(data stored in SCRATCH zone)

EMBL: CP000966

ID   CP000966; SV 1; circular; genomic DNA; STD; PRO; 91096 BP.
XX
AC   CP000966;
XX
PR   Project:PRJNA28471;
XX
DT   26-SEP-2008 (Rel. 97, Created)
DT   22-OCT-2018 (Rel. 138, Last updated, Version 3)
XX
DE   Klebsiella variicola strain 342 plasmid pKP91, complete sequence.
XX
KW   .
XX
OS   Klebsiella variicola
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Enterobacteriaceae; Klebsiella.
OG   Plasmid pKP91
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-91096
RX   DOI; 10.1371/journal.pgen.1000141.
RX   PUBMED; 18654632.
RA   Fouts D.E., Tyler H.L., DeBoy R.T., Daugherty S., Ren Q., Badger J.H.,
RA   Durkin A.S., Huot H., Shrivastava S., Kothari S., Dodson R.J., Mohamoud Y.,
RA   Khouri H., Roesch L.F., Krogfelt K.A., Struve C., Triplett E.W.,
RA   Methe B.A.;
RT   "Complete genome sequence of the N2-fixing broad host range endophyte
RT   Klebsiella pneumoniae 342 and virulence predictions verified in mice";
RL   PloS Genet. 4(7):E1000141-E1000141(2008).
XX
RN   [2]
RP   1-91096
RA   Fouts D.E., Tyler H.L., DeBoy R.T., Daugherty S.C., Ren Q., Badger J.H.,
RA   Harkins D.M., Durkin A.S., Huot H.L., Shrivastava S., Kothari S.P.,
RA   Dodson R.J., Mohamoud Y., Khouri H.M., Roesch L.F., Krogfelt K.A.,
RA   Struve C., Triplett E.W., Methe B.A.;
RT   ;
RL   Submitted (05-MAR-2008) to the INSDC.
RL   J. Craig Venter Institute, 9712 Medical Center Dr, Rockville, MD 20850, USA
XX
DR   MD5; 71c8f43a4b45b9b1ffaa0e20325c6b22.
DR   BioSample; SAMN02603449.
DR   EnsemblGenomes-Gn; EBG00001273694.
DR   EnsemblGenomes-Tr; EBT00001805779.
DR   EuropePMC; PMC6153814; 30012771.
DR   RFAM; RF00042; CopA.
DR   RFAM; RF00383; IS1222_FSE.
XX
CC   The source for the DNA and/or cells is:  Professor Eric W.
CC   Triplett, Chair, Department of Microbiology and Cell Science,
CC   Institute of Food and Agricultural Sciences, University of Florida,
CC   P.O. Box 110700, Gainesville, FL 32611-0700, ewt@ufl.edu.
CC   The organism was changed from 'Klebsiella pneumoniae 342' to
CC   'Klebsiella variicola' in October 2018.
CC   ##Taxonomic-Update-Statistics-START##
CC   This Genome (query) :: GCA_000019565.1
CC   Current Name        :: Klebsiella variicola
CC   Previous Name       :: Klebsiella pneumoniae 342
CC   Date Updated        :: 2018-10-11
CC   Analysis Type       :: Average Nucleotide Identity (ANI)
CC   Analysis 1 (A1)     :: Query vs. TYPE genome for current name
CC   A1 Genome (subject) :: GCA_000828055.2
CC   A1 Name             :: Klebsiella variicola
CC   A1 ANI              :: 99.09519%
CC   A1 Query Coverage   :: 87.28%
CC   A1 Subject Coverage :: 93.59%
CC   Analysis 2 (A2)     :: Query vs. TYPE genome for previous name
CC   A2 Genome (subject) :: GCA_000281755.1
CC   A2 Name             :: Klebsiella pneumoniae 342
CC   A2 ANI              :: 94.60205%
CC   A2 Query Coverage   :: 78.68%
CC   A2 Subject Coverage :: 84.5%
CC   ##Taxonomic-Update-Statistics-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..91096
FT                   /organism="Klebsiella variicola"
FT                   /plasmid="pKP91"
FT                   /strain="342"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:244366"
FT   gene            complement(121..255)
FT                   /locus_tag="KPK_B0001"
FT   CDS_pept        complement(121..255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0001"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12269"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKG2"
FT                   /protein_id="ACI12269.1"
FT                   /translation="MGALSDVAEPARPAGRCKGGHSPEPVHRAGDEQVMCLQDLLKDL"
FT   gene            complement(533..712)
FT                   /locus_tag="KPK_B0002"
FT   CDS_pept        complement(533..712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0002"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12298"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKG3"
FT                   /protein_id="ACI12298.1"
FT                   /translation="MEAPAEVEWSTAGKWRRYPAQPAAVLTGSANPFPRPDKPYPLKTS
FT                   QTSLYAVGVVPTRR"
FT   gene            complement(819..1739)
FT                   /locus_tag="KPK_B0003"
FT   CDS_pept        complement(819..1739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0003"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165;
FT                   match to protein family HMM PF06719"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12302"
FT                   /db_xref="GOA:B5RKG4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR009594"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKG4"
FT                   /protein_id="ACI12302.1"
FT                   /translation="MPGMITLVKALAVQEGYNLTALPDVRILRADRPLARTPVLYDPGI
FT                   VIVCQGSKRGYFGQQTYLYDEQHYLAVSVPVPFVMETDASAEHPLLAIYMHLDFHLAAE
FT                   LMLQIEQHDARYPLAAPQSMMSSPMDDAVKTAVRHLLEVLNNPLEAAILGPARVRELYF
FT                   RVLTGAQGNAMRAALTLQGQFGKIGKVLQRIHATYAEPLTLTQLAMEAGMSVPTFHSHF
FT                   KAITRMPPMQYVKSVRLHQARMLMVRQQITAAAASYAVGYESPSQFNREFKRLFGLPPA
FT                   EEIKRMQRYFAVPPVQQASIFVSSH"
FT   gene            1844..2677
FT                   /locus_tag="KPK_B0004"
FT   CDS_pept        1844..2677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0004"
FT                   /product="NAD dependent epimerase/dehydratase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF01370"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12210"
FT                   /db_xref="GOA:B5RKG5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKG5"
FT                   /protein_id="ACI12210.1"
FT                   /translation="MTSAKTILITGVSSGFGRALAQEALATGHRVIGTVRSREAQHDFE
FT                   ALHSQRAFGRLLDITDFEHIDEVVAEIESTVGPVDVLVNNAGYGHEGIMEESSLAEMRR
FT                   QFEVNVFGAVAMIKAMLPGMRQRRHGHIINITSMGSFITLPGISYYCGSKFALEGISET
FT                   LSKELAPFNIHVTAVAPGSFRTDWAGRSMVRSARSIPDYDALFDPIRQAREEKSGKQLG
FT                   DPVKAAHAMLAMIESQNPPTHLLLGSDALSLVRQKLEALGKEIEQWEEITRSTDG"
FT   gene            2670..2810
FT                   /locus_tag="KPK_B0005"
FT   CDS_pept        2670..2810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0005"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12205"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKG6"
FT                   /protein_id="ACI12205.1"
FT                   /translation="MADQLLRQRAYWIMDYGWSHKRSFRSGIMLMPLQFSLFTFRLPGL
FT                   R"
FT   gene            2955..3152
FT                   /locus_tag="KPK_B0006"
FT   CDS_pept        2955..3152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0006"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12294"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKG7"
FT                   /protein_id="ACI12294.1"
FT                   /translation="MTPSGSEHITSGSGEKQTHTAALRTSLQQEDRLLRAEEQGIIDQG
FT                   SRTAIHIREQEVQRDIRELR"
FT   gene            complement(3521..3646)
FT                   /locus_tag="KPK_B0007"
FT   CDS_pept        complement(3521..3646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0007"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12223"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKG8"
FT                   /protein_id="ACI12223.1"
FT                   /translation="MTIFGTKQTLKTTASDAALAAWRRQMKLHVSVESNGAESPA"
FT   gene            3869..5107
FT                   /locus_tag="KPK_B0008"
FT   CDS_pept        3869..5107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0008"
FT                   /product="transposase, IS110 family"
FT                   /note="identified by match to protein family HMM PF01548;
FT                   match to protein family HMM PF02371"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12307"
FT                   /db_xref="GOA:B5RKG9"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKG9"
FT                   /protein_id="ACI12307.1"
FT                   /translation="MTAKDQFAAYVGLDWADKKHDVCVQFKNGDRIFHVIEHTPEALDI
FT                   WLNELHQRAKGRIAIAVELKKGPVVYALQKYPFVTVFPVHALSLARYRQAFWPSGAKDD
FT                   PQDAELALDLMLRYPHKIKAIEADNPDIRLLQQLVEQRRLLVEDKRRFVNRLINTLKQY
FT                   YPQPLEWFSHRDSSLFCELIIRWPSLQQLKRARSDTVRHFMNAKGGPAVAYTEQRVASI
FT                   ASAIPLATDKTVIEANALMATALASQIKLTGDLVRTYDERIESLFDTLPDAELFKSLPG
FT                   MGPCMGPRMLAALGDNRNRFNSAEEIQNYAGIAPVTERSGQKSWVHWRWQCAKFVRQTF
FT                   VEWTAKTVNSSYWARLYYQGQREKGKSHQSAIRALAFKWIRIIYRCWKTRTRYDEAKYL
FT                   LALEARKSPLLKP"
FT   gene            5333..6148
FT                   /locus_tag="KPK_B0009"
FT   CDS_pept        5333..6148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0009"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF08659"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12263"
FT                   /db_xref="GOA:B5RKH0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKH0"
FT                   /protein_id="ACI12263.1"
FT                   /translation="MSLATQPGKGTAVITGASTGIGAVYASRLARMGYDLIIIARNHNL
FT                   LNQMASHITADTARNVEVVTTDLGDAQQLAALEKKLRADASITLLVNNAGVGTHTPLLS
FT                   SDVDQMQAMINLNVVALTRLTYSMVPGFVARGVGAIINISSIVSLAPELLNGVYGGTKA
FT                   FVLAFSQSLHHELSEKGIHIQAVLPGATATPFWDNGGLPLEQLDKSTVMSAYDLVDAAL
FT                   AGFLNGELVTIPSLHNDAYWQAMESSRQAMIPHLSSNVPAGRYRAGFTH"
FT   gene            6178..6939
FT                   /locus_tag="KPK_B0010"
FT   CDS_pept        6178..6939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0010"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF08659"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12282"
FT                   /db_xref="GOA:B5RKH1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKH1"
FT                   /protein_id="ACI12282.1"
FT                   /translation="MKLTGNTIFITGGTSGIGRAMAEKFHQLGNQVIISGRRKALLDTV
FT                   TSANPGMDSVALDVTNASSIKSAAKEVLSRYPALNVVINNAGIMPFDNAAAELDDDMAT
FT                   TLLNTNLLGTVRVSSAFVEHLKQQPDAVLINNSSILAFLPLVTNALYSATKAAIHSYTL
FT                   SQRFLLRDVGVKVIEISPPWVDTDLIYKSGDSRAMPLADFIQQTFDKLATDSIEAIVDS
FT                   VLPARANQGVNEHEMVNTFNQSMVDNPIPVA"
FT   gene            6983..8182
FT                   /locus_tag="KPK_B0011"
FT   CDS_pept        6983..8182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0011"
FT                   /product="transporter, major facilitator family"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12288"
FT                   /db_xref="GOA:B5RKH2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKH2"
FT                   /protein_id="ACI12288.1"
FT                   /translation="MQNHLSAFQKRALWALSLAYFIQATGSLSVAGSLVPISQEWGISD
FT                   AQSARLLSIFGLTFALGAPLAQVMFGKLMRRTQVLAGMLVFGLGALIFAIAPDYKVLVA
FT                   SRIVMGLGASLIGPVLIALGAELVAPEERGSAIAMILLGVSMASMVGIPLAAWLAMVLG
FT                   ARMLFTLIALVSILTAGAVFLLVPDVVKGVDIRLRQVGMVLREGKSLAAFLVVFFITSG
FT                   VYDMYAFISPMIRDHWQGDASAISIALAVIGAAGIVGNLFVARAARYFSAEHLLVTGLT
FT                   LLVTDMLLVMLLPAQLSLLYFLLVVWAFSTDLLWPTQQRRIVEISTAETRGISLALTSA
FT                   FMFCGIGFGSAVASWLYPLSGFYGVMISSVMFLLLALTSLWTSERLRARSAKYQAVRLS
FT                   "
FT   gene            8193..9128
FT                   /locus_tag="KPK_B0012"
FT   CDS_pept        8193..9128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0012"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165;
FT                   match to protein family HMM PF01965"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12231"
FT                   /db_xref="GOA:B5RKH3"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKH3"
FT                   /protein_id="ACI12231.1"
FT                   /translation="MHRIGLIIADHFQMLALSTLTVFEFANLVAEHPFYQPVVYSEHGG
FT                   TVRSSSGIGVDSTKLTEETLVDTWLVAGVLSPVEDPASPGVIHFLQTTARQARRIAGVC
FT                   TGAFVLAQAGLLEQKRATTHWAHSHSLASRHPTIQLEDDRIFIIDDTIWTSAGMTAGLD
FT                   MALGMVEKDLGADIARTVAHRLVMNQRRSGGQTQHSEMLALAPRSDRLQTALEYARHNL
FT                   HKTLTVEILADAVHVSARQLSRLFRQETGKSPAKAIEGLRLEAARLMIEQSRLSLDAIA
FT                   RESGFRDRRHMREVFIRGYGIPPQSLRAGR"
FT   gene            complement(9150..9539)
FT                   /locus_tag="KPK_B0013"
FT   CDS_pept        complement(9150..9539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0013"
FT                   /product="putative transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12279"
FT                   /db_xref="GOA:B5RKH4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKH4"
FT                   /protein_id="ACI12279.1"
FT                   /translation="MLALILRILLSLHEPPAGVLRLLSDKRLAPAVLAVIADPALPWTM
FT                   ESMAQRCFLSRATFARHFSHSYHQTPQVWLNQLRMVLAARLLSEEKNLTAERVAEQCGF
FT                   LSLSSFSKAFKKTYGITPALHRKRG"
FT   gene            complement(9556..10032)
FT                   /locus_tag="KPK_B0014"
FT   CDS_pept        complement(9556..10032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0014"
FT                   /product="putative membrane protein"
FT                   /note="identified by similarity to GB:AAS04364.1"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12309"
FT                   /db_xref="GOA:B5RKH5"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKH5"
FT                   /protein_id="ACI12309.1"
FT                   /translation="MIALLLLFFVALGAGVLSGVVGTGSSLIMLPVLVATYGPRIAVPV
FT                   MAIASLFGNIGRVIVWWHEIRWRPVFAYSLAGVPAAVLGAHTLLTISPGTVEVFLAAFF
FT                   LAMIPLRRLIRRSNLHLNLWHMSLAGAIVGFMTGFALSTGPLSVPVFTGQCEYR"
FT   gene            complement(10044..10940)
FT                   /locus_tag="KPK_B0015"
FT   CDS_pept        complement(10044..10940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0015"
FT                   /product="putative 2-dehydropantoate 2-reductase"
FT                   /note="identified by match to protein family HMM PF02558;
FT                   match to protein family HMM PF08546; match to protein
FT                   family HMM TIGR00745"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12222"
FT                   /db_xref="GOA:B5RKH6"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKH6"
FT                   /protein_id="ACI12222.1"
FT                   /translation="MNTEINTVVAVVGPGAIGTTVAAALHEVSRTPLLCGRTPRDRLTL
FT                   QDGNRFITVPGPVQTNPAQITRTVDLIFLAVKSTQIDAAAEWLRALTGPETVICVLQNG
FT                   VEQLDRLATYSLPGQIVPAVVWFPAQAQSDGSVRLRGEARLSVPDAPASRVVAAALQGT
FT                   WCSVDLAANFSSLAWRKLMQNAVAGLMALTHRRSGMFGRADIARLTLAYLQECLAVARA
FT                   EGAELGDEVPQEILDKFRAAPADMSTSILTDREAGRPLEWDIRNGVIARRGRVHSIPTP
FT                   ISDILVPLLAAASDGPG"
FT   gene            11017..11901
FT                   /locus_tag="KPK_B0016"
FT   CDS_pept        11017..11901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0016"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="identified by match to protein family HMM PF01380;
FT                   match to protein family HMM PF01418"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12244"
FT                   /db_xref="GOA:B5RKH7"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKH7"
FT                   /protein_id="ACI12244.1"
FT                   /translation="MNKENGNIISEGEQRLQQWLGSIHARSGDLAASEAKVVDLLLVDP
FT                   LFVGTSTAAQVATRAGVSPPTVIRAARAIGFTGFTELKIEIARARGTAQFFAPPEVLTA
FT                   DATLASVLETSIRAGVDALTALSGAIEISALDEAVDLIRSARQVFAFGAGPSATVAADA
FT                   VFRLRTAGVITVSIQDYLSAMIAARLLGPGDVIIVVSSTGRTSSTLSIADAASSAGASL
FT                   IAITNQYDTPLATLANVSLVVGGMPLPAQMAAAGSRLAQLVVIDTLVAALTLRDKEQSR
FT                   RAERAGIDLPDMS"
FT   gene            11901..12758
FT                   /locus_tag="KPK_B0017"
FT   CDS_pept        11901..12758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0017"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12207"
FT                   /db_xref="GOA:B5RKH8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKH8"
FT                   /protein_id="ACI12207.1"
FT                   /translation="MQFSTVAMILTAAVAHAVWNIASKYKREDTLVFVWAYSCASALLW
FT                   VPFSLILIVEGKQELDWRLAVGAVISSALHIAYSLILQAGYERAELGVVYPIARGSGPV
FT                   LTILFATLLMGERISPGALLGAFMVIAGIFVVTGNPFRSGSRPLQGMLWGAATGTAIAG
FT                   YTLWDGYSVISMHLDPVRYYASTLLLQSLILTPGAMRRRNRIPTAVRVDLIPILIIAVC
FT                   SPLAYILVLTAMQSMPLALVAPLRETSIIVGSLLSYWLFRENHLARRIAGAVVVLAGIA
FT                   VISL"
FT   gene            complement(13199..14089)
FT                   /pseudo
FT                   /locus_tag="KPK_B0018"
FT                   /note="transposase, IS630 family, fragment; identified by
FT                   similarity to SP:P16943"
FT   gene            14114..15037
FT                   /locus_tag="KPK_B0019"
FT   CDS_pept        14114..15037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0019"
FT                   /product="IS903, transposase"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12290"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B5RK99"
FT                   /protein_id="ACI12290.1"
FT                   /translation="MAKQKFKITNWPTYNKALINRGSITFWLDDEAIQAWYESATPSSR
FT                   GRPQRYSDLAITTVLVIKRVFRLTLRAAQGFIDSIFSLMNVPLRCPDYSCVSRRAKSVN
FT                   VSFKTPTRGEIAHLVIDSTGLKVFGEGEWKVKKHGQERRRIWRKLHLAVDSKTHEIICA
FT                   DLSLNNVTDSEAFPGLIRQTHRKIRSAAADGAYDTRLCHDELRRKKISALIPPRKGAGY
FT                   WPGEYADRNRAVANQRMTGSNARWKWTTDYNRRSIAETAMYRVKQLFGGSLTLRDYDGQ
FT                   VAEAMALVRALNKMTKAGMPESVRIA"
FT   gene            complement(15161..16024)
FT                   /locus_tag="KPK_B0020"
FT   CDS_pept        complement(15161..16024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0020"
FT                   /product="auxiliary transport protein, membrane fusion
FT                   protein (MFP) family"
FT                   /note="identified by match to protein family HMM PF00529"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12208"
FT                   /db_xref="GOA:B5RKI0"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKI0"
FT                   /protein_id="ACI12208.1"
FT                   /translation="MKSLLSLLGRYLLTLSAVAVATLLAFILWKHYVQTPWTRDGRVRA
FT                   DVVQIAPDVSGPVLNVAVRDNQWVNRGDVLYSIDPHWLRLAVVSAQADVEAKRHEMLMR
FT                   QDAARRRSQIKGVISSEDLQQTASAASVAAANYHGALAALDLAELNLSHAIVRSPVTGY
FT                   VTHLRLRPGDYATAGETKLSIIDANSFWVVGYFEETKLQHIRTGNTAHITLMGFKPVIT
FT                   GHVESIGRGIDDNNDETGGLGLPNVEPTFSWVRLAQRIPVRIHIDRLPEGVELVAGLSA
FT                   SISITP"
FT   gene            complement(16021..16236)
FT                   /locus_tag="KPK_B0021"
FT   CDS_pept        complement(16021..16236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0021"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07869"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12291"
FT                   /db_xref="GOA:B5RKI1"
FT                   /db_xref="InterPro:IPR012451"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKI1"
FT                   /protein_id="ACI12291.1"
FT                   /translation="MINDFNIEGVFVPGLLLISLVALTCTLLLVQLFSLSKGYRRLPFR
FT                   PMIDFSIFIITFYLLLQGLTELGFLK"
FT   gene            complement(16226..18265)
FT                   /locus_tag="KPK_B0022"
FT   CDS_pept        complement(16226..18265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0022"
FT                   /product="fusaric acid resistance domain protein"
FT                   /note="identified by match to protein family HMM PF04632"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12211"
FT                   /db_xref="GOA:B5RKI2"
FT                   /db_xref="InterPro:IPR006726"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKI2"
FT                   /protein_id="ACI12211.1"
FT                   /translation="MKKLTRVTFIFLHTICHRLRGMASPSLLNDANALLYSAKSFTAAM
FT                   LAYYIALSIGLERPSWAIITVYIVSQTSVGASLSRSLYRLVGTVIGAGMTVLIVPTFVN
FT                   SPVFCSVILAGWITFCLYLSLLERTPRAYGFVLAGYTASLIGFPAVSDPGAIFDIAITR
FT                   VQEIMTGIFCAALIHRYVLPARISGQFNSKLSQTLLAARQRIAETLTGKPDPVSSPLHM
FT                   ALALQFLQGISHHIPYDFAFSVPVRQARKRLHDRLARLVIVNCELRDRLALIAKIPFDV
FT                   QILMDDVEVWLACKDEGKFKSEGEALKKRSEKLLQRYVVHELTFVEALHVSFMRYLTEA
FT                   IVLVQQCYRLSDAIHHANQMPAHSEMNNVKGYVFHRDPLTAARTALGAFTIILSGCMVW
FT                   IFSAWPDGGTAVSILGVCCTLFGSFDTPAPHIVKYIIGSLWGVVISLIYSFVLLPQVSD
FT                   FIVLVVVLAPVYLLAGSLQARPPTTFMAMGITLTLPILCELGAHYSGDFAVAVNTSIAL
FT                   FSATGFAVFSMGFLQTVQADAAIKRLLKLCQRDINRSVKGVLNTDETLWINLMIDRAAL
FT                   ILPRLPRSGQSSEQALNHLLHTLRIGLCVMRLRRWDAHADKEIKEVLTCLTHSTDINTL
FT                   LERIVSLTERSLSVADELSRHHVNQLVDLYCALSTQEMEHADDQ"
FT   gene            18342..19148
FT                   /locus_tag="KPK_B0023"
FT   CDS_pept        18342..19148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0023"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12270"
FT                   /db_xref="GOA:B5RKI3"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKI3"
FT                   /protein_id="ACI12270.1"
FT                   /translation="MLPPLANTLFDPDAIPCPAVARHLDFVDYAAEVPVHTHRKGQLII
FT                   ALYGAVICRAENDIWIVPPDCAVWIPGGVPHSAKATWNAHLNYLFIEPGAAALPERCCT
FT                   LAISGLIKELVARLTREGVGYPPESHLARLTRVTLDELATMPQQKLSLPVSSHPKIRAM
FT                   ADALVSQPDDRSTFKTWAKRLALSERSLARLMLRETGLTFGRWRQQLQLIIALRELASG
FT                   VSVQNVAANLGYESVNAFITMFKKAMGSTPAHYFSERKISTHLSDS"
FT   gene            complement(19314..20258)
FT                   /locus_tag="KPK_B0024"
FT   CDS_pept        complement(19314..20258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0024"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165;
FT                   match to protein family HMM PF01965"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12275"
FT                   /db_xref="GOA:B5RKI4"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKI4"
FT                   /protein_id="ACI12275.1"
FT                   /translation="MHTVGFYIYPGHQILDLAGPFGAFESVTRILGHSFYELSTVSRAG
FT                   GRVCGSGGLPVESSLATSAETDTLIVVGGDTVTMLDSGEAEVVAALAGRTARVASVCTG
FT                   AFLLAKAGLLDGRRATTHWRMAHRLQQEYPAVKVESDRIFTEDSGIWTSAGVTAGIDLA
FT                   LALIETDLGVDVARRVASELVVYHRRSGGQSQFSPMSLMDPETDRMRMALSFMRDHLHE
FT                   PLSIERIAEAVNLSPRQFGRNFRRETGETPARAVERLRSEAAMVRLQAGSEPIERIAGA
FT                   VGFGDPERMRRAFIKIYGKPPQAVRRADKSGSN"
FT   gene            20360..21049
FT                   /gene="inhA"
FT                   /locus_tag="KPK_B0025"
FT   CDS_pept        20360..21049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="inhA"
FT                   /locus_tag="KPK_B0025"
FT                   /product="cyclohexyl-isocyanide hydratase"
FT                   /EC_number="4.2.1.103"
FT                   /note="identified by similarity to GB:BAC41251.1; match to
FT                   protein family HMM PF01965"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12301"
FT                   /db_xref="GOA:B5RKI5"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKI5"
FT                   /protein_id="ACI12301.1"
FT                   /translation="MTTVVIPLYEGITHLDFTGPHQMLSLVPDVQIIVASLDGLPVKSH
FT                   GLTFGELACLEAIEHCDILCVPGGAGCVSAIEDPRFVTVIQRLGSHAEYLTSVCTGSLI
FT                   LAAAGLLEGRRAACHWAWRDMLTLFGAIADDRRVVRDGHVITGGGVTAGIDFALTLISE
FT                   LRGTDIAQSIQLILEYAPEPPFNAGLPDTAPSSVRHLVLNKMANTLTEAKQRIGQVAQQ
FT                   HPDSLTI"
FT   gene            21101..21844
FT                   /locus_tag="KPK_B0026"
FT   CDS_pept        21101..21844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0026"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF08659"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12250"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKI6"
FT                   /protein_id="ACI12250.1"
FT                   /translation="MRLKGKTALITGGTSGIGLATAQLFVREGARVIVTGRDTSKFDEV
FT                   QTILGKNAVVLSADVGSVEDMRLISHRTRETLGGLDIFFANAGIAYATPLATTDENHYD
FT                   EIMDINVKGVFFSMQAMAPILNKGASVILTTSFIIHVGRPGISLLAASKAALRSLARSW
FT                   SRELLDRQIRVNAISPGSIDTPLISRHRTPEQLADFKDQMADQIPVGRMGEAADIAAAA
FT                   LYLASDDSAYVLGAEIVVDGGISQI"
FT   gene            21951..22076
FT                   /locus_tag="KPK_B0027"
FT   CDS_pept        21951..22076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0027"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12251"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKI7"
FT                   /protein_id="ACI12251.1"
FT                   /translation="MTAPGSRIKLIYMMLWHHNVDSFRWYPLHSMQQCWADQATR"
FT   gene            complement(22101..22358)
FT                   /locus_tag="KPK_B0028"
FT   CDS_pept        complement(22101..22358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0028"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12202"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKI8"
FT                   /protein_id="ACI12202.1"
FT                   /translation="MQDEGIPFRDIAKAIGQGLGIPVKSIPKEEAAAQFGWLAMFAMAD
FT                   VPASSKLTRERLGWVPLEASLLSDLTLPSYFNPAARALGT"
FT   gene            complement(22490..22865)
FT                   /pseudo
FT                   /locus_tag="KPK_B0029"
FT                   /note="Tn3 family transposase, internal deletion; this gene
FT                   contains a frame shift which is not the result of
FT                   sequencing error; identified by similarity to SP:P08504"
FT   gene            23033..23671
FT                   /locus_tag="KPK_B0030"
FT   CDS_pept        23033..23671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0030"
FT                   /product="resolvase domain protein"
FT                   /note="identified by match to protein family HMM PF00239"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12215"
FT                   /db_xref="GOA:B5RKI9"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKI9"
FT                   /protein_id="ACI12215.1"
FT                   /translation="MFIRAYLRASTEDQFADRAKEMLEQFVQERGHKIASYYRENISGT
FT                   KLDRPELGRLLTDSHRNDILLVEQIDRLTRLSNSDWMTLKKQIEQHELRIVSLDVPTSW
FT                   QALSDKDPSQADPITRAVISAINNMLIDLMAAMSHKDWLSRRQRQKQGIERAHTLGKYR
FT                   GKQADQERHQKVLYYRQVKKLSIRETADATGYSPSQICRIQALYRQRAL"
FT   gene            23686..23823
FT                   /locus_tag="KPK_B0031"
FT   CDS_pept        23686..23823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0031"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12259"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKJ0"
FT                   /protein_id="ACI12259.1"
FT                   /translation="MPVTTMAWLNGSVEAWRVFEKFLDQSRVICPPKFLