLKRE"
FT   gene            complement(409381..410271)
FT                   /locus_tag="YPK_0376"
FT   CDS_pept        complement(409381..410271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0376"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ypi:YpsIP31758_0304 maltose
FT                   ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66681"
FT                   /db_xref="GOA:A0A0H3AX79"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AX79"
FT                   /protein_id="ACA66681.1"
FT                   /translation="MAMVQPKSQRLRLLGTHFLMLCFIALIMFPLLMVIAISLRPGNFA
FT                   TGSLIPDQISWEHWKLALGMSVTHADGSVTPPPFPVMLWLWNSIKIALITAMGIVALST
FT                   TCAYAFARMRFRGKSALLKGMLIFQMFPAVLSLVALYALFDRIGQYMPFIGLNTHGGVI
FT                   FAYMGGIALHVWTIKGYFETIDNSLEEAAALDGATPWQAFRLVLLPLSVPILAVVFILS
FT                   FIAAITEVPVASLLLRDVNSYTLAVGMQQYLNPQNYLWGDFAAAAVLSAIPITTVFLLA
FT                   QRWLVGGLTAGGVKG"
FT   gene            complement(410285..411862)
FT                   /locus_tag="YPK_0377"
FT   CDS_pept        complement(410285..411862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0377"
FT                   /product="Fructose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ypi:YpsIP31758_0305 maltose
FT                   ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66682"
FT                   /db_xref="GOA:A0A0H3AYW7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR029345"
FT                   /db_xref="InterPro:IPR030156"
FT                   /db_xref="InterPro:IPR035277"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYW7"
FT                   /protein_id="ACA66682.1"
FT                   /translation="MQLSHTELQSRKKKIAWWQSDALKWLVISLLSLFTCYLIVLMYAQ
FT                   GEYLFAIVTLILVSLGLYVFANRRAYAWRYVYPGVAGMGLFVLFPLICTIAIAFTNYSS
FT                   TNQLTFERAQSVLLDRQFQTGKTFTFGLYPSDNQWRLQLTNPDDGSLFISEPFSFEATG
FT                   EQKVMVAPTNTAQTSEPASLRIITQSRQALSGLVAILPDGAELRMSSLRQFSGTKPLYT
FT                   LGADGKELINQQTGVKYWPNPNTGFYQAVNADGQWENEKLSPGFTVSIGWKNFLRVLHD
FT                   EGIQKPFISIFIWTILFSVMSVTFTVAVGMVLACVVQWDSLKGKAIYRVMLILPYAVPS
FT                   FISILIFKGLFNQSFGEINLMLSHLFGIKPAWFSDPITAKSMILIVNTWLGYPYMMILC
FT                   MGLLKAIPDDLYEASAMDGAGPFQNFFRITFPLLIKPLTPLMIASFAFNFNNFVLIQLL
FT                   TNGGPDMIGTSTPAGYTDLLVNYTYRVAFEGEGGQDFGLAAAIATLIFILVGALAILNL
FT                   KASKMNFD"
FT   gene            complement(412049..413260)
FT                   /locus_tag="YPK_0378"
FT   CDS_pept        complement(412049..413260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0378"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: ypi:YpsIP31758_0306 maltose ABC transporter,
FT                   periplasmic maltose-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66683"
FT                   /db_xref="GOA:A0A0H3AZX6"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006060"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZX6"
FT                   /protein_id="ACA66683.1"
FT                   /translation="MTRSFTKSGIGKTARVLALSALTTLVLSSSAFAKIEEGKLVIWIN
FT                   GDKGYNGLAEVGKKFEKDTGIKVTIEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYA
FT                   QSGLLAELTPSKAFQEKLFPFTWDAVRFNGKLIGYPVAVEALSLIYNKDLVKEAPKTWE
FT                   EIPALDKTLRANGKSAIMWNLQEPYFTWPVIAADGGYAFKFENGVYDAKNVGVNNAGAQ
FT                   AGLQFIVDLVKNKHINADTDYSIAEAAFNKGETAMTINGPWAWSNIDKSKINYGVTLLP
FT                   TFHGQPSKPFVGVLTAGINAASPNKELATEFLENYLITDQGLAEVNKDKPLGAVALKSF
FT                   QEQLAKDPRIAATMDNATNGEIMPNIPQMAAFWYATRSAVLNAITGRQTVEAALNDAAT
FT                   RITK"
FT   sig_peptide     complement(413159..413260)
FT                   /locus_tag="YPK_0378"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 34"
FT   gene            413738..414100
FT                   /locus_tag="YPK_0379"
FT   CDS_pept        413738..414100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0379"
FT                   /product="glycosidase"
FT                   /note="KEGG: ypm:YP_3075 glycosidases"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66684"
FT                   /db_xref="GOA:A0A0H3B0N8"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B0N8"
FT                   /protein_id="ACA66684.1"
FT                   /translation="MLSARSIPNPALYRIHPVSFRDGQGNGVGDYRGLNGVYDSLLPCW
FT                   ISMLRRCSTCSPILRPRRRPGQPCHWLGGTARSERVIRALGVINGSCRGLLPLFFFIQI
FT                   HMKSCLRKQRSNAWLM"
FT   gene            414088..415197
FT                   /locus_tag="YPK_0380"
FT   CDS_pept        414088..415197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0380"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; TOBE domain protein;
FT                   Transport-associated OB domain protein; SMART: AAA ATPase;
FT                   KEGG: ypi:YpsIP31758_0308 maltose ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66685"
FT                   /db_xref="GOA:A0A0H3AZD6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR015855"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZD6"
FT                   /protein_id="ACA66685.1"
FT                   /translation="MANVTLSSVYKAFGEAVISRDINLEIDDGEFVVFVGPSGCGKSTL
FT                   LRMIAGLEDITSGELLIGGKRMNEVPPSERGIGMVFQSYALYPHLSVAENMSFGLKLAG
FT                   VKKAEIYQRVNQVAEVLQLAHLLDRRPKALSGGQRQRVAIGRTLVSEPDVFLLDEPLSN
FT                   LDAALRVQMRIEISRLHKRLERTMIYVTHDQVEAMTLADKIVVLDAGNIAQVGKPLELY
FT                   HYPANRFVAGFIGSPKMNFLPVKVTAAEPRQVQIELPNHQRVWLPVEGDQVQVGANMSL
FT                   GIRPEHLLPSSASEVTLEGEIQVVEQLGNETQIHIQIPAIRQNLVYRQNDVVLVEEGAT
FT                   FSIGLPPHRCHLFREDGTACKRLYQELGV"
FT   gene            415268..416539
FT                   /locus_tag="YPK_0381"
FT   CDS_pept        415268..416539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0381"
FT                   /product="porin LamB type"
FT                   /note="PFAM: porin LamB type; KEGG: ypi:YpsIP31758_0309
FT                   maltoporin LamB"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66686"
FT                   /db_xref="GOA:A0A0H3AX81"
FT                   /db_xref="InterPro:IPR003192"
FT                   /db_xref="InterPro:IPR023738"
FT                   /db_xref="InterPro:IPR036998"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AX81"
FT                   /protein_id="ACA66686.1"
FT                   /translation="MITLRKLPIALAVAAGVLSTQAMAVDFHGYARSGIGWTASGGEQQ
FT                   CFQTTGAQSKYRLGNECETYAELKLGQELWKEGDKSFYLDTNVAYSVSQRDDWESTDPA
FT                   FREANVQGKNLIESLPGSTIWAGKRFYQRHDVHMIDFYYWDISGPGAGLETIDLGFGKL
FT                   SVAATRNSESGGSSAWIDNQRENAKYTINNVYDVRLAGLETNPGGSLELGVDYGRADTQ
FT                   EGYSLAPNASKDGVMLTAEHTQSLMGGFNKFVVQYATDSMTSYNTGHSQGTSVNNNGHL
FT                   LRVIDHGAINLAEKWDMMYVALYQDIDLDNNNGNTWYSVGVRPMYKWTPIMSTLLEAGY
FT                   DNVKSQHTGERNGQYKLTLAQQWQAGDSIWSRPAIRVFATYANWDEKWGYSDTTGVAQD
FT                   GTIGTNSRGKNNEVTFGAQFEAWW"
FT   sig_peptide     415268..415342
FT                   /locus_tag="YPK_0381"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 25"
FT   gene            416780..417691
FT                   /locus_tag="YPK_0382"
FT   CDS_pept        416780..417691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0382"
FT                   /product="Maltose operon periplasmic"
FT                   /note="PFAM: Maltose operon periplasmic; KEGG:
FT                   ypp:YPDSF_0190 maltose operon periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66687"
FT                   /db_xref="GOA:A0A0H3AYX1"
FT                   /db_xref="InterPro:IPR010794"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYX1"
FT                   /protein_id="ACA66687.1"
FT                   /translation="MKKNLLSLCLVLALGGTAPLAVQAASTISPANVSIAPTISTTTLQ
FT                   QLPWQPLVPPVTQDIQLTAGSPHISQGEVEGAVAAFALPADRGSLEVTLSSLLTDKQLF
FT                   TPSVLVLDEQMRPAAYYPSSYFTYEKAGIMINDRLQGVMKLTPALGQKQIYLLVYTTRD
FT                   DLKKTTQLLDPAKAYAQGVGNAVPDIPDPIVNHSPTGTLRIKVTSEQGMGNIMIGLIQS
FT                   APTSAPVVVGSSIQPVAAPQSEPAKPAAPMLGETENYFNQAIKDAVKAGDVDKALKLLN
FT                   EAEHLGSTSARKTFIGSVKGKG"
FT   sig_peptide     416780..416854
FT                   /locus_tag="YPK_0382"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.987 at
FT                   residue 25"
FT   gene            418030..418440
FT                   /locus_tag="YPK_0383"
FT   CDS_pept        418030..418440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0383"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ypp:YPDSF_0191 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66688"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZX9"
FT                   /protein_id="ACA66688.1"
FT                   /translation="MSDINKQINHANDSHFFCHSMTLNMTGSSLVVEKNPVGNFLKFAM
FT                   TFPNLLLLFSDGTLIKQVERELKTHLICNNFVKNKSKIVTVYITFGNDALPLIYYSNRV
FT                   FYKNSYIKCGDIACMNYTVNEGYLTTEIILWR"
FT   gene            418431..418649
FT                   /locus_tag="YPK_0384"
FT   CDS_pept        418431..418649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0384"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66689"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B0P2"
FT                   /protein_id="ACA66689.1"
FT                   /translation="MALIYPWRRHIELHSISVKRAMKIKGISGGLNTLKTISKNQQPIT
FT                   SLAAEEIQYYASIGARQSSAPEVPAVV"
FT   gene            complement(418592..419110)
FT                   /locus_tag="YPK_0385"
FT   CDS_pept        complement(418592..419110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0385"
FT                   /product="type VI secretion system effector, Hcp1 family"
FT                   /note="TIGRFAM: type VI secretion system effector, Hcp1
FT                   family; PFAM: protein of unknown function DUF796; KEGG:
FT                   ypi:YpsIP31758_0312 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66690"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZD7"
FT                   /protein_id="ACA66690.1"
FT                   /translation="MPTPAYISITGKTQGNITAGAFTAESVGNIYVQGHEDEMLVQEFE
FT                   HIVTVPTDPQSGQPSGQRAHKPLRFTVAYNKAVPLLYNALASGEMLPTVELKWYRTSIE
FT                   GKQEHFFTTKLEDATIIDIDCKMPHCQDSTKAEFTQLVRVSLAYRKINWDHTTAGTSGA
FT                   DDWRAPIEA"
FT   gene            419634..420131
FT                   /locus_tag="YPK_0386"
FT   CDS_pept        419634..420131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0386"
FT                   /product="type VI secretion protein, VC_A0107 family"
FT                   /note="TIGRFAM: type VI secretion protein, VC_A0107 family;
FT                   PFAM: conserved hypothetical protein; KEGG:
FT                   ypi:YpsIP31758_0313 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66691"
FT                   /db_xref="InterPro:IPR008312"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AX86"
FT                   /protein_id="ACA66691.1"
FT                   /translation="MSKNKQSSVAPKERINIKYVPNTGDQVAEIELPLNLLVVGDLKGV
FT                   REETSIEERQVVSVNKNNFNSVMNEANISLSFNVPNRLEGDGEEDMPVALSIKGLDDFS
FT                   PDNVAKKVPELKKILELREALVALKGPLGNIPAFRSRLQDLLGNEDMREQLLKELDILN
FT                   QK"
FT   gene            420199..421680
FT                   /locus_tag="YPK_0387"
FT   CDS_pept        420199..421680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0387"
FT                   /product="type VI secretion protein, EvpB/VC_A0108 family"
FT                   /note="TIGRFAM: type VI secretion protein, EvpB/VC_A0108
FT                   family; PFAM: protein of unknown function DUF877; KEGG:
FT                   ypi:YpsIP31758_0314 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66692"
FT                   /db_xref="InterPro:IPR010269"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYX5"
FT                   /protein_id="ACA66692.1"
FT                   /translation="MPLHEENTVLAAEPASATFLLDEIMSQTRMAPGNDGYDIAKQGVA
FT                   AFISSILDTGTNEEPINKLLVDRMIIELDKKLSAQMDEILHANEFREIESSWRSLKLLV
FT                   DRTDFRENIKINIMHATKEELLEDFEFSPEIIQSGFYKHVYSSGYGQFGGEPTAAIIGN
FT                   YAFNNSSPDMKLLQYVSAVGAMAHAPFLSSVAPDFFGISSFTELPAIKDLKSVFEGPAH
FT                   TKWRALRESEDSRYLGLTTPRFLLRLPYSTVENPIKNFNYYEDVSRNHEHFLWGNTAFL
FT                   LASCLTDSFAKYRWCPNIIGPQSGGTVHDLPVHLYEAMGQIQAKIPTEVLITDRREFEL
FT                   AEEGFITLTMRKGSDNAAFFSANSVQKPKVFPNTREGKMAETNYKLGTQLPYMFIINRL
FT                   AHYIKVLQREQIGSWKERQDLERELNIWLKQYIADQENPPTDVRSRRPLRSAQIQVLDV
FT                   EGDPGWYQVAMQVRPHFKYMGASFELSLVGRLDKE"
FT   gene            421687..422127
FT                   /locus_tag="YPK_0388"
FT   CDS_pept        421687..422127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0388"
FT                   /product="type VI secretion system lysozyme-related
FT                   protein"
FT                   /note="TIGRFAM: type VI secretion system lysozyme-related
FT                   protein; PFAM: GPW/gp25 family protein; KEGG:
FT                   ypi:YpsIP31758_0315 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66693"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR017737"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZY2"
FT                   /protein_id="ACA66693.1"
FT                   /translation="MAALLNWDRGSSASLFDRIQGKGASSSSDGRLRELLNSIQKHLNE
FT                   VLNSRPGACQSAVDLGVIDLNDATATSSDFRKSIEKAIKDCIENYEPRISAVTVQSLLN
FT                   HGDPLQLSFHISARVNFDDMGDVVEFNIQLDNNRRYCFNQET"
FT   gene            422127..423947
FT                   /locus_tag="YPK_0389"
FT   CDS_pept        422127..423947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0389"
FT                   /product="type VI secretion protein, VC_A0110 family"
FT                   /note="TIGRFAM: type VI secretion protein, VC_A0110 family;
FT                   PFAM: protein of unknown function DUF879; KEGG:
FT                   ypi:YpsIP31758_0316 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66694"
FT                   /db_xref="InterPro:IPR010272"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B0P7"
FT                   /protein_id="ACA66694.1"
FT                   /translation="MSFEKYFRDELDYLRQLGRDAAIERPHLAAFLSEQGSDPDVERLL
FT                   EGFAFLTGNLREKIDDQFPELTHGLLNMLWPNYLRPIPSMTIIEYTPDESVVTEATLVK
FT                   RGSQVMSIPIAQNGQRSAFINSNAHAGPQCTFTLCRDVWLFPMSIREISANSSNEQGIL
FT                   SVHFAAKAELNLQDLQLDKLRFYLGEDNYTSTQLYFWINHYFERAELVVNGITIPMPDF
FT                   DFNPVGFERDDALLPYPKNAYMGYRILQEYFCFPEGFLFFDVNGVVDFPPHLNASEFSL
FT                   NLYFSQALPPDVKVRSTTLRMNCTPAVNLFQHDSEAIDLDGTQTEYPLCVSYHNPDHYD
FT                   IFSVDRVDSWLSEKGAPKGRGRGHGRVYTSFESFHHQIEHSQEKTALYYRLRVKNSLFR
FT                   KGFEHYISFVRSDESKLVLAEENVSVSLTCTNRELPLSLRVGDINQLSTDSPSFATFRN
FT                   ITRPSVPLYPVLDGGLHWSLLSNMSLNYMSLLDKDALKQILHTYDFPSLHNRQSARASQ
FT                   KKLDAIQRIETQPIDRLFRGLPVRGLQTTLWLEQGAFSSEGELYLFSTVLARFFSLYAS
FT                   VNAFHLLKVINLDNQECYEWPVQTGQHALM"
FT   gene            423911..424981
FT                   /locus_tag="YPK_0390"
FT   CDS_pept        423911..424981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0390"
FT                   /product="type VI secretion protein, VC_A0111 family"
FT                   /note="TIGRFAM: type VI secretion protein, VC_A0111 family;
FT                   PFAM: protein of unknown function DUF1305; KEGG:
FT                   yps:YPTB3634 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66695"
FT                   /db_xref="InterPro:IPR010732"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZE2"
FT                   /protein_id="ACA66695.1"
FT                   /translation="MAGTDRSTCTDVSVVEDVSGVEARPEGQALDVSRYNFFQLVELLN
FT                   QLAVAWQGAAPVATPANEAIRFKSTASLAFPTRDVIALDTSARGQFELEVSFLGLHGSQ
FT                   SPLPGYYLDSLAWEDAQNENRLTDFMNVFNHRLLTLLHQIWRKYRYYICFDNGGDDAFS
FT                   QRMFSLVGLGSEVVRNKLQINHSKMLAYAGLLASPGRAPEVICSLVSHCFNLPDITLHS
FT                   WQLRKVDIAPSQQNRLGMRVKVRGKKYDEKSVLGVNFSIGSRVADRSGKFLLCINKLTR
FT                   EQFLSFLPNGANYASLVMFVAFIMRDQFAWDLRLGLAEQQVGGMVLGTEQNSLLGWTSI
FT                   LGDPEQKPSVTIGVME"
FT   gene            425107..426423
FT                   /locus_tag="YPK_0391"
FT   CDS_pept        425107..426423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0391"
FT                   /product="FHA domain containing protein"
FT                   /note="TIGRFAM: type VI secretion system FHA domain
FT                   protein; PFAM: Forkhead-associated protein; KEGG:
FT                   ypi:YpsIP31758_0318 FHA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66696"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR017735"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AX90"
FT                   /protein_id="ACA66696.1"
FT                   /translation="MDKKQPTLSLRVVNSDKLESGKQASSLFHAQGGSVGSDGSHHWSI
FT                   QDQGGNISPSQFAIEWRDGSFCLRLLNGSLNINHSMLTPNSGFVRLQQGDEMTLGNLVI
FT                   KSHISRSAADMIDPLMVSPESLVSSYSNPMDAMMEGEPLASPHHQQDSRLAATVSHNFS
FT                   HDPLRVLETESLTTQGHDAVISDADHSLQQDRYRNPLFSSPLSDTPKDSAMDQAFIDLP
FT                   QISTFLNGKQAGGKPEGLNNQMEQHHVAITPLMRGFDAQLPIRNSQEAHDFLEEAGKTL
FT                   KATIEGLLALQRSQHGLRDKHLRPIEDNPLRLNMDYDTTLNLMFADQKSPVHLSAPAAV
FT                   AESLDNLRLHHQANQQAITQALNTMLEAFSPERLLTRFTHYLRSNERQEQDSAWAWDMY
FT                   KNYYNELASSRQQGFEKLFGEVYEQAYDRALRQGMKDSE"
FT   gene            426423..426968
FT                   /locus_tag="YPK_0392"
FT   CDS_pept        426423..426968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0392"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: ypi:YpsIP31758_0319 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66697"
FT                   /db_xref="InterPro:IPR017734"
FT                   /db_xref="InterPro:IPR038706"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYX8"
FT                   /protein_id="ACA66697.1"
FT                   /translation="MNNARGYLLTWALCVVFLLSGCSGAWEATKKVGKVVMDPDIPVGQ
FT                   AADQPSTVRLTLLSDRDTNPNEKGEAAPTEIVVVYLSENSKLLAADYDQLSSDALEKTL
FT                   GKNYIDHQEYTLLPDQFKALDPIKLEEKNSYLGVIAHYADANRSEWKKIIKIKGIGHNY
FT                   QVLVHVRSNDVDLRKEEE"
FT   sig_peptide     426423..426500
FT                   /locus_tag="YPK_0392"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.746 at
FT                   residue 26"
FT   gene            426971..428317
FT                   /locus_tag="YPK_0393"
FT   CDS_pept        426971..428317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0393"
FT                   /product="type VI secretion protein, VC_A0114 family"
FT                   /note="TIGRFAM: type VI secretion protein, VC_A0114 family;
FT                   PFAM: protein of unknown function DUF876; KEGG:
FT                   ypi:YpsIP31758_0320 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66698"
FT                   /db_xref="InterPro:IPR010263"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZY5"
FT                   /protein_id="ACA66698.1"
FT                   /translation="MPTKNRVIWREGLFIKPQHFQQQQRHNDYQLQRRIIALQGYSYGF
FT                   SSLILNQELLKLGRIGLTVASGNMADGTVFDIPYQDYSPKPLDVLNCNDAASRDIYLAL
FT                   PMLNDAINEVAGQQGQAPGTLRYREHSDDVRDLHTEGGDVSQLVLAQLAPRLMQGSEDL
FT                   SAYSVLPLCRVKEKRPDGSLILDEEFIPTCTTLSVSTQLKGFMDEVEGTLVERAQLLAK
FT                   RIGSPGQQGIADVAEFMMLQVFNRTQPLFTHLAHQAILHPEAFYHQLVQTCGELRTFTD
FT                   ESRLAGTFPVYNHDNLTDSFQPLFLAMRQALSTVLTPRAISIQLHMQAHGIRVATINDS
FT                   DLLRSADFVLAVRAQIPQEQLRRQFVQQTKITSLEKIRDLVSVQLPGVPLVALSAAPRQ
FT                   LPYHSGYTYFMLDLQSPVWKEIQQSNAIAFHVSGDFPDLDMQFWAIRSS"
FT   gene            428317..429084
FT                   /locus_tag="YPK_0394"
FT   CDS_pept        428317..429084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0394"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ypi:YpsIP31758_0321 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66699"
FT                   /db_xref="GOA:A0A0H3B0Q1"
FT                   /db_xref="InterPro:IPR017732"
FT                   /db_xref="InterPro:IPR038522"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B0Q1"
FT                   /protein_id="ACA66699.1"
FT                   /translation="MKTDAVTDNTPFPAAEAVTSHRQYQLPLRGESLNAMIDTATPLLG
FT                   MVLRLKDMENQALPDQLYQQVVTDIRAIEQYLQTKGYEPGAIISFRYVLCTFIDETALG
FT                   HGWNTQNGWLQQSLLVHFHNETWGGEKVYVLLERLMGEPKRYQDLLEFIYLCFCLGYRG
FT                   RYKVTSQNGDDFERLFRRLHHQLQQLRGDAPPTVLYQGGGRLNSRYHLSKRLTIKHLLW
FT                   GGVSLLVVIYLFYAIHLHTQSQDILQQLNNLLS"
FT   gene            429095..431698
FT                   /locus_tag="YPK_0395"
FT   CDS_pept        429095..431698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0395"
FT                   /product="type VI secretion ATPase, ClpV1 family"
FT                   /note="KEGG: ypm:YP_3951 Clp ATPase; TIGRFAM: type VI
FT                   secretion ATPase, ClpV1 family; PFAM: ATPase associated
FT                   with various cellular activities AAA_5; ATPase AAA-2 domain
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66700"
FT                   /db_xref="GOA:A0A0H3AZE5"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR017729"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZE5"
FT                   /protein_id="ACA66700.1"
FT                   /translation="MIQIDLPTLVNRLNPIARHSLEAAAAHCVSQQEAEITVSQVLLQM
FT                   ISTPLCDVRLILSHAGVEEDELRESLDQRVSGYQAITQAYPSFSPLLVEWLQDSWLLAS
FT                   TEMEHSQLRSGVMLLTLLLSPSRYLVPTANRLLSPINRELLRQNFANWTADSAETPRAE
FT                   KGAEAGNGAEINGDSLLARYASNMTEQARNGELDPVLCRDTEIDLMIDILCRRRKNNPI
FT                   VVGEAGVGKSALIEGLALRIVDNQVPEKLRNSELMTLDLGALQAGAAVKGEFEKRFKGI
FT                   MAEIAQSTTPIILFIDEAHTLIGAGNQQGGLDISNLLKPALARGELKTIAATTWSEYKK
FT                   YFEKDAALSRRFQLVKVSEPSAQEATIIMRGLRTVYEQAHGVLIDDEALQAAAVLSDRY
FT                   ISGRQLPDKAIDVLDTAAARVAINLTSAPRQVSALKNELYHQGMEIEMLEREQRLSLSR
FT                   PDERLSVLQQQRIEIEQQLIALNTGWEKQQHLVQQIIALRAVLLAQEESATDEQVVNLT
FT                   ALSDELERLQQHQTLVSPHVDKSQIAAVIAEWTGVPLNRLSQSELAVVTELPSYLGQQI
FT                   KGQETAIHCLHQHLLTARADLRRPGRPMGAFLLVGPSGVGKTETVLQIADLLYGGRQYL
FT                   TTINMSEFQEKHTVSRLIGSPPGYVGYGEGGVLTEAIRQKPYSVVLLDEVEKAHPDVLN
FT                   LFYQAFDKGELADGEGRIIDCKNIVFFLTSNLGYQTIVDHADEPALLNERLYPELSAFF
FT                   KPALLARMEVVPYLSLGMETLQIIIHGKLNRLDTLLRQRFSADVVIEPEVIDEILLRAT
FT                   RAENGARMLESIIDGALLPPVSLLLLQKVAAGTAISHIRIAVEGNVFTAQVEGAI"
FT   gene            431695..432492
FT                   /locus_tag="YPK_0396"
FT   CDS_pept        431695..432492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0396"
FT                   /product="transcriptional regulator, Fis family"
FT                   /note="PFAM: helix-turn-helix Fis-type; KEGG:
FT                   ypi:YpsIP31758_0323 transcriptional regulator, fis family"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66701"
FT                   /db_xref="GOA:A0A0H3AX94"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AX94"
FT                   /protein_id="ACA66701.1"
FT                   /translation="MRQRLKSVLALLDNDSTEQLIHRFLTINHHRQRFSALMVSMFNAS
FT                   EGRLDCYHQPDGGMNVALKLDANIEDVNHPLVRVLRNGFPEVWGSLYQGVRIEDDDFRS
FT                   FIQALPTRCGLYALPLFDVHGHACGVIAVFSENIERFADTRGIFSIYCHIFQHRLNKLQ
FT                   EMDQLRSQFNQIRTVFKEQRQREKQLDELLVSLSTSDTHALPGISQDYSKIDSLTTAVE
FT                   TFECAVLTQRQRLYGNDKSRIAASLGLSLRALTYKLAKYRCQL"
FT   gene            432489..433175
FT                   /locus_tag="YPK_0397"
FT   CDS_pept        432489..433175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0397"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ypi:YpsIP31758_0324 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66702"
FT                   /db_xref="InterPro:IPR017738"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYY5"
FT                   /protein_id="ACA66702.1"
FT                   /translation="MNTWLLISSLLFSGGHTDAFWTMGLTPPVAEKEEAGTLALVMRCR
FT                   SENSALVRLDCYDKALSPVNAVDEKRVNAGPAWQRAMNQEKGRTDHSTAFLVTEGEGSN
FT                   PMVLITTPAIGMPPPRPVLMLSCIDNITRLQIALVGPQKESSVTLIIDKAGIIDKTRLD
FT                   AQWFLRENGYLLESSRGLAGIDEIKRLMSAETLTIEGANGAFPRLTFTLSQLTPALKPL
FT                   RNACHW"
FT   sig_peptide     432489..432548
FT                   /locus_tag="YPK_0397"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.749) with cleavage site probability 0.597 at
FT                   residue 20"
FT   gene            433181..434569
FT                   /locus_tag="YPK_0398"
FT   CDS_pept        433181..434569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0398"
FT                   /product="type VI secretion-associated protein, VC_A0119
FT                   family"
FT                   /note="TIGRFAM: type VI secretion-associated protein,
FT                   VC_A0119 family; PFAM: ImpA domain protein; KEGG: ypk:y0272
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66703"
FT                   /db_xref="InterPro:IPR010657"
FT                   /db_xref="InterPro:IPR017739"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZY7"
FT                   /protein_id="ACA66703.1"
FT                   /translation="MDITSQHPWHVLLQAPLSPEQTAQALADDDPQWEYIDGQMVKLGS
FT                   LAHATLNIDDIQQQAMALLSQKSKDFRLVVHLLRTLQHGGQPDELMLAMSLLTEYVQLF
FT                   WTTAWPQNPLHKRRFAQQILKRFDSASSSFSQRADEAQRENVQGLLAHLAQVWHSREPG
FT                   LAKEVDALRSRYARPPERVIEAVASDEPLSSNTLAAAMATTPVSPSLAIDNTSDRAWRQ
FT                   TLLKMADLLSEQQPDAAIGFRLRRHAVWGALTAPPMAQSDGRTPLAAVSADRTADYLAR
FT                   LANADLPLWHQVEQSLTLAPYWLDGHVLSAQIALQLGYDAVAQAIRDELSVFLARIPAL
FT                   KTLFFTDMTPFLSSESAAWLQQDANHQGRSRTIEQDEIWQCYQQQGLEAALQMINRQPQ
FT                   QSEPRDRFYHQLLSAQLFEKAGLTALAQQHYHSLLLVGQQLQLSEWEPALIALLTEKQR
FT                   QLKP"
FT   gene            434601..438134
FT                   /locus_tag="YPK_0399"
FT   CDS_pept        434601..438134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0399"
FT                   /product="type VI secretion protein IcmF"
FT                   /note="TIGRFAM: type VI secretion protein IcmF; PFAM: ImcF
FT                   domain protein; protein of unknown function DUF1215; KEGG:
FT                   ypi:YpsIP31758_0326 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66704"
FT                   /db_xref="GOA:A0A0H3B0Q6"
FT                   /db_xref="InterPro:IPR009612"
FT                   /db_xref="InterPro:IPR010623"
FT                   /db_xref="InterPro:IPR017731"
FT                   /db_xref="InterPro:IPR025743"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B0Q6"
FT                   /protein_id="ACA66704.1"
FT                   /translation="MKLPFFIRIAKPAIPRLKASIPVVLALMACAALIWVWIYGPEWQL
FT                   GENYPFETLLSRWLVTAVFVLVAVCWLSLKVMRRVQHLEKLQLQTKIQLDDPVSADIEQ
FT                   QNHYLNGWKHQLQRHLNTPEYLYHLPWYMVIGARNSGKSTLIKEGYKLTEISASERLHV
FT                   EGAADLRVRCWLGEQAVIIDPAGVLIEQPTTPIAGKASLNSRLWQSLLSWLIEQRQRQP
FT                   LNGIILTVDLHQMMTANKAQRETYVADIHQRLQEIRLSLHSQVPLYVVFTKMDLLYGFE
FT                   AMYQSLDKAEREAVLGVTFSLNAADPDVWRTELKQFWQQWVAQLNGAMPDMMLNSVDAG
FT                   QRSQLFSFTRQMQGLHDYVVQLLEGILYRGEHAQPLLRGVYLTSAQQRGQMDDIFTQSA
FT                   AVQYHLAPQAFPTWPVSDTTPYFTKALFNQVLLAEPNLAGENGIWLQKTRKRMFIFSGV
FT                   GALAALTLWGYWHYYHQLNYRAGEEVLTQAKTFLSIPPPEGDDRYGNLQLPLLNPIRDA
FT                   TLAYGNYHERSPFLADMGLYQGNNIGPYVESTYLQLLQQRFVPALMSGLLEQLNAAPKG
FT                   SEEKLEILRVMRMLEDGSGRNAALVEQYMSHRWSQQFNGQRELQEQLSSHLNYALKHTD
FT                   WHGARESGDQYAIKSFVPYLSPIQSAQQELSKLSIYQRVYQNLRIKAQDALPPALDLRD
FT                   QIGASFDDIFVSGNDRLLVIPQFLTRSGLQSYFIKQNDQLVDLTVMDSWVLNLTKNVEY
FT                   SEADRKEIHRQVTEQYLGDYTATWRAAMNNLSVSDFEGLPQAISAIEQVISGEQPFRRA
FT                   LQTLSDNTRLPVISDLIPAKEQQELLQKPDYLLLTRINREFSPETAVLVENGDKGSVIQ
FT                   SVYQKLTELHRYLLAIQNSPAPGKAALKAVQLRLDQNNSDPIFEVQQLAKNLPEPLNRW
FT                   VGELAEQAWRVVMMEAIQSLEVEWNETVIKQYQTYLAGRYPFDPHAKQDVPLSEFERFF
FT                   GPKGTLDAFYQQNLKPFVENNLTGGSDGELLIRPDVLQQLAQARKIRDTFFSAQNGLGT
FT                   QFAIEPVLLSGNKRRSVLNLDGQLLDYAHGRSGVVHLVWPNSMRAGVESKLTLVPDESG
FT                   KSPRTLSFSGPWAQLRLINAGELTNVGTNSFDVRFKVDGGEMTYRIFVDESDNPFAGGL
FT                   FSKFSLPDTLY"
FT   sig_peptide     434601..434696
FT                   /locus_tag="YPK_0399"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.897) with cleavage site probability 0.788 at
FT                   residue 32"
FT   gene            438259..439566
FT                   /locus_tag="YPK_0400"
FT   CDS_pept        438259..439566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0400"
FT                   /product="ImpA domain protein"
FT                   /note="PFAM: ImpA domain protein; KEGG: ypi:YpsIP31758_0327
FT                   ImpA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66705"
FT                   /db_xref="GOA:A0A0H3AZE8"
FT                   /db_xref="InterPro:IPR010657"
FT                   /db_xref="InterPro:IPR021069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZE8"
FT                   /protein_id="ACA66705.1"
FT                   /translation="MSDTPQHIIIKTGTDPRNRPEFNAIREEINKINHPARPEVNWGLI
FT                   ESLALTLFRTHGVDLQTAVYYTLARTQKNGLAGFTEGCELLAGMVVGQWDHLWPEQPQA
FT                   RSEILEWFNTRVSNQLRQHDFTRDDLRLVYRAERALQLLYDKLQQVELKRVPRIENLLY
FT                   LMQNTAKKLESASDAAKAQQTAAPLKMPPMVYLSVPEAEPVRTAAPEPAANIEVRSPPP
FT                   ETKRGAVLWGFGAGVLCSLLVATAVYVTQFKPLQQQMTVLATQPESAALLWLNRPDVAT
FT                   YGEQLSTLENLSPLFVLNTADQSVAMARQRWPSDPSQVAESQRWARLVEARIGLAGTDS
FT                   SYFQLQQRLHALSEKLLEQERSRGSLTISYLKTAVYQMQTELNREIPLEELLRQLAVSA
FT                   DEHQPASPVLIKQIDDRWNALLSRYHHLTQQTNSAR"
FT   gene            439588..441810
FT                   /locus_tag="YPK_0401"
FT   CDS_pept        439588..441810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0401"
FT                   /product="type VI secretion system Vgr family protein"
FT                   /note="TIGRFAM: type VI secretion system Vgr family
FT                   protein; PFAM: Rhs element Vgr protein; KEGG:
FT                   ypi:YpsIP31758_0328 rhs element Vgr protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66706"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AXA1"
FT                   /protein_id="ACA66706.1"
FT                   /translation="MFAHDKANNNKAADKTGTVTPTHIVSPEAAPTVSGAQMTEIAGGI
FT                   GDAVGGTAGKRINQAAEVAKTALDAKAKVLDGGVTPLNLAAGGAGAGLPDSVAAALTRL
FT                   VKQPSGLQFTLTAAGLPPQTFAVVDFTLSEMLSSPFVLNVGLASADPAVDFAAVLDEDA
FT                   TLFIWREGVLQRSITGMVASFEQGDTGFHQTRYSMVIRPALWRTSLRRNARIFQQASVE
FT                   EIITTLLKENGINDFAFGFRHPHPVREFCVQYQESDFDFIQRLTAEEGIFYYFEFSAGK
FT                   NTVVYADDVGSLPKGASLPYNPNVAAQAQELSITTFTRSAQVRPAMVQLKDYTFKNPNW
FT                   AAAFSEQSGELQNQRPDYEHFDFPGRFKDAQHGQDFTRYRLDALRNDANLGQGASNDFT
FT                   LQPGQLFSLYNHPRSDLNHAWQLLGIQHSGKQMQALEQASGDQGTVLFNHFSFIPHTQT
FT                   WRPTPLAKPAMDGPQIAMVVGPPGEEIYCDEYGRIRLQFLWDRYGQSNDNSSCWIRVTQ
FT                   PWAGQGWGMLAIPRIGQEVVVDFLHGDPDQPIVTGRTYHANNIPPGSLPASKTQMAFRS
FT                   KTHKGEGYNEMRFEDAKGGEGLFMHAQKDMTTMVLNDRKTDVTQDHSEHIGQDQSVTVV
FT                   RNQSNTIQNDRRVEVTRDQQTEVGNDYQLVVKGEKKEFVTKIRYTEVHEDETLTVTKSI
FT                   KIHAKQGDISISTPNAGITITHDGAIILQGKYIRLAADMIDLNPEE"
FT   gene            441816..442274
FT                   /locus_tag="YPK_0402"
FT   CDS_pept        441816..442274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0402"
FT                   /product="Domain of unknown function DUF1795"
FT                   /note="PFAM: Domain of unknown function DUF1795; KEGG:
FT                   ypm:YP_3943 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66707"
FT                   /db_xref="InterPro:IPR014894"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYY6"
FT                   /protein_id="ACA66707.1"
FT                   /translation="MPENNINTYCIQEGTLECPEGFTDRTVNLFMKGKPGAAFALNIAR
FT                   DVPEAHEVLSDYVQRQIGILKDNLKKYEVKKHQQIDVGAQHIPGEYVEATYMAETRRVW
FT                   QRQVAIQVGDHMMIFTATNASPFNPQQQATWEQWIHSFAPWAREAGHV"
FT   gene            442267..446439
FT                   /locus_tag="YPK_0403"
FT   CDS_pept        442267..446439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0403"
FT                   /product="YD repeat protein"
FT                   /note="TIGRFAM: YD repeat protein; PFAM: RHS protein; YD
FT                   repeat-containing protein; PAAR repeat-containing protein;
FT                   KEGG: yps:YPTB3621 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66708"
FT                   /db_xref="GOA:A0A0H3AZZ1"
FT                   /db_xref="InterPro:IPR001826"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZZ1"
FT                   /protein_id="ACA66708.1"
FT                   /translation="MFEAARVDDKLYHSSALAGFIIGSIIGAAVIFAAAAYAASIVLTG
FT                   GATLVATGFIVGMGVTTLGVVAGGLIRSVGEKIGSMCHHDVGQITTGSKNVKVNSKRAA
FT                   HVELSTVACKDDSAIQRMAEGSSNIFINSKAAVRLEDKTTCDAVVDSASSNVTFGGGRV
FT                   QYLDIKREISDEMRDLSEKLFIVAGLAGGIFGAAKQAGCFGLKCLSKIALGEMAGAAAG
FT                   YGLEKGVGAIAGYFGYPVDVISGQKLLTGEGDDTDFILPGIFPLHWSRIYRSENHHVGA
FT                   LGQGWSLVWERSLRKEDDSIVYQNDEGREIVFPLIKRGERYFSPTEHIWLARTERDTYA
FT                   ISSPFETCFIFEAFSEAGVAKLASLEDLNGHALYFSYDDIGQLKKISTTSGYGVYCQYE
FT                   KGRLVSVACVKGGTPGTLVRYQYNEQHQLVSVTNREGQITRQFGYHGHLINKLADVRGL
FT                   ECRYTWADIGGTPRITHSATNLGEQWQFDYDIDNQQTTLTDLNTGQTACWGYNAQHLIT
FT                   DYRDFDGGKYAFDYNDLNMPVRVVLAGERTLVLVYDALARPIQITDPLKRETHIDYHRN
FT                   SLRVVRRQYPDGQVWKGEYDRTGRLLKENAPDGGVTLYHYPGASSLPERITNAVGAQTH
FT                   LGWERHGQLTEHTDCSGKLTRYEYDIDGHLLTVIDAENHSTHYSYNRLGQPTGVRYADG
FT                   RKEQLRYNAQGLVEQFTDPVGRQLHWRYNLRGQPVSFTDRLQREYRYRYDCHGQMIELD
FT                   NANGGQYHFRWSSGGQLVEEQYPDNLVRRYRYGESGMLMALETTAPTVDDLTVSRQVSF
FT                   DYDAGGRMTQRLTGMSATRYDWDIMDRLLLAERVPTAVGEQAGIVGHGVRLAYDKAGHL
FT                   LTESGDLGAVTYQWDPLHHLAALTLPDGQTLSWLRYGAGHVSAIRHGDTLISEFSRDNL
FT                   HREVSRTQGILTQYRDYDAMGRRLWQSAGSDAPTVAADLLPRQGDIWRKFSFDTAGELS
FT                   MATDFIRGEQQYRYDAEGRLTDSRERHQLSVAEDFAYDNADNLLNLRKLPFDTVDPLYD
FT                   TPVANNRLTQWQHYRFEYDAWGNITTRHAGGRMQHFAYDDDNRLLRAWGTGPLGEHDSH
FT                   YRYDALGRRIHKSVTIKRGAEKTTRQTDFIWQGLRLLQEQHADGNATYIYDPNESYTPL
FT                   ARVDQRHGETESQVYYFHTDINGTPLDVTDGEGKHRWSGKYHAWGKVTRQNVSDPRQST
FT                   VSRFAQPLRYPGQYSDDETGLHYNTFRYYDPEIGRFSTQDPIGLAGGVNLYQYGPNPLG
FT                   WVDPWGLATYTSYEQARNAALKWLQDRGFKAETENLGRFGDIKGKPVGMQTGNGKVGFR
FT                   VEFDERSGAHINTWSGKEKGPHFQFEASEKTVKKIQKGFDKKTNGRC"
FT   sig_peptide     442267..442383
FT                   /locus_tag="YPK_0403"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.928) with cleavage site probability 0.893 at
FT                   residue 39"
FT   gene            446442..446861
FT                   /locus_tag="YPK_0404"
FT   CDS_pept        446442..446861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0404"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpu:BPUM_1759 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66709"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B0Q8"
FT                   /protein_id="ACA66709.1"
FT                   /translation="MTYDQELKLDCANSNIALIELGDAVDYFNSLEAKYSLKYNRVDFS
FT                   LLDKHIHMKANGNDLATDYQSFIIGLFDSIKCYSDIIYIGDNLTESAYKLHLSFLIPFV
FT                   SKIAEIPQSHYFFPDDYSWCLNFSFEDDMDFGFLV"
FT   gene            447145..447390
FT                   /locus_tag="YPK_0405"
FT   CDS_pept        447145..447390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0405"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZF3"
FT                   /protein_id="ACA66710.1"
FT                   /translation="MKPLDQNITYGQARGYEQFYIDEFGTKTGVRGDDISPMNRGNKIN
FT                   SYDSNSTTRDPIRQQYFDDAYDSKKSGTSSKGGGGC"
FT   gene            447390..447878
FT                   /locus_tag="YPK_0406"
FT   CDS_pept        447390..447878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0406"
FT                   /product="putative cytoplasmic protein"
FT                   /note="KEGG: stm:STM0294 putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66711"
FT                   /db_xref="InterPro:IPR029278"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AXA4"
FT                   /protein_id="ACA66711.1"
FT                   /translation="MSDFKFWRWDKKPRTMLRFIKPGDIFCFRLDGEKYCFGRIISEMS
FT                   VGHVAEIFDFISSLPEVTEGDISHSLRLTELIVLDTYTLFDKKIEPEGDWRIIGHQDSY
FT                   TPTNVENTYFTYGIGNSCKKVDIFNNEVPITESEARKIPELVPLRDVHIKELIKSYIG"
FT   gene            complement(447924..448286)
FT                   /locus_tag="YPK_0407"
FT   CDS_pept        complement(447924..448286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0407"
FT                   /product="Domain of unknown function DUF1813, HSP20-like
FT                   protein"
FT                   /note="PFAM: Domain of unknown function DUF1813 HSP20-like;
FT                   KEGG: yps:YPTB3619 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66712"
FT                   /db_xref="GOA:A0A0H3AYZ1"
FT                   /db_xref="InterPro:IPR014944"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYZ1"
FT                   /protein_id="ACA66712.1"
FT                   /translation="MNGNIILNCIMNNNIPELIIDKPDIINAGFTPGTKFKIQQYRNGL
FT                   IITLIANEIATQQILNEIENDHHIGMDWIQDKGELSLSGEWLTQTGLTGQPLAISVMAG
FT                   KVVIRGQQGNMQHSYG"
FT   gene            448319..448594
FT                   /locus_tag="YPK_0408"
FT   CDS_pept        448319..448594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0408"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ypi:YpsIP31758_2860 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66713"
FT                   /db_xref="InterPro:IPR021069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZZ3"
FT                   /protein_id="ACA66713.1"
FT                   /translation="MFDGDKYRLSREETQRLHALSEKLLEQERSRGSLIISYLKTAVYP
FT                   SYFKPHVRWPPSLTPVTYLCKLPGIYSVAAFLQLELFWVYTRCRPN"
FT   gene            448579..448686
FT                   /locus_tag="YPK_0409"
FT   CDS_pept        448579..448686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0409"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66714"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B0R7"
FT                   /protein_id="ACA66714.1"
FT                   /translation="MQTELNREIPLEELLRQLAVSAYGLRRLPSGLARD"
FT   gene            448646..452215
FT                   /locus_tag="YPK_0410"
FT   CDS_pept        448646..452215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0410"
FT                   /product="YD repeat protein"
FT                   /note="TIGRFAM: YD repeat protein; PFAM: RHS protein; YD
FT                   repeat-containing protein; KEGG: yps:YPTB3615 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66715"
FT                   /db_xref="InterPro:IPR001826"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZF8"
FT                   /protein_id="ACA66715.1"
FT                   /translation="MVSGDYLQVWPVIDIAGVLPVRLQRTYRSGDYFTVSGCFGHKWAD
FT                   SWSQHLVVHEDNIDYIDEEGVGLSFFTPENKVQAVNLYNLRYELVGERHGELRVFDRST
FT                   QQTLHFNQQQQQQRYLSAITDHKGNRIDFRYQQGELISVEHSDGYVLEIDSRGRTIHAV
FT                   ELVTQEKRQKLLQSTFSERGYLVQCQSFQYGTLSHEYDPKGYMVRWRDTDSTDVAVRYD
FT                   ISGRVVALKTSTGFFADHFIYHDKERYTIYRDGEGGETGYYYNENNLLIKLVDPLGNIT
FT                   LTDWDLTQKIKETDALGRITRFIYNERGDLTAVIHPDETRTEYEYNPSGVVTAFTSSAG
FT                   DSWQYQYDRQGLLRQVTYPSGQTMSFRYGKKGEVLRKIIAEDQVWRYHYDHHGCLTTII
FT                   DPKGNSTAVTLDVLGRLFSHQNALGELTRYTHSDAHASPAGSVTKMVMPDGVEQAIAYD
FT                   SEKRIAALTDGAGKTTRYEYGGFDLLTGLIRPDGQRLTFGYDTLTRLNQVTNASGDTYR
FT                   YTRDRAGQVISETDFTGRTVHYQYDAVGRRIGARYPDQRLVRWHYSMQDQVLAQQTWHC
FT                   DALSSTLVGTVSYGYDRAGRLLSATNADAVVEFDYDEAGQLVAERLNGREVRHQWDALN
FT                   GTPVARQVGELGLTFVYGAQGELTRLQLAGHQPLALQHDRLGRETVRESAAGFIQACNY
FT                   TPSGLLAHQAAGRNSALFQQQLIAPESPALHGSAVNRSWQYDRAYNVVGMDDGRWGKTQ
FT                   YQYDRNDQVVRADFGGFLPLQEQFSYDVNQNLREHRCLPRGAQAVLAQASQQQQAGRVV
FT                   KRGDSEYRYDAAGRLVEKRSQKDGYRPQLWRYRWNEQDQLSELITPTGARWRYGYDAFG
FT                   RRIRKLRVVDTPPLNEMDAPSTGPATASLAGYAYLWSGDQLIEEVPVYADGTVAYEQGI
FT                   HWLYAPGGLTPMARYAQGKLHYVVADHLGTPRELLNEQGKVVWASRLSTWGQAELWRQA
FT                   ANEEDRVSCNLRFAGQYADAESGLHYNRFRYYDGETGQYLCPDPIGLEGGLNPYGYVHN
FT                   PVSWVDPLGLATCPPHPYQGVRDASEYLRSQNVPRDFRKQIIQSFDIETIKVRPATSNE
FT                   YGLRYFDNVNALEKGRYIFETFPATRSSLAVKTEWNQMTYFSQFKVTPGVTIIEGKAAA
FT                   QGVGLPGGQIQKYISNLDKLTKQ"
FT   gene            452212..452493
FT                   /locus_tag="YPK_0411"
FT   CDS_pept        452212..452493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0411"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: yps:YPTB3614 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66716"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AXA8"
FT                   /protein_id="ACA66716.1"
FT                   /translation="MKTDNAMKKIKLAIDGINQAIDNFNEVQTFTTINQLNHFKEKLMN
FT                   CEHLIQLNNIPDKSHRNLGISRIIIDQWPFDSELGCMIINAESEYKSL"
FT   gene            452695..452916
FT                   /locus_tag="YPK_0412"
FT   CDS_pept        452695..452916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0412"
FT                   /product="putative rhs accessory genetic element"
FT                   /note="KEGG: yps:YPTB3613 putative rhs accessory genetic
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66717"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYZ5"
FT                   /protein_id="ACA66717.1"
FT                   /translation="MVQLKDYTFKNPNWAVAFSEQSGELQNQRPDYEHFDFPGRFKDAQ
FT                   HGQDFTRYRLDALRKIIAEDQAWRYHFQ"
FT   gene            complement(453206..454105)
FT                   /locus_tag="YPK_0413"
FT   CDS_pept        complement(453206..454105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0413"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: ypi:YpsIP31758_0344 AP endonuclease, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66718"
FT                   /db_xref="GOA:A0A0H3AZZ8"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZZ8"
FT                   /protein_id="ACA66718.1"
FT                   /translation="MINVGIFTGYYPYTLSGTIDKIKQAGMGCVQLDLEFTDIDLRRGR
FT                   ITKEKAHQVRNAFRRANIPIVAISAYTNLVHPDPVKRAENIAAVKEILAHARHFGTPYV
FT                   ISETGTYNTDSDWLYDPKNSTEEAYQEFKAIAKELATFAYEHNAVFLVENYVNNIIGSV
FT                   GQVARLMQEVEHPGLGLALDPTNYFDDKNIDAIDETLHNIFNVLESRIKIAHAKDCKKT
FT                   DAIAEKFGGGAAEHNSFRGAGSVELPAAGLGALNYPLYVELLAQKHPNIPLIIEHVDEE
FT                   DIPRAKRFVDEVLMATGS"
FT   gene            complement(454102..455232)
FT                   /locus_tag="YPK_0414"
FT   CDS_pept        complement(454102..455232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0414"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; KEGG:
FT                   ypi:YpsIP31758_0345 oxidoreductase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66719"
FT                   /db_xref="GOA:A0A0H3B0R9"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B0R9"
FT                   /protein_id="ACA66719.1"
FT                   /translation="MDTLISQLEHATQPVLPKRRDYRIGIIGAGFIVEHCHLVAYQKAG
FT                   FVPYGITSKEHSQNHRLAETFAIKKVYETWQDMVCDPQIDIIDIAVPPHIQLEIVRFIC
FT                   ESNSAAKHIKGILCQKPLAMSLKDGREIVRLSQQSGIPIAVNSNMRYDPSMRALKYILE
FT                   NQLIGDPVIASIDMRAIPDWQAFLQKYKKLELYAMAIHHIDAFRFLFGDPVKVTAVCRT
FT                   DPRTTFEHIDGITQYTFQYANGLIATSLDDVWAWPGEPCAKNNYINWRVEGSDGLAEGD
FT                   FGWHRREPEYCGSTLKLASRNHPGQWIAPKWERQWFPDAFIGTMANLMCAIEENRPPEI
FT                   SAEDNLGTLACIEACYLSIQQERTVYLNEILLENAK"
FT   gene            455502..456368
FT                   /locus_tag="YPK_0415"
FT   CDS_pept        455502..456368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0415"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; AraC protein arabinose-binding/dimerisation;
FT                   KEGG: yps:YPTB3610 putative AraC-family transcriptional
FT                   regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66720"
FT                   /db_xref="GOA:A0A0H3AZG1"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZG1"
FT                   /protein_id="ACA66720.1"
FT                   /translation="MQRTQVVANWYRESDEFSTLVNYRILRAGHIRAADNFHVRRQSVA
FT                   GHELIFCLNGSGFIRLENNLHEVKKGNLAWLPVRWPHEHFPNKQEPWEILWLRIDGAKL
FT                   NNIMQILDVAQQPVFEFTSPETITDIYHRLFDLMQSHTLVADAHCDVLCSQLIYTLLEN
FT                   RSFDATKSPVISHRGLGRLIYQIHSHYNDDWDIDKFMQYCQVSKSQLFRLFQETFNQSP
FT                   LRWLKNYRLSQARRLLVETEETISRIAGQVGYNDPLHFSRDFHRSVGLSPSDFRRQERQ
FT                   LDNDRHD"
FT   gene            complement(456528..457031)
FT                   /locus_tag="YPK_0416"
FT   CDS_pept        complement(456528..457031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0416"
FT                   /product="RbsD or FucU transport"
FT                   /note="PFAM: RbsD or FucU transport; KEGG: yps:YPTB3609
FT                   putative carbohydrate transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66721"
FT                   /db_xref="GOA:A0A0H3AXB3"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AXB3"
FT                   /protein_id="ACA66721.1"
FT                   /translation="MRPDRILHPELAAALATLGHTDIILVTDAGFPIPPQAKRIDLGFW
FT                   PGTVDVLDILRVLRKEIFVEEVRFASEVRDCHPQLYRDVQTLYTGSGAEFQAASHETLC
FT                   HDLAYQAKVVIRSGSFNPWANFALVASTDPFAWFTDESGVKPLPAYVARRQRILDNVVP
FT                   ELNA"
FT   gene            complement(457037..457966)
FT                   /locus_tag="YPK_0417"
FT   CDS_pept        complement(457037..457966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0417"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: yps:YPTB3608
FT                   probable carbohydrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66722"
FT                   /db_xref="GOA:A0A0H3AYZ8"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AYZ8"
FT                   /protein_id="ACA66722.1"
FT                   /translation="MSVFILGSYAKALVMTTDRIPLAGETLIGYDFRQTWGGKGSDMAV
FT                   QAVRLGAEVAYAGVVGDDTFGHEFVGLMQEEGVNIDALTISGELPTGAGLIVKDKEARN
FT                   VIVVDMGANKLFTPALVDSALSQLKQSNVVLAQLEIPLETALYGLQRAKEFGKITILNP
FT                   APARDLRGLDLSAIDYLTPNETEARVALGLPPDDPRSNREIANLLLETGCQYVVMTLGE
FT                   SGSAVFGRNDTQEIPPCIIDVVDSNGAGDSFNAALAVALDEGLPISEAVLFANATAALC
FT                   CMDWETVPSYRYREDVDAFMRSITVKEE"
FT   gene            complement(458147..458848)
FT                   /locus_tag="YPK_0418"
FT   CDS_pept        complement(458147..458848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0418"
FT                   /product="deoxyribose-phosphate aldolase"
FT                   /EC_number="4.1.2.4"
FT                   /note="KEGG: ypi:YpsIP31758_0350 putative
FT                   deoxyribose-phosphate aldolase; TIGRFAM:
FT                   deoxyribose-phosphate aldolase; PFAM: deoxyribose-phosphate
FT                   aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66723"
FT                   /db_xref="GOA:A0A0H3B003"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR028581"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B003"
FT                   /protein_id="ACA66723.1"
FT                   /translation="MIDFNDPRQVAKAIQFTNVNADLTREGVIKHLNICLEYQFDAAMI
FT                   APCWVSLAKDVLKGSGVRVATTVNFPQANDTTAMKVAIVRELAKEGADEFDFPPNPGFL
FT                   LGGLDELYFNELKEVTHIAHDLGMKVKAMLEFGFITEEAMKIKATRYAYEAGIDWVKQS
FT                   SGWGKGGCAATVEDVQLLKANIQAPCRVKVSGKVNTLEKMKEMFLAGAELVGTSSGPEL
FT                   VKGLTGDINAY"
FT   gene            459319..459899
FT                   /pseudo
FT                   /locus_tag="YPK_0419"
FT                   /note="NADPH-dependent FMN reductase"
FT   gene            459914..461035
FT                   /locus_tag="YPK_0421"
FT   CDS_pept        459914..461035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0421"
FT                   /product="aliphatic sulfonates family ABC transporter,
FT                   periplsmic ligand-binding protein"
FT                   /note="KEGG: ype:YPO3624 putative aliphatic sulfonates
FT                   binding protein; TIGRFAM: aliphatic sulfonates family ABC
FT                   transporter, periplsmic ligand-binding protein; PFAM:
FT                   Substrate-binding region of ABC-type glycine betaine
FT                   transport system; SMART: extracellular solute-binding
FT                   protein family 3"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66724"
FT                   /db_xref="GOA:A0A0H3B0S0"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010067"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B0S0"
FT                   /protein_id="ACA66724.1"
FT                   /translation="MSLSFFFRRGFNVHRWLNIGAMAAIITLAFTNTVIAQDSAPAQFR
FT                   IGYQKGSVNLVLAKTHQLLEKRFPDTQISWIEFPAGPQMLEALNVNSIDLGSTGDIPPI
FT                   FAQAAGADLLYVGMEPPKPKAEVILVPENSAINSVAELKGHKVAFQKGSSSHNLLLQAL
FT                   QKAGLKFTDIQPVYLTPADARAAFQQGNVDAWVIWDPYYSAALLQGGIRVLIDGSQLNQ
FT                   TGSFYLASRPYTEANGPFIQQVLEVLTQADALTLSDRAQSITLLANAMGLPEAVIASYL
FT                   DHRPPTAIQPLSQATVAAQQRTADLFFANRLLPVKVDISQRVWLPAGQLSSKPPSSKPS
FT                   SSNQSSPSQLPTDQPSIAQTSIEQSSTAKSQTK"
FT   sig_peptide     459914..460024
FT                   /locus_tag="YPK_0421"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.998 at
FT                   residue 37"
FT   gene            461054..462202
FT                   /locus_tag="YPK_0422"
FT   CDS_pept        461054..462202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0422"
FT                   /product="Alkanesulfonate monooxygenase"
FT                   /EC_number="1.14.14.5"
FT                   /note="PFAM: luciferase family protein; KEGG: yps:YPTB3604
FT                   alkanesulfonate monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66725"
FT                   /db_xref="GOA:B1JKC0"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019911"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JKC0"
FT                   /protein_id="ACA66725.1"
FT                   /translation="MSINVFWFLPTHGDGHYLGSSEGARAVDYSYLQQIAQAADRLGFG
FT                   GVLIPTGRSCEDSWLVAASLIPVTQRLKFLVALRPGIISPTLAARQAATLDRLSNGRAL
FT                   FNLVTGGDPEELAAEGLHLNHTERYEASAEFTHVWRKVLEGETVDFAGKHIQVKGAKLL
FT                   FPPVQHPRPPLYFGGSSAAAQDLAAEQVELYLTWGETPEQVKEKIEEVRAKAAAKGRTV
FT                   RFGIRLHVIVRETTEEAWRAANRLIANLDDKTIADAQQAFARFDSVGQQRMAALHGGKK
FT                   DNLEISPNLWAGVGLVRGGAGTALVGDGPTVAQRIQEYADLGIDTFVFSGYPHLEEAYR
FT                   VSELLFPHLDLATTELPTQRPATQPQGEVVANIYVPQKVSQS"
FT   gene            462214..463008
FT                   /locus_tag="YPK_0423"
FT   CDS_pept        462214..463008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0423"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ypm:YP_3921 putative
FT                   aliphatic sulfonates transport permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66726"
FT                   /db_xref="GOA:A0A0H3AZG5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZG5"
FT                   /protein_id="ACA66726.1"
FT                   /translation="MTISAQRILHRLAPWILPVALVVGWQVAVEAGWLSNRILPAPSAV
FT                   VTAFWALTKSGELWQHLTISSWRALIGFSIGGSIGLVLGVITGLSRWGERLLNSSVQMI
FT                   RNVPHLALIPLVILWFGIDESAKIFLVALGTLFPIYLNTYHGIKNIDSGLLEMARSYGL
FT                   SGFRLLTQVVLPGALPSIMVGVRFALGFMWLTLIVAETISANSGIGYLAMNAREFLQTD
FT                   VVVVAIVLYALLGKLADGSAQLLERVWLRWHPAYQQKSGEAQ"
FT   gene            463005..463820
FT                   /locus_tag="YPK_0424"
FT   CDS_pept        463005..463820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0424"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ypi:YpsIP31758_0356 putative ABC aliphatic sulfonates
FT                   transporter, ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66727"
FT                   /db_xref="GOA:A0A0H3AXB7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017875"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AXB7"
FT                   /protein_id="ACA66727.1"
FT                   /translation="MTILTHIPQGTPITLESIGKRYGNRTVLDNLQLRITAGQFVAVVG
FT                   RSGCGKSTLLRLLAGLEAASDGTLLSGNALLSHAKDETRLMFQEARLLPWKKVIDNMGL
FT                   GLRGHWRDDALQVLDTVGLADRANEWPAALSGGQKQRVALARALIHRPRLLLLDEPLGA
FT                   LDALTRIEMQGLIERLWQQHGFTVLLVTHDVSEAIALADRVLLIEEGRIGLDLAIDLPR
FT                   PRRKGSAKLAALEAEVLERVLSPPQGIEASRQGIKASRQGTATSRRVAN"
FT   gene            complement(464439..464642)
FT                   /locus_tag="YPK_0425"
FT   CDS_pept        complement(464439..464642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0425"
FT                   /product="RelB antitoxin"
FT                   /note="PFAM: RelB antitoxin; KEGG: ypm:YP_3919 putative
FT                   DNA-damage-inducible protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66728"
FT                   /db_xref="GOA:A0A0H3AZ00"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="InterPro:IPR026262"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZ00"
FT                   /protein_id="ACA66728.1"
FT                   /translation="MANAKALGLDLSTVIRMVVNRLAVNAELPIDLLQPNQETLQAIRD
FT                   LENGVEVYRVDSVDALKRDLGW"
FT   gene            465096..466451
FT                   /locus_tag="YPK_0426"
FT   CDS_pept        465096..466451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0426"
FT                   /product="Xanthine/uracil/vitamin C permease"
FT                   /note="PFAM: Xanthine/uracil/vitamin C permease; sulphate
FT                   transporter; KEGG: ypm:YP_3918 putative xanthine/uracil
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66729"
FT                   /db_xref="GOA:A0A0H3B007"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B007"
FT                   /protein_id="ACA66729.1"
FT                   /translation="MSSSNPQAQPKGTLDAFFKLSERGSNVRQEVLAGLTTFLAMVYSV
FT                   IVVPSMLGKAGFPPTAVFVATCLVAGLGSLLMGLWANLPMAIGCAISLTAFTAFSLVLG
FT                   QQISIPVALGAVFLMGVLFTIISVTGIRSWILRNLPMGVAHGTGIGIGLFLLLIAANGV
FT                   GLVIKNPIEGLPVALGAFTSFPVIMTLLGLAVIFGLEKLRVPGGILLVIVAISVIGLIF
FT                   DPSVTYQGLFAMPSLADANGDSLIFSLDIMGALQPVVLPSVLALVMTAVFDATGTIRAV
FT                   AGQANLLDKDGQIISGGKALTTDSVSSIFAGLVGAAPAAVYIESAAGTAAGGKTGLTAT
FT                   VVGILFLLILFLSPLSYLVPAYATAPALMYVGLLMLSNVSKLDFEDFVDAMSGLLCAVF
FT                   IVLTCNIVTGIMLGFSSLVIGRVCSGEWRKLNVGTVIIAVALVAFYAGGWAI"
FT   gene            complement(466708..467916)
FT                   /locus_tag="YPK_0427"
FT   CDS_pept        complement(466708..467916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0427"
FT                   /product="transposase mutator type"
FT                   /note="PFAM: transposase mutator type; KEGG: yps:YPTB3311
FT                   putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66730"
FT                   /db_xref="GOA:A0A0H3B0S3"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B0S3"
FT                   /protein_id="ACA66730.1"
FT                   /translation="MDEKKLKALAAELAKGLKTEADLNAFSRMLTKLTVETALNAELTE
FT                   HLGHEKNTPKSGSNTRNGYSSKTLLCDDGEIELNTPRDRENTFEPQLIKKNQTRITQMD
FT                   SQILSLYAKGMTTREIVATFKEMYDADVSPTLISKVTDAVKEQVAEWQNRQLDALYPIV
FT                   YMDCIVVKVRQNGSVINKAVFLALGINTEGQKELLGMWLAENEGAKFWLSVLTELKNRG
FT                   LQDILIACVDGLKGFPDAINSVYPQTHIQLCIIHMVRNSLKYVSWKDYKAVTSGLKMVY
FT                   QAPTEEAALMALDKFAEAWDDKYPQISKSWRTHWENLNTFFGYPPDIRKAIYTTNAIES
FT                   VNSVIRAAIKKRKVFPTDDSVRKVVYLAIKDASKKWSMPIQNWRLAMSRFIIEFGDRLS
FT                   DHL"
FT   gene            468170..469819
FT                   /locus_tag="YPK_0428"
FT   CDS_pept        468170..469819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0428"
FT                   /product="Na+/H+ antiporter"
FT                   /note="TIGRFAM: Na+/H+ antiporter; PFAM: sodium/hydrogen
FT                   exchanger; KEGG: ypm:YP_3917 putative putative Na(+)/H(+)
FT                   exchanger protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66731"
FT                   /db_xref="GOA:A0A0H3AZH0"
FT                   /db_xref="InterPro:IPR004705"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZH0"
FT                   /protein_id="ACA66731.1"
FT                   /translation="MEIFFTILILILVVSLSGVVTRMLPFQVPLPLMQIVCGALLAWPN
FT                   FGLHVNFDPELFLVLFIPPLLFADGWKTPTREFIHHGREILGLALALVLVTIVGIGYLI
FT                   YWMVPGIPLVAAFALAAVLSPTDAVALSGIVGKGRIPKSIMGVLEGEALMNDASGLVAL
FT                   KFAIAVAMGTMIFTVSGATLEFLKVAIGGLLAGVAITWLYSKSLRIMSRWSGDDPATQI
FT                   VLLLLLPFASYLVAEHLGVSGILAAVAAGMTISQSGIIRNAPLAMRLRADSVWSMLEFV
FT                   FNGMVFILLGLQLPGILETSITQAELDPTIQTWNLFADVAIIYGALLLLRFGWLWSMKK
FT                   ISKRVLTKRPLQFSDYTTRELWVASFAGVRGAITLAGVLSIPLFLSDGSAFPSRYQLVF
FT                   IATGVILLSVIIGVIALPPLLRGVVVADKSASREEIRLARAAMAEVAIVSLNKMEERLM
FT                   TSSEENIDSELLKEVSSRVIGTLRRRTGSKDEVENTLLIENLERRFRLTALRAERGELY
FT                   HLRATQKISNETLQKLLHDLDLLEALLIEKEG"
FT   gene            complement(470036..471223)
FT                   /locus_tag="YPK_0429"
FT   CDS_pept        complement(470036..471223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0429"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: yps:YPTB3598 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66732"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AXC2"
FT                   /protein_id="ACA66732.1"
FT                   /translation="MKSLILLLALLIPASVTANTLSVEPKDTKPALIDSLSATFAIDKI
FT                   AMLKKEKGANESNLYLPFEQTKDGLAILFGDINQDGKIDALVPFTWEGLNGLDQEIPSN
FT                   DWYSYYAIYLQDDQGWKQVGQIPTGTFTTDNQTLLTGIEDGVIYGEIMPRMTDDDPQPQ
FT                   QWVLRAHPEKDNLLVPIPTPQPLANALTLNLSKKRPLTRNALVTAFGEPINIGDNYFLV
FT                   DGDCVGHPDWKYYQYPGAAFNVSQDDNSVGVSHFIGIPDNLSLVLGDLTITQKTSAHQL
FT                   IKALSQNDSFTVSRTSTDLRTDLGQSSPYFDDANDIFALRLPYYIAGFEAWAKKNEARE
FT                   VPNDEEADTFTRQFYFTTTIGVAPIQNSPTRLMFYFLGDKMVALSVIYDDGQVCI"
FT   sig_peptide     complement(471167..471223)
FT                   /locus_tag="YPK_0429"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.947 at
FT                   residue 19"
FT   gene            complement(471375..472295)
FT                   /locus_tag="YPK_0430"
FT   CDS_pept        complement(471375..472295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0430"
FT                   /product="lipid A biosynthesis lauroyl (or palmitoleoyl)
FT                   acyltransferase"
FT                   /note="TIGRFAM: lipid A biosynthesis lauroyl (or
FT                   palmitoleoyl) acyltransferase; PFAM: lipid A biosynthesis
FT                   acyltransferase; KEGG: ypm:YP_3915 lipid A biosynthesis
FT                   lauroyl acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66733"
FT                   /db_xref="GOA:A0A0H3AZ05"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="InterPro:IPR011920"
FT                   /db_xref="InterPro:IPR030857"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZ05"
FT                   /protein_id="ACA66733.1"
FT                   /translation="MIKPQKFHISLLHPRYWLTWFGLGVLFLLVQLPYPLLNKLGVWLG
FT                   RTSMRFLKRRVSIARRNLELCFPDMDKQVLEQTIIGNFESLGMGLLETGMAWFWSDTRI
FT                   QRWFSVSGLENLKRAQQGKRGVLVIGVHFMSLELGGRVMGQCQPMMAMYRPHNNKVMEL
FT                   VQTWGRMRSNKAMLDRRDLRGMVRALKQGEAVWFAPDQDYGPRGSVFAPLFAVEHAATT
FT                   SGTFMLARLAKPALLPLVLLRKKEGRGYDLLIQPALEDYPIDDEIAAASYMNKVIEKEI
FT                   MRAPEQYLWLHRRFKTRPIGEPSLY"
FT   gene            473102..474091
FT                   /locus_tag="YPK_0431"
FT   CDS_pept        473102..474091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0431"
FT                   /product="carbohydrate uptake (CUT2 family) ABC
FT                   transporter, periplasmic carbohydrate-binding protein"
FT                   /note="KEGG: ypi:YpsIP31758_0364 carbohydrate uptake (CUT2
FT                   family) ABC transporter, periplasmic carbohydrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66734"
FT                   /db_xref="GOA:A0A0H3B009"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR030159"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B009"
FT                   /protein_id="ACA66734.1"
FT                   /translation="MKFNLALLNVCIVSACMLFTTQTLAAEKKHEIAVVAKVTGIPWFT
FT                   RMEVGVNEAAKKLDVNAYQVGPATPDPAQQVKVIEDLIAKNVDAIIVVPNDAKVLEPVL
FT                   KKAQEKGIVVLTHESPDQRIGQWDVETIDSEKYAQANMDELAKAMGNKGGYAIYVGSLT
FT                   VPLHNAWADYAIKYQKEKYPEMFEVTPRLPVAENIDKSYSTTLDLMKTYPQMKGIIGFG
FT                   SLGPIGAGQAVAKKRAKDQIAVVGIAMPAQAAPYLMRGDIKKALLWDPKDAGFAVVEIA
FT                   NQLLNGQKVTEDLTIDGLGKADVDSKNGVIRFNKILEVTKDNAKTLGF"
FT   sig_peptide     473102..473179
FT                   /locus_tag="YPK_0431"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 26"
FT   gene            474295..475791
FT                   /locus_tag="YPK_0432"
FT   CDS_pept        474295..475791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0432"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ypm:YP_3913 ABC transporter ATP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66735"
FT                   /db_xref="GOA:A0A0H3B0S6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B0S6"
FT                   /protein_id="ACA66735.1"
FT                   /translation="MTQATAFITLENISKRFPGVLALDGVNLTLNKGEVHCLAGQNGCG
FT                   KSTIIKVISGVYQPEKGASILIDGKLLHQLTPQLSFYYGVQVIYQDLSLFPNLTVAENI
FT                   AVHRYLPGGDFWVKRKSMRERALAAMQRVGVTLDLDKKVEQLSIADRQLVAICRAIAAD
FT                   ARLVIMDEPTASLTSQEVKGLLNVVRDLKSQGICVVFVSHRLDEVMEVADRISVMRDGK
FT                   WVGTWQASELDSHELAFLMTGQRFTYRPLPPLAAKAAPLLEIRKLSRGEQFRNIDLTLH
FT                   QGEIVSITGLLGAGRTELCLSLFGMTQPESGEIFVAGEPVRFRHNRDAIRHGIGYVSED
FT                   RLTQGLIMEQSIYDNTIVSVFDQLHTRSGLLDHSKAAALVNKLVQDLNIKVSDTALPVK
FT                   TLSGGNAQRIAIAKWVATQPRILILDSPTVGVDIANKEGIYHIAKALAEQGMAVLMICD
FT                   EIPEAYYNSHRVLVMRKGELIAEFYPHQCTEQQIAEVVNG"
FT   gene            475784..476773
FT                   /locus_tag="YPK_0433"
FT   CDS_pept        475784..476773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0433"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: inner-membrane translocator; KEGG: ypm:YP_3912
FT                   putative branched-chain amino acid transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66736"
FT                   /db_xref="GOA:A0A0H3AZH4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZH4"
FT                   /protein_id="ACA66736.1"
FT                   /translation="MDKLKLRQLTGHHEFYLGLLVLLLAIGLSVQSPEFLTLGNLTDVA
FT                   TSYAILGILACGLFVVLIAGGIDISFPAVTAIAQYVMASWVITQGGSFPLALVMAMAVG
FT                   LLLGLINGLLVYWLKVPAIIITIATLNLFYGLLVYFTNGTWLYGFPDWFMTGINWFSFE
FT                   GSDGYDYGLTLPLLCLAGTIIFTGVMMNYTRLGRQIFAMGSNKDAASRLGINIFRLHLY
FT                   VYGYMGILAGVAAVVQAQISQSVAPNSLMGFELTVLAAVVLGGTSMSGGRGSLTGTVLG
FT                   VMLLAFLQNGLTLLSVSSYWHTVFSGVIILVSISTTAWNEKRKLLREH"
FT   gene            476775..477728
FT                   /locus_tag="YPK_0434"
FT   CDS_pept        476775..477728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0434"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   ypi:YpsIP31758_0367 carbohydrate uptake (CUT2 family) ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66737"
FT                   /db_xref="GOA:A0A0H3AXC7"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AXC7"
FT                   /protein_id="ACA66737.1"
FT                   /translation="MTWLNRIIPDDRIIRLQLLILIAVMLVFSLTLGQRFFSLGNFQSM
FT                   SSQLPILGMLALGMGLTMLTGGINLSIIAGANACSLVMAAIIVSHPGQPAFLLLALVAG
FT                   LLVAVAIGTLNGVLISVIGVSPILATLGTMTLITGLNILLSNGDVISGFPPVIQYIGSG
FT                   DIAGIPVAMILFLLVAAGLWVLLEHTTLGRSIYLVGSNEQATRFSGVNTHRVQIAVYIL
FT                   SALLGWGAAILMMAKFNSAKAGYGESYLLVTILASVLGGINPDGGFGRIIGLILALVVL
FT                   QLLESGLNLLGVSSYLTMALWGGVLILFIALQNRKA"
FT   gene            477747..479384
FT                   /locus_tag="YPK_0435"
FT   CDS_pept        477747..479384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0435"
FT                   /product="FGGY-family pentulose kinase"
FT                   /note="TIGRFAM: FGGY-family pentulose kinase; PFAM:
FT                   carbohydrate kinase FGGY; KEGG: ypm:YP_3910 putative
FT                   carbohydrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66738"
FT                   /db_xref="GOA:A0A0H3AZ07"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006003"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZ07"
FT                   /protein_id="ACA66738.1"
FT                   /translation="MASYFIGVDVGTGSARAGVFDLQGRMVGQASREITMFKPKADFVE
FT                   QSSENIWQAVCNAVRDAVNQADINPIQVKGLGFDATCSLVVLDKEGNPLTVSPSGRNEQ
FT                   NVIVWMDHRAITQAERINATKHPVLEFVGGVISPEMQTPKLLWLKQHMPNTWSNVGHLF
FT                   DLPDFLTWRATKDETRSLCSTVCKWTYLGHEDRWDPSYFKLVGLADLLDNNAAKIGATV
FT                   KPMGAPLGHGLSQRAASEMGLIPGTAVSVSIIDAHAGTIGILGASGVTGENANFDRRIA
FT                   LIGGTSTAHMAMSRSAHFISGIWGPYYSAILPEYWLNEGGQSATGALIDHIIQSHPCYP
FT                   ALLEQAKNKGETIYEALNYILRQMAGEPENIAFLTNDIHMLPYFHGNRSPRANPNLTGI
FT                   ITGLKLSTTPEDMALRYLATIQALALGTRHIIETMNQNGYNIDTMMASGGGTKNPIFVQ
FT                   EHANATGCAMLLPEESEAMLLGSAMMGTVAAGVFESLPEAMAAMSRIGKTVTPQTNKIK
FT                   AYYDRKYRVFHQMYHDHMRYQALMQEGA"
FT   gene            479381..479986
FT                   /locus_tag="YPK_0436"
FT   CDS_pept        479381..479986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0436"
FT                   /product="sugar isomerase (SIS)"
FT                   /note="PFAM: sugar isomerase (SIS); KEGG:
FT                   ypi:YpsIP31758_0369 SIS domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66739"
FT                   /db_xref="GOA:A0A0H3B013"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B013"
FT                   /protein_id="ACA66739.1"
FT                   /translation="MSQNKEWLAASDAWMIYSRELAALKENVDQQVWLQVLDALAECRG
FT                   KIAVTGVGTSGIAARKVAHMLACVEQPAIYLNATDAAHGDLGFLGAQDIIILISRGGNS
FT                   DELTRLLPTLQRKQVKIISVTENEQSAIAQVSALVLKTHVKQEIDPLNMLATTSIVLVL
FT                   ALFDAICACLMARTGFSKETLLAVHPGGDVGMALRKQQ"
FT   gene            complement(480085..480939)
FT                   /locus_tag="YPK_0437"
FT   CDS_pept        complement(480085..480939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0437"
FT                   /product="Glutathione S-transferase domain"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   yps:YPTB3590 putative glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66740"
FT                   /db_xref="GOA:A0A0H3B0T0"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B0T0"
FT                   /protein_id="ACA66740.1"
FT                   /translation="MMKDNEYQPPKIWTENNASGGVWSKINRPTAGARYEADLPVGKHP
FT                   LQLYSMGTPNGQKVTILLEELLALGEKGAEYDAHLIRISEGEQFSSGFVSINPNSKIPA
FT                   LMDYSSTPPVRVFESGAILLYLADKFGHFLPKSHAARTEALNWLFWLQGAAPYLGGGFG
FT                   HFYHYAPVKIEYAIDRFTMEAKRQLDLLNTQLKTHKYIAGDEYTIADIAIWPWYGSLVL
FT                   GLQYEAGEFLDVKSYTHLIRWTETIAKRPAVQRGRIVNRTWGAPEEQLPERHDAADFDP
FT                   LIK"
FT   gene            481190..482536
FT                   /locus_tag="YPK_0438"
FT   CDS_pept        481190..482536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0438"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: yps:YPTB3589 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66741"
FT                   /db_xref="InterPro:IPR027372"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZI1"
FT                   /protein_id="ACA66741.1"
FT                   /translation="MHMSKFRLVLLASSIAFSTSSWAQAVEVPAVLAGHAVLPVKSTVA
FT                   TPSDAPTDLQQSGKYTSGQRVSALGSVAAKSADRLTGIGLPINGQPLQGHSGIKHMPDG
FT                   TYWVLTDNGFGSKANSPDAMLYLNHYNIDFKNGNVTPLQTVFLHDPDKKVPFHIINEST
FT                   EKRYLTGSDFDPESFQFADDALWIGDEFGPYLIKADLNGKVLAVFETQVDGNVVKSPDN
FT                   PTLTLPGAPDGKQNFQVARSKGFEGMAVSPDGSKLYPMLEGALWDGEKFENIDGKRYLR
FT                   VLEFDVKNQAWTGRSWQYVLEDNQNAIGDFNLIDANHGLVIERDNGEGTADKACAAGAP
FT                   TDKCFSQIAKFKRVYKIAFSDDNVGKPEEKVSYIDLLNIKDPQNLARKPLNNGVLTFPF
FT                   FTIENVDVVDASHIIVGNDNNFPFSSSRQPNEADDNEFILLDVKALLSQ"
FT   sig_peptide     481190..481261
FT                   /locus_tag="YPK_0438"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.969 at
FT                   residue 24"
FT   gene            complement(482582..482698)
FT                   /locus_tag="YPK_0439"
FT   CDS_pept        complement(482582..482698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0439"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66742"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AXD2"
FT                   /protein_id="ACA66742.1"
FT                   /translation="MKHNAMKHSSLKHSSLKHNSMKHNIVLKRKKPAHGLAP"
FT   gene            complement(482688..483863)
FT                   /locus_tag="YPK_0440"
FT   CDS_pept        complement(482688..483863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0440"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ypi:YpsIP31758_0372 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66743"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZ12"
FT                   /protein_id="ACA66743.1"
FT                   /translation="MKKLIKRLEIIKSGIELEDDDIIRHQLPYLKSETQDPVLVFIVMA
FT                   IEQGKFTQALDAIATWLGSKQGVIQWQDIELAACKLELKALEEQLSELIDKRNERIQLL
FT                   DDFNDLYLVRLGPLMKQILNLRRQLAESTLRKAEAEARRRERDYRNCQQYISQAIDELI
FT                   SLKQRWLALPSISNDTIEIRNRIQQQTELITALLAEIKELENSFCTRNTESTRKAREEA
FT                   KEKYERYQEQQTDAEQRLDNDRKLSSEQRQDLKRLWRQASRLCHPDLVADAFKEKAHQL
FT                   MVQLNQARQRGDFPAIHALLESLKQGLEPLMASDLIDDLERLRRKISDVRTQIDAILHE
FT                   IDALKGEESWRLATSLPDKDKWFKEQENVLSKTLNILERQVEEASRVLYEA"
FT   gene            484021..484173
FT                   /locus_tag="YPK_0441"
FT   CDS_pept        484021..484173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0441"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66744"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B016"
FT                   /protein_id="ACA66744.1"
FT                   /translation="MMSAGDSGARGSAVFFYISTGVIGTKKPARRQVLFIRYEFIALGY
FT                   RLHRD"
FT   gene            complement(484200..484412)
FT                   /locus_tag="YPK_0442"
FT   CDS_pept        complement(484200..484412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0442"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="PFAM: Cold-shock protein DNA-binding; SMART: Cold
FT                   shock protein; KEGG: ypi:YpsIP31758_0376 cold shock
FT                   DNA-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66745"
FT                   /db_xref="GOA:A0A0H3B0T6"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B0T6"
FT                   /protein_id="ACA66745.1"
FT                   /translation="MSNKMTGLVKWFDAGKGFGFISPADGSKDVFVHFSAIQSNDFKTL
FT                   DEGQNVEFSIENGAKGPAAVNVIAL"
FT   gene            complement(484672..484884)
FT                   /locus_tag="YPK_0443"
FT   CDS_pept        complement(484672..484884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0443"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="PFAM: Cold-shock protein DNA-binding; SMART: Cold
FT                   shock protein; KEGG: ypi:YpsIP31758_0376 cold shock
FT                   DNA-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66746"
FT                   /db_xref="GOA:A0A0H3AZI6"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZI6"
FT                   /protein_id="ACA66746.1"
FT                   /translation="MSNKMTGLVKWFDAGKGFGFISPADGSKDVFVHFSAIQSNDFKTL
FT                   DEGQNVEFSIENGAKGPSAVNVIAL"
FT   gene            complement(485144..485356)
FT                   /locus_tag="YPK_0444"
FT   CDS_pept        complement(485144..485356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0444"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="PFAM: Cold-shock protein DNA-binding; SMART: Cold
FT                   shock protein; KEGG: ypp:YPDSF_0251 major cold shock
FT                   protein CspA1"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66747"
FT                   /db_xref="GOA:A0A0H3AXD7"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AXD7"
FT                   /protein_id="ACA66747.1"
FT                   /translation="MSNKMTGLVKWFDAGKGFGFITPADGSKDVFVHFSAIQSNDFKTL
FT                   DEGQNVEFSIENGAKGPSAVNVIAL"
FT   gene            complement(485890..486357)
FT                   /locus_tag="YPK_0445"
FT   CDS_pept        complement(485890..486357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0445"
FT                   /product="17 kDa surface antigen"
FT                   /note="PFAM: 17 kDa surface antigen; KEGG:
FT                   ypi:YpsIP31758_0378 outer membrane lipoprotein PcP"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66748"
FT                   /db_xref="GOA:A0A0H3AZ17"
FT                   /db_xref="InterPro:IPR008816"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZ17"
FT                   /protein_id="ACA66748.1"
FT                   /translation="MNKLAIAVALAATVLSGCANNTASGDTFTASQARQVQTVTYGSIV
FT                   SAHPVTIQGGNNNNVAGAIGGAVVGGFLGNTIGGGRGNSLATAGGAVAGGVAGQGIQSA
FT                   MNRSEGVQLEIRRDDGSNIVVVQAQGPTRFSAGQRVIIASDRSGTVTVSPR"
FT   sig_peptide     complement(486280..486357)
FT                   /locus_tag="YPK_0445"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.557 at
FT                   residue 26"
FT   gene            486833..487645
FT                   /locus_tag="YPK_0446"
FT   CDS_pept        486833..487645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0446"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   ypi:YpsIP31758_0379 metallo-beta-lactamase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66749"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B021"
FT                   /protein_id="ACA66749.1"
FT                   /translation="MSASHENYRIFAIKFAHHHRLTRDNFLGGDPHDGPMPIDYFVWAI
FT                   VGTTRTIMVDTGFDAAMARQRGRTITHCIEDGLSQLGIDAGKIEDVIISHMHYDHAGNH
FT                   GLFPNARFHLQDREMAFCTGRCMGHHGLSQAFDVEDVKAMVGRLFAGRLQFHHGDAEIA
FT                   PGISVHRVGGHTDGLQIIRVHTARGWVVLASDATHFYANIQQRRPYPILYNVGDVLEGY
FT                   NTLYRWADSFDHIIPGHDPMVLQRYPAGTPETAAWIAQVDVAPLTQWT"
FT   gene            487710..488600
FT                   /locus_tag="YPK_0447"
FT   CDS_pept        487710..488600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0447"
FT                   /product="3-hydroxyisobutyrate dehydrogenase"
FT                   /EC_number="1.1.1.31"
FT                   /note="PFAM: 6-phosphogluconate dehydrogenase NAD-binding;
FT                   KEGG: ypi:YpsIP31758_0380 6-phosphogluconate dehydrogenase
FT                   NAD-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66750"
FT                   /db_xref="GOA:A0A0H3B0U2"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B0U2"
FT                   /protein_id="ACA66750.1"
FT                   /translation="MKQLQRIGFIGLGKMGTPMVQRLVKAGFELYLCDADITKVQILTA
FT                   ELNAESLTVDNAASLDALITMLPNSEAVEQALLGSDGISGWVAQLSQAAVVIDMSSSDP
FT                   ERSRRLAILLAVWELDYLDAPVSGGVKKAQNGTLSILIGGEDRVLKSCYTALAAMGEQI
FT                   LFVGPAGSGHAAKALNNYVSATGLLATIEALHVAQRFGIEPEVMTEVLNTSTGRSNTSE
FT                   NKVRQFMLNGSYASGFTLQLMNKDLHIARNLAQRLNYPMRLGMHCVDVWDEVSRRATPM
FT                   ADHTEMYRLLIDKEP"
FT   gene            488792..489187
FT                   /locus_tag="YPK_0448"
FT   CDS_pept        488792..489187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0448"
FT                   /product="Carboxymuconolactone decarboxylase"
FT                   /note="PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   yps:YPTB3581 putative gamma carboxymuconolactone
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66751"
FT                   /db_xref="GOA:A0A0H3AZI9"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZI9"
FT                   /protein_id="ACA66751.1"
FT                   /translation="MVAQDRFERGFHNRKAVLGAEHVETSWGNSDEFNRPVQKLITEYC
FT                   WGEIWGDPALTFKTRSMLNIGILTAMGQHHELSLHVKGALRNGVTREEIRAVLLQTVVY
FT                   CGAPVALAAFRIASAAIKAYDDEIADS"
FT   gene            489341..490705
FT                   /locus_tag="YPK_0449"
FT   CDS_pept        489341..490705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0449"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: ypi:YpsIP31758_0382
FT                   transporter, major facilitator family"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66752"
FT                   /db_xref="GOA:A0A0H3AXE1"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AXE1"
FT                   /protein_id="ACA66752.1"
FT                   /translation="METLSADSAITAAENDPLRDVKRKNAIKGAFFSEFIDMFDIYLPV
FT                   IVLPPVLFYFQPPNLSSSTANILASLVFITTLLGRPIGALLFGIMADRIGRRMASIYSV
FT                   SGFGVVTFLIALIPGYETLGIASYLLLVLLRFIDGIFLGGGYTGAIPLALEYSKKEQRG
FT                   FVGGLILSGFPAAYVAINLVAMLMFALIPLDGLYSPYAQWGWRIPFVIGGLLAGFLALY
FT                   YVFNVTESEVWQQGSSKKRAREKQPLSTLVSGQSGRNLWQVLLMMSGFWLTQNLITLFL
FT                   PTGLLINTLNMSGLQVTSILLVTYCVLFFSYIGMGMLGQKIGRRRFFMIAGPLIATMGS
FT                   ALLYVLSHGDGLSFSTVMLLVCLLAVVVTSPWGVIITYINERFATGVRATGFGVGFSLS
FT                   VIIPSFYAFYMDWLSVVVPFELTAVVLLALGGMIGTVGAIMGPETKEVDFTSSAG"
FT   gene            490795..491469
FT                   /locus_tag="YPK_0450"
FT   CDS_pept        490795..491469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0450"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: ypi:YpsIP31758_0383 transcriptional
FT                   regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66753"
FT                   /db_xref="GOA:A0A0H3AZ21"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZ21"
FT                   /protein_id="ACA66753.1"
FT                   /translation="MLAGMGVIKPETLRYQVENVLRQAIMSGRFTPGERLIERELCETL
FT                   GVSRTSIREALRRLEAEKLVSIVPHKGPIVAIISRQEAAELFALRGLLEGFAAREFAQR
FT                   ATDVAIVHFAQAIQALRMAGMTKDRAKVLKAKTDLYDVLLDNCGNGLVKETLTSLHSRI
FT                   NLLRATSLMDPQRLPVSINEIDDLYQALKARDPDAAQAAAERHVANAKEVALRILEETN
FT                   AT"
FT   gene            491535..492011
FT                   /locus_tag="YPK_0451"
FT   CDS_pept        491535..492011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0451"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ypi:YpsIP31758_0384 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66754"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B025"
FT                   /protein_id="ACA66754.1"
FT                   /translation="MNTENKKLSTLIGKIHTIAKSRLAAGYEDRNGINEHQVTPCHHAL
FT                   TLLGGDDFAESYLPFLRNVNGFDLNGVRLFGYFDDKGDERDLRKQLADLKAFPELFPDA
FT                   FNDWVLIGETDTDILIFNKKNGSYENRDRIGLDRLNESYDDIVGLLISLMPLIE"
FT   gene            complement(492765..493061)
FT                   /locus_tag="YPK_0452"
FT   CDS_pept        complement(492765..493061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0452"
FT                   /product="transcriptional regulator, Fis family"
FT                   /note="PFAM: helix-turn-helix Fis-type; KEGG: yen:YE3817
FT                   DNA-binding protein fis"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66755"
FT                   /db_xref="GOA:B1JKF0"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR005412"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JKF0"
FT                   /protein_id="ACA66755.1"
FT                   /translation="MFEQRVNSDVLTVATVNSQDQVTQKPLRDSVKQALKNYFAQLNGQ
FT                   DVSDLYELVLAEVEQPLLDMVMQYTRGNQTRAALMMGINRGTLRKKLKKYGMN"
FT   gene            complement(493086..494051)
FT                   /locus_tag="YPK_0453"
FT   CDS_pept        complement(493086..494051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0453"
FT                   /product="TIM-barrel protein, nifR3 family"
FT                   /note="TIGRFAM: TIM-barrel protein, nifR3 family; PFAM:
FT                   dihydrouridine synthase DuS; dihydroorotate dehydrogenase;
FT                   KEGG: ypi:YpsIP31758_0386 dihydrouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66756"
FT                   /db_xref="GOA:A0A0H3B0U5"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR032887"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B0U5"
FT                   /protein_id="ACA66756.1"
FT                   /translation="MRIGHFQLTNCLIAAPMAGITDRPFRALCHGMGAGMAVSEMLSSN
FT                   PEVWRTDKSRLRMVHVDEPGIRNVQIAGNDPDEMAAAARINVASGAQIIDINMGCPAKK
FT                   VNRKLAGSALLQHPDLVKQILSAVVNAVDVPVTLKIRTGWSPEHRNCIEIAQLAENCGI
FT                   QALTIHGRTRSCLFNGEAEYDSIRAVKQTVSIPVIANGDITDPHKARAVLDYTGADALM
FT                   IGRAAQGRPWIFREIQHYLDTGELLPPMPLGEVQRLLDGHIRELHDFYGPGKGFRIARK
FT                   HVSWYLQEHAPNDQFRRTFNAIEDASEQLEALEAYFENLA"
FT   gene            complement(494640..495521)
FT                   /locus_tag="YPK_0454"
FT   CDS_pept        complement(494640..495521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0454"
FT                   /product="ribosomal protein L11 methyltransferase"
FT                   /note="TIGRFAM: ribosomal protein L11 methyltransferase;
FT                   PFAM: putative RNA methylase; methyltransferase small;
FT                   ribosomal L11 methyltransferase; Methyltransferase type 12;
FT                   KEGG: ypm:YP_3891 ribosomal protein L11 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66757"
FT                   /db_xref="GOA:B1JKF2"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JKF2"
FT                   /protein_id="ACA66757.1"
FT                   /translation="MPWIQLKLNTTGNQAESLGDVLVESGAVSVTFQDTHDNPVFEPLP
FT                   GETRLWGDTDVIGLYDAETDMADVVAMLECHPQIGKGFIHKIEQLEDKDWEREWMDNFH
FT                   PMRFGERLWICPSWRDVPDPTAVNVMLDPGLAFGTGTHPTTALCLQWLDSLDLNGKTLI
FT                   DFGCGSGILAIAALKLGAARAIGIDIDPQAIQASRDNAQRNGVSERLELYLAKDQPAEL
FT                   SADVVVANILAGPLRELAPLISVLPTTGGHLGLSGVLATQAAGVAQAYEDKFILDPVAE
FT                   KEEWCRITGIKK"
FT   gene            complement(495597..497051)
FT                   /locus_tag="YPK_0455"
FT   CDS_pept        complement(495597..497051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0455"
FT                   /product="sodium/pantothenate symporter"
FT                   /note="TIGRFAM: SSS sodium solute transporter superfamily;
FT                   sodium/pantothenate symporter; PFAM: Na+/solute symporter;
FT                   KEGG: ypm:YP_3890 sodium/pantothenate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66758"
FT                   /db_xref="GOA:A0A0H3AZJ4"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR011849"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZJ4"
FT                   /protein_id="ACA66758.1"
FT                   /translation="MQTDVVLPLVGYLVLVFGLSIYAYTRRQTGNFLNEYFIGNRSMGG
FT                   FVLAMTLTATYISASSFIGGPGAAYKYGLGWVLLAMIQLPAVWLSLGVLGKKFAILARR
FT                   YNAVTLNDMLYARYQSRLLVWLASISLLVAFVGAMTVQFIGGARLLETAAGIPYDTGLL
FT                   IFGISIALYTSFGGFRASVLNDALQGLVMLIGTILLLVAVIHAAGGLHKAVETLQHIDP
FT                   ALVSPQGGDQILDVPFMASFWILVCFGVIGLPHTAVRCISYRDSKAVHRGIILGTIVVA
FT                   ILMFGMHLAGALGRAVLPDLKIPDQVIPTLMITVLPPFAAGIFLAAPMAAIMSTINAQL
FT                   LQSSATIVKDLYLNLWPAELKNERKLARISSLSTLILGLLLLLAAWRPPEMIIWLNLLA
FT                   FGGLEAVFLWPLVLGLYWERANAHGALSAMIVGAVCYTVLASFDIKIAGLHPIVPSLTL
FT                   NLLAFYIGNLFGDRARARHPAIVSAD"
FT   gene            complement(497041..497283)
FT                   /locus_tag="YPK_0456"
FT   CDS_pept        complement(497041..497283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0456"
FT                   /product="protein of unknown function DUF997"
FT                   /note="PFAM: protein of unknown function DUF997; KEGG:
FT                   ypi:YpsIP31758_0390 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66759"
FT                   /db_xref="GOA:A0A0H3AXE5"
FT                   /db_xref="InterPro:IPR010398"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AXE5"
FT                   /protein_id="ACA66759.1"
FT                   /translation="METRFLQANKEARWAFGLTLAYLAGWIITAYLPGNLPGMSGLPAW
FT                   FEAACIALPLLFIVLCILMVRLIFRDIPLEDDDAN"
FT   gene            498343..498519
FT                   /locus_tag="YPK_0457"
FT   CDS_pept        498343..498519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0457"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66760"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZ24"
FT                   /protein_id="ACA66760.1"
FT                   /translation="MKKIIASLLLVCASYSIAPVYASGINWHLDRCPQGSGAMVSYDEN
FT                   GKEDFFQCLPGAN"
FT   sig_peptide     498343..498411
FT                   /locus_tag="YPK_0457"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 23"
FT   gene            complement(498765..500114)
FT                   /locus_tag="YPK_0458"
FT   CDS_pept        complement(498765..500114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0458"
FT                   /product="acetyl-CoA carboxylase, biotin carboxylase"
FT                   /note="TIGRFAM: acetyl-CoA carboxylase, biotin carboxylase;
FT                   PFAM: phosphoribosylglycinamide synthetase;
FT                   Carbamoyl-phosphate synthase L chain ATP-binding;
FT                   Carbamoyl-phosphate synthetase large chain domain protein;
FT                   biotin carboxylase domain protein; RimK domain protein
FT                   ATP-grasp; KEGG: yps:YPTB3572 biotin carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66761"
FT                   /db_xref="GOA:A0A0H3B029"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B029"
FT                   /protein_id="ACA66761.1"
FT                   /translation="MLDKIVIANRGEIALRILRACKELGIKTVAVHSVADRDLKHVLLA
FT                   DETVCIGPAPSVKSYLNIPAIISAAEITGAVAVHPGYGFLSENADFAEQVERSGFIFIG
FT                   PRAETIRLMGDKVSAISAMKKAGVPCVPGSDGPLSDDTTKNKAFAKRIGYPVIIKASGG
FT                   GGGRGMRVVRHDKDLEESINMTRAEAKAAFNNDMVYMEKYLENPRHIEVQILADGQGNA
FT                   IYLAERDCSMQRRHQKVVEEAPAPGITSEMRRYIGERCAKACMEIGYRGAGTFEFLYEN
FT                   GEFYFIEMNTRIQVEHTVTEMITGIDLIKEQLRIAAGQPLSIKQDEVKVHGHAVECRIN
FT                   AEDPNTFLPSPGKITRFHAPGGFGVRWESHIYAGYTVPPYYDSMIGKLITYGENRDVAI
FT                   ARMKNALAELIIDGIKTNVELQQRIMNDENFQHGGTNIHYLEKKLGLQET"
FT   gene            complement(500126..500590)
FT                   /locus_tag="YPK_0459"
FT   CDS_pept        complement(500126..500590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0459"
FT                   /product="acetyl-CoA carboxylase, biotin carboxyl carrier
FT                   protein"
FT                   /note="TIGRFAM: acetyl-CoA carboxylase, biotin carboxyl
FT                   carrier protein; PFAM: biotin/lipoyl attachment
FT                   domain-containing protein; KEGG: yps:YPTB3571 biotin
FT                   carboxyl carrier protein of acetyl-CoA carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66762"
FT                   /db_xref="GOA:A0A0H3B0U9"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B0U9"
FT                   /protein_id="ACA66762.1"
FT                   /translation="MDIRKIKKLIELVEESGISELEISEGEESVRISRAPAAPNYPMMQ
FT                   QPYAFAAPQQQPALAAAVAPAPVAEAAPAAISGHIVCSPMVGTFYRTPSPDAKAFVEVG
FT                   QKVSVGDTLCIVEAMKMMNQIEADKSGTVKAILVENGQPVEFDEPLVVIE"
FT   gene            complement(500748..501200)
FT                   /locus_tag="YPK_0460"
FT   CDS_pept        complement(500748..501200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0460"
FT                   /product="3-dehydroquinate dehydratase, type II"
FT                   /EC_number="4.2.1.10"
FT                   /note="KEGG: ypm:YP_3886 putative class II dehydroquinase;
FT                   TIGRFAM: 3-dehydroquinate dehydratase, type II; PFAM:
FT                   dehydroquinase class II"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66763"
FT                   /db_xref="GOA:B1JKF8"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JKF8"
FT                   /protein_id="ACA66763.1"
FT                   /translation="MSDKFHILLLNGPNLNLLGTREPEKYGYTTLAEIVSQLEIQAQGM
FT                   DVALSHLQSNAEHALIDSIHQARGNTDFILINPAAFTHTSVALRDALLGVQIPFIEIHL
FT                   SNVHAREPFRHHSYLSDIAVGVICGLGADGYNFALQAAVNRLSKSN"
FT   gene            complement(501462..502082)
FT                   /locus_tag="YPK_0461"
FT   CDS_pept        complement(501462..502082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0461"
FT                   /product="Ferric reductase domain protein transmembrane
FT                   component domain"
FT                   /note="PFAM: Ferric reductase domain protein transmembrane
FT                   component domain; KEGG: ypm:YP_3885 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66764"
FT                   /db_xref="GOA:B1JKF9"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR022837"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JKF9"
FT                   /protein_id="ACA66764.1"
FT                   /translation="MRLSLRHITWLKIAIWLAATLPLLWLVLSINLGGLSADPAKDIQH
FT                   FTGRMALKLLLATLLVSPLARYSKQPLLLRCRRLLGLWCFAWGTLHLLSYSILELGLSN
FT                   IGLLGHELINRPYLTLGIISWLVLLALALTSTRWAQRKMGARWQKLHNWVYVVAILAPI
FT                   HYLWSVKTLSPWPIIYAVMAALLLLLRYKLLLPRYKKFRQWFR"
FT   sig_peptide     complement(501972..502082)
FT                   /locus_tag="YPK_0461"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.979) with cleavage site probability 0.485 at
FT                   residue 37"
FT   gene            complement(502082..503182)
FT                   /locus_tag="YPK_0462"
FT   CDS_pept        complement(502082..503182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0462"
FT                   /product="oxidoreductase molybdopterin binding"
FT                   /note="PFAM: oxidoreductase molybdopterin binding; KEGG:
FT                   yps:YPTB3568 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66765"
FT                   /db_xref="GOA:A0A0H3AZK2"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR022867"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZK2"
FT                   /protein_id="ACA66765.1"
FT                   /translation="MHNTFTHTKNNTHTKNNTQAKNSGSQTKSNAVSLNKPRKLTEADV
FT                   TPESIFYQRRKVLQALGITAATLALPASAQADLLAWFKGNEPPKAPSGKPLTFTPSAAY
FT                   HPDLALTPEDKVTGYNNFYEFGLDKADPAANAGTLKTEDWQIKIDGDVVKPMTLDMDYL
FT                   MKCFPLEERIYRLRCVEAWSMVVPWIGFELGKLLKLAEPTSNARYVAFQTLYAPDQMPG
FT                   QKNRFIGGGLDYPYVEGLRLDEAMHPLAFMVVGVYGKTLPPQNGAPLRLMTPWKYGFKS
FT                   IKSIVHIRLTRDQPPTTWNLSAPNEYGFYANVNPHVDHPRWSQATERVIGSGGILDVKR
FT                   QPTLLFNGYADQVASLYRGLDLRKNF"
FT   gene            complement(503405..504382)
FT                   /locus_tag="YPK_0463"
FT   CDS_pept        complement(503405..504382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0463"
FT                   /product="quinone oxidoreductase, YhdH/YhfP family"
FT                   /note="TIGRFAM: quinone oxidoreductase, YhdH/YhfP family;
FT                   PFAM: Alcohol dehydrogenase zinc-binding domain protein;
FT                   Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   ypm:YP_3883 probable zinc-binding dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66766"
FT                   /db_xref="GOA:A0A0H3AXE9"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014188"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AXE9"
FT                   /protein_id="ACA66766.1"
FT                   /translation="MRALILEQIEGRTTAEVRQISASQLPAGNVTVDVNWSSLNYKDAL
FT                   AITGQGKIIRQFPMVPGIDFAGTVHSSEDPRFHIGQSVLLTGWGVGENHWGGLAEQARV
FT                   NGDWLVPMPDGLDARKAMIIGTAGFTAMLCVMALEDGGVTPKSGEVVVTGASGGVGSTA
FT                   IALLSALGYQIAAISGRDSNSDYLKNLGAQRILPRSDYLDASRPLEKQLWAGAIDTVGD
FT                   SMLAKILAQMNYNGTVAACGLAGGYNLPTTVMPFILRNIRLQGVDSVMTPQPRRLQAWQ
FT                   RLQKILPESFYQQASQAITLADTPTIAARLLANEVTGRTLVKVR"
FT   gene            504783..506699
FT                   /locus_tag="YPK_0464"
FT   CDS_pept        504783..506699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0464"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; KEGG:
FT                   ypi:YpsIP31758_0397 putative diguanylate cyclase/cyclic
FT                   diguanylate phosphodiesterase protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66767"
FT                   /db_xref="GOA:A0A0H3AZ28"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033423"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZ28"
FT                   /protein_id="ACA66767.1"
FT                   /translation="MRFTTKLSAFMTLLVVLAMCLVLLGSTISFFYLCQKKMEQRLQSI
FT                   VTAYDQSLLLQPINKKREWLPLMMQTLGVVDVSVKNSTSTLYQLHIPAVYTPWNSNSRY
FT                   RQMVLPLLHQPGAEMHFNYIDPLGSYARSIYAAAILSLVVVVIALTLLLSFRWLRDQTV
FT                   GQEKLERRARRILNGEREHAVRSEDYEWPPCASRAIDHLLSELMEVRAERNRVDTLIRT
FT                   FAAQDAQTGLSNRQFFDNQLTTQLEETGAHGVVMMVQLPDFEALNETHDQQQVQELMSS
FT                   LVNLLSTFVARYPSALLARYLNSDIAILLPHKTLKDADVMAAQLVNAVRTLPEPHIIDR
FT                   ESLLHIGIVAYRSGESVEQIMDNAGQATKSAALYGGNGWYVFDTQVPERGRGSVKWRTL
FT                   LEQTLASGGPRLYQKPVITVDGKISHREIISRIYDGEQELLAAEFMPLVQLLGLGERYD
FT                   RQKIDKIIPLLSLWPDETLAFSISVDSLLHRPFQRWLRDTLLQCKKSDRMRIIFELAEA
FT                   DVCQHIEEIRQMVRLLRGVGCKVMASQAGLTVVSTSYIKSLQVEMIKLHPGVVRSINFR
FT                   YENQLFVESLTGACAGTQTKVFAAEVRTREEWQTLQEKGVYGGQGNFFAPPTPLNSGKK
FT                   KYS"
FT   sig_peptide     504783..504860
FT                   /locus_tag="YPK_0464"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.955 at
FT                   residue 26"
FT   gene            507036..508079
FT                   /locus_tag="YPK_0465"
FT   CDS_pept        507036..508079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0465"
FT                   /product="cell shape determining protein, MreB/Mrl family"
FT                   /note="TIGRFAM: cell shape determining protein, MreB/Mrl
FT                   family; PFAM: cell shape determining protein MreB/Mrl;
FT                   KEGG: ypm:YP_3881 rod shape-determining protein MreB"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66768"
FT                   /db_xref="GOA:A0A0H3B033"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B033"
FT                   /protein_id="ACA66768.1"
FT                   /translation="MFKKFRGMFSNDLSIDLGTANTLIYVKGQGIVLNEPSVVAIRQDR
FT                   AGSPKSVAAVGHDAKQMLGRTPGNIAAIRPMKDGVIADFFVTEKMLQHFIKQVHSNSFM
FT                   RPSPRVLVCVPVGATQVERRAIRESAQGAGAREVFLIEEPMAAAIGAGLPVSEATGSMV
FT                   VDIGGGTTEVAVISLNGVVYSSSVRIGGDRFDEAIINYVRRNYGSLIGEATAERIKHSI
FT                   GSAYPGDEVLEIEVRGRNLAEGVPRGFTLNSNEILEALQEPLTGIVSAVMVALEQCPPE
FT                   LASDISERGMVLTGGGALLRNLDRLLMEETGIPVVVAEDPLTCVARGGGKALEMIDMHG
FT                   GDLFSEE"
FT   gene            508283..509278
FT                   /locus_tag="YPK_0466"
FT   CDS_pept        508283..509278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0466"
FT                   /product="rod shape-determining protein MreC"
FT                   /note="TIGRFAM: rod shape-determining protein MreC; PFAM:
FT                   Rod shape-determining protein MreC; KEGG:
FT                   ypi:YpsIP31758_0399 rod shape-determining protein MreC"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66769"
FT                   /db_xref="GOA:A0A0H3B0W1"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B0W1"
FT                   /protein_id="ACA66769.1"
FT                   /translation="MKPIFSRGPSLQLRLFFAIIAAIVLVIADSRLGTFVKIRTYMDTA
FT                   VSPFYFLANGPRKILDNVSDTLATREQLELENRALRQELLLKNTDLQLLGQFKQENNRL
FT                   RELLGSPLRQDEQKMVTQVMSSGTDPYSDHVVIDKGSNSGVYEGQPVISDRGVVGQVVA
FT                   VSKFTSRVLLICDASHALPIQVLRNDIRVIAAGSGCSDDLLLEHLPSNTDIRVGDVLVT
FT                   SGLGGRFPEGYPVAVVSSVKVDNQRAYTVIQARPTADLQRLRYLLLLWGADRNGDMPMP
FT                   PDEVRRVANERLAPMMSQVLPSADAMGPPAPAASTPAGATPGVVTPGVSP"
FT   gene            509275..509763
FT                   /locus_tag="YPK_0467"
FT   CDS_pept        509275..509763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0467"
FT                   /product="rod shape-determining protein MreD"
FT                   /note="TIGRFAM: rod shape-determining protein MreD; PFAM:
FT                   Rod shape-determining protein MreD; KEGG: ypm:YP_3879 rod
FT                   shape-determining protein MreD"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66770"
FT                   /db_xref="GOA:A0A0H3AZK5"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="InterPro:IPR026034"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZK5"
FT                   /protein_id="ACA66770.1"
FT                   /translation="MNRYSSHGRWVIWLSFLIAMVLQIMPWPEQIYMFRPSWLALVLIY
FT                   WVMALPHRVNVGTGFILGLIMDLILGSTLGVRALAFSIIAYLVAFKFQLFRNMALWQQA
FT                   LIVMLLSLTMDVVVFWSEFLVINVAFRPEVFWSSVVNGILWPWLFLLMRKIRRQFSVQ"
FT   gene            509777..510370
FT                   /locus_tag="YPK_0468"
FT   CDS_pept        509777..510370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0468"
FT                   /product="maf protein"
FT                   /note="TIGRFAM: maf protein; PFAM: Maf family protein;
FT                   KEGG: ypi:YpsIP31758_0401 septum formation protein Maf"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66771"
FT                   /db_xref="GOA:A0A0H3AXF3"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AXF3"
FT                   /protein_id="ACA66771.1"
FT                   /translation="MTALYLASASPRRRELLALLDLPFEVLKTEVEEQRHPGESAQVYV
FT                   QRLAQDKARAGVAVAPQDLPVLGADTIVVLNGQVLEKPRDKEHAQQILSALSGQKHQVM
FT                   TAVALADRQNMLSAMVVTDVTFRVLSPLEISDYIATGEPMDKAGAYGIQGKGGCFVRAI
FT                   AGSYHAVVGLPLVETHELLSHFIAQRNVRGIHDS"
FT   gene            510360..511829
FT                   /locus_tag="YPK_0469"
FT   CDS_pept        510360..511829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0469"
FT                   /product="ribonuclease, Rne/Rng family"
FT                   /note="TIGRFAM: ribonuclease, Rne/Rng family; PFAM: RNA
FT                   binding S1 domain protein; KEGG: ypi:YpsIP31758_0402
FT                   ribonuclease G"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66772"
FT                   /db_xref="GOA:A0A0H3AZ33"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZ33"
FT                   /protein_id="ACA66772.1"
FT                   /translation="MTAELLVNITPSETRVAYIDGGILQEIHIEREAKRGIVGNIYKGR
FT                   VSRVLPGMQAAFVDIGLDKAAFLHASDIMPHTECVAGDEQKNFNVRDIAELVRQGQDLM
FT                   VQVVKDPLGTKGARLTTDITLPSRYLVLMPGAAHVGVSQRIESEAERERLKKTVAAYCD
FT                   EQGGFIIRTAAEGIGEEELSADAAFLKRLWTKVQERKKRNITKYKLYGEMALAQRVLRD
FT                   FAGAALDKIRVDSKLTYDLLVEFTREYIPEMTDKLELYTGKQPIFDLYDVENEIQRSLE
FT                   RKVELKSGGYLIIDQTEAMTTVDINTGAFVGHRNLEETIFNTNIEATQAIARQLRMRNL
FT                   GGIIIIDFIDMSNEDHRRRVLHSLEQALSKDRVKTSINGFSQLGLVEMTRKRTRESIEH
FT                   VLCHECPTCRGRGTVKSVETVCYEILREIVRVHHAYDSDRFLVYASPAVGEALKGEESH
FT                   ALAEVEIFVGKQVKVQIEPLYNQEQFDVVMM"
FT   gene            511923..515846
FT                   /locus_tag="YPK_0470"
FT   CDS_pept        511923..515846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0470"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: yps:YPTB3560 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66773"
FT                   /db_xref="InterPro:IPR011836"
FT                   /db_xref="InterPro:IPR025263"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B039"
FT                   /protein_id="ACA66773.1"
FT                   /translation="MRRLPKIMFATGATIIVVVALLVSALRMMLPLINEYRPQIVAKIQ
FT                   SVSGIPLDVGFMQGTWETFGPTLELRDIRAQMPKADLQVQRVTLALDVWQSLLHWRWQF
FT                   RDLTFYQLQLDLHTTLDATQNNGSNLETGNVHNIFLRQLDRFDLRNSRISFLTPSGPRA
FT                   ELEIPQLTWLNSSTRHRAEGQISLSTINGQHGVVQVRMDLHDNQGILNNGTVYMQADNI
FT                   DLKPWISRWLQNNTGLDNAEFSLAAWLSIKSGEIYRGNVLLSQGQANWTVGSNSHQLSV
FT                   DNFVLEGRRQGNGWQIDAPVLNLKTDGQAWPKGRLSALWLPENTQFIGPEQRQELRIRA
FT                   SNLQLERIGPLLPTLSPFTPELLARWADLQPQGYVDALALDIPISQPETTRFQAKWHDV
FT                   SWQYWGQLPGVNHFDGELSGSARLGRLNINLKNSLLLYGDLFRAPLEVSQASGALNWRI
FT                   DDKGWALWSDQLDVQAKSLWGNGSFYYMQPNQKPSQLNQAQPWLKILAGIRLYDATDAW
FT                   RYFPVSLMGEKLADYLTEALQGGQVDNATLVYNGNPHDFPYKNKEGQFQVYVPLRNAVF
FT                   QFQPDWPALDNLAIDLNFLNEGLWMNAPHTLLGKVTGSNISAIIPDYLKEKLYVDADVL
FT                   GEGRDVHDYFTATPLKDSVAETLNELQVGGKVSGRLHLDIPLEEESITHASGEVTLNNN
FT                   SLLVKPLQSQLENINGKFRFYDGNLESETLSANWYGQPLTVNFTTKEQPKDFLVNVGLQ
FT                   GDWLPAKLPGVPDSLAKMLSGSANWQGKVAVKLPQHGKPDYQVDVSADLKKVSSHLPSP
FT                   LDKNSGQALPLHVQVNGGLEAFTLSGSAGNNNAFNSQWLLQGEKVELARAIWQTDSKKI
FT                   PSLPDDKALVFKLPAIDGERWLALLAPELATAASPFAASFSSPSATSSTQPKIKGSKTN
FT                   VILPKRLTLQTPELLVGGQAWHQLTLQADPLPSGMKITAKGQEVDGSLLMADYGPWHAD
FT                   LNYLYYNPQWGSREANNPLAQAVLQEPTVLQKPQPPSGISFSDWPALQLRCKACWILGQ
FT                   NIGRVNADLTPKGSALILTNGLIEAGNGRATITGEWQQDRAGDKTTLNIGLNGPRIDET
FT                   LSFFGLTTLIKNASFAINADLNWRGVPWEPQINTLSGTLKGRLGKGQLTDLGGGRAGQL
FT                   LRLVSFDALLRKLQLDFSDTFSRDFAFDSIRSTATLKNGVMSTNDLVIDGLAADIAMNG
FT                   KVDLVKRKIAMEAVITPELSATVGVATAFAINPIVGAAVFAASKILGPLWSKVSLIRYQ
FT                   ITGSLDQPTIHEVLRQLKENEAP"
FT   sig_peptide     511923..512000
FT                   /locus_tag="YPK_0470"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.877) with cleavage site probability 0.576 at
FT                   residue 26"
FT   gene            515843..516712
FT                   /locus_tag="YPK_0471"
FT   CDS_pept        515843..516712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0471"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: ypm:YP_3875 putative
FT                   carbon-nitrogen hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66774"
FT                   /db_xref="GOA:A0A0H3B0W5"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B0W5"
FT                   /protein_id="ACA66774.1"
FT                   /translation="MKNANVALLQLCSGENTRDNLAQIEQQIKQLNAGIKLVMTPENAL
FT                   LFANAASYRHHAEHHNDGPLQQEVREMARRYGVWIQVGSMPMVSRESPDLITSSSLLFD
FT                   DQGELKARYDKIHMFDVDINDIHGHYRESDTYQPGQQLTVVDTPVGRLGMTICYDLRFP
FT                   GLFQALRAQGAEIISVPAAFTKMTGEAHWETLLRARAIENQCVILAAAQVGRHGATRRT
FT                   WGHTMAVDAWGKILGHNPDAVAALKVRIETAGLKTIRNQMPVMQHNRFQATLEPTLNKP
FT                   LLNKPPSN"
FT   gene            516724..518169
FT                   /locus_tag="YPK_0472"
FT   CDS_pept        516724..518169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0472"
FT                   /product="peptidase U62 modulator of DNA gyrase"
FT                   /note="PFAM: peptidase U62 modulator of DNA gyrase; KEGG:
FT                   ypi:YpsIP31758_0405 TldD protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66775"
FT                   /db_xref="GOA:A0A0H3AZK9"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZK9"
FT                   /protein_id="ACA66775.1"
FT                   /translation="MSLSFVSEQLLTANKLNHEDLFSVLGQLTERRLDYADLYFQSSYH
FT                   EAWVLEDSIIKDGSYNIDQGVGVRAVSGEKTGFAYADQITLNALQQSAHAARSIVRDTG
FT                   NGKVHTLGEIAYQALYPLLDPLQSLSREDKIALLHRVDKVARAADKRVQEVSASLTGVY
FT                   EQILVAATDGTLAADVRPLVRLSVSVLVEDNGKRERGACGGGGRFGYDYFLETVDGEVR
FT                   ADNFANEAVRMALVNLSAIAAPAGAMPVVLGAGWPGVLLHEAVGHGLEGDFNRRGSSVF
FT                   SGQMGKLVASELCTVVDDGTMQGRRGSLAIDDEGVPGQYNVLIENGILKGYMQDKLNAR
FT                   LMGVAPTGNGRRESYAHLPMPRMTNTYMLAGQSTPEDIIASVEYGLYAPNFGGGQVDIT
FT                   SGKFVFSTSEAYLIEKGKITHAVKGATLIGSGIEAMQQISMVGNDLALDKGVGVCGKEG
FT                   QSLPVGVGQPTLKLDNLTVGGTA"
FT   gene            complement(518371..521229)
FT                   /locus_tag="YPK_0473"
FT   CDS_pept        complement(518371..521229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0473"
FT                   /product="YD repeat protein"
FT                   /note="TIGRFAM: YD repeat protein; KEGG: yps:YPTB3557
FT                   putative insecticidal toxin"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66776"
FT                   /db_xref="GOA:A0A0H3AXF7"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="InterPro:IPR041508"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AXF7"
FT                   /protein_id="ACA66776.1"
FT                   /translation="MPNTSPTDLCANTPTLTIHDNRGLAIRTLAYNRRSHNETVDELIS
FT                   RNRYNASGQLIASRDPRLEVDNFRYQYSLSGVPLRTDSVDSGSTLQLADSAGRTVLTRD
FT                   AHHTRRWVEYETGEHSLGRPLSYREQAKGGLKTVTDRFFYGENSEQDKGCNLNGQCVRH
FT                   YDSAGLQALISQSIIDVPLQQQRRLLTETKGPVDWFGEKENWGARLSESPFVSHCTTNA
FT                   LGQLITQTDAKGHIQRMAYNRAGQLIGSWLTVKNGVEQPIVYSLTYSAAGQKLREESGN
FT                   GVITEYRYEPQTQRLIGIKTTRPAKKDRPTRLQDLRYDYDPVGNILAIHNDAEATRFYR
FT                   NQKIVPETTYRYDALYQLIEATGREADTNGIQNSQLPTLASLNDSNQFVNYTRHYHYDR
FT                   AGNLLKIQHTGASQYSTYITVSDSSNHGIQQQDGITAHDVRSQFDTAGNQRQLQPGQLL
FT                   HWNSRNQLQQVEPVPRNDGISDSENYLYDGSGSRVVKISLHKTHNAIQTRSVIYLAGLE
FT                   LRSQYNGNNLTEDFQVMTVGAAGRAQVRVLHWERGQPVDIVNDQLRYSFDNHLGSALIE
FT                   LDSDGDIISQEEYYPFGGTAVLASRNTVEAKYKTVRYSGKERDTTGLYYYGYRYYQPWL
FT                   GRWLSADPAGTIDGLNLYRMVRNNPIRLRDNNGLLTEEQIDMYVNLLSNIGLKNDDELK
FT                   SELLRYGLSEEEQDQIYLNMPMFTQSGSSSSSATSFSENSSSSGSTQSADSGYLSPVRN
FT                   YHFFEDINLVTMHRPYPTEKVSSEEIISAAAELKEASPIEILIGLDLTSENLHSYKSAL
FT                   ADEGIDYITKEKYEIKDFFEEGDLSTEQIDLTVNEILTLQESAIVGVHCGAGNGRSGII
FT                   ASALAINKLYATNEVSNFDATHPLGGTMFGNTDTYQVDIVTASAVGIIRKTNPQAVERN
FT                   EDVSALYDYSYLLYTRQHSTSL"
FT   gene            complement(521283..521456)
FT                   /locus_tag="YPK_0474"
FT   CDS_pept        complement(521283..521456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0474"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ypm:YP_3870 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66777"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZ37"
FT                   /protein_id="ACA66777.1"
FT                   /translation="MTVNECLPFPEVLLPPCQMPTFDVQTWGDYPHYVERTRLAMVRCN
FT                   ANRESALRFLQR"
FT   gene            complement(521443..521802)
FT                   /locus_tag="YPK_0475"
FT   CDS_pept        complement(521443..521802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0475"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ypi:YpsIP31758_0411 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66778"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B043"
FT                   /protein_id="ACA66778.1"
FT                   /translation="MISLSTLFGLGKSMMLLAGVVAIVWGVQASRTLDRLNQENVQLTT
FT                   QLARIGQLNQQLTQHIQATTVQLKQAQEQERLEGEKSSELQKRLRLAQKGNRCAEEPVP
FT                   AAVIRMQQQSFSDGK"
FT   sig_peptide     complement(521713..521802)
FT                   /locus_tag="YPK_0475"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.795) with cleavage site probability 0.646 at
FT                   residue 30"
FT   gene            complement(521799..522200)
FT                   /locus_tag="YPK_0476"
FT   CDS_pept        complement(521799..522200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0476"
FT                   /product="putative phage-related protein"
FT                   /note="KEGG: yps:YPTB3555 putative phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66779"
FT                   /db_xref="GOA:A0A0H3B0W8"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR039561"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B0W8"
FT                   /protein_id="ACA66779.1"
FT                   /translation="MMNDKPTFRLSQISEHNLHHVHPDLVLIVRRALTLSHIDFRVIEG
FT                   IRTPERQRQMVLNGHSKTMNSRHLTGHAVDLAPMVNNRIPWDDWHAFAHVAKAMKQAAK
FT                   AMELPLQWGGDWKNFRDGPHFELPRECYP"
FT   gene            complement(522213..522515)
FT                   /locus_tag="YPK_0477"
FT   CDS_pept        complement(522213..522515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0477"
FT                   /product="putative phage-related protein"
FT                   /note="KEGG: ypi:YpsIP31758_0413 putative phage-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66780"
FT                   /db_xref="GOA:A0A0H3AZL3"
FT                   /db_xref="InterPro:IPR032126"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZL3"
FT                   /protein_id="ACA66780.1"
FT                   /translation="MHVQVPIDDFFITWVIIGTFSAWGGLVRYIVDQNNEYEEWSWVGV
FT                   LCQVIVSAFTGLIGSLFTLETGSSRYITFAIAGLFGAMGNTALKHLWQRFFSHSK"
FT   gene            complement(522649..527118)
FT                   /locus_tag="YPK_0478"
FT   CDS_pept        complement(522649..527118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0478"
FT                   /product="virulence plasmid 65kDa B protein"
FT                   /note="PFAM: virulence plasmid 65kDa B protein; KEGG:
FT                   yps:YPTB3553 insecticidal toxin complex"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66781"
FT                   /db_xref="GOA:A0A0H3AXG1"
FT                   /db_xref="InterPro:IPR003284"
FT                   /db_xref="InterPro:IPR022044"
FT                   /db_xref="InterPro:IPR022045"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AXG1"
FT                   /protein_id="ACA66781.1"
FT                   /translation="MENSKQQVAVAPLSLPKGGGAITGMGDSLGPIGPSGMATLTLPLP
FT                   ISAGRGYAPSLTLSYSSGSGNGPFGLGWQLGTMAIRRRTNAQVPRYDEYDEFLAPNGEV
FT                   MVVAADPQGNIERTEQSLNGEQFSVIRYLPRIEGNFHRIEYWRPRTNNSQAPFWLVHSS
FT                   DGQKHGLGYSASARIADPLHPEHIAEWLLEESVSLSGEHICYQYQAEDEQDIDESEKQN
FT                   HPAASAQRYLSTVVYGNREVAHELYCLTQRPAPTSWLFSLIFDHGEYSNIAEQVPVIIK
FT                   GKSWNFRQDAFSRFSCGFEVRTRRLCQQVLMYHNLSALKGDEPDAQATLVSRLRLHYQH
FT                   DAYATQLVGCQQLAHEPDGTKRSLPPLEFDYQDFSTRDALGWQPLTDWAEFNYQYQMVD
FT                   LNGEGIPGMLYQDSGHWIYRPPVRQPGTADGITFGAAQRLPSLPAMRENAMLMDINGDG
FT                   KLDWVISQPGLAGYFSRDPDLSRDPDLSWTQFIPLSTLPAEYFHPQAQLVDLAGSGLSD
FT                   LALVGPKSVRVYTNLCDSFAAATQVAQDDDITLPLPGVHFTELVAFSDVMGSGQQHLVR
FT                   IRHNSVTCWPNLGHGRFGHPLSLPGFNQPIEQFNPLAIYLADIDGSGTIDLIYATTSQL
FT                   LIYRNQSGNRFAEPVAIALPTGIRFDNSCQLSLADIQGLGVASIMLSVPHPTTQHWRYD
FT                   FVASKPYLLCTTNNNMGAESQLFYRSSAQFWLDEKAQAAKQGRSLACQLPFPIHLLAQT
FT                   TQLDEITGNSLSQTARYFHGFYDGVQREFCGFGRVDTLDTDTSAQGSAAERTAPTKSSN
FT                   WFHTGRADNETLWQSEYWQGDDQDYPLLPTRLTKFINDTQGDDVLSELDDNQTFWLHRA
FT                   LKGSLLRSELYGLDGSELATQPYSVNSARYQVRQIQSSTDEITSPVALPMMLEQLNYHY
FT                   ERIVQDPQCNQQIVLRCDEFGHPLHSATIYYPRRDKASIPPYSWLAEGHWDSHFDEQQQ
FT                   QLRITESQQSYHHEISDKFYVLGLPAGQRSDVLTYPDNFVPTAGIHWEELQQPEGLLGT
FT                   KAERTFAGQQQVFYASDTIPGLVAYSQQAEFDDQTLAALDELLPTNEREQQLIEAGYQR
FT                   APRLFSRPGETDIWAAQRGFTDYGDASRFYRPISQRSSPLVGKTALEWDKNSCAITQMI
FT                   LADGSTTQAEYDYRFITPYHLTDINDNSRHIELDALGRVTSSRFWGTELDSQTGEVSTT
FT                   GFPLIAEPPFTVPNSVDAAISMENTQVPVAQFSVYQPQSWMISLQLDDIETLSETNNVT
FT                   LEYLFQNHILIDNYYLCPLALRRWIRQSNPLITEYVGLTLKNPVRQPPHVLTVVVDNYF
FT                   SAAEPQQHQQTLAFSDGFGRVLQSAQRVEAGTAYFHTGEGGLEMDQQGHLTQDESDQRW
FT                   AVSGRTEYDNKGLPIRRYQPYFLDDWRYIADDNARKEAWADTHIYDPLGREIKVITAKG
FT                   YLRRAHYFPWFVISEDENDTASEITPNP"
FT   gene            complement(527175..530768)
FT                   /locus_tag="YPK_0479"
FT   CDS_pept        complement(527175..530768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0479"
FT                   /product="toxin subunit"
FT                   /note="KEGG: ypp:YPDSF_0286 toxin subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66782"
FT                   /db_xref="InterPro:IPR040840"
FT                   /db_xref="InterPro:IPR041079"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZ46"
FT                   /protein_id="ACA66782.1"
FT                   /translation="MPTSTVLNKINESRRDALVNYYLAKNVSGDEKIKTAEQLYQYLLL
FT                   DTKIGHEVKTSSIAEAISSLQIYINRCVDGEENDLHEKNISTHFSSDNFLHGWNSYNKR
FT                   YARWAGKEKLMYYAADYIDPTLRYNKTELFNTFEQSINNSRLTEKSVKSALQSYLISYE
FT                   KLAQIDTIKELYVENIKTHFFLGKTRESPCQYYWRSGEQLSNDSHHLRWSEWKKVNCNI
FT                   NGTEEKFFINLSWHRSSLYIDWINKFSIRTDKDETTEKYHYNRVYKNDDNTWSELIINM
FT                   DIGFKLSTSTEVITLPPFFVNQGNQNAKEEVENLFLTNGTSIKKIESRIHGYIKGHIKV
FT                   LCNDDGISFEIAEKLINGDNGTIGDIKIVENGKNILVINNEKGENKKINLIDKFEIKIF
FT                   PYNELVASTIAFNRIKPEEKIIDELDDKISLLSPNSLPLKEKFQTSVDELLSYNTQKNN
FT                   VKLDAFNGSYGIYLWELFFHIPLLASMRFLNEQRFDLAKHWLKYLFNSAGYRDGNGNLL
FT                   KEGDNILYWNSLPLQQDTAWDNNTLIQATDDPDVIAMQDPMQYKLAIFMRTLDLIISQG
FT                   DQAYRQLERDTLAEAKIHYIQASQLLGPRPNLNRGHQWEDIKLAEESRQLENSHFLPPY
FT                   NELLLSYWDKLEIRLYNLRHNLNLDGQPLHLPLFATPVDPKALQRQHGAGNGIISSEQM
FT                   ATAQTSLYRFPLLIERAKSAVSSVIQFGNSLQSVLERQDNEAMTLLFQQQQQKVLQHTK
FT                   DIQNNNIQVLQASLEATDSLKSAAEQRRKHYKELLDNGISSDEQLAINIRIASAALNAE
FT                   SLVPLGLSAVLDTAPNVFGLADGGSRWGAISQAVGWGMQSLALGLETTAGVRDAKANYS
FT                   RRAQEWTLQKNQADKDIEQLAHQYTSVREQLNMAQKQLNLAELEQGHADALYQMQSSRF
FT                   TGKELYNWMAGRLSGLYFQLFDATQPLCLMAKAVLEKEVDKAKTDGLFIRSGWNDLYQG
FT                   LLAGEDLQLNLQKLENVWLMEEQRALEVERTVSLAQHYQQLSDHKFNLAEIVTGYMAQD
FT                   KDQKTGNEQDFVELKNSTLITSLSIKGLNLVEDYPETMHLGDIRRIKQISVSLPALLGP
FT                   YQDVQATLDYAGENTHLAKGCTALAISRGMNDSGQFLLDFNDGKYLPFEGIDISDKGTL
FT                   VLRFPNATSKQKLLLQSLSDIILHIRYTIRS"
FT   gene            complement(530809..533310)
FT                   /locus_tag="YPK_0480"
FT   CDS_pept        complement(530809..533310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0480"
FT                   /product="virulence plasmid 28.1 kDa A protein"
FT                   /note="PFAM: virulence plasmid 28.1 kDa A protein; KEGG:
FT                   ypp:YPDSF_0287 insecticidal toxin"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66783"
FT                   /db_xref="InterPro:IPR018003"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B046"
FT                   /protein_id="ACA66783.1"
FT                   /translation="MQDNIDHTASVITDTDNTIHQQAKAEERHRQAVRRATQLRNDPVL
FT                   SGINKLAFSVAPKILQPEARTDLSLAEGIPERANEYADPASIQSLFSPGRYLCELYHVA
FT                   KELHEDGNKLHIDQRRPDLQDLVLNNSNMNQEVSSLEILLNVLQTKAPLDELTKDTEAH
FT                   VNDVSFTLPYDDNLTVINAVLQDKSTSLREIAALLAENNDPWANPITPALVQEQLGLNP
FT                   ASYELIDIKSPLDESYAKRLAHATQLSVEQLQWLNKNAIENSSNKNDPAKLEILAVISE
FT                   YRRLHQRYGLSVDPFIAIINAVNTTHTNENKTSFFQQIFSTLDVDAGFNFLDQGSWEVI
FT                   IRKALGITAEELLRIAKYCFGKSSISNVKMNSKKFSQLYRMAMIPRTLGVSFSQAEYLW
FT                   QLYSHPDENIMEKIAQGNALTIIDAIIVLENTLQWMSEQKLDITTLQAMLTKQYSTTAT
FT                   PELFNFLSNIYQTLGKQVYSESLKPNLYRSLANGFHLKANVVAGLVNWLAKNDSEFTLE
FT                   RFWQNISMTFAEEPSLHQLEVHQPLILQCQKLSQYVLIAQWAMLSEQEIALILLPNGID
FT                   NRGRAPSPSITLLKLLSEFKLWQQEAEVSQSELFDIMQQLITGTNEKQENLRNAAEKVL
FT                   RSIAKNIGDIDSDIDRADSTINIRNGSATLFPPEHPMYKALKLEVSNLEKSKIQLEGKK
FT                   KEEEIKLEQAKDNIQSLINNWDSEIIIRLADAYHWDINIANSMFILIFGEKINFTFHYE
FT                   NRNDYHYEEHYGYRFEQKPMYSFDKKLTNGFGSILLLKNHIYIAEKLKIHPGTIIKIKN
FT                   YIFDDKSNELENIANKLRVNL"
FT   gene            complement(533546..534358)
FT                   /locus_tag="YPK_0481"
FT   CDS_pept        complement(533546..534358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0481"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; KEGG: ypp:YPDSF_0289
FT                   LysR-family transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66784"
FT                   /db_xref="GOA:A0A0H3B0X0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B0X0"
FT                   /protein_id="ACA66784.1"
FT                   /translation="MTNAAVKLFTTPPPMSRSLKILEEELGFKLFTRTTSGLKLTLEGA
FT                   AFYQEIYPTYVRLTEITKNYKKNKNGIINIATYQLNSDHAGVICDYFIKKGNFNIELRE
FT                   NIGDISQMDIVISTKEIKGYDFDTELTASCEIKLLYASHLNDLPDRVEYLKKLPFIQSS
FT                   IFCSSCCFKRFSHNLIQQGYSGNVLRIDDARVRHEIIKKGAGISLSTNYFFDKKKISHS
FT                   TEISFISDINFDITYYIYFKSSVINKEFFIQYITNNSLLQWQKAEKKH"
FT   gene            complement(534673..535584)
FT                   /locus_tag="YPK_0482"
FT   CDS_pept        complement(534673..535584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0482"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: ypk:y0180 transcriptional
FT                   regulator LYSR-type"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66785"
FT                   /db_xref="GOA:A0A0H3AZL6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZL6"
FT                   /protein_id="ACA66785.1"
FT                   /translation="MERLKQMSVFAKVVECGSFTAAARRLENSVSSISQTVSKLENELN
FT                   VKLLNRSTRRIGLTEAGRIYYQGCRRMLQEVQQVHEQLYAFNNTPTGTLRIGCSSTMAQ
FT                   NVLATMTADMLKAYPGLSVNLVAGIPAPDLIADGLDVVIRVGALQNSGLFSRRLGAMPM
FT                   VVCAAKSYLSQYGTPAKPSDMANFSWLEYNVRPDSNFELIAPEGITTQISPQGRFVTND
FT                   SQTMIRWLKAGAGIAYAPLMWVIEEIKRGEVEILFKHYHSDPRPVYALYTEKDKMPLKV
FT                   QVCIDYLTEYFKRVADVYQDYR"
FT   gene            535887..536090
FT                   /locus_tag="YPK_0483"
FT   CDS_pept        535887..536090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0483"
FT                   /product="protein of unknown function DUF1656"
FT                   /note="PFAM: protein of unknown function DUF1656; KEGG:
FT                   ypi:YpsIP31758_0419 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66786"
FT                   /db_xref="GOA:B1JKI1"
FT                   /db_xref="InterPro:IPR012451"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JKI1"
FT                   /protein_id="ACA66786.1"
FT                   /translation="MSLLPVMVIFGLSFPPIFLELLISLALFFVVRRILQPTGIYEFVW
FT                   HPALFNTALYCCLFYLTSRLFS"
FT   gene            536098..537033
FT                   /locus_tag="YPK_0484"
FT   CDS_pept        536098..537033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0484"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   ypm:YP_3858 putative HlyD family secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66787"
FT                   /db_xref="GOA:B1JKI2"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR022871"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JKI2"
FT                   /protein_id="ACA66787.1"
FT                   /translation="MSTFSLKIIRVGITVLVVVLAVIAIFNVWAFYTESPWTRDAKFTA
FT                   DVVAIAPDVSGLLTEVPVKDNQLVQKGQILFVIDQPRYQQALAEAEADVAYYQTLAAEK
FT                   QRESSRRHRLGIQALSQEEIDQASNVLQTVQHQLAKAIAVRDLARLDLERTTVRAPAEG
FT                   WVTNLNVHAGEFINRGATAVALVKKDTFYILAYLEETKLEGVKPGYRAEITPLGSNRIL
FT                   HGTVDSISAGVTNSSSSADSKGLATIDNNLEWVRLAQRVPVKIHLDSEDQQYLYPAGTT
FT                   ATVVITGPNDRDPHQVSPMTKLMHRLREFG"
FT   sig_peptide     536098..536190
FT                   /locus_tag="YPK_0484"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.981) with cleavage site probability 0.978 at
FT                   residue 31"
FT   gene            537035..538990
FT                   /locus_tag="YPK_0485"
FT   CDS_pept        537035..538990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0485"
FT                   /product="Fusaric acid resistance protein conserved region"
FT                   /note="PFAM: Fusaric acid resistance protein conserved
FT                   region; KEGG: ypi:YpsIP31758_0421 p-hydroxybenzoic acid
FT                   efflux pump subunit AaeB"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66788"
FT                   /db_xref="GOA:B1JKI3"
FT                   /db_xref="InterPro:IPR006726"
FT                   /db_xref="InterPro:IPR023706"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JKI3"
FT                   /protein_id="ACA66788.1"
FT                   /translation="MTHPSFIRLRFAFKLSFAIVAALFLGFHLQLETPRWSVLTAAIVS
FT                   AGPAFAAGGEPFSGAIRHRGWLRIIGTFIGCIGGLVIIVLTIRAPVLTLMLCCLWAGIC
FT                   TWISSLVRVENSYAFGLAGYTALIIIVTTGETPLLTPQFAVERCSEIVLGIVCAVMADL
FT                   LFSPRSIKQDIDRLVDKVLVDQYRLLQLCIQPAEKSEIDRAWNELVKNTTSLNGMRSYL
FT                   MMESSRWQRCNRRLQVLHTESLALITQACETYLVMSNHPEVISAELKTMLSEPAQTPAE
FT                   IHQQMKKLRQFIAASHSEAIPHTISSWVGAATRYLLLSKGIQTNSSINQVEEDILAGDA
FT                   PVKPISAEGHHAMINGLRTGIATAIGGLFWLWTGWTSGAGCMVMIAVVTSLAMRTPNPR
FT                   RMALDFLVGVIIALPIGALYFMFIIPSTQQSMLLLCISLGVLAFIIGIEVQKRRLGSLG
FT                   TLASTINIIVLSNPMIFNVRQFLDSALGQIVGCFVSLIVLLLIRDNAKDRTGRTLLNRF
FT                   VYSAVSALTTNKTKRGENHLPALYQQLNQLLMMFPADIDKYRLALTLIIAHQRLNRTEI
FT                   PVNAELSAFHKQIRSTAERVITVNNDQKRRYYFARLLQELDQYQQKLVDYQAADAVIRP
FT                   VKRLTEMLRKYQSALI"
FT   sig_peptide     537035..537190
FT                   /locus_tag="YPK_0485"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.916 at
FT                   residue 52"
FT   gene            539257..540726
FT                   /locus_tag="YPK_0486"
FT   CDS_pept        539257..540726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0486"
FT                   /product="succinic semialdehyde dehydrogenase"
FT                   /note="TIGRFAM: succinic semialdehyde dehydrogenase; PFAM:
FT                   Aldehyde Dehydrogenase_; KEGG: ypi:YpsIP31758_0422
FT                   succinate-semialdehyde dehydrogenase (NADP+)"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66789"
FT                   /db_xref="GOA:A0A0H3AXG4"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AXG4"
FT                   /protein_id="ACA66789.1"
FT                   /translation="MPAQNPLQHQRQHDGIYHIGYFVGGKWSQAQEQFDVCNPATGELV
FT                   ARVAKSGKQETEAAIKAASEAFPAWRKTPAKQRAEILQRWYLLIMEHQQSLAELMVSEQ
FT                   GKPLKEALVEVAYAASFIQWFSEQAKRANGEIIPSAKEGARILATREPIGVVAAITPWN
FT                   FPLAMLTRKLGPALAAGCTGLIKPANNTPLSAFALLALAEQAGVPAGVLNGVVGDTHAI
FT                   SDAIMASSDVRKISFTGSTNVGKTLMRNAAATMKRISMELGGNAPYIVFDDADLEAAVA
FT                   GAMACKFRNAGQVCVCVNRFYIQDAIYDEFVNRLAAEVKKLKVGNGMDKDVNMGPLINL
FT                   AGLEKVEEHVKDALEKGGRLLAGGHRHALGGNFFQPTVIADANEQMKVASEETFGPLAA
FT                   CFRFSTEAEVIQRANNTPFGLAAYFYTQNLQRVFRVSEALESGMIGVNECSVSTELAPF
FT                   GGVKESGLGREGSVLGLDEFMEVKTLHLGNL"
FT   gene            540921..541394
FT                   /locus_tag="YPK_0487"
FT   CDS_pept        540921..541394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0487"
FT                   /product="guanine-specific ribonuclease N1 and T1"
FT                   /note="PFAM: guanine-specific ribonuclease N1 and T1; KEGG:
FT                   ypm:YP_3855 putative ribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66790"
FT                   /db_xref="GOA:A0A0H3AZ49"
FT                   /db_xref="InterPro:IPR000026"
FT                   /db_xref="InterPro:IPR001887"
FT                   /db_xref="InterPro:IPR016191"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZ49"
FT                   /protein_id="ACA66790.1"
FT                   /translation="MNKRLMAILGAVLLLIAGAWQGIDGVTVRDIGSSAELERPALSAS
FT                   AATESLTQHQKVVKYLQTHHRLPDFYLTKKQAREQGWDAQKGNLCDVLPGKAIGGDRFS
FT                   NRERQLPDAKGRHWREADVNYRCGRRGSDRLLYSNDGLIYLTQDHYKHFIRME"
FT   sig_peptide     540921..540980
FT                   /locus_tag="YPK_0487"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.515 at
FT                   residue 20"
FT   gene            541399..541680
FT                   /locus_tag="YPK_0488"
FT   CDS_pept        541399..541680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0488"
FT                   /product="Barstar (barnase inhibitor)"
FT                   /note="PFAM: Barstar (barnase inhibitor); KEGG:
FT                   ypi:YpsIP31758_0424 barstar"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66791"
FT                   /db_xref="InterPro:IPR000468"
FT                   /db_xref="InterPro:IPR035905"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B051"
FT                   /protein_id="ACA66791.1"
FT                   /translation="MVKVVFDFNHIPDLPAFYRAFSQNFALSEDFGANLDALWDVVTGE
FT                   IALPVEIEFVHFSRRHQRRFAAIVLLLEEAEEELAGRLHFNVVDEHIV"
FT   gene            complement(541776..542324)
FT                   /locus_tag="YPK_0489"
FT   CDS_pept        complement(541776..542324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0489"
FT                   /product="protein of unknown function DUF615"
FT                   /note="PFAM: protein of unknown function DUF615; KEGG:
FT                   ypi:YpsIP31758_0425 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66792"
FT                   /db_xref="InterPro:IPR006839"
FT                   /db_xref="InterPro:IPR023153"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JKI7"
FT                   /protein_id="ACA66792.1"
FT                   /translation="MNKQPEDWLDDVPENKNDDDDEIIWVSKSEIKRDAEALKDLGTEL
FT                   VDLGKNALERIPLDEDLLAAIELAQKIKKEGRRRQIQLIGKMLRARDVEPIQTALDKLK
FT                   NRHNQQVSLFHKLETLRDRLIAEGDDAIPTVLELYPDADRQQLRSLVRNAQKEQAANKP
FT                   PKSFRQIFSYLRELAEKQQ"
FT   gene            542505..543845
FT                   /locus_tag="YPK_0490"
FT   CDS_pept        542505..543845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0490"
FT                   /product="peptidase U62 modulator of DNA gyrase"
FT                   /note="PFAM: peptidase U62 modulator of DNA gyrase; KEGG:
FT                   ypi:YpsIP31758_0426 PmbA protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66793"
FT                   /db_xref="GOA:A0A0H3B0X3"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B0X3"
FT                   /protein_id="ACA66793.1"
FT                   /translation="MKVVTQVAEQRKTLEQAVAQALELARAGSDAAEVAVSKTTGISVS
FT                   TRFGEVENVEFNSDGALGITVYHQQRKGSASTTDLNPDAVARTVQAALDIARYTSPDPY
FT                   AGPADKSLLAFDAPDLDLFHPSDLDAEQGILLAARAEQAALQADKRITNTEGGSFNSHY
FT                   GIKVFGNSHGMLQSYCSSRHSLSSSVIAEHNGDMERDYAYTIGRRMEDLATPEWVGEEC
FT                   ARRTLSRLSPRKLPTMQSPVLFAAEVATGLFGHLVSAISGGNIYRKSTFLLDHLGQQIL
FT                   PEWLTIEEHPHLLRGLASTPFDSEGVRTLQREIVKDGVLQTYLLTSYSARKLGLQSTGH
FT                   AGGIHNWRIAGQGQDFAGMLKQLDKGLVVTELMGQGVSTVTGDYSRGAAGFWVENGEIQ
FT                   YPVSEITIAGNLKDMLRNIVSVGSDIETRSNIQCGSVLLPVMKIAGE"
FT   gene            544005..544613
FT                   /locus_tag="YPK_0491"
FT   CDS_pept        544005..544613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0491"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ypi:YpsIP31758_0427 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66794"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZM0"
FT                   /protein_id="ACA66794.1"
FT                   /translation="MIVMPSTYSPATIAREFKVIHEFELSSMKYGVIFDKNVPKAAIIR
FT                   MNTESFNGIPRHRIIAALDLVAKQELGENVISVQRFWQDSALFQVEGMVVEQGARGKGL
FT                   ATLLYEELVVKCGVILMSDNKQYEAGKALWQKIAQESDKLAVFILDSDVGQFYPYCGDR
FT                   VPYNGKGIPEEKIWSLHPDTTKWGVVLVAENREKISQYC"
FT   gene            544821..545207
FT                   /locus_tag="YPK_0492"
FT   CDS_pept        544821..545207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0492"
FT                   /product="cytochrome b562"
FT                   /note="PFAM: cytochrome b562; KEGG: ypi:YpsIP31758_0428
FT                   cytochrome b562"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66795"
FT                   /db_xref="GOA:A0A0H3AXG9"
FT                   /db_xref="InterPro:IPR009155"
FT                   /db_xref="InterPro:IPR010980"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AXG9"
FT                   /protein_id="ACA66795.1"
FT                   /translation="MGKTLMALITAALLSTSSLVMAASVADDMETIAEHYGKVLKADST
FT                   AVIKQDLQAMRVAAVDAQKGIPTKLKSKVEDSPEMKDFRHGMDVLIGEIDGALALADQG
FT                   KLDEAKQAAQDFKDTRNTYHKKYR"
FT   sig_peptide     544821..544889
FT                   /locus_tag="YPK_0492"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.965 at
FT                   residue 23"
FT   gene            complement(545439..545849)
FT                   /locus_tag="YPK_0493"
FT   CDS_pept        complement(545439..545849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0493"
FT                   /product="GreA/GreB family elongation factor"
FT                   /note="KEGG: ypm:YP_3849 regulator of nucleoside
FT                   diphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66796"
FT                   /db_xref="GOA:A0A0H3AZ54"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028625"
FT                   /db_xref="InterPro:IPR029462"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZ54"
FT                   /protein_id="ACA66796.1"
FT                   /translation="MTKPTITINELDAERLDALLAQPAFAGSVVATALNEELDRAEILP
FT                   PNEIPADVVTMNSRVRFLDLNSQEEHIRTLVYPASLKDSNEQLSVMAPLGAALLGLHVN
FT                   DEISWKLPGGDETRITVLELLYQPESAGEYHR"
FT   gene            complement(546202..547863)
FT                   /locus_tag="YPK_0494"
FT   CDS_pept        complement(546202..547863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0494"
FT                   /product="alpha,alpha-phosphotrehalase"
FT                   /note="KEGG: ypm:YP_3848 putative trehalose-6-phosphate
FT                   hydrolase; TIGRFAM: alpha,alpha-phosphotrehalase; PFAM:
FT                   alpha amylase catalytic region; SMART: alpha amylase
FT                   catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66797"
FT                   /db_xref="GOA:A0A0H3B056"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012769"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022567"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B056"
FT                   /protein_id="ACA66797.1"
FT                   /translation="MNNPIPWWQHGVIYQIYPKSFQDSTGNGYGDLAGVAQRLDYLQKL
FT                   GVDAIWLTPVYVSPQVDNGYDVADYCAIDPAYGTLDDFKRLVAGAHQRGIRIIMDMVFN
FT                   HTSTEHAWFKASQDRNSPYRQFYIWRDGGDGSLPNNWRSKFGGHAWQWHAASGQYYLHL
FT                   FAPEQADLNWEHQPVRDELKKVCEFWADLGVDGLRLDVINLVSKQQDFPNDLDGDGRRF
FT                   YTDGPRIHEFLQELSRDVFQPRRLMTVGEMSSTRLEHCQRYAALGGDELSMTFNFHHLK
FT                   VDYLNGEKWSLMPPNRVELKHIFNQWQQGMHNRAWNALFWCNHDQPRIVSRFGHEGALR
FT                   LPAAKMLAMVLHGMQGTPYIYQGEEIGMTNPNFTDITQYRDVESLNMFAELSVAGREPD
FT                   ELLAILAAKSRDNSRTPMQWDSSDNAGFSQGTPWIAPCSNYHEINVNAALADADSVFYA
FT                   YQYLIALRKQYDIFTFGDYQDLCPQHPDLWCYLRSWQGKQLLVVANLSEEPQRWQPEGL
FT                   TLDGNWQLLMSSYDQSAFQPQDMILRGYEGIYWVCE"
FT   gene            complement(547958..549373)
FT                   /locus_tag="YPK_0495"
FT   CDS_pept        complement(547958..549373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0495"
FT                   /product="PTS system, trehalose-specific IIBC subunit"
FT                   /note="TIGRFAM: PTS system, trehalose-specific IIBC
FT                   subunit; PTS system, glucose-like IIB subunint; PFAM:
FT                   phosphotransferase system PTS EIIB protein;
FT                   phosphotransferase system EIIC; KEGG: yps:YPTB3536 PTS
FT                   system, trehalose-specific IIBC component"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66798"
FT                   /db_xref="GOA:A0A0H3B0X9"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011296"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B0X9"
FT                   /protein_id="ACA66798.1"
FT                   /translation="MGKVKQQDIDQLIVLVGGRENIATVSHCITRLRFVLKDPSIASPK
FT                   EIENLSMVKGCFTNAGQFQVVIGPEVDDYYKALIAKIGQSEVDKEQTKLAARQNMTWFE
FT                   RGISHFAEIFFPLLPALISGGLILGFRNVIGDIPMSEGKTLAQMYPAWQTIYDFLWLLG
FT                   EAIFFYLPVAICWSTVKKMGGTPVLGIVLGITLVSPQLMNSYLLGQQLPDVWNFGWFTI
FT                   EKVGYQAQVIPSILAGLALGWIETNLKKIIPAYLYLVVVPVVSLLLAVFLAHTLIGPFG
FT                   RMIGDGVAWGVKAVMTGSFAPVGAALFGFLYAPLVITGVHQTTLAIDMQMVQSMGGTPV
FT                   WPLIALSNIAQASAVLGIIIISRKINEREISVPAAISAYLGVTEPAMYGINLKYRFPML
FT                   CAMIGSALAGLICGLTGVMANGIGVGGLPGILSIQPQFWGIYAVAMLVAIVVPLALTIL
FT                   VYKRKERRGELPV"
FT   gene            complement(549784..550737)
FT                   /locus_tag="YPK_0496"
FT   CDS_pept        complement(549784..550737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0496"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="TIGRFAM: trehalose operon repressor; PFAM:
FT                   regulatory protein LacI; periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: ypm:YP_3846 trehalose
FT                   operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66799"
FT                   /db_xref="GOA:A0A0H3AZM4"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR012771"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZM4"
FT                   /protein_id="ACA66799.1"
FT                   /translation="MQNRLTIKDIARMSGVGKSTVSRVLNNEGSVSPQTRERVEAVIRQ
FT                   HGFTPSKSARAMRGQSDKVVGIIVSRLDSPSENQAVRTMLPLFYQQGYDPILMESQFDT
FT                   TLVSEHLHILQQRHVDGVILFGFSGLTAEMLAPWQEKMVVLAREYRGFSSVCYDDEGAI
FT                   YLLMDKLRQAGHRHISYIGVQSSDATTGMRRYQAYLDYSQQHGLTPMVALGELSYQSGF
FT                   QLAPQVITPQTSALVCASDTIAMGVSKYLQQQEREQPPIQVCGIGNTPLLHFLFPDTLT
FT                   IELGYGRAGVKAAQQLLDQLSNSQPIQQIIIPGQLV"
FT   gene            complement(550971..551447)
FT                   /locus_tag="YPK_0497"
FT   CDS_pept        complement(550971..551447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0497"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ypi:YpsIP31758_0433 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66800"
FT                   /db_xref="InterPro:IPR031948"
FT                   /db_xref="InterPro:IPR038643"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AXH2"
FT                   /protein_id="ACA66800.1"
FT                   /translation="MKLRTWLLIPIICSPFFWGSTAIAKNGVAIPLPDKRVAVLSEGDL
FT                   ESASVGTYSVAIFKNDTFLDFIAGGVFSRDGSIFQDNGKPRVEFTDINGDGNKELIVSQ
FT                   LTAGSGNYLRVDAFSLGPDSINKVLSIQSDTKSDYISLLKELCEICLPIDAPPH"
FT   sig_peptide     complement(551373..551447)
FT                   /locus_tag="YPK_0497"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.976 at
FT                   residue 25"
FT   gene            complement(551746..552132)
FT                   /locus_tag="YPK_0498"
FT   CDS_pept        complement(551746..552132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0498"
FT                   /product="endoribonuclease L-PSP"
FT                   /note="TIGRFAM: endoribonuclease L-PSP; PFAM:
FT                   Endoribonuclease L-PSP; KEGG: ypi:YpsIP31758_0434 putative
FT                   endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66801"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZ61"
FT                   /protein_id="ACA66801.1"
FT                   /translation="MSRVISTELAPAAIGPYVQGVDLGSMIITSGQIPVDPKTGLVADD
FT                   IAAQARQSLENVKAIVEAAGLNVADIVKTTVFVKDLNDFSTVNATYEAFFTEHSAPFPA
FT                   RSCVEVARLPKDVKIEIEAIAVRR"
FT   gene            complement(552270..552737)
FT                   /locus_tag="YPK_0499"
FT   CDS_pept        complement(552270..552737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0499"
FT                   /product="aspartate carbamoyltransferase, regulatory
FT                   subunit"
FT                   /note="TIGRFAM: aspartate carbamoyltransferase, regulatory
FT                   subunit; PFAM: aspartate transcarbamylase regulatory
FT                   subunit; KEGG: yps:YPTB3532 aspartate carbamoyltransferase
FT                   regulatory chain"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66802"
FT                   /db_xref="GOA:B1JKJ7"
FT                   /db_xref="InterPro:IPR002801"
FT                   /db_xref="InterPro:IPR020542"
FT                   /db_xref="InterPro:IPR020545"
FT                   /db_xref="InterPro:IPR036792"
FT                   /db_xref="InterPro:IPR036793"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JKJ7"
FT                   /protein_id="ACA66802.1"
FT                   /translation="MMTQDYKLQVEAIKCGTVIDHIPAQIGFKLLSLFKLTATDQRITI
FT                   GLNLPSKRSGRKDLIKIENTFLTEQQANQLAMYAPDATVNRIDNYEVVKKLTLSLPERI
FT                   DAVLTCPNSNCISHNEPVDSSFTVKAQRGEISLKCKYCEKEFDHLAVLHAD"
FT   gene            complement(552746..553681)
FT                   /locus_tag="YPK_0500"
FT   CDS_pept        complement(552746..553681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0500"
FT                   /product="aspartate carbamoyltransferase"
FT                   /EC_number="2.1.3.2"
FT                   /note="KEGG: ypi:YpsIP31758_0436 aspartate
FT                   carbamoyltransferase; TIGRFAM: aspartate
FT                   carbamoyltransferase; PFAM: aspartate/ornithine
FT                   carbamoyltransferase Asp/Orn-binding region;
FT                   aspartate/ornithine carbamoyltransferase carbamoyl-P
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66803"
FT                   /db_xref="GOA:B1JKJ8"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JKJ8"
FT                   /protein_id="ACA66803.1"
FT                   /translation="MANPLYHKHIISINDLSRDELELVLRTAASLKKTPQPELLKHKVI
FT                   ASCFFEASTRTRLSFETSIHRLGASVVGFSDSSNTSLGKKGETLADTMSVISTYVDAIV
FT                   MRHPQEGASRLAAQFSGNVPIVNAGDGANQHPTQTLLDLFTIQETQGRLDNINIAMVGD
FT                   LKYGRTVHSLTQALAKFNGNRFFFIAPDALAMPAYILQMLEEKEIEYSLHESLEEVVPE
FT                   LDILYMTRVQKERLDPSEYANVKAQFILRSSDLTGARDNLKVLHPLPRIDEITTDVDKT
FT                   PYAYYFQQAGNGIFARQALLALVLNAELAL"
FT   gene            complement(554019..554291)
FT                   /locus_tag="YPK_0501"
FT   CDS_pept        complement(554019..554291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0501"
FT                   /product="Phosphotransferase system, phosphocarrier protein
FT                   HPr"
FT                   /note="TIGRFAM: phosphocarrier, HPr family; PFAM:
FT                   phosphocarrier HPr protein; KEGG: ypi:YpsIP31758_0437
FT                   phosphocarrier protein, HPr family"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66804"
FT                   /db_xref="GOA:A0A0H3B059"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B059"
FT                   /protein_id="ACA66804.1"
FT                   /translation="MTVKQTVEIKNKLGMHARPAMKLFELVQSFDAEVMLRNDSGTEAE
FT                   ASSVIALLMLDSAKGRQIEVEATGVDEIQALAAVIELFNSGFDED"
FT   gene            complement(554288..555142)
FT                   /locus_tag="YPK_0502"
FT   CDS_pept        complement(554288..555142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0502"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   ypi:YpsIP31758_0438 P-loop ATPase protein family"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66805"
FT                   /db_xref="GOA:B1JKK0"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JKK0"
FT                   /protein_id="ACA66805.1"
FT                   /translation="MVLMIVSGRSGSGKSVALRALEDMGFYCVDNLPVVLLPQLASTLA
FT                   DRNISAAVSIDVRNMPESPEVFEHAMTQLPDSFSPQLLFLDADRNTLIRRYSDTRRLHP
FT                   LSAKNLSLESAIDEESDLLEPLRSRADLIIDTSEMSVHELAEMLRTRLLGKRERELTMV
FT                   FESFGFKHGIPIDADYVFDVRFLPNPHWDPKLRPMTGLDKPVISFLDRHTEVHNFIYQT
FT                   RSYLEQWLPMLETNNRSYLTVAIGCTGGKHRSVYVAEQLADYFRARGKNVQSRHRTLEK
FT                   RKQ"
FT   gene            complement(555448..555930)
FT                   /locus_tag="YPK_0503"
FT   CDS_pept        complement(555448..555930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0503"
FT                   /product="PTS IIA-like nitrogen-regulatory protein PtsN"
FT                   /note="TIGRFAM: PTS IIA-like nitrogen-regulatory protein
FT                   PtsN; PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; KEGG: ypi:YpsIP31758_0439
FT                   nitrogen regulatory IIA protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66806"
FT                   /db_xref="GOA:A0A0H3B0Z4"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR006320"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B0Z4"
FT                   /protein_id="ACA66806.1"
FT                   /translation="MTNDPALQLSSVLNIESTKSSVHCSSKKRALEIISELAAKQLNLP
FT                   SQVVFDAVLTRERMGSTGIGSGIAIPHGKLEEDTLRAVGVFIRLEQPIAFDAIDNQPVD
FT                   LLFALLVPADQCKTHLHTLSLVAKRLADKTVCRRLRSAQSDDELYQIITELPPEIA"
FT   gene            complement(556049..556336)
FT                   /locus_tag="YPK_0504"
FT   CDS_pept        complement(556049..556336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0504"
FT                   /product="sigma 54 modulation protein/ribosomal protein
FT                   S30EA"
FT                   /note="TIGRFAM: ribosomal subunit interface protein; PFAM:
FT                   sigma 54 modulation protein/ribosomal protein S30EA; KEGG:
FT                   ypi:YpsIP31758_0440 ribosomal subunit interface protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66807"
FT                   /db_xref="GOA:A0A0H3AZM5"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZM5"
FT                   /protein_id="ACA66807.1"
FT                   /translation="MQLNITGHHVEITEALREFVTTKFAKLEQYFDRINQVYVVLSVEK
FT                   VKQIAEATVHVNGGELHASSEQEDMYAAIDILVDKLARQLNKHKDKLKQH"
FT   gene            complement(556360..557793)
FT                   /locus_tag="YPK_0505"
FT   CDS_pept        complement(556360..557793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0505"
FT                   /product="RNA polymerase, sigma 54 subunit, RpoN"
FT                   /note="TIGRFAM: RNA polymerase sigma-54 factor, RpoN; PFAM:
FT                   sigma-54 factor; sigma-54 factor core-binding region;
FT                   sigma-54 DNA-binding domain protein; KEGG:
FT                   ypi:YpsIP31758_0441 RNA polymerase sigma-54 factor"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66808"
FT                   /db_xref="GOA:A0A0H3AXH6"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AXH6"
FT                   /protein_id="ACA66808.1"
FT                   /translation="MKQGLQLKFSQQLAMTPQLQQAIRLLQLSTLELQQEIQLALESNP
FT                   LLEQTDLHEEIDAKETVDSESLDTREALEQKDMPEELPLDATWDEIYTAGTPSGMGNDY
FT                   SDDELPVYQGETTQTLQDYLMWQVDLTPFTETDAAIATSIVDAVDDTGYLTVPLEDILE
FT                   SMGDENVALDEVEAVLKRIQHFDPIGVAARNLRECLLVQLSQYAKDTPYLAEARLIVSE
FT                   YLDLLGNHDFRMMIRLSRLKEDTLKEAIALIQSLDPRPGQSINTGESEYVIPDVLVRKE
FT                   KGIWTVELNADSIPRLKVNQQYAAMGNSVRNDSDGQFIRSNLQEAKWLIKSLESRNETL
FT                   LKVARCIVEQQVEFFEKGAEFMKPMVLADIAQAVDMHESTISRVTTQKFLHSPRGIFEL
FT                   KYFFSSHVNTDSGGEASSTAIRALVKKLVAAENPAKPLSDSKLTTLLCEQGIMVARRTV
FT                   AKYRESLSIPPSNQRKQLV"
FT   gene            complement(557855..558580)
FT                   /locus_tag="YPK_0506"
FT   CDS_pept        complement(557855..558580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0506"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ypm:YP_3836 probable ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66809"
FT                   /db_xref="GOA:A0A0H3AZ66"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZ66"
FT                   /protein_id="ACA66809.1"
FT                   /translation="MATLIAEKLAKAYKGRKVVEDVSLNVKSGEIVGLLGPNGAGKTTT
FT                   FYMVVGIVQRDAGRIVIDDEDISLLPLHERARRGIGYLPQEASIFRRLSVFNNLMAVLE
FT                   IRKDLSAEQREERAEELMEEFHINHLRDSLGQSLSGGERRRVEIARALAANPKFILLDE
FT                   PFAGVDPISVIDIKKIIKHLRDSGLGVLITDHNVRETLDVCERAYIVSQGHLIAHGTPQ
FT                   DILADEQVKRVYLGEEFRL"
FT   gene            complement(558587..559132)
FT                   /locus_tag="YPK_0507"
FT   CDS_pept        complement(558587..559132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0507"
FT                   /product="lipopolysaccharide transport periplasmic protein
FT                   LptA"
FT                   /note="TIGRFAM: lipopolysaccharide transport periplasmic
FT                   protein LptA; PFAM: OstA family protein; KEGG:
FT                   ypi:YpsIP31758_0443 cell envelope biogenesis protein YhbN"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66810"
FT                   /db_xref="GOA:A0A0H3B062"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR014340"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B062"
FT                   /protein_id="ACA66810.1"
FT                   /translation="MKSKNKISHLLLACSLLAASLSAFALTGDTEQPAEVKSDKQTLDM
FT                   ETNTITFIDNVVIKQGTIEIKADKVVVTRPGGDQSKMIIEGFGNPVTFYQMQDSGKPVK
FT                   GHGQKLRYEIANDFVVLTGDAYLEQLDSNIKGDRITYLVKKQQMEAFSDKGKRVTTVLL
FT                   PSQLQDKGPAASGQKKSK"
FT   sig_peptide     complement(559055..559132)
FT                   /locus_tag="YPK_0507"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.922 at
FT                   residue 26"
FT   gene            complement(559116..559679)
FT                   /locus_tag="YPK_0508"
FT   CDS_pept        complement(559116..559679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0508"
FT                   /product="protein of unknown function DUF1239"
FT                   /note="PFAM: protein of unknown function DUF1239; KEGG:
FT                   ypi:YpsIP31758_0444 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66811"
FT                   /db_xref="GOA:A0A0H3B0Z6"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="InterPro:IPR026265"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B0Z6"
FT                   /protein_id="ACA66811.1"
FT                   /translation="MSKTRRWITLVLALIALALIGWNMSGFNQQGAPVVADDNEPSSQS
FT                   QHTVTTVFNPVGQLNYKLVAEEVQNFSAKELTWFTKPVMTLFGDNAVATWTVRADRAKL
FT                   TDDKMLYLYGHVEVDSLTADAQLKKIRTDNAQVNLITQDVASDDEVTLFGIGFTSEGMR
FT                   MRGNLRDKTAELIEKVKTSYEIQK"
FT   sig_peptide     complement(559584..559679)
FT                   /locus_tag="YPK_0508"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.447 at
FT                   residue 32"
FT   gene            complement(559676..560239)
FT                   /locus_tag="YPK_0509"
FT   CDS_pept        complement(559676..560239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0509"
FT                   /product="3-deoxy-D-manno-octulosonate 8-phosphate
FT                   phosphatase, YrbI family"
FT                   /EC_number="3.1.3.45"
FT                   /note="TIGRFAM: hydrolase, HAD-superfamily, subfamily IIIA;
FT                   3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI
FT                   family; KEGG: ypm:YP_3833 Uncharacterized proteins of HAD
FT                   superfamily, CMP-Neu5Ac homologs"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66812"
FT                   /db_xref="GOA:A0A0H3AZN4"
FT                   /db_xref="InterPro:IPR010023"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZN4"
FT                   /protein_id="ACA66812.1"
FT                   /translation="MSNTAYIDTCYGPVADDVIQRAANIRLLICDVDGVMSDGLIYMGN
FT                   QGEELKAFNVRDGYGIRCLITSDIDVAIITGRRAKLLEDRANTLGITHLYQGQSDKLVA
FT                   YHELLATLQCQPEQVAYIGDDLIDWPVMAQVGLSVAVADAHPLLLPKAHYVTRIKGGRG
FT                   AVREVCDLILLAQDKLEGATGLSI"
FT   gene            complement(560789..561862)
FT                   /locus_tag="YPK_0510"
FT   CDS_pept        complement(560789..561862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0510"
FT                   /product="KpsF/GutQ family protein"
FT                   /EC_number="5.3.1.13"
FT                   /note="KEGG: ypm:YP_3832 putative isomerase; TIGRFAM:
FT                   KpsF/GutQ family protein; PFAM: CBS domain containing
FT                   protein; sugar isomerase (SIS)"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66813"
FT                   /db_xref="GOA:A0A0H3AXI0"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AXI0"
FT                   /protein_id="ACA66813.1"
FT                   /translation="MLRKAWSESNQHTYSVKDDGNTNIGRILSMSTFDLQPGVDFQQAG
FT                   KQVLQIEREGLAQLDQYINEDFSRACEAIFRCHGKVVVMGMGKSGHIGCKIAATFASTG
FT                   TPAFFVHPGEASHGDLGMITPQDIVLAISNSGESNEILTLIPVLKRQKILLICMSSNPE
FT                   STMGKAADIHLCINVPQEACPLGLAPTTSTTATLVMGDALAVALLKARGFTQEDFALSH
FT                   PGGALGRKLLLRISDIMHTGTEIPTVSPDASLRDALLEITRKSLGLTVICDDSMRIKGI
FT                   FTDGDLRRVFDMGIDLNNAKIADVMTRGGIRVPPNILAVDALNLMESRHITALLVADGD
FT                   QLLGVVHMHDMLRAGVV"
FT   gene            complement(561886..562860)
FT                   /locus_tag="YPK_0511"
FT   CDS_pept        complement(561886..562860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0511"
FT                   /product="Na+/Ca+ antiporter, CaCA family"
FT                   /note="TIGRFAM: Na+/Ca+ antiporter, CaCA family; PFAM:
FT                   sodium/calcium exchanger membrane region; KEGG: ypm:YP_3831
FT                   putative sodium/calcium exchanger protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66814"
FT                   /db_xref="GOA:A0A0H3AZ68"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZ68"
FT                   /protein_id="ACA66814.1"
FT                   /translation="MFLAITLLIIGLVLLVYGADRLVYGAAVLSRSFGVPPLIIGMTIV
FT                   GIGTSLPELIVSVTAALNGQTDMAVGNVLGSNITNLLLIVGGAALIRPLIVRSEILRRE
FT                   LPLMLVVTALCGFLLADNHLSRGDGVILLLAAAAFIVLMLKIARLAHAEGNDILTREQL
FT                   SELPQDSSTTVALLWLVLAFIILPLSAKMIIDNATVIARVAGVSELVIGLTVIAIGTSL
FT                   PELATFIAGALKGENDIAVGNIIGSNIFNIVIVLGVPALLSPGEINPEAFQRDYWVMLA
FT                   VSVVFTLLCLGRKHRIGHLAGALLLCGFITYLAVLFFAPISAL"
FT   sig_peptide     complement(562804..562860)
FT                   /locus_tag="YPK_0511"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.768) with cleavage site probability 0.742 at
FT                   residue 19"
FT   gene            563125..563943
FT                   /locus_tag="YPK_0512"
FT   CDS_pept        563125..563943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0512"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ypm:YP_3830 putative ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66815"
FT                   /db_xref="GOA:A0A0H3B066"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030296"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B066"
FT                   /protein_id="ACA66815.1"
FT                   /translation="MKQLASNVMNLIEIRGMSFTRGERLIFADINMTVPRGKVTAIMGP
FT                   SGIGKTTLLRLIGGQLAPDTGEIWFDGDNIPALSRQRLYDVRKKMSMLFQSGALFTDLT
FT                   VFENVAFPLREHSRLPEELLHSTVMMKLEAVGLRGAANLMPAELSGGMARRAALARAIA
FT                   LDPELIMFDEPFVGQDPITMGVLVKLIDELNHALGVTCVVVSHDVPEVLSIADYAYIVA
FT                   DQHVIAEGTPEQLQTNSDMRVRQFLDGIADGPVPFRFPAGDYKTELLYPK"
FT   gene            564161..564943
FT                   /locus_tag="YPK_0513"
FT   CDS_pept        564161..564943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0513"
FT                   /product="protein of unknown function DUF140"
FT                   /note="PFAM: protein of unknown function DUF140; KEGG:
FT                   ypm:YP_3829 putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66816"
FT                   /db_xref="GOA:A0A0H3B104"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B104"
FT                   /protein_id="ACA66816.1"
FT                   /translation="MLVKSLASLGRRGINVCASFGRAGLMLFNALVGRPEPRKQWPLLI
FT                   KQLYSVGVQSLLIIVVSGLFIGMVLGLQGFLILTTYSAEASLGMMVSLSLLRELGPVVT
FT                   ALLFAGRAGSALTAEIGLMKATEQISSLEMMAIDPLRRVVAPRFWAGLISMPLLTAIFV
FT                   AVGIWGGSVVGVDWKGIDSGFFWSAMQNAVEWRTDLLNCLIKSLVFALTVTWIALFNGY
FT                   DAVPTSEGISRATTRTVVHSSLAVLGLDFVLTALMFGN"
FT   gene            564948..565505
FT                   /locus_tag="YPK_0514"
FT   CDS_pept        564948..565505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0514"
FT                   /product="Mammalian cell entry related domain protein"
FT                   /note="PFAM: Mammalian cell entry related domain protein;
FT                   KEGG: ypi:YpsIP31758_0450 mce family protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66817"
FT                   /db_xref="GOA:A0A0H3AZN7"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR030970"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZN7"
FT                   /protein_id="ACA66817.1"
FT                   /translation="MQTKKSEVWVGMFILIAILAVVFLCLKVADIKSVGNQPTYRIYAN
FT                   FDNIGGLKNHSPVKIGGVVVGRVAEITLDTKNYTPRVAIDIQQRYNHIPDTSSLAVRTS
FT                   GLLGEQFLALNVGFEDPEMGTSILKDGGTIQDTKSALVLEDLIGQFLYKSSGDSPAVSE
FT                   TAPATETAAPQAAVPSLPAQHP"
FT   gene            565518..566141
FT                   /locus_tag="YPK_0515"
FT   CDS_pept        565518..566141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0515"
FT                   /product="toluene tolerance family protein"
FT                   /note="PFAM: toluene tolerance family protein; KEGG:
FT                   ypm:YP_3827 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66818"
FT                   /db_xref="InterPro:IPR008869"
FT                   /db_xref="InterPro:IPR042245"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AXI6"
FT                   /protein_id="ACA66818.1"
FT                   /translation="MFKRLFMVALLAIAPLVHAVDQSNPYRLMDEAAKKTFTRLKNEQP
FT                   KIKQNPDYLRTIVREELLPFVQIKYAGALVLGSYYKDATPAQREAYFNAFGKYLEQAYG
FT                   QALALYHGQTYDVAPDQPLGDANIVAIRVTILDPSGRPPVRLDFQWRKNSQTGNWQAYD
FT                   MIAEGVSMISTKQNEWASILRQKGVDGLTQQLLSAAKQPITLDK"
FT   sig_peptide     565518..565577
FT                   /locus_tag="YPK_0515"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT   gene            566177..566479
FT                   /locus_tag="YPK_0516"
FT   CDS_pept        566177..566479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0516"
FT                   /product="putative anti-sigma B factor antagonist"
FT                   /note="KEGG: ypm:YP_3826 putative anti-sigma B factor
FT                   antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66819"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZ72"
FT                   /protein_id="ACA66819.1"
FT                   /translation="MAGELSWQSLQETLVLQGELDRETLLPLWQQRETLLADKSRIDVS
FT                   QLQRVDSSGLALLVHFRELQSQRGHSLEIIGISNRLATLIELYNLQQIIPVETAS"
FT   gene            566617..566880
FT                   /locus_tag="YPK_0517"
FT   CDS_pept        566617..566880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0517"
FT                   /product="BolA family protein"
FT                   /note="PFAM: BolA family protein; KEGG: yps:YPTB3514
FT                   putative BolA/YrbA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66820"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B069"
FT                   /protein_id="ACA66820.1"
FT                   /translation="MNLMDTNEIKDVLMNALALQEAHVTGDGSHFQVIVVGELFADMSR
FT                   VKKQQAVYAPLMEYIADNRIHALSIKAYTPQEWQRDRKLNGF"
FT   gene            567034..568296
FT                   /locus_tag="YPK_0518"
FT   CDS_pept        567034..568296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0518"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1-carboxyvinyltransferase); KEGG:
FT                   ypm:YP_3824 UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66821"
FT                   /db_xref="GOA:B1JL60"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JL60"
FT                   /protein_id="ACA66821.1"
FT                   /translation="MDKFRVQGRTRLSGEVTISGAKNAALPILFAALLAEEPVELQNVP
FT                   KLKDIDTTIKLLSQLGTKIERNNGSVFVDASAVNEFCAPYDLVKTMRASIWALGPLVAR
FT                   FGQGQVSLPGGCAIGARPVDLHITGLEQLGAEIKLEEGYVKASVNGRLKGAHIVMDKVS
FT                   VGATVTIMSAATLAEGTTVIENAAREPEIVDTANFLNTLGAKISGAGTDRITIEGVTRL
FT                   GGGVYRVLPDRIETGTFLVAAAISGGKVVCRQTRPDTLDAVLAKLREAGADIEVGDDWI
FT                   SLDMQGKRPKAITFRTAPHPGFPTDMQAQFSLLNLVAEGTGVITETIFENRFMHVPELI
FT                   RMGAHAEIESNTVICYGVEQLSGAQVMATDLRASASLVLAGCIAEGVTIVDRIYHIDRG
FT                   YERIEDKLRALGAKIERVKGE"
FT   gene            complement(568477..569628)
FT                   /locus_tag="YPK_0519"
FT   CDS_pept        complement(568477..569628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0519"
FT                   /product="periplasmic serine protease DegS"
FT                   /EC_number="1.3.1.74"
FT                   /note="KEGG: ypp:YPDSF_0329 protease; TIGRFAM: periplasmic
FT                   serine protease DegS; PFAM: peptidase S1 and S6
FT                   chymotrypsin/Hap; PDZ/DHR/GLGF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66822"
FT                   /db_xref="GOA:A0A0H3B109"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011783"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B109"
FT                   /protein_id="ACA66822.1"
FT                   /translation="MLCPPNSCYSPFHPFIYALNLMFLKLLRSIILGLIVAGILLVALP
FT                   MLRSPGYLFSGKSNNVNEEVPTSYNQAVRRAAPAVVNVYNRSLSATQQGLAIRTLGSGV
FT                   IMSDKGYILTNKHVINDAEQIIVAMQNGRISEALLVGSDNLTDLAVLKIDATNLPVIPI
FT                   NINRTPHIGDVVLAIGNPYNLGQTVTQGIISATGRIGLSSSGRQNFLQTDASINQGNSG
FT                   GALVNTLGELMGINTLSFDKSNNGETPEGIGFAIPTALATKVMEKLIRDGRVIRGYIGI
FT                   TGEEYPPFNANDNGSDRVHGIKVKKVSPDGPAAQAGIHVGDIILNVNNKPATSVIETMD
FT                   QVAEVRPGTTIPVLLLRNGQQIAVQITITELDQNEMLTTQAAD"
FT   gene            complement(569655..571028)
FT                   /locus_tag="YPK_0520"
FT   CDS_pept        complement(569655..571028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0520"
FT                   /product="protease Do"
FT                   /EC_number="1.3.1.74"
FT                   /note="KEGG: ypm:YP_3821 protease; TIGRFAM: protease Do;
FT                   PFAM: peptidase S1 and S6 chymotrypsin/Hap; PDZ/DHR/GLGF
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66823"
FT                   /db_xref="GOA:A0A0H3AZP4"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZP4"
FT                   /protein_id="ACA66823.1"
FT                   /translation="MKKTSLLLSALAISVGLGLASVPMVSAAALPAAVAGQTLPSLAPM
FT                   LEKVLPAVVSVHVSGSQAQQQRLPEEFKFFFGPNAPSGKESSRPFEGLGSGVIINAEKG
FT                   YILTNNHVINNADKIRVQLNDGREYDAKLLGRDEQTDIALLQLTDAKNLTAIKIADSDN
FT                   LRVGDFAVAVGNPFGLGQTATSGIISALGRSGLNLEGLENFIQTDASINRGNSGGALVN
FT                   LDGELIGINTAILAPGGGNIGIGFAIPSNMAQNLSQQLIEFGEVKRGLLGIRGSEMTAD
FT                   IAKAFNIDAQRGAFVSEVLPKSAAAKAGIKPGDVLISVDGKKISSFAELRAKVGTTGPG
FT                   KTIKIGLLREGKPLEVSVTLDNSSSTSTSAENLSPSLQGASLSNGELKDGSKGIKVDSV
FT                   TKGSPAAQSGLQKDDVIIAVNRERVKDIAELRKAIEAKPAVIALNIVRGEDNIYLLIR"
FT   sig_peptide     complement(570945..571028)
FT                   /locus_tag="YPK_0520"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.679 at
FT                   residue 28"
FT   gene            complement(571299..571703)
FT                   /locus_tag="YPK_0521"
FT   CDS_pept        complement(571299..571703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0521"
FT                   /product="protein of unknown function DUF1043"
FT                   /note="PFAM: protein of unknown function DUF1043; KEGG:
FT                   ypi:YpsIP31758_0457 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66824"
FT                   /db_xref="GOA:A0A0H3AXJ2"
FT                   /db_xref="InterPro:IPR009386"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AXJ2"
FT                   /protein_id="ACA66824.1"
FT                   /translation="MTWEYALIGLVVGVVIGAVAMRFGNRKLRQQQVLQNELEKSKTDL
FT                   EEYRQELVGHFARSAELLDNMARDYRQLYQHMAKSSNNLLPDLPLQDNPFRYRLTESEA
FT                   DNDQAPVKLPPRDYSEGASGLLRPEHQNRD"
FT   gene            571848..571970
FT                   /locus_tag="YPK_0522"
FT   CDS_pept        571848..571970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0522"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66825"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZ77"
FT                   /protein_id="ACA66825.1"
FT                   /translation="MLRFPEKSVRKRSEKSITILSGIADKHATEFTYNALSAGT"
FT   gene            571927..573054
FT                   /locus_tag="YPK_0523"
FT   CDS_pept        571927..573054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0523"
FT                   /product="AFG1-family ATPase"
FT                   /note="PFAM: AFG1-family ATPase; KEGG: ypm:YP_3819
FT                   predicted ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66826"
FT                   /db_xref="GOA:A0A0H3B075"
FT                   /db_xref="InterPro:IPR005654"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030870"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B075"
FT                   /protein_id="ACA66826.1"
FT                   /translation="MQQSSPITLYQQALDAGGYQPDDVQRRAVARLETIYQALNQYQNV
FT                   PAASASLRNRLGRLFGKPARRPPVSPVQGLYMWGGVGRGKTWLMDLFFHSLPGERKLRL
FT                   HFHRFMLRVHQELTELQGHENPLEIVADGFKAQTDVLCFDEFFVSDITDAMLLATLLEA
FT                   LFARGITLVATSNIPPDNLYHNGLQRGRFLPAIALIKQHCEVMNVDAGIDYRLRTLTQA
FT                   NLYLTPLNSQTEQAMAAIFVKLAGKEGGKATVLEVNHRPLPAICVAEGVLAVDFHTLCE
FT                   EARSQLDYIALSKRYHTVLLHNVRCMAARDENTARRFLALVDEFYERRVKLIIAAEASM
FT                   FEIYSGERLKFEYQRCLSRLQEMQSEEYLSLPHLP"
FT   gene            573368..573796
FT                   /locus_tag="YPK_0524"
FT   CDS_pept        573368..573796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0524"
FT                   /product="ribosomal protein L13"
FT                   /note="PFAM: ribosomal protein L13; KEGG:
FT                   ypi:YpsIP31758_0459 ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66827"
FT                   /db_xref="GOA:B1JL66"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JL66"
FT                   /protein_id="ACA66827.1"
FT                   /translation="MKTFTAKPETVKRDWYVVDASGKTLGRLATELARRLRGKHKAEYT
FT                   PHVDTGDYIIVLNAEKVAVTGNKRTDKIYYHHTGFVGGIKQATFEEMIARRPERVIEIA
FT                   VKGMLPKGPLGRAMYRKLKVYAGTEHNHAAQQPQVLDI"
FT   gene            573811..574203
FT                   /locus_tag="YPK_0525"
FT   CDS_pept        573811..574203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0525"
FT                   /product="ribosomal protein S9"
FT                   /note="PFAM: ribosomal protein S9; KEGG:
FT                   ypi:YpsIP31758_0461 ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66828"
FT                   /db_xref="GOA:B1JL67"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JL67"
FT                   /protein_id="ACA66828.1"
FT                   /translation="MAENQYYGTGRRKSSSARVFLKPGSGKIVINQRSLEVYFGRETAR
FT                   MVVNQPLELVDMVTKFDMYITVKGGGISGQAGAIRHGITRALMEYDESLRGELRKAGFV
FT                   TRDAREVERKKVGLRKARRRPQFSKR"
FT   gene            574577..575218
FT                   /locus_tag="YPK_0526"
FT   CDS_pept        574577..575218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0526"
FT                   /product="Glutathione S-transferase domain"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   yps:YPTB3506 putative stringent starvation protein A"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66829"
FT                   /db_xref="GOA:A0A0H3B115"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034341"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B115"
FT                   /protein_id="ACA66829.1"
FT                   /translation="MAVAANKRSVMTLFSGPTDIFSHQVRIVLAEKGVSVEIEQVEADN
FT                   LPQDLIDLNPYRTVPTLVDRELTLYESRIIMEYLDERFPHPPLMPVYPVARGSSRLMMH
FT                   RIEHDWYSLLYKIEQGNAQEAEAARKQLREELLSIAPVFNETPFFMSEEFSLVDCYLAP
FT                   LLWRLPVLGIEFTGAGSKELKGYMTRVFERDAFLASLTEAEREMHLKTRS"
FT   gene            575224..575739
FT                   /locus_tag="YPK_0527"
FT   CDS_pept        575224..575739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0527"
FT                   /product="Stringent starvation protein B"
FT                   /note="PFAM: Stringent starvation protein B; KEGG:
FT                   yps:YPTB3505 putative stringent starvation protein B"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66830"
FT                   /db_xref="InterPro:IPR007481"
FT                   /db_xref="InterPro:IPR036760"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZP8"
FT                   /protein_id="ACA66830.1"
FT                   /translation="MEMSDMSPRRPYLLRAFYEWLIDNQLTPHLVVDVTRPGVSVPMEF
FT                   ARDGQIVLNVAPRAVGNLELSNDDVRFNARFGGVPRQVTVPIAAVMAIYARENGSGTMF
FT                   EPEAAYDADADGNFEGIEGKENETAPTESLMLVTDDTRVEQDDDNSPDDKPPQPPRSGG
FT                   RPALRVVK"
FT   gene            complement(575892..576377)
FT                   /locus_tag="YPK_0528"
FT   CDS_pept        complement(575892..576377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0528"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ypi:YpsIP31758_0464 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66831"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AXJ7"
FT                   /protein_id="ACA66831.1"
FT                   /translation="MKFHLPFIVGGLLAMSSSAFAMSLNYQEVGYNIEARGARAVVAEL
FT                   EKSGQLPAVENNIKLGDDNWIAMAPKLASAGNAKFTEGVKSALSSALIYNPAAVLKAVS
FT                   GSKILTLSDVCTAPIDVKDSEAKANFQQRASRTLLTIKNSDMAGPRDSCLAELKKLS"
FT   sig_peptide     complement(576312..576377)
FT                   /locus_tag="YPK_0528"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 22"
FT   gene            complement(576977..578395)
FT                   /locus_tag="YPK_0529"
FT   CDS_pept        complement(576977..578395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0529"
FT                   /product="glutamate synthase, small subunit"
FT                   /note="TIGRFAM: glutamate synthase, small subunit; PFAM:
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: ypm:YP_3812 glutamate synthase
FT                   [NADPH] small chain"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66832"
FT                   /db_xref="GOA:A0A0H3AZ83"
FT                   /db_xref="InterPro:IPR006006"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZ83"
FT                   /protein_id="ACA66832.1"
FT                   /translation="MSQNVYQFIDLQRVDPPKKPLKIRKIEFVEIYEPFSETQAKAQAD
FT                   RCLSCGNPYCEWKCPVHNYIPNWLKLANEGRIMEAADLAHQTNSLPEVCGRVCPQDRLC
FT                   EGSCTLNDEFGAVTIGNIERYISDKAIAMGWKPDMSHVHPTGKRVAVIGAGPAGLACAD
FT                   VLARNGVQAVVFDRHPEIGGLLTFGIPAFKLEKEVMIKRRKIFSEMGIEFQLNTEVGKD
FT                   ITMEALLKDYDAVFLGVGTYQSMRGGLENEEANGVYDALPFLIANTKQLMGYEATAHEP
FT                   YINMQGKRVVVLGGGDTAMDCVRSSIRQGATDVVCAYRRDEVNMPGSKREVKNAREEGV
FT                   EFKFNLQPLSIEVNSNGKVCGVRMVRTQLGAPDAQGRRMAEQIPGSEHVLPADAVVMAF
FT                   GFRPHSMEWLAAHDVKLDKQGRVIAPESTDNAFQTSNPKIFAGGDIVRGSDLVVTAIAE
FT                   GRKAADGIMNYLEV"
FT   gene            complement(578405..582862)
FT                   /locus_tag="YPK_0530"
FT   CDS_pept        complement(578405..582862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0530"
FT                   /product="Glutamate synthase (ferredoxin)"
FT                   /EC_number="1.4.7.1"
FT                   /note="PFAM: glutamine amidotransferase class-II; glutamate
FT                   synthase alpha subunit domain protein; ferredoxin-dependent
FT                   glutamate synthase; glutamate synthase; KEGG: yps:YPTB3502
FT                   glutamate synthase [NADPH] large chain precursor"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66833"
FT                   /db_xref="GOA:A0A0H3B080"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B080"
FT                   /protein_id="ACA66833.1"
FT                   /translation="MLYDQSQERDNCGFGLIAHIEGEPSHKVVRTAIHALARMQHRGAI
FT                   LADGKTGDGCGLLLQKPDRFFRMVAEERGWRLAKNYAVGMMFLSQDEELAKASRRIVEE
FT                   ELQNETLSIVGWREVPTNPDVLGEIALSSLPRIEQIFVNAPAGWRSRDMERRLFVARRR
FT                   IEKRISDKDFYACSFSNLVTIYKGLCMPADLPRFYLDLADLRLESAICLFHQRFSTNTV
FT                   PRWPLAQPFRYLAHNGEINTIAGNRQWAKARAYKFKTPLIPDLQDAAPFVNETGSDSSS
FT                   LDNMLELFLSGGMDLIRAMRLLVPPAWQNNPDMDTDLRAFFDFNSMHMEPWDGPAGIVM
FT                   SDGRYAACNLDRNGLRPARYVITKDKLITCASEVGIWDYQPDEVVEKGRVGPGELMVID
FT                   TRSGKILHSAETDNDLKSRHPYKEWMEKNVKRLVPFEDLPEEQVGSRQLDDSQLETYQK
FT                   QFGYSNEELDQIIRVLGENGQEATGSMGDDTPFAVLSSGPRIIYDYFRQQFAQVTNPPI
FT                   DPLREAHVMSLATSIGREMNVFCEAEGQAHRLSFKSPILLYSDFQQLTTLEGEHYRADR
FT                   LDLTFNPAENDLEQAVLSLCDEAERKVRDGAVMLVLSDRAIAPNRLPVPAPMAVGAIQT
FT                   RLVDKSLRCDANIIVETASARDPHHFAVLLGFGATAIYPYLAYESLAKLVDSQAIDKKY
FT                   RDVMLNYRNGINKGLYKIMSKMGISTVASYRCAKLFEAVGLHRDLSDLCFQGVVSRIGG
FT                   ASFSDFQQDLQNLSKRAWLKRKPLDQGGLLKFVHNGEYHAYNPDVVSTLQKAVHSGEYS
FT                   DYQAYAKLVNERPIATLRDLLAIKPQGTPIPVDQVEPAESLFKRFDTAAMSIGALSPEA
FT                   HESLAIAMNSLGGFSNSGEGGEDPARYGTNKVSRIKQVASGRFGVTPAYLVNADVIQIK
FT                   VAQGAKPGEGGQLPGDKVTPYIAKLRYSVPGVTLISPPPHHDIYSIEDLAQLIFDLKQV
FT                   NPKAMISVKLVSEPGVGTIATGVAKAYADLITIAGYDGGTGASPLSSVKYAGCPWELGL
FT                   VETQQALVANGLRHKIRLQVDGGLKTGVDIVKAAILGAESFGFGTGPMVALGCKYLRIC
FT                   HLNNCATGVATQDEKLRRDHYHGLPERVVNYFHFIARETREIMAELGVSQLVDLIGRTD
FT                   MLLELDGISAKQNKLDLSPMLKTATPHPGKALYCTESNPPFDKGLLNKELLSQAEPYIE
FT                   AKQSKTFYFDIRNTDRSVGAALSGAIATKHGDQGLATDPIKAYFSGTAGQSFGVWNAGG
FT                   VELMLTGDANDYVGKGMAGGRIAVRPPVGSNFRSHEASIIGNTCLYGATGGKLFAAGRA
FT                   GERFAVRNSGAITVVEGIGDNGCEYMTGGIVCVLGRTGINFGAGMTGGFAYVLDEDGEF
FT                   RKRVNPELVEVLDVEQLAIHEEHLRGLITEHVQLTGSSRGEEILANWPEWVTKFALVKP
FT                   KSSDVKALLGHRSRSAAELRVQAQ"
FT   gene            583619..584608
FT                   /locus_tag="YPK_0531"
FT   CDS_pept        583619..584608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0531"
FT                   /product="conserved hypothetical radical SAM protein"
FT                   /note="KEGG: ypm:YP_3810 uncharacterized Fe-S
FT                   oxidoreductases; TIGRFAM: conserved hypothetical radical
FT                   SAM protein; PFAM: Radical SAM domain protein; SMART:
FT                   Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66834"
FT                   /db_xref="GOA:A0A0H3B120"
FT                   /db_xref="InterPro:IPR005911"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR032432"
FT                   /db_xref="InterPro:IPR039661"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B120"
FT                   /protein_id="ACA66834.1"
FT                   /translation="MLLGRNANGFGYGLFLTGSAKIMQLQQLVNMFGADLQRRYGEKIH
FT                   KLTLHGGFSCPNRDGTLGRGGCTFCQVASFADEQMQQQSITQQLAIQAKKANRANRYLA
FT                   YFQAYTSTYAEVNALAAMYQQALCEADIVGLCVGTRPDCVPDAVLDLLSSYQQQGYEVW
FT                   LELGLQTANDKTLKRINRGHDFACYQQTARRARARGLKVCCHLIVGLPGEDRAQGRETL
FT                   EKVVTTGVDGIKLHPLHIVEGSTMAKAWRAGRLTALALEDYVLTAGEMIRHTPAEVVYH
FT                   RISASARRPTLLAPLWCENRWTGMNELNNYLLQHGVQGTAIGDAYCYR"
FT   gene            584643..584861
FT                   /locus_tag="YPK_0532"
FT   CDS_pept        584643..584861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0532"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66835"
FT                   /db_xref="GOA:A0A0H3AZQ2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZQ2"
FT                   /protein_id="ACA66835.1"
FT                   /translation="MVNRLIAMAKMLIAMAKILIITVGGDIYWLVLSVVCLLFRSINAL
FT                   FPNISPAICNLFHTSESPGLSLCGFTV"
FT   gene            584892..587228
FT                   /locus_tag="YPK_0533"
FT   CDS_pept        584892..587228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0533"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /note="KEGG: ypi:YpsIP31758_0469 putative aerobic
FT                   respiration control sensor protein ArcB; TIGRFAM: PAS
FT                   sensor protein; PFAM: response regulator receiver;
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; Hpt domain protein; PAS fold-4 domain
FT                   protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66836"
FT                   /db_xref="GOA:A0A0H3AXK1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR014409"
FT                   /db_xref="InterPro:IPR027460"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR040642"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AXK1"
FT                   /protein_id="ACA66836.1"
FT                   /translation="MKQIRVLAQYYVDLMVKLGLVRFSLLLASALVLLAMVVQMAVTFV
FT                   LRGSVETLDLVRSIFFGLLITPWAVYFLSVVVEQLEESRQRLSRLVDKLEVMRHRDLEL
FT                   NKQLTENITQLNQEIVEREKAEKAHLQVVDKLKEEMGHREQAQIELGQQSALLRSFLDA
FT                   SPDLVYYRNEDNEFSGCNRSMELLTGKSEKQLVGLTPKDVYAPDIAEKVMETDEKVFRH
FT                   NVSLTYEQWLVYPDGRKACFELRKVPFYDRVGKRHGLMGFGRDITERKRYQDALENASR
FT                   DKTTFISTISHELRTPLNGIVGLSRILLDTELDAEQLKYLKTIHVSAITLGNIFNDIIE
FT                   MDKLERRKVQLDNQPVDFTGFMADLENLSGLLVQPKGLKFIMEPQLPLPEKVIADGTRL
FT                   RQILWNLIGNAVKFTQQGKIVVRVRREGNDRLIFEVEDSGMGIPEDEQDKIFAMYYQVK
FT                   DRNGGRPATGTGIGLAVSKRLAQSMGGDITVKSTQGVGSCFTLTIKAPAVQEASNAPSG
FT                   DDMPLPALHVLLVEDIELNVIVARSVLEKLGNSVDVAMNGHDALAMFNPEDFDLVLLDI
FT                   QLPDMSGLDIARQIRAEYGKQSLPPLVALTANVLKDKKEYLDAGMDDVLSKPLSVPALT
FT                   AMIKQFWDSKPSSAVQKQEHKVMQTHESLLDTTMLEQYIDLVGPQLIHQSLEMFEQMMP
FT                   GYLAVLDSNMTARDQKGITEEAHKIKGAAGSVGLRHIQQLAQQIQTPTLPAWWDNVQDW
FT                   VDELKLEWRNDVQVLREWAAEVEKK"
FT   sig_peptide     584892..585017
FT                   /locus_tag="YPK_0533"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.934) with cleavage site probability 0.902 at
FT                   residue 42"
FT   gene            587470..588123
FT                   /locus_tag="YPK_0534"
FT   CDS_pept        587470..588123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0534"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /note="PFAM: ThiJ/PfpI domain protein; KEGG:
FT                   ypi:YpsIP31758_0470 enhancing lycopene biosynthesis protein
FT                   2"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66837"
FT                   /db_xref="GOA:A0A0H3AZ86"
FT                   /db_xref="InterPro:IPR026041"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZ86"
FT                   /protein_id="ACA66837.1"
FT                   /translation="MKTVGVVLSGCGVLDGAEIHESVLTMLALDRAGAEVLFFAPDKPQ
FT                   LHVINHITGEIVAEERNVLVESARIARGLITPLSAADPEVLDALIVPGGFGVAKNLCDF
FT                   AIKGVECSVEPDLYKLIQLMHKSGKPIGLMCISPVMLPKLLGKPIRLTIGNDPDTIDAI
FT                   EIMGGEHVICPADDVVIDLENKVVTTPAYMLAGSISEAAKGIDKLVTKVLDLTE"
FT   gene            588120..588845
FT                   /locus_tag="YPK_0535"
FT   CDS_pept        588120..588845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0535"
FT                   /product="monofunctional biosynthetic peptidoglycan
FT                   transglycosylase"
FT                   /note="TIGRFAM: monofunctional biosynthetic peptidoglycan
FT                   transglycosylase; PFAM: glycosyl transferase family 51;
FT                   KEGG: yps:YPTB3497 monofunctional biosynthetic
FT                   peptidoglycan transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66838"
FT                   /db_xref="GOA:B1JL77"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR011812"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JL77"
FT                   /protein_id="ACA66838.1"
FT                   /translation="MISVRRGLSQLWYWGKRGVIGIIALWMAGILIFAFLPVPFSMVMI
FT                   ERQLGAWLTGDFAYVAHSDWVPMDEISPYMALAVMAAEDQKFPDHWGFDVGAIESALSH
FT                   NQRNQKRIRGASTLSQQTAKNVFLWDGRSWIRKGLEVGLTAGIELIWTKRRILTVYLNI
FT                   AEFGNGIFGVEAAARHFFNKPASKLSASEAALLAAVLPNPLRFKVNAPSGYVISRQQWI
FT                   LRQMHQLGGKTFLQENTLD"
FT   gene            complement(589052..589627)
FT                   /locus_tag="YPK_0536"
FT   CDS_pept        complement(589052..589627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0536"
FT                   /product="transport-associated"
FT                   /note="PFAM: transport-associated; SMART:
FT                   Transport-associated and nodulation region; KEGG:
FT                   ypi:YpsIP31758_0472 putative YraP protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66839"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B084"
FT                   /protein_id="ACA66839.1"
FT                   /translation="MKVGYIFAMLFSALLLQGCVGAVVVGSAAVATKTATDPRTIGTQV
FT                   DDGTLEARVVNALSKDKEIKSQTRFVVTAYQGKVLLTGQTPSAELSNRAKQIASGVDGA
FT                   TEVYNEMRLGKPVDLSTASMDTWITTKVRSQLLTSDSVKSSNVKVTTENGEVFLLGLVT
FT                   QQEAQSAAQIASKVSGVKHVTTAFTIVK"
FT   sig_peptide     complement(589559..589627)
FT                   /locus_tag="YPK_0536"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.979) with cleavage site probability 0.248 at
FT                   residue 23"
FT   gene            complement(589638..590228)
FT                   /locus_tag="YPK_0537"
FT   CDS_pept        complement(589638..590228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0537"
FT                   /product="phosphoheptose isomerase"
FT                   /note="TIGRFAM: phosphoheptose isomerase; KEGG:
FT                   ypi:YpsIP31758_0473 phosphoheptose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66840"
FT                   /db_xref="GOA:B1JL79"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR023070"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JL79"
FT                   /protein_id="ACA66840.1"
FT                   /translation="MLERIKGCFTESIQTQIAAAEALPDAISCAAMALVQSLLNGNKIL
FT                   CCGNGTSAANAQHFAASMINRFETERPSLPAIALNADNVVLTAITNDRLHDEVYAKQVR
FT                   ALGQAGDVLLAISTRGNSRDIVKAVEAAVTRDMTIVALTGYDGGELAGLLGQLDVEIRI
FT                   PSHRGARVQELHMLTVNCLCDLIDNTLFPHQDD"
FT   gene            complement(590499..590852)
FT                   /locus_tag="YPK_0538"
FT   CDS_pept        complement(590499..590852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0538"
FT                   /product="protein of unknown function UPF0102"
FT                   /note="PFAM: protein of unknown function UPF0102; KEGG:
FT                   ypm:YP_3803 predicted endonuclease distantly related to
FT                   archaeal Holliday junction resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66841"
FT                   /db_xref="GOA:B1JL80"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JL80"
FT                   /protein_id="ACA66841.1"
FT                   /translation="MSQRDTGAHYENLARRHLERAGLVFQAANVAFRGGEIDLIMRDGD
FT                   AWVFVEVRFRRNDLFGGAAASITPRKQQRLHLAAAVWLAQRGASFATTSCRFDVVAITG
FT                   NQLEWLPNAFNTD"
FT   gene            complement(590951..592924)
FT                   /locus_tag="YPK_0539"
FT   CDS_pept        complement(590951..592924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0539"
FT                   /product="LppC family lipoprotein"
FT                   /note="PFAM: LppC family lipoprotein; KEGG:
FT                   ypi:YpsIP31758_0475 putative LppC lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66842"
FT                   /db_xref="GOA:A0A0H3B125"
FT                   /db_xref="InterPro:IPR007443"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B125"
FT                   /protein_id="ACA66842.1"
FT                   /translation="MLSSTFVRSKAGLVPVILAALILAACTGDAPQTPPPVNIQDEASA
FT                   NSDYYLQQLQQSSDDNKADWQLLAIRALLREAKVPQAAEQLSTLPANLSDTQRQEQQLL
FT                   AAELLIAQKNTPAAADILAKLEATQLSANQKVRYYQAQIAANQDKATLPLIRAFIAQEP
FT                   LLTDKAHQDNIDGTWQSLSQLTPQELNTMVINADENVLQGWLDLLRVYQDNKQDPELLK
FT                   AGIKDWQTRYPQNPAAKNLPTALTQISNFSQASTAKIALLLPLSGPAQVFADAIQQGFT
FT                   AAQNGSAVTASVPVTPNVTESSPTDTAAVVSDDTPATLPAPVTPPVVTNAQVKIYDTNT
FT                   QPLAALLAQAQQDGATLVVGPLLKPEVEQLSATPSTLNILALNQPEASNNSPNICYFAL
FT                   SPEDEARDAAHHLWEQQKRMPLLLVPRGALGERIAKAFADEWQKQGGQTVLQQNFGSTT
FT                   ELKQSINSGAGIRLTGTPVSVSNVAAAPASVTIAGLTIPAPPIDAPVVSTSSSGNIDAV
FT                   YIIATPSELTLIKPMIDMATSSRSKPALFASSRSYQAGAGPDYRLEMEGIQFSDIPLMA
FT                   GSNPALLQQASAKYANDYSLVRLYAMGIDAWALANHFSEMRQIPGFQVKGVTGDLTASS
FT                   DCVITRKLPWLQYRQGMVVPLA"
FT   sig_peptide     complement(592847..592924)
FT                   /locus_tag="YPK_0539"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.430 at
FT                   residue 26"
FT   gene            592987..593886
FT                   /locus_tag="YPK_0540"
FT   CDS_pept        592987..593886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0540"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: ypm:YP_3801
FT                   putative tetrapyrrole methylase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66843"
FT                   /db_xref="GOA:A0A0H3AZQ5"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZQ5"
FT                   /protein_id="ACA66843.1"
FT                   /translation="MNQHDRAVISASTLYVVPTPIGNLGDITHRALEVLKGVDLIAAED
FT                   TRHTGLLLQHFAINARLFALHDHNEQQKADQLLAKLQEGQSIALVSDAGTPLINDPGYH
FT                   LVRRCREAGIRVVPLPGACAAITALSAAGLASDRFCYEGFLPAKTKGRKDTLQALIEEP
FT                   RTLIFYESTHRLLESLQDMVTVLGPQRYVVLARELTKTWESIHGAPVGELLAWVKEEET
FT                   RRRGEMVLIVEGHKVQSDDALPADALRTLALLQKELPLKKAAALAAEIHGVKKNALYKY
FT                   ALEQQQGDVETEEDDIQQ"
FT   gene            complement(594484..595188)
FT                   /locus_tag="YPK_0541"
FT   CDS_pept        complement(594484..595188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0541"
FT                   /product="Pirin domain protein"
FT                   /note="PFAM: Pirin domain protein; KEGG:
FT                   ypi:YpsIP31758_0477 YhhW family protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66844"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR041602"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AXK6"
FT                   /protein_id="ACA66844.1"
FT                   /translation="MITCRTAEQCGQADFGWLQARYTFSFGHYFDPTLLGYASLRVLNQ
FT                   EVLAPGAAFQPRTYPQVDILNLILQGEAEYRDSLGNHVHAKTGDALLFSPQQGVSYSEH
FT                   NLSDNKSLTRIQLWLNACPERESAPTQHQRLSTRPVQLLASPAGEQGSLQLRQQMWIHH
FT                   LALAAGEQQKMPLHGHRAYLQSIHGTVDVAGPQTGTSQRLTCGDGAFVEEEQHLVIKAI
FT                   TPLRALLIDLPV"
FT   gene            595450..596343
FT                   /locus_tag="YPK_0542"
FT   CDS_pept        595450..596343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0542"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: ypm:YP_3798 LysR-family
FT                   transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66845"
FT                   /db_xref="GOA:A0A0H3AZ93"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZ93"
FT                   /protein_id="ACA66845.1"
FT                   /translation="MARDRALTLEALRVMDAIDRRGSFAAAADELGRVPSALSYTMQKL
FT                   EEELDVVLFDRSGHRTKFTNVGRMLLERGRVLLEAADKLTTDAEALARGWETHITIVSE
FT                   ALSPAWKLFPLIDKLALKANTQVSILTEVLAGAWERLEQGRADIVIAPDMHFRASSEIN
FT                   SRKLYKVTSVYVASPDHPIHQEPEPLSELTRVKYRGIAVADTARERPVITVQLLDKQQR
FT                   LTVSTIEDKRRALLAGLGVATMPYEMVEKDIAAGRLRVIGPEYSREADIIMAWRRDSMG
FT                   EAKSWCLREIPKLLGK"
FT   gene            complement(596474..597460)
FT                   /locus_tag="YPK_0543"
FT   CDS_pept        complement(596474..597460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0543"
FT                   /product="putative glutathione S-transferase"
FT                   /note="KEGG: yps:YPTB3489 possible glutathione
FT                   S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66846"
FT                   /db_xref="GOA:A0A0H3B091"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR016639"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B091"
FT                   /protein_id="ACA66846.1"
FT                   /translation="MGQLINGVWKDVWYDTQSTGGHFKRSTAQFRNWVTTDGQAGPQGK
FT                   GGFNAEAHRYHLYVSLACPWAHRALLMRTLKGLESLISVSVVHPLMQENGWTFSSDFPA
FT                   ATGDALYHLDYLYQLYLRAAPDYSGRVTVPVLWDKQQQTVVSNESADIIRMFNNAFDDV
FT                   GAKAGDYYPTALRNDIDDINGWVYDQVNNGAYKAGFATTQEAYDEAVGTLFSALDRLEQ
FT                   ILGQHRYLTGNQLTEADLRLWTTLVRFDPVYVTHFKCDKRRISDYPNLYGFLRDIYQMP
FT                   GIAETVDFAHIRTHYYRSHGTINPYGIISIGPQQNLLEPHDRANRFV"
FT   gene            complement(597546..597941)
FT                   /locus_tag="YPK_0544"
FT   CDS_pept        complement(597546..597941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0544"
FT                   /product="DoxX family protein"
FT                   /note="PFAM: DoxX family protein; KEGG: ypm:YP_2887
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66847"
FT                   /db_xref="GOA:A0A0H3B135"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B135"
FT                   /protein_id="ACA66847.1"
FT                   /translation="MNKLQDTGLLVARILMPIIFIVAGYGKMGDAYAGTQQYMQAMGVP
FT                   GFFLPLTILLEFGGGLAILFGFLTRTTSLFIAGFTLLTAFIFHTDFTDSTNQLMFMKNL
FT                   SIAGGFLVLAMAGPGGFSIDRLLGKKW"
FT   gene            complement(598245..598529)
FT                   /locus_tag="YPK_0545"
FT   CDS_pept        complement(598245..598529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0545"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ypm:YP_2888 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66848"
FT                   /db_xref="InterPro:IPR025612"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZQ9"
FT                   /protein_id="ACA66848.1"
FT                   /translation="MSRHQLALEKEALLREIQQQRLDLADSAARWVEVTAPFDRGWAQI
FT                   VSMRKYLIAGGSLVALYSVRHPSKLLRWSRRAVSTWSTLQLFRRTFLSR"
FT   gene            complement(598526..598921)
FT                   /locus_tag="YPK_0546"
FT   CDS_pept        complement(598526..598921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0546"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ypm:YP_2889 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66849"
FT                   /db_xref="GOA:A0A0H3AXL1"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AXL1"
FT                   /protein_id="ACA66849.1"
FT                   /translation="MAEQPRTQGPAKGVLDTVHRIATIVVGIVETRVRLAVIELEEEKA
FT                   TLVQLLMMAGITLLLTAFGLMSLLVLVIWAIDPAYRLVALGTTTAVLLILALIGVIWTL
FT                   TKVRHSTLLGSTRKQLETDRELLEKDH"
FT   gene            complement(598924..599229)
FT                   /locus_tag="YPK_0547"
FT   CDS_pept        complement(598924..599229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0547"
FT                   /product="protein of unknown function DUF883 ElaB"
FT                   /note="PFAM: protein of unknown function DUF883 ElaB; KEGG:
FT                   ypi:YpsIP31758_0483 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66850"
FT                   /db_xref="GOA:A0A0H3AZ96"
FT                   /db_xref="InterPro:IPR010279"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZ96"
FT                   /protein_id="ACA66850.1"
FT                   /translation="MPQDKTSEHLRAELKSLADTLEEVLQSSTDKPKAELDKLRAKAES
FT                   ALKDTRVRLSETSDKIAAQTKEIADKADNYVHDNPWTGVGIGAAVGVVLGVLLSRR"
FT   gene            complement(599384..599764)
FT                   /locus_tag="YPK_0548"
FT   CDS_pept        complement(599384..599764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0548"
FT                   /product="protein of unknown function DUF1090"
FT                   /note="PFAM: protein of unknown function DUF1090; KEGG:
FT                   ypi:YpsIP31758_0485 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66851"
FT                   /db_xref="InterPro:IPR009468"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B094"
FT                   /protein_id="ACA66851.1"
FT                   /translation="MLLRRSLLLALPLITFCGFATAASDNECDIKAKEIQQQIDYAKQH
FT                   GNTRRAAGLETALKEVKTHCTEESLQAERQKKIRQKQHNVTERQQELKEAQQKGDAGKI
FT                   AKQQKKLAEAQAELQQAQSQQH"
FT   sig_peptide     complement(599696..599764)
FT                   /locus_tag="YPK_0548"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.988 at
FT                   residue 23"
FT   gene            complement(599990..600379)
FT                   /locus_tag="YPK_0549"
FT   CDS_pept        complement(599990..600379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0549"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ypi:YpsIP31758_0486 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66852"
FT                   /db_xref="GOA:A0A0H3B138"
FT                   /db_xref="InterPro:IPR026574"
FT                   /db_xref="InterPro:IPR027398"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B138"
FT                   /protein_id="ACA66852.1"
FT                   /translation="MINFRGRFGRPLWHYLVLPVVLLLLAVILLTPMIVQTESTLKIRP
FT                   NQQGLSLPDGFYLYQHLNGRGIHIKSIIPENDSLVVSLEFPEQQMQAIEVLQDVLPAGY
FT                   AIVASESKKRHRLLPVFRSNQQNLG"
FT   sig_peptide     complement(600266..600379)
FT                   /locus_tag="YPK_0549"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.935) with cleavage site probability 0.921 at
FT                   residue 38"
FT   gene            complement(600376..601074)
FT                   /locus_tag="YPK_0550"
FT   CDS_pept        complement(600376..601074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0550"
FT                   /product="SNARE associated Golgi protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   ypi:YpsIP31758_0487 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66853"
FT                   /db_xref="GOA:A0A0H3AZR4"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZR4"
FT                   /protein_id="ACA66853.1"
FT                   /translation="MDIIKELLHALWAQDYETLADPSLVWAIYLLLFVILFLENGLLPA
FT                   AFLPGDSLLILVGVLIAKGAMSFPVTLVVLTTAASLGCWVSYIQGRWLGNTKVVQGWLS
FT                   HLPAHYHQRAHNLFHRHGLSALLVGRFLAFVRTLLPTIAGLSGLDNARFQFFNWMSGLL
FT                   WVLILTTMGFAFGKTPVFLRYEDEVMFVLMLLPLALLVIGLFGSLYVLWRKKNATPAKV
FT                   SHDNKKGKSE"
FT   gene            complement(601351..601884)
FT                   /locus_tag="YPK_0551"
FT   CDS_pept        complement(601351..601884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0551"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: yps:YPTB3481 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66854"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AXL4"
FT                   /protein_id="ACA66854.1"
FT                   /translation="MRWLFALFITVSCWASLVSGNMLLPPHSTPSGAALSALSTVYSDN
FT                   HCASYSLSSFHALSAKLRLQNQDVSPQLRLVGVPVKKTAIKNRLSAAQFTGSANLSLLN
FT                   NTWPAAYFAISRSHRADDIYKQPRQSLSLVNYSNWIFHAATQQNRVGGWKESNTQYSGM
FT                   LTYHHYDAMVFMLA"
FT   sig_peptide     complement(601822..601884)
FT                   /locus_tag="YPK_0551"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.963) with cleavage site probability 0.373 at
FT                   residue 21"
FT   gene            complement(602133..602927)
FT                   /locus_tag="YPK_0552"
FT   CDS_pept        complement(602133..602927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0552"
FT                   /product="regulatory protein GntR HTH"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: ypi:YpsIP31758_0489 transcriptional
FT                   regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66855"
FT                   /db_xref="GOA:A0A0H3AZA0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZA0"
FT                   /protein_id="ACA66855.1"
FT                   /translation="MEFTETRRLYQQLAAELKRRIEAGVYPVGDKLPAERYISEEMNVS
FT                   RTVVREAIIMLEVEGYVEVRKGSGIHVMSNQQKHLVTNQGIEFDTAGPFELLQARQLIE
FT                   SNIAEFAATQVTRQDIVQLIEIQKHARQEDRFRDSQWDLKFHVQVALATQNTAMATIVE
FT                   KMWSQRTHNPYWIKLHEHIDDVSIESWCEDHDKILEALIRKDPHASKLAMWQHLENTKQ
FT                   MLFRATTDDFEFNVDRYLFTENPVVHLDNLMNNSKVPISSKN"
FT   gene            complement(603190..604494)
FT                   /locus_tag="YPK_0553"
FT   CDS_pept        complement(603190..604494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0553"
FT                   /product="d-galactonate transporter"
FT                   /note="TIGRFAM: d-galactonate transporter; PFAM: major
FT                   facilitator superfamily MFS_1; KEGG: ypm:YP_2897 ExuT
FT                   transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66856"
FT                   /db_xref="GOA:A0A0H3B097"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B097"
FT                   /protein_id="ACA66856.1"
FT                   /translation="MMRKIKGLRWYMIALVTVGTILGYLTRNAIAVAAPTLQEQLHITT
FT                   QQYSYIIAAYSAAYTLMQPVAGYVLDVMGTKVGYAMFAVMWAIFCMSTALASSWGGLAI
FT                   ARGAVGMAEAAMIPAGLKASSEWFPAKERSIAVGYFNVGSSIGGMIAPPLVVWAIVMHS
FT                   WQMAFIITGVLSLIWAIAWLILYKHPKDQKRLSDEEREYILSGQEAQHSTANAKKMSAM
FT                   QIIRNRQFWGIAIPRFLAEPAWGTFNAWIPLFMFKAYGFNLKEIAMFAWMPMLFADVGC
FT                   ILGGYLPPLFQKYFKVNLIVSRKLVVTMGGVLMIGPGTIGLFTSPYAAIALLCIGGFAH
FT                   QALSGALITLSSDVFGRNEVATANGLTGMAAWTASTLFALVVGALADTMGFSPLFAALA
FT                   VFDLLAVVVIWTVLQDRTADEPTNDPVQRPPVGQN"
FT   sig_peptide     complement(604399..604494)
FT                   /locus_tag="YPK_0553"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.976) with cleavage site probability 0.759 at
FT                   residue 32"
FT   gene            605239..606648
FT                   /locus_tag="YPK_0554"
FT   CDS_pept        605239..606648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0554"
FT                   /product="Glucuronate isomerase"
FT                   /EC_number="5.3.1.12"
FT                   /note="PFAM: Glucuronate isomerase; KEGG:
FT                   ypi:YpsIP31758_0491 glucuronate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66857"
FT                   /db_xref="GOA:B1JL96"
FT                   /db_xref="InterPro:IPR003766"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JL96"
FT                   /protein_id="ACA66857.1"
FT                   /translation="MSQFLTEDFLLDTEFARRLYHDYAKDQPIFDYHCHLPPEQIAENY
FT                   RFKNMYDIWLKGDHYKWRAMRTNGVAERLCTGDASDREKFDAWAATVPHTIGNPLYHWT
FT                   HLELRRPFGITGKLLSPATSEEIWQRGNELLAQDPFSARGIMQQMNVKMVGTTDDPIDD
FT                   LRHHKAIAADGSFNIKVLPSWRPDKAFNIEAAGFNDYMQRLEAAADTSISRFADLCVAL
FT                   NKRMDHFAAHGCKVSDHALDVVVYGEADETTLDAILARRLAGNQPSTEEIAQFKTAVLL
FT                   FLSGEYHRREWVQQYHIGALRNNNSRMFNLVGPDIGFDSINDQPLAQPLSRLLDAQGLR
FT                   NALPKTILYCLNPRDNEVIGTMVGNFQGEGEAGKMQFGSGWWFNDQKDGMQRQMTQLAQ
FT                   LGLLSRFVGMLTDSRSFLSYTRHEYFRRILCQMIGRWVADGEAPADIALLGAMVKNICF
FT                   DNAQQYFAIEL"
FT   gene            606847..608298
FT                   /locus_tag="YPK_0555"
FT   CDS_pept        606847..608298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0555"
FT                   /product="Mannitol dehydrogenase domain"
FT                   /note="PFAM: Mannitol dehydrogenase domain; Mannitol
FT                   dehydrogenase rossman domain; KEGG: ypp:YPDSF_0367
FT                   altronate oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66858"
FT                   /db_xref="GOA:A0A0H3B141"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B141"
FT                   /protein_id="ACA66858.1"
FT                   /translation="MQTLNRRDFPGRSHPDKIIQFGEGNFLRAFVDWQIDLLNEHTDLN
FT                   AGIVVIRPIDTDFPPSLSTQDGLYTAVIRGLNEQGEAVRESRLIRSVNREINIYRQFDD
FT                   YLALARDANIRFMFSNTTEAGIAWNEADQFSDAPPSSFPAKLTRLLFERFEHFDGAADK
FT                   GWVLLPCELIDYNGEALRELVLRYASHWQLPAAFTHWLTENNTFCSTLVDRIVTGYPRD
FT                   EVAALQTELGYQDSFLDTAEYFYLFVIQGPQGLAQELRLDQLDLNVRIVDDIKPYKERK
FT                   VAILNGAHTALVPVAYLSGLDTVGQTMDDAQISRFVEKTITEEIVPVLDLPEDELLSFS
FT                   QAVLSRFRNPFIQHQLLSIALNGMTKFRTRILPQLLTYQQQKGQLPPRLTFALAALIAF
FT                   YRGEREGQTYPLQDDAHWLECYSTLWNGVKHGDIALAELVNRVLSDANHWGQDLTAVPQ
FT                   LANQVTEQLQTILSRGMRAAVAAYS"
FT   gene            608309..609799
FT                   /locus_tag="YPK_0556"
FT   CDS_pept        608309..609799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0556"
FT                   /product="Altronate dehydratase"
FT                   /EC_number="4.2.1.7"
FT                   /note="PFAM: D-galactarate dehydratase/Altronate hydrolase
FT                   domain protein; SAF domain protein; KEGG:
FT                   ypi:YpsIP31758_0493 altronate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66859"
FT                   /db_xref="GOA:A0A0H3AZR6"
FT                   /db_xref="InterPro:IPR007392"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZR6"
FT                   /protein_id="ACA66859.1"
FT                   /translation="MQNIIKIHPLDNVAVALQDLAADERIESGEFSVKLAQPVVRGHKF
FT                   ALTAIEPGQMIVKYGLPIGHALTLIQPGEHIHSQNAKTNLSDLDEYEYQPEFSSLPPQM
FT                   ADRDVQIYRRPKGEVGIRNELWIIPTVGCVNGIARQIQQRFLKETQDAEGIDGVYLFSH
FT                   PFGCSQLGQDHENTRTMLQNMVRHPNAGAVLVIGLGCENNQVDVFQTTLGKVDEERVRF
FT                   MVCQQHDDEVEAGLEHLHALYQVMRHDRREPGQLSELKFGLECGGSDGLSGITANPLLG
FT                   RFSDYVIANGGTSVLTEVPEMFGAERILMSRCRDEATFEKTVSMVNDFKQYFIAHDQPI
FT                   YENPSPGNKAGGITTLEEKSLGCTQKAGQSQVVDVLKYGERLQRLGLNLLSAPGNDAVA
FT                   TSALAGAGCHMVLFSTGRGTPYGGFVPTVKLATNSELAAKKPHWIDFDAGKLIHGTSMD
FT                   TLLNEFVDLIVEIANGKPARNEVNDFRELAIFKSGVTL"
FT   gene            609952..610482
FT                   /locus_tag="YPK_0557"
FT   CDS_pept        609952..610482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0557"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ypm:YP_2902 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66860"
FT                   /db_xref="GOA:A0A0H3AXL9"
FT                   /db_xref="InterPro:IPR019629"
FT                   /db_xref="InterPro:IPR026267"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AXL9"
FT                   /protein_id="ACA66860.1"
FT                   /translation="MTFYWFAQAVGVLAFFVGITMFFNRDERRFKQQLSVYSAIIGCHF
FT                   FLMGASAAGSSALLNSLRTLISTKTRSSRVMVVFIILTLALGIWRMQHAVEILPIFGTV
FT                   ISTWALFRTSGLTTRSVMWISTACWFIHNVWLGSIGGSLIEGSFLLLNGFNIIRFRRLQ
FT                   LQGIDPFEIEKKA"
FT   gene            complement(610549..611868)
FT                   /locus_tag="YPK_0558"
FT   CDS_pept        complement(610549..611868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0558"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="PFAM: sodium:dicarboxylate symporter; KEGG:
FT                   ypm:YP_2904 Na/dicarboxylate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66861"
FT                   /db_xref="GOA:A0A0H3AZA4"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR023025"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZA4"
FT                   /protein_id="ACA66861.1"
FT                   /translation="MKGINGQNILNFTWEEALLEAMEKTQSVFIRFIVNGSLVKQILIG
FT                   LVAGIVLALVSTPAAIAVGLLGSLFVGALKAVAPVLVLMLVIASIANHKKGQKTSIRPI
FT                   LFLYVLGTFSAALVAVVVSFIYPSTLILVAESADITPPSGIVEVLHGLLNSIIANPIHA
FT                   LLNANYIGILAWAVGLGIALRHAADTTKALINDMSDAVTLVVRVVIRFAPLGIFGLVAS
FT                   TIAATGFGALQLYAQLLVVLIGCMLLVALVVNPLIVYWKIRRNPYPLVFACLRESGVTA
FT                   FFTRSSAANIPVNMEMCKKMNLNEDTYSISIPLGATINMAGAAITITVLTLAAVHTLGI
FT                   TVDLPTALLLSVVAAICACGASGVAGGSLLLIPLACSMFGIPNDVAMQVVGVGFIIGVL
FT                   QDSAETALNSSTDVLFTAAVCQAEDAKLANPDPLAAGKSV"
FT   gene            complement(612340..613335)
FT                   /locus_tag="YPK_0559"
FT   CDS_pept        complement(612340..613335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0559"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; KEGG:
FT                   yps:YPTB3473 possible MocA-family oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66862"
FT                   /db_xref="GOA:A0A0H3B0A4"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B0A4"
FT                   /protein_id="ACA66862.1"
FT                   /translation="MIRFAVIGTNWITARFVDAAHESGKMKLVAVYSRKLDQAQTFGDD
FT                   YHVTDCFDNLEALAASDLIDAVYIASPNALHYSQAKLFLSHKKHVICEKSLASNLAEVE
FT                   SLIACAHQHQVVLFEAFKTAYLPNFIQLQQALPRVGKLRKAFINFCQYSSRYQRYLNGE
FT                   NPNTFNPAFSNGSIMDIGYYCLASALALWGEPKSVWASASLLPSGVDAHGTVSLNYGDF
FT                   DVIIIHSKVSQSDIPSEIQGEDGSLVIESISECLSVAFTPRGSHSQDLTQPQHINTMLY
FT                   EAEAFARLVENNRVDHDGLHLSLLTSRIQTEIRRQTGVIFPADTQYPAAS"
FT   gene            complement(613538..614047)
FT                   /locus_tag="YPK_0560"
FT   CDS_pept        complement(613538..614047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0560"
FT                   /product="protein of unknown function DUF45"
FT                   /note="PFAM: protein of unknown function DUF45; KEGG:
FT                   ypi:YpsIP31758_0498 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66863"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B146"
FT                   /protein_id="ACA66863.1"
FT                   /translation="MSVLTYLQGYPEHLQTQVRQLITEQRLGNVLRQRYPQPHDYNTDK
FT                   TLYHYTIELKNQYLRNAQPLSKVAYDNKIQVMKHALGLHTAISRVQGGKLKSKAEIRVA
FT                   TVFKNAPEAFLKMIVVHELAHLKEKDHNKAFYNLCCHMEPQYHQLEFDTRLYLTHLDLF
FT                   GSIYAY"
FT   gene            complement(614303..617296)
FT                   /locus_tag="YPK_0561"
FT   CDS_pept        complement(614303..617296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0561"
FT                   /product="outer membrane autotransporter barrel domain
FT                   protein"
FT                   /note="TIGRFAM: outer membrane autotransporter barrel
FT                   domain protein; PFAM: Pertactin; Autotransporter beta-
FT                   domain protein; KEGG: ypp:YPDSF_0374 autotransporter
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66864"
FT                   /db_xref="GOA:A0A0H3AZS0"
FT                   /db_xref="InterPro:IPR004899"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZS0"
FT                   /protein_id="ACA66864.1"
FT                   /translation="MKNSNRSPKNISRNFKHHKETSLSSKNKSPIATCVAAALFIFGSS
FT                   SVIANPDHEGIVVGKSILNKKQSAVNAIINEGNSLVLTDSASAEHTAVNTGSIFTLKED
FT                   STADITSVTGGFFSLSGSSKANINTVLSGGWLEVNDDASITETTISSDIEKKSTVRLYQ
FT                   DGSATKTTVGDNGILYVSGDSRAEETHVTKGGKLIVYSESQGPTLKNTQIAGTLTLKSD
FT                   VTLEGKTEFVSSATIKTTGHLIDNQGQLIFNSDKDIVIEAMIDGQGSLTKENPLTTLTL
FT                   SSAGDAWVASYVYSGETHINAGNLKLANTHFFGSPISGNPNTRLILEKSTLDTTVQGSS
FT                   VFIDKHSIWNMQGDSNIHHLDILDSGRHDLNNPGKTGNQLIINGDYFSDNGTLIFHSQL
FT                   AGDDSVTDHILIKGNTGGHTNVRVINVNGEGNKTDSGIQLIEVRGISDGEFSQVGRITA
FT                   GAYEYRLGRGKDELSKNWYLSSDITDYSSDGVPEAELPGILVLKSDNAAVFSAKLADYA
FT                   LQAVGGVVDSFTQPETSPPSNTPELTVPDPKRANAAVFSAKLADYALQAVGGVVDSFTQ
FT                   PETNTPSNTPELTVPDPKRANAEAFSAKLADYALQAVGGVVDTFTSPEQTEQTEQTTAT
FT                   PDSTPKSTDSAVKPASTPKPTDLAVKPANTVISNAKTAAPKRQTLVHTPENGSYIANIA
FT                   MARNLFTTRLEDRTSHYLYKDIVTGQWQPTSMWMHTQGGRSQFGHTVEQLNIKGNYYSV
FT                   QLGGDIAQWATNEQGSGRIGMLAGLGKATNHSHSKVTSYHSRGSVDGYNLGIYATWFAD
FT                   QQHNTGVYIDTLAQYSWFNNAVNGQDKAEEKYKSSGFTTSIESGYTFNLANSDQLSYFI
FT                   QPNAQITWAGINTQTHKTADGAVVSYRNNGHFITRIGAKAYLQTHDTLNTKFTPFVAVN
FT                   WIHQNQNTGTTISGQGIDNKIQNSTEFNVGVESQIDQQLHIWANINHQIGRYNYTDTNA
FT                   LVGVKYHF"
FT   sig_peptide     complement(617147..617296)
FT                   /locus_tag="YPK_0561"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 50"
FT   gene            617771..618958
FT                   /locus_tag="YPK_0562"
FT   CDS_pept        617771..618958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0562"
FT                   /product="rRNA (guanine-N(2)-)-methyltransferase"
FT                   /EC_number="2.1.1.171"
FT                   /note="PFAM: methyltransferase small; KEGG:
FT                   ypi:YpsIP31758_0500 methyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66865"
FT                   /db_xref="GOA:B1JLA4"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR017237"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1JLA4"
FT                   /protein_id="ACA66865.1"
FT                   /translation="MSQLDLGTQSLELERFPPQENSNTLQAWEAADEYLLQNIDLSQID
FT                   GRPVLVFNDQFGTLACALHAYRPFSSSDSYMSQLATAHNLRLNHLDESAVTLLSSVDDL
FT                   PEAPKLVVIKIPKALALLEHQLRALRRVVAPDTVIIAGAKSRDVHNSTLQLFEKILGPT
FT                   KTTLAWKKARLIHCEVADIPLADAPETIDWPLPNTDYIIHNHANVFSRNNLDIGARFFM
FT                   EILPYDVTGKIADLGCGNGVVGLIALEQNPLAEMLFVDESYMAVASSELNITVNRPQDL
FT                   SRCEFMVSHGLAGVERESLQLVLCNPPFHQQHAVSDHVAWQMFCDAKRCLKAGGELMIV
FT                   GNRHLDYFHKLKRLFGNCETLDSNQKFMVLKSVKQASSRSEGGGSGSLDMSYSDF"
FT   gene            complement(619074..621095)
FT                   /locus_tag="YPK_0563"
FT   CDS_pept        complement(619074..621095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0563"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase;
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: ypp:YPDSF_0376 2,4-dienoyl-CoA
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66866"
FT                   /db_xref="GOA:A0A0H3AXM2"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AXM2"
FT                   /protein_id="ACA66866.1"
FT                   /translation="MLAYPHLFTPLDLGFTTLKNRILMGSMHTGLEELPDGPQRLAAFY
FT                   AERAAGGVGLIVTGGIAPNMKGGVYQGASVLNDAAQIPHHQVVTEAVHQAGGKIALQIL
FT                   HAGRYSYQKHPVAPSALQAPINPFVPQALSHEEILQTIADFAHCAQLAKQAGYDGVEIM
FT                   GSEGYLINQFLTARTNQRDDEWGGDFTHRMRFAVEIVRAVRQATGHDFILIYRLSMLDL
FT                   VEEGSNWVEIEQLAQAVEQAGATVINTGIGWHEARIPTIATMVPRAGFSWVTRKLMGKV
FT                   NIPLITTNRINDPAVAEQVLADGCADMVSMARPFLADAAFVQKAAQGRADEINTCIGCN
FT                   QACLDQIFDGKLTSCLVNPRACRETEMPELPTDAPKRLAVVGAGPAGLAFAVTAARRGH
FT                   QVTLFDAAAEIGGQFNIAKQIPGKEEFYETLRYFRRQLVLNGVTLQLNTLVQVKQLAEF
FT                   DEVILACGIQPRLPCINGIDHPKVLTYLDVLRDKKPVGQRVAIIGAGGIGFDTAEYLSQ
FT                   SGDSPRFDSTAFSTEWGIDQDLAHRGGLSPAGAKVPPSPRQIFLLQRKASKVGEGLGKT
FT                   TGWIHRTSLAMRGVKMLNSVSYEAIDDKGLHIIRAEQACCLPVDTIIICAGQEPRRELH
FT                   QPLLDMGKTVYLIGGADKAVELDARRAIDQGTRLALAI"
FT   gene            complement(621308..621877)
FT                   /locus_tag="YPK_0564"
FT   CDS_pept        complement(621308..621877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0564"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ypi:YpsIP31758_0502 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66867"
FT                   /db_xref="GOA:A0A0H3AZA9"
FT                   /db_xref="InterPro:IPR005325"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZA9"
FT                   /protein_id="ACA66867.1"
FT                   /translation="MLNIDQKYLTNLDESALKKQRIFMRIVAVLLLLGGIFCLINPLAS
FT                   GAALSMVIGILLLLSGIAMIVGMIANRSDNFWPMVAGILLGVAYIVMGYVFITNPAIGM
FT                   ISLAVVLAVLFAFGGVLRLINGFKDLKRPGAWLQILLGVLDLVITYLLVSAGPLMSITM
FT                   VTTLVGIEMLFSSFSCFMVASLFKRS"
FT   sig_peptide     complement(621737..621877)
FT                   /locus_tag="YPK_0564"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.790) with cleavage site probability 0.504 at
FT                   residue 47"
FT   gene            complement(622245..623744)
FT                   /locus_tag="YPK_0565"
FT   CDS_pept        complement(622245..623744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0565"
FT                   /product="putative kinase protein"
FT                   /note="KEGG: yps:YPTB3467 putative kinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66868"
FT                   /db_xref="GOA:A0A0H3B0B2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B0B2"
FT                   /protein_id="ACA66868.1"
FT                   /translation="MANIVTCTTKDGETIQYVDEIIGSGSMKDVYFSPDKSYVVAFYKK
FT                   PQNDQAKERIDMITGRYRQNIFEQSGGEYWKDLFCWPTHVVEHNGKIGIVVPTYQNHFF
FT                   FKYGSKNNDFLGIKGREKEGKWFASANNQNKFLDPRERGNILNYLKVCLLLTRAVRRMH
FT                   AAGLCHSDLSYKNVLIDPEQGHACIIDVDGLVVPGKFPPDVVGTPDFIAPEVVKTSHLL
FT                   KEDPQRILPNITTDRHALSVLIYMYLFYRHPLRGGKIHDMDDEVRDESLAMGERALFIE
FT                   HPTDRSNAVKLNQVKPSSLPWADPQKVPYTIMGPYLTQLFEKAFIDGLHDPSKRPTADE
FT                   WETALVKTVDLIQPCQNTACEQKWYVFSGKTKPVCPYCGTAFKGKLPILNLYSSRKAGS
FT                   YRPDDHRLMVWNGQSLYAWHVNRLIAPNERTSEAQKKRVGYFVFHNDQWWLVNEGITGL
FT                   MSLPDKKAIGIGEKLALTDGAQLVLSTEEGGRLVVVQLVAN"
FT   gene            complement(623776..625524)
FT                   /locus_tag="YPK_0566"
FT   CDS_pept        complement(623776..625524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0566"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: yps:YPTB3466 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66869"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B148"
FT                   /protein_id="ACA66869.1"
FT                   /translation="MDINDNLHQDDLRQDDVYQKVLRLLLDEAGIVLPETELAALKQDT
FT                   AIRSLLNDLLASVSAKAKHLALANNETVTDDRQQLASLTEENSHEVIRGEENIVKEPDQ
FT                   QNERLLLAETLSAEILSAKTLEPNPPADVLPPIEIHHKVPVEEESWQAMLFSPIEQHAN
FT                   TASSAAGTKPLRPGQIPVGMPNPANCPPQYTQPKAKINIANARVGTPFHSDVDISLDNG
FT                   AKAEILDVSFAKDIGLIFDQATSSLSGTPTESGDIEATVTWSCHSAPYFSTKVLFIVNP
FT                   DPRSLWKILEPPADDRYFKENVDHKLISAPGVNIAAASRRGRSHEHVGSFRDDDFFISS
FT                   NHDTGWNIMLVADGAGSAKNSRKGSQIVTETVGHYLSAQLSGDKGRELKERIINWTPED
FT                   QRVVGETFIRQFHHASVIAINNIKNESLIAEETVKSYSTTLLATVSFRTGTELFAAAFW
FT                   MGDGAIAAYGPVGRVRILGTPDSGEYAGQTRFLDVDAVGDPEFSKRVSIGKWTGISHLV
FT                   LMTDGVSDPRFETDNGLQNPQKWDALIAEISPCLNDNPQAAEQLAEWLNFFSPGNHDDR
FT                   TMVVSW"
FT   gene            complement(625524..626564)
FT                   /locus_tag="YPK_0567"
FT   CDS_pept        complement(625524..626564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0567"
FT                   /product="von Willebrand factor type A"
FT                   /note="PFAM: von Willebrand factor type A; KEGG:
FT                   ypi:YpsIP31758_0505 putative tellurium resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66870"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR028274"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZS5"
FT                   /protein_id="ACA66870.1"
FT                   /translation="MRRLPIFFVLDCSESMIGENLKKMNDGLQMIINDLKKDPHALETA
FT                   WISVIAFAGVAKTIVPLVEVVSFYPPRLPIGGGTSLGAALQELTRQIDTQVRKTTEERK
FT                   GDWKPVVYLLTDGRPTDDTTAEITRWKTHYARKVNLIAIGLGPSADLNILRQLTENVLL
FT                   FNDTQEGDFTQFIKWITASVSAHSRSVGEESPPLLNQTDYIVKLAKDDVARAYDENCVT
FT                   LIGRCSKSRRPYIIKYERPAVNLSSLNFKLNINGFNLAGCLPIDEDYFAWSDESVSSQQ
FT                   VNTSELHGTPGCPHCGNGSAFAMCNCGKLLCINGADDVICPWCDRGLTFNVDGGGSDFD
FT                   VIRGRG"
FT   gene            complement(626666..627367)
FT                   /locus_tag="YPK_0568"
FT   CDS_pept        complement(626666..627367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0568"
FT                   /product="von Willebrand factor type A"
FT                   /note="PFAM: von Willebrand factor type A; KEGG:
FT                   yps:YPTB3464 putative TerY-like tellurite resistance
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66871"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR011392"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AXM6"
FT                   /protein_id="ACA66871.1"
FT                   /translation="MPLVSLLILTPLSLILRTTSDMRRLPVYLLIDTSGSMRGESIHAV
FT                   NVGIQAMMSALRQDPYALESVHLSIITYDNQAREYIPLTALENFQFTDITVPSAGGTFT
FT                   GAALECLIHCVDRDIQRSDGDQKGDWRPLVFLMTDGTPSDVYAYGEAIKEVKKRAFGSI
FT                   IACAVGAKAKHEHLKQLTSQVVALETLDSTAFSGFFKWVSASVAAGSSSAGINTGQDNL
FT                   PPPPPEIQLVL"
FT   gene            complement(627306..627947)
FT                   /locus_tag="YPK_0569"
FT   CDS_pept        complement(627306..627947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0569"
FT                   /product="stress protein"
FT                   /note="PFAM: stress protein; KEGG: ypi:YpsIP31758_0507
FT                   tellurium resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66872"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZB5"
FT                   /protein_id="ACA66872.1"
FT                   /translation="MSVSLHKGQGVSLRKNEYDLSSVTIGLGWDINEEKKGILGSLFGK
FT                   KEEEYDLDVIAFLCNAQGKVTDLGNVENGKPSLVNGDIIFFNSLRHKSGQIWLTGDNRT
FT                   GAGDGDDEQIIVKLNTLDPKYEKIVFIVQIYNGSKLQQHFGKVQNAFIRAVDAKNIEMA
FT                   RFNLSGGPAFNQQCSMLFAELVRESTGWKLNAIGEPSDSDTFVTHLKNYL"
FT   gene            complement(627980..628618)
FT                   /locus_tag="YPK_0570"
FT   CDS_pept        complement(627980..628618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0570"
FT                   /product="von Willebrand factor type A"
FT                   /note="PFAM: von Willebrand factor type A; KEGG:
FT                   ypi:YpsIP31758_0508 putative tellurium resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66873"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR011392"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B0B5"
FT                   /protein_id="ACA66873.1"
FT                   /translation="MRRLPVYLLLDTSGSMTGEPIEAVKNGVQMLLSTLRQDPYALETA
FT                   YVSVITFDSSARQAVPLTDLLNFKLPELVANGTTALGDALSLTAKCIGNEVQKTTADTK
FT                   GDWRPLVFIMTDGSPTDDWRKGLSDFKAARTGVVVACAAGHAVETKVLQEITEIVLQLD
FT                   TADSSSIKAFFKWVSASISVGSQKVESGKKEVIGLDDLPPPPPEVNVVL"
FT   gene            629333..631021
FT                   /locus_tag="YPK_0571"
FT   CDS_pept        629333..631021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0571"
FT                   /product="Polypeptide-transport-associated domain protein
FT                   ShlB-type"
FT                   /note="PFAM: Hemolysin activator HlyB domain protein;
FT                   Polypeptide-transport-associated domain protein ShlB-type;
FT                   KEGG: ypp:YPDSF_0385 hemolysin activator protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66874"
FT                   /db_xref="GOA:A0A0H3B160"
FT                   /db_xref="InterPro:IPR005565"
FT                   /db_xref="InterPro:IPR013686"
FT                   /db_xref="InterPro:IPR027282"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR035251"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B160"
FT                   /protein_id="ACA66874.1"
FT                   /translation="MSRFYYSILVAGVLLKIVAIPDASYGAELAPVQQSIHQQERQRAL
FT                   EERLAPPTPDVRLSAPSAFFRRIIFPLETPCFVINRIKISGAEPLPRWLPLQRIADQAQ
FT                   GQCLGAKGINLLMSQMQNRLVDHGYVTTRVLAPQQDLNSGTLALNVVPGKIRGVELTPD
FT                   SNRYVTLFSAFPARAGTLLDLRDIEQGLENLQRVPTVQANMVLIPGSAPGETDIILNWQ
FT                   QRKMWRLAASLDDSGTRSTGRYQGGATLFLDNPLSLSDLFYVSAGGALQRRGDKGTNNL
FT                   TGHYSLPFGYWTAGMTASRYDYYQAVAGLNGDINYRGESENVAFQLSRLLHRNASQKTT
FT                   FTYDVLTRSSKNYINDTEVEVQRRHTSAWRIGLQHRHFISQAILDAGISYQRGTRWFGA
FT                   IPAQEEYFGEATALSKILRLNAQLDIPFAVMAQNLHYNLQYQRQSTNTPLTPQDQFSIG
FT                   GRWSVRGFNGERTLIADRGWWVRNDIGWYLPLPGHELYVGVDYGEVGGRSGAYLLGRHL
FT                   AGSAVGVRGNVLNTRYDLFAGKPLSKPNGFKTDSLAVGFNLNWLY"
FT   gene            631066..633042
FT                   /locus_tag="YPK_0572"
FT   CDS_pept        631066..633042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0572"
FT                   /product="filamentous haemagglutinin family outer membrane
FT                   protein"
FT                   /note="TIGRFAM: filamentous haemagglutinin family outer
FT                   membrane protein; adhesin HecA family; PFAM: Haemagluttinin
FT                   repeat-containing protein; filamentous haemagglutinin
FT                   domain protein; KEGG: ypi:YpsIP31758_0510
FT                   adhesin/haemagluttinin repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66875"
FT                   /db_xref="InterPro:IPR008619"
FT                   /db_xref="InterPro:IPR008638"
FT                   /db_xref="InterPro:IPR010069"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR024973"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZT2"
FT                   /protein_id="ACA66875.1"
FT                   /translation="MNKNLYRIVFNQARGMLMVVADIAASGRAASSPSSGVGHTQRHRV
FT                   SALSPLSFRLLMALGGISLSAQAAIVADGSAPGNQQPTIISSANGTPQVNIQTPSSGGV
FT                   SRNAYRQFDVDNRGVILNNGRGVNQTQIAGLVDGNPWLARGEASVILNEVNSRDPSQLN
FT                   GYIEVAGRKAQVVIANPAGITCEGCGFINANRATLTTGQAQLNNGQLTGYDVERGEIVI
FT                   QGKGLDSRGQDHTDLIARSVKVNAGIWANELNITTGRNQVDAAHQNINTNAADGRPRPA
FT                   VAVDVANLGGMYAGKIRLIGTETGVGVHNAGEIGASAGDIVITADGMLVNRGQISSAQQ
FT                   LAVNTPSGIENSGVLYGKGNTQLTTAGKLSNSGTVAAAGDTLIRAAEVNSSRNSVLGAG
FT                   IKSDNSAITRGTLDIKARGQLTAQGKNISGTAQTFNANRIDLSGSQTQSGDLTFTTEGG
FT                   DIDLTGANLFANRRLSVSTPSLLRTDKANLFAEQIALDAQALANVGGVITQTGLTDFNL
FT                   NLPGYIDNRGGSLLTRGNFLLQAEHLTSNSQSLLGAGIQSDGKLAPRGDLNVTTRHALI
FT                   AQGKTLAAGTLALSGSRLDLTDSLTQAKYMRLTATEGDIALTGATVMAANTLFADSQIR
FT                   RFIDWACYKNNSSNDKRKYPLTQ"
FT   gene            633011..633367
FT                   /locus_tag="YPK_0573"
FT   CDS_pept        633011..633367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0573"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ypi:YpsIP31758_0517 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66876"
FT                   /db_xref="GOA:A0A0H3AXN0"
FT                   /db_xref="InterPro:IPR033806"
FT                   /db_xref="InterPro:IPR040559"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AXN0"
FT                   /protein_id="ACA66876.1"
FT                   /translation="MTKENIRSLNRENESAQILAKSGFHVEQNPIVSGRKDPDYKINGE
FT                   IFDNYAPKSSSVRNIWTEVKGKIDKRQTNNVVINMSDTKVSAPELQRQLTKWPIMGLDK
FT                   VIVIDKSGNAIRVK"
FT   gene            633374..633679
FT                   /locus_tag="YPK_0574"
FT   CDS_pept        633374..633679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0574"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spe:Spro_4401 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66877"
FT                   /db_xref="InterPro:IPR033805"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZC1"
FT                   /protein_id="ACA66877.1"
FT                   /translation="MSIDLRCYTTLSVDELQKKLDVFLAKYPEIFPEHYILYKASTLGP
FT                   FDKEISNEFGLDPESYFYISVSNKMLEICTNEIARLVKDELGEDHVIVLHNGEDLI"
FT   gene            633782..637015
FT                   /locus_tag="YPK_0575"
FT   CDS_pept        633782..637015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0575"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ypi:YpsIP31758_0514 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66878"
FT                   /db_xref="GOA:A0A0H3B0B8"
FT                   /db_xref="InterPro:IPR006914"
FT                   /db_xref="InterPro:IPR025157"
FT                   /db_xref="InterPro:IPR033799"
FT                   /db_xref="PDB:4ZQU"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0A0H3B0B8"
FT                   /protein_id="ACA66878.1"
FT                   /translation="MLSAGSIDVSSQNIAVAGSSVVADKDIRLRAQENLTVSTAQQSES
FT                   GTQLFEQKKSGLMSTGGIGVFIGTSRQKTTDQTQTVSHIGSTVGSLTGNVRLEAGNQLT
FT                   LHGSDVVAGKDLALTGADVAISAAENSRSQQYTAESKQSGLTVALSGPVGSAVNTAVTT
FT                   AKAAREENTGRLAGLQGVKAALSGVQAVQAGQLVQAQGGGITEMVGVSVSLGSQKSSSQ
FT                   QQQEQTQVSGSALTAGNNLSIKATGGGNAANSGDILIAGSQLKAGGDTRLDAARDVQLL
FT                   GAANRQKTDGSNSSRGGSIGVSVGGSGLSVFANANKGQGNERGDGTFWTETTVDSGGMF
FT                   SLRSGRDTTLTGAQVSAETVKADVGRNLTLQSQQDRDNYDAKQSRASGGISVPVAGGGA
FT                   AVNLSMSRDRLSSQYDSVQAQTGIFAGSGGVDIRVGEHTQLDGAVIASTAAADKNTLDT
FT                   GTLGFSDIKNKAVFTVEHQGGSLSTGGPVGSDLLSNLGGMVLAGLGNGGYAEGTTQAAV
FT                   SEGTITVRDTENQQQNVDDLSRDTGNANGSIGPIFDKEKEQNRLKEVQLIGEIGGQALD
FT                   IASTQGKIIATHAANDKMKAVKPEDIVAAEKQWEKAHPGKAATAEDINQQIYQTAYNQA
FT                   FNESGFGTGGPVQRGMQAAIAAVQGLAGGNMGAALTGASAPYLAGVIKQSTGDNPAANT
FT                   MAHAVLGAVTAYASGNHALAGAAGAATAELMAPTIISALGWDKNTLTEGQKQAVSALST
FT                   LAAGLAGGLTGDSTADALAGGQAGKNAVENNYLNSTQALTFDKELSDCRKSGGNCQAVI
FT                   DKWKKVSDEQSVKLDETLKNNPLEAQVWDKEVAQGGIAITERPGWLSSLGADVMSSEEA
FT                   KAYVQQWNGQDLSKIDVNSPGWTKFAAFASDPENQVAVASLGMLGKDLTKAALSYMGRN
FT                   TSTATVSASSVGMKWGQGNMKQGMPWEDYVGKTLPVGSRLPPNFKTYDYFDRATGAVVS
FT                   AKSLDTQTMAKLSNPNQVYSSIKKNIDVTAKFEKASLSGVTVNSSMITSKEVRLAVPVN
FT                   TTKAQWTEINRAIEYGKNQGVKVTVTQVK"
FT   gene            637017..637550
FT                   /locus_tag="YPK_0576"
FT   CDS_pept        637017..637550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0576"
FT                   /product="protein of unknown function DUF1436"
FT                   /note="PFAM: protein of unknown function DUF1436; KEGG:
FT                   plu:plu3061 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66879"
FT                   /db_xref="InterPro:IPR009888"
FT                   /db_xref="InterPro:IPR037891"
FT                   /db_xref="PDB:4ZQU"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0A0R4I987"
FT                   /protein_id="ACA66879.1"
FT                   /translation="MNDIVKSAWASVKMNTDFICVDTYSGYRSNQLDPLGVQHLSSPDV
FT                   SDLDLGEMVKDALSHSRFVLPAPRTDIWIHPEVTFDLDLYDSRRTVERYDEWVKKLMVH
FT                   YGYKTKRALFKDMKSCDICCNHDAITISPTRHEKLEVWGGTGLKGSDNVILSVDSSPTE
FT                   IGAGLRLALSRCKG"
FT   gene            637676..639475
FT                   /locus_tag="YPK_0577"
FT   CDS_pept        637676..639475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0577"
FT                   /product="putative adhesin"
FT                   /note="KEGG: ypm:YP_2919 putative adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66880"
FT                   /db_xref="InterPro:IPR006914"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZT4"
FT                   /protein_id="ACA66880.1"
FT                   /translation="MSRDRLSSQYDSVQAQTGIFAGSGGVDIRVGEHTQLDGAVIASTA
FT                   AADKNTLDTGTLGFSDIKNKAVFTVEHQGGSLSTGGPVGSDLLSNLGGMVLAGLGNGGY
FT                   AEGTTQAAVSEGTITVRDTENQQQNVDDLSRDTGNANGSIGPIFDKEKEQNRLKEVQLI
FT                   GEIGGQALDIASTQGKIIATHAANDKMKAVKPEDIAAAEKQWEKAHPGKAATAEDINQQ
FT                   IYQTAYNQAFNESGFGTGGPVQRGMQAATAAVQGLAGGNLGAALTGASAPYLAGVIKQS
FT                   TGDNPAANTMAHAVLGAVTAYARGNNALAGAAGAATAELMAPTIISALGWDKNTLTEGQ
FT                   KQAVSALSTLAAGLAGGLTGDSTADALAGGLAGKNAVENNLLGGNEFTHTQFVQKHGAD
FT                   VLSCADNPSNAACQRGIAENKAYIAALATGSVALLPGSSQAMWALGAGTNAGMQYADNG
FT                   KINPVNSVAAGWINVITMGQGWKGTIAWNAAGGALINAINGGDPLTGAITNGTGAGFGY
FT                   GVGNYVVKPAANTLGKWITGGWNPKFDPNLLKYAEVKGQLGISKEMLPSKIPSAVGNAG
FT                   GSLSSEFGSSLIQQKKDAMEDSK"
FT   gene            639472..639705
FT                   /locus_tag="YPK_0578"
FT   CDS_pept        639472..639705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0578"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ypm:YP_2920 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66881"
FT                   /db_xref="GOA:A0A0H3AXN4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AXN4"
FT                   /protein_id="ACA66881.1"
FT                   /translation="MKNLLYVVLLMAVCILGLLIVGTIFYLFLEVFMYFYVNAPISLES
FT                   FQFTRLLKMSIYGGGILGLGIGLLRIFKIKGF"
FT   sig_peptide     639472..639561
FT                   /locus_tag="YPK_0578"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.608) with cleavage site probability 0.460 at
FT                   residue 30"
FT   gene            639977..640198
FT                   /locus_tag="YPK_0579"
FT   CDS_pept        639977..640198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0579"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ypp:YPDSF_0388 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66882"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZC7"
FT                   /protein_id="ACA66882.1"
FT                   /translation="MVVVGSGGSANLSMSRDQLRSNFDSVQEQTEKNAVENNFLSATKN
FT                   EKLMKALNDQKEDKTLACYTRKNCSRFR"
FT   gene            640158..640292
FT                   /locus_tag="YPK_0580"
FT   CDS_pept        640158..640292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66883"
FT                   /db_xref="InterPro:IPR025331"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B0C1"
FT                   /protein_id="ACA66883.1"
FT                   /translation="MPAIQGKIAPAFGEPGGGIQILPNMQERVNVEWLLKNNYIREVR"
FT   gene            640294..640710
FT                   /locus_tag="YPK_0581"
FT   CDS_pept        640294..640710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0581"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ypm:YP_2922 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66884"
FT                   /db_xref="InterPro:IPR028952"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B170"
FT                   /protein_id="ACA66884.1"
FT                   /translation="MLLSIAEIQKKVDEMALRAGLPRHSVNLCTEPIGEGTPYITFENN
FT                   MYNYIYSERGYEFSRRVTKSLDELLYWIMSELAHKAAFQYELDHRVEGRDGRRIAFPKF
FT                   IELMANMNSAWESEARHEIQKILAESPYDDSLYT"
FT   gene            640743..641540
FT                   /locus_tag="YPK_0582"
FT   CDS_pept        640743..641540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0582"
FT                   /product="putative adhesin/hemolysin"
FT                   /note="KEGG: yps:YPTB3460 possible adhesin/hemolysin"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66885"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZU1"
FT                   /protein_id="ACA66885.1"
FT                   /translation="MRRTYKGKLWGIAWGPEMKLRPNNQYASSITAKTLTGSGTVINNT
FT                   VINNGTAPGAIVAPRDRDSTGKNIAVEFNGISLTLPRSGLYQLKTDKGDYAPGPEAALS
FT                   LANISPPSSLDATGQRGVPPPSDDLNRTGLVTPDRAVSGGYLVETHPAFASLNNWKGSD
FT                   LYLQQLSSDPSVIHKRLGDNAYEQRLLRDQVLALTGRTVASDYRSEQAQFEQLFAAGVQ
FT                   YSKAFNLAPGTRLSAEQMATLTGNIVLMENRDVAGQTVLVPVV"
FT   gene            complement(641999..644284)
FT                   /locus_tag="YPK_0583"
FT   CDS_pept        complement(641999..644284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0583"
FT                   /product="outer membrane autotransporter barrel domain
FT                   protein"
FT                   /note="TIGRFAM: outer membrane autotransporter barrel
FT                   domain protein; PFAM: Autotransporter beta- domain protein;
FT                   KEGG: yps:YPTB3449 putative autotransporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66886"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AXN8"
FT                   /protein_id="ACA66886.1"
FT                   /translation="MNNHKIWRLSAVAVALLISGNGYADQTFHFAQQPHNTGDHTVIAA
FT                   PEVNNFSLADLTANAEGQAVDATNAGALSLRVEPTQGDAQANGVLVTSGTFTNQAQGSI
FT                   TVSASSQDQHAVASGLQATDAYWSTLRNQGSIRATSNSLHGSAEAYGIQAGLAFSDAAG
FT                   DHYGDHMMLSNEGVMQVSATAEQDAFASGIYTNAGNGVVNNGRLDVSAHASAGDARATG
FT                   LHTLSANPGVDPDPWNPANPTHLMSNNGSLSVTASGNNATASAISTEGEGVYIYNNGTL
FT                   IVDAFSESAQGSASAYGIHVLNGSATINSSGRILATATGGSQQQAYEVMADGSVVNIER
FT                   YTLALGDETPWAVSNGGSIVLGNGTQGADLVLMAGQASEGFAYGKEYSLDNLAYDTTSG
FT                   QQSTVGGSIAGLYGITPDIKVIHSGSSSSSLGSAALVYAPDVSHAGVSALAQRSSMEQA
FT                   SNIISSQLHSQLVSNAGCNQKLESADSCVFITPYAGEYRRDPVTSGYSGQRYGVLLGQN
FT                   QHFGDFQLGWHGGYESASTDFNGTSVGRKEEINTLMLGVQGGMKLSESLFIAATSTWFS
FT                   SDTDYSDSNTYYGVGSQSGSYDSSGLYTDVSVGNSWQLNRNYAMTPMVGLTHIWQQRDG
FT                   YIVSSNNSNYDLIDTRYSSYSNHAVALHAGVRLDGRYPLTNETLLKPFFNVGLQQMLYG
FT                   DEITIDQSIPNSPVVGVSTKDKTTQGTFDLGMALVSDNGVSASLQLSGMVNSDRQDFTG
FT                   WANLGWAF"
FT   sig_peptide     complement(644210..644284)
FT                   /locus_tag="YPK_0583"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            complement(644344..645339)
FT                   /locus_tag="YPK_0584"
FT   CDS_pept        complement(644344..645339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0584"
FT                   /product="putative exported protein"
FT                   /note="KEGG: yps:YPTB3448 putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66887"
FT                   /db_xref="InterPro:IPR025737"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZD5"
FT                   /protein_id="ACA66887.1"
FT                   /translation="MKRLLLSALLITPGTLLAADAQELPLLSGGDTPTIKNSNLDLFGV
FT                   SRDFGDIIFIDDDRTVNDSAPKRTRVFTGYEYENIKFSNHPAQLYSTLVFADGSTKITD
FT                   SFSMGYVLRETTIYDGPRNNAFAGSDKSRRDSFMEIQLLPKYINWVNENLSYGAELGYE
FT                   RFTDAKDAPEKQMYHIRPEINLGFGRNFLHLNAELGWIDRTDRGAYIETEPLYLYRVTD
FT                   NFNIGAKAYYHAEDNDYRWRETAIRPLIQYRFANSTYLELRWEIGGIRTHDGSGYNYNN
FT                   YGLYTEIPFNPTISFMADLQYKDQKQHRGNEWSWGDKEDIFAKVGFILNF"
FT   sig_peptide     complement(645283..645339)
FT                   /locus_tag="YPK_0584"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.929 at
FT                   residue 19"
FT   gene            complement(645441..646820)
FT                   /locus_tag="YPK_0585"
FT   CDS_pept        complement(645441..646820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0585"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ypi:YpsIP31758_0524 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66888"
FT                   /db_xref="InterPro:IPR019282"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B0C2"
FT                   /protein_id="ACA66888.1"
FT                   /translation="MINKRKIVLAAILLTVNGGLFAQSVVIDQLKVSEHLYPKGFESEF
FT                   QNNLDFYRDGVGVDEKAKVPYDTIRIEGTEIVKGYYTNTTEVGLYLNILTESVKAGNLQ
FT                   ALQRIKETLTTLEQAPKWNGLFYWPYDIRDGKLVTNPDEIVPAVDNGNLSFALAGVAGA
FT                   FLDSSDADKREIVQRIEAILDGQKPGWAALYDENKGLLSSGWSTKNNASLGYFVDRKGN
FT                   ESRAAVAWAVLATKDMGAKALPVSAFSKMELYTQRYEINGKQYNPLLTWDGAYFQMMMP
FT                   QIWLNERELMPNYGIVEDHTFIQKVYASKHGIPMVSSSATTDNAYHSFGVPQLSESKVR
FT                   FKNKIDDGYTGTPHAIALSYIVDPAGAISALKKLKQAYPNIESPYGWYDAVDSNGKISK
FT                   NILSLDVGMFVGAFLAKEINADVEKYLQSKGDMELLKEMYQSYVPNNYKPLDGLSSSSL
FT                   H"
FT   sig_peptide     complement(646752..646820)
FT                   /locus_tag="YPK_0585"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 23"
FT   gene            647146..648261
FT                   /locus_tag="YPK_0586"
FT   CDS_pept        647146..648261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0586"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; TOBE domain protein;
FT                   Transport-associated OB domain protein; SMART: AAA ATPase;
FT                   KEGG: ypm:YP_2927 putative transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66889"
FT                   /db_xref="GOA:A0A0H3B174"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B174"
FT                   /protein_id="ACA66889.1"
FT                   /translation="MTGVMLHNVNKIYPNGMQVLHDINLDIKDGEFMVIVGPSGCAKST
FT                   MLRMIAGLEEISSGELTIADRKCNDVQPKDRGIAMVFQNYALYPHMTVYENMAFGLKVA
FT                   KKTKAEIAQRVNEAAELLEITDLLQRKPKEMSGGQCQRVALGRAMVRKPAVFLFDEPLS
FT                   NLDAKLRVSMRLRISKLHQQLRESGRPATMIYVTHDQVEAMTMGERVCILRKGKIMQVD
FT                   RPMNVYRHPLNKFVAEFVGSPAMNMFSGRIEEYQEQLVIRCGEYRFPLPADKVAKSRSY
FT                   LGREIDFGIRPEDISISRADVANALTATVIRVDAMGSDEFIYFNLMGQQAICKRPNPED
FT                   EIQINETCHFSFNLDKCHLFDKESEKNILYI"
FT   gene            648344..651697
FT                   /locus_tag="YPK_0587"
FT   CDS_pept        648344..651697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0587"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: yps:YPTB3445 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66890"
FT                   /db_xref="GOA:A0A0H3AZU5"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZU5"
FT                   /protein_id="ACA66890.1"
FT                   /translation="MITKSITNVVHSAQGGVLQFNFMQGNMLKNMLAGDIMLNLFDTPR
FT                   LDMAIANIFLRQLDDSGIVRVTPLLFHNDQLVTYKNAQDEIIWQTTAPDFTAFVTLSFS
FT                   HEQEETYYYSVRVENHSAQALRYDLIYGQDLSLSDAGATKTNESYCSQYLDHKVFSLDK
FT                   YGYTVSSRQNLPQSTGNPLLQLGSFSPAVGFSTDGYQFFAKQYKFSHLPTIVTEPSLEN
FT                   RNYQYEMAYVALQLQPVTLPAGDSADSVFYGFYLSHQPEANIAQAFDVARIRANYRQPQ
FT                   REPATEQASPTQQGYDQRPLSGDKLTAEEIEQLFDGEKQFVEQLDGELLSFFYQEANYV
FT                   TLAEKERHLERPTGHIISSGNNIDFTNPIMNSTHYIYGVFNSHLTLGNTSFNKLLGVNR
FT                   NMLNQFKSSGQRILVQIGGEYRILAMPSAYEVGANFSRWIYKLAEGMIQVRAFASQSEP
FT                   VIQLDIAVSGHSQPLNVIVSHQLIMGNMEEEATVQVERHGDLLQISRTGDDHGPRFSIA
FT                   TRGGFTGVERYVDSDSQGVQYLLLQGQIAQQASIAFGGVLNGVDSRGKWLDFEHERQAY
FT                   HAQYRALLNDFSVSFSAAPQQAQKLNHAMHWFTHNALTHYSSPHGLEQPAGAAWGTRDV
FT                   SQGPIEFFMAMGRYQQVEAILCQTYRHQYLETGTWPQWFMFDEYAQVQQQESHGDIVVW
FT                   PLKALADYLLATDRVALLDTRLSYTSIKQNFAFTGEQETLLQHVQRQIDHIVAHLVPGT
FT                   YLSSYGDGDWDDTLQPANQSLRENMVSGWTIPLTLQTLKTLTKALQAYPQFADFIARIV
FT                   TLTSNMEADYHKYLIKDGVISGFIHFNQGEAEYLLHPTDTTTQIKYRLLPAKRSIISES
FT                   FDKEMAEQHMKIIMDNLMYPDGVRLMDRMAEYKAGKQTYFKRAELSANLGREIGLQYCH
FT                   AHIRFIEALCKMGMAQELYDNLFKTIPVGIQESVPNAELRQANSYFSSSDAKFDDRYQA
FT                   YNNFDQLKTGAVAAKAGWRIYSSGPGIYINQIVSNVLGVRYQAGDLLLDPVISRQFGDV
FT                   TLNYQLYNLPVTLRIYPQQGEFTPKRVLLDGQPLAFTLQDNPYRSGAALIHRQEIEGRL
FT                   TAHSQLEIYL"
FT   gene            651806..652792
FT                   /locus_tag="YPK_0588"
FT   CDS_pept        651806..652792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0588"
FT                   /product="transcriptional regulator, LacI family"
FT                   /EC_number="5.1.1.1"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG:
FT                   ypi:YpsIP31758_0527 sugar-binding transcriptional
FT                   regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66891"
FT                   /db_xref="GOA:A0A0H3AXP3"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AXP3"
FT                   /protein_id="ACA66891.1"
FT                   /translation="MSVTIKDVAKRAKVSISTVSYAINGSPKITEETRLRVLKIAQEMN
FT                   YTANNNAKMLKAKKSGAIGLFFNSWFGPVYSELVRGIEERVHREHYDLVACSLYGGEQS
FT                   TAHKYLRDRSVDGAIILTSSFDDRFLQSVASDVLPIVVLDRELKSPHIYNVLIDNFGGA
FT                   FKAVNALLAKGCRDIYFFSGPEQSYDNQKRLDGFIAALGYHNIQLNRDFIIHSNFTEAD
FT                   AYLKMQALIAAGRVPSAIFSANDEMAIGILRAAKEHNIRVPDDLKVVGFDNIYASGVLT
FT                   PSLTTINHHKYEMGVISANTLLRAIKEETDIDAVTLLPTELIERETL"
FT   gene            652869..654113
FT                   /locus_tag="YPK_0589"
FT   CDS_pept        652869..654113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0589"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: ypm:YP_2930 putative sugar binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66892"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZD9"
FT                   /protein_id="ACA66892.1"
FT                   /translation="MKILYYIAIAIASLPLMAAERLEIMVPSGSYVSFMRNTVTPEFNK
FT                   LYPEVNLVVSNDEQLDTRMAAGDNPNVYIGVFGYQPAKLAKLGKLAYLDKFPGFAELNE
FT                   RIDPHFLRENFGRTYYIPWNATTQMMIYNKELFAEAGLDPERPPATWDEFLLVAEKISA
FT                   LPPRSDGSKVYGTVFWNDVLSFGSWYWNLLAPMYYNVNQGQYQLLNRYGTDIVFDRPDA
FT                   NMAQFMRTMQQAQRFAPLTMEKSFFSRNIGMWLQFGFGWKATLSSAAERPMVVGQDVAI
FT                   APIPVQTKGDIHYSVLDGRAIMIFKDEARKEQLSWALLNLLMRDDINLQANIALGQLPT
FT                   LKALQDAPYFQSAEAQPFVQQLQHAILSEPFANAMEVANIILANYSKVVLKGEISPEQA
FT                   VATSAQAARQLLNEH"
FT   sig_peptide     652869..652925
FT                   /locus_tag="YPK_0589"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.991 at
FT                   residue 19"
FT   gene            654167..655048
FT                   /locus_tag="YPK_0590"
FT   CDS_pept        654167..655048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0590"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ypi:YpsIP31758_0529 sugar
FT                   ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66893"
FT                   /db_xref="GOA:A0A0H3B0D8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B0D8"
FT                   /protein_id="ACA66893.1"
FT                   /translation="MKNKNVMMGYLFIAPWIIYFLVFILYPFFLSFQNSFLDINVLSPE
FT                   STQFVGLNNWISVSSDGLFWRSLFNVIFNQVIFVLLSFVLAMGMALLLHEITHFGGLFR
FT                   TIMFIPVITSITVAMIIFNFLSSPAGPVQSLLLEWGVLDAPVFWKFERWLPMPLIAVFS
FT                   TWKWFGIQMIIFLGGIAGISKSLYEAADIDGASWRRKTWSITLPLLKPQIIFVMTMNII
FT                   NGMQMFIEVLMNFDLHGGPYNAALTPVLYLYKTGFSDMKMGTASTIGLLLAAVIYIFTM
FT                   LQLKFTQEKEHS"
FT   gene            655048..655866
FT                   /locus_tag="YPK_0591"
FT   CDS_pept        655048..655866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0591"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ypi:YpsIP31758_0530 sugar
FT                   ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66894"
FT                   /db_xref="GOA:A0A0H3B179"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B179"
FT                   /protein_id="ACA66894.1"
FT                   /translation="MRISKKNLLIYSLLIIISLIVLYPFFFMIMNSFKTGSEIINAPNA
FT                   LPKNFSFNGYIQAFYSLNLGRIFLNTLFISVTVTLVNTLLSAMVAYAIVKMNLPGREFW
FT                   IKLILTSMMVPAVLFTIPTYMMLYSWGWVNTFQALIVPGTISAYNIFLLVQFLKQVDNA
FT                   YLEAARIDGAGEFTIFFKVVLPMIRPALATVAILTFMGSWNDFMGPLLYVRDDSLMTLQ
FT                   LALFKFVNDIPTDNLEQLWAMTTMIAVPVVLVFFFLQRNFIKAFTGIGVK"
FT   sig_peptide     655048..655152
FT                   /locus_tag="YPK_0591"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.945) with cleavage site probability 0.673 at
FT                   residue 35"
FT   gene            655866..656378
FT                   /locus_tag="YPK_0592"
FT   CDS_pept        655866..656378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0592"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ypi:YpsIP31758_0531 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66895"
FT                   /db_xref="GOA:A0A0H3AZU7"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZU7"
FT                   /protein_id="ACA66895.1"
FT                   /translation="MSGKKGFFALVLIILLAYLSAWLMVYQQSKRYFDFAEQRYAAGDY
FT                   ILALKGMNKIELYRHDVYSGGYQQVIDDWRHGMLVYRPDFYYQALARSSDLLARASDQQ
FT                   LAEFIATYTEIDTRFVAEAATCLLARYRQRGESASQRTMEEYLAEAFPAHALRTSSQLD
FT                   AGCNTDS"
FT   sig_peptide     655866..655937
FT                   /locus_tag="YPK_0592"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.965) with cleavage site probability 0.474 at
FT                   residue 24"
FT   gene            656429..658612
FT                   /locus_tag="YPK_0593"
FT   CDS_pept        656429..658612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0593"
FT                   /product="glycoside hydrolase family 3 domain protein"
FT                   /note="PFAM: glycoside hydrolase family 3 domain protein;
FT                   KEGG: yps:YPTB3439 putative glycosyl hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66896"
FT                   /db_xref="GOA:A0A0H3AXP8"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AXP8"
FT                   /protein_id="ACA66896.1"
FT                   /translation="MSTVYRDATLPIEARIDDLLSQMTLAEKVGQLCQQPMLDYQQHRD
FT                   DYLAGVRAGRWGSRILADTAWAGNAPGENVDPCQLNEIQRAAVEHSRLGIPLLFARDVI
FT                   YGQATVLPIPLAQAASWNPELVQQAYRVIAREAASLGIHWTFAPMLDIARDPRWGRTIE
FT                   TSGEDPWLTAQFAAAVVKGFQGDDLSAADSLMACAKHFVGYAAVEGGRDYDTTELSDNT
FT                   LHNVHLPPFQAAIEAGVGSVMTGFCDLGGTPVTAHGELIRGWLKQQQNFDGLVISDWGS
FT                   IADLTHFGIAQDALRAAELALQAGVDMAMTHEAYEDKLDQLVLQGRIKEALLDDAVRRV
FT                   LRAKFRCGLFERPYVDEEWHKRELRRPEHLALAQRLAEQSIVLLKNRQALLPISRTSVP
FT                   LTLAVIGPHAHSQRQHLGSWCLDGDADQVMSIYQSLCAIAGEVKVITEQSCFSDEMIEC
FT                   AHRADIVILCTGESHRRTGEARNIAELQLPPGQEELIAAVGRTGKPLVVIQCTGRPLPS
FT                   PATEQYADALLYGWQCGSEAGKAIARIIFGEQVPCGKLPMTVPRSTGQIPIYYGRKPLG
FT                   KMRDYREYQPYKDLADTPLYPFGFGLSYTRFTYSDLQLSHESLELGASLRVTMTVTNDG
FT                   AVAGDEVVQCYIRQYVASTTRPQRELKGFQRISLQPGESGEVSFTLGVRELAFYGQHRR
FT                   YAQEPSRISVFVGGDSTTPHQADFTLFENLYTV"
FT   gene            complement(658676..660202)
FT                   /locus_tag="YPK_0594"
FT   CDS_pept        complement(658676..660202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0594"
FT                   /product="outer membrane efflux protein"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   yps:YPTB3438 possible outer membrane factor (OMF) family
FT                   efflux porin"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66897"
FT                   /db_xref="GOA:A0A0H3AZE7"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR028351"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZE7"
FT                   /protein_id="ACA66897.1"
FT                   /translation="MMTHAVLTARIAKISLTCSILSWSLLIVGCATDRLDLAPASYTEP
FT                   WTPDGNARASMGGGNFSVPPNPIVAELAQPPTIKSDHAYSLPELIDIAQRQNPDTRIAW
FT                   QQARQAALAVGMGEAIFLPIISASVIGGYQRTTTPLPYAIGNEKDLKTTGSAVIPALAL
FT                   QWLIFDFGQRSALLDAAKQTSYAANVTFNGMHQKLIYDVTRTYFQYGAAQAQSQIAKQT
FT                   LQNSLKIQDAAEERQKKGIATTVEVALARQQVAQSQLRRVVAKGTERDAYQALLGAMGV
FT                   SPSLDIKAAYTEDRALPDGISAPTEKMIQLALSQRPDVLASYAAVEAAKAGIKATEADF
FT                   LPKVYLAGAVAGGDGHFDIQGLPGISPQTSSSSILVGVSVPLYDGGIRAARVKEAESRA
FT                   AVAAEGFKKTQELAVREIVVAADTLRSALESNQAALNLVKTSFISYDAALESYRSGVGT
FT                   ITVANEAANGLLNAQQMSTDAHAASLVAAANLAFVMGKMTNTSPPLELLH"
FT   gene            complement(660207..662108)
FT                   /locus_tag="YPK_0595"
FT   CDS_pept        complement(660207..662108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0595"
FT                   /product="Fusaric acid resistance protein conserved region"
FT                   /note="PFAM: Fusaric acid resistance protein conserved
FT                   region; KEGG: ypi:YpsIP31758_0534 fusaric acid resistance
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66898"
FT                   /db_xref="GOA:A0A0H3B0E2"
FT                   /db_xref="InterPro:IPR006726"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B0E2"
FT                   /protein_id="ACA66898.1"
FT                   /translation="MTTVADGTLGGIIRQAKADLAFFPGRVAMAWRVAVLCALMAMIAM
FT                   IYGIPESAISCYLIIFVMKPDGVESMVMAVAITILVSLVVGLVFLLIHFTLEAAPLRMA
FT                   ALIVSSFLFLYLGSASKLGPVGSIIALVIAYVMTLLSNIPMGEVATRGLLYAWLMAVSP
FT                   MLLIIGFNLFFGRAPQTLLRASLAERLSTVAETLRHPNAANMARVGEQLQEGQHEHQQR
FT                   ALFVRIFHLRPSAEAAWLESAVKSSYRLLLVTSALPPTSPEAVRLELAAYCSDAAQAIA
FT                   SGDLAAPPHFAIEDTSDEINEIRNALIALANTDNGQDLDAPKSSFFAADALTNPVHQQF
FT                   ALKTTAAALICYLIYTALDWQDIHTAMITCYVAALGTTGETVHKLVLRIIGCLIGALMG
FT                   VLSIIFIIPHMSDIGQLMALVFGCILVAAWVSCGSERIAYAGVQVGLAFLLTVLQGFGP
FT                   STDMGVALDRVLGILLGNLVVYLIFSRLWPVAITDAVHVHISRALKGLTNLAALSPDAR
FT                   PAALREATTVEAEITKAQEELALIPFEPVQFRPSRKECARLQAILAEMGKLCPVLFLPT
FT                   EKSASDVEQLRQLSAGSDAMTLSDEQGQNSGSLRQELSPINLTIQQRIKRLEELLGI"
FT   gene            complement(662092..663141)
FT                   /locus_tag="YPK_0596"
FT   CDS_pept        complement(662092..663141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0596"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   ypi:YpsIP31758_0535 auxiliary transport protein, membrane
FT                   fusion protein family"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66899"
FT                   /db_xref="GOA:A0A0H3B180"
FT                   /db_xref="InterPro:IPR030196"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3B180"
FT                   /protein_id="ACA66899.1"
FT                   /translation="MNKQQGSGRKRQLALIVAGVIIIAAAISGWLSVRQTTLNPLSEDA
FT                   ELGASVVHIASSVPGRIISINVEENSKVRRGDLLFSIEPDLYRLQVEQAQAELKMAEAA
FT                   HDTQQRTVVAERSNAAITNEQIVRAQANLKLATQTLARLQPLRPKGYVTAQQVDDAATA
FT                   KHDAEVSLKQALKQSVAAEALVSSTASSEALVVARRAALAIAERELANTQIHAPNDGRV
FT                   VGLTVSAGEFVAPDQAIFTLINTEHWHASAFFRETELKHIKVGDCATVYVMADRQRAIQ
FT                   GRVEGIGWGVSSEDMLNIPRGLPYVPKSLNWVRVVQRFPVRISLEKPPEDLMRIGATAV
FT                   VIVRNDDGC"
FT   sig_peptide     complement(663055..663141)
FT                   /locus_tag="YPK_0596"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.850) with cleavage site probability 0.646 at
FT                   residue 29"
FT   gene            complement(663151..663486)
FT                   /locus_tag="YPK_0597"
FT   CDS_pept        complement(663151..663486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0597"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: yps:YPTB3435 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66900"
FT                   /db_xref="GOA:A0A0H3AZV0"
FT                   /db_xref="InterPro:IPR031381"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AZV0"
FT                   /protein_id="ACA66900.1"
FT                   /translation="MNNMTSLRKLRWFFCTCLTTAKQALWRGPLILLSAIALSGCSGAE
FT                   APSFSVVGSYFPYWMACAFIGIITAVIARVLFIRVGIDEVLPWRLLVYVCLALAVAFIC
FT                   SLLLFTR"
FT   sig_peptide     complement(663352..663486)
FT                   /locus_tag="YPK_0597"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.875 at
FT                   residue 45"
FT   gene            complement(663483..663683)
FT                   /locus_tag="YPK_0598"
FT   CDS_pept        complement(663483..663683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPK_0598"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ypi:YpsIP31758_0537 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPK_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACA66901"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AXQ4"
FT                   /protein_id="ACA66901.1"
FT                   /translation="MENNTLANLTLLEGHPLEDRQLVTQTEKAFRLIMNQKHSGKCSVA
FT                   VVYDDEPSFLVGFSALIEAVQ"
FT   gene            664449..665681
FT                   /locus_tag="YPK_0599"
FT   CDS_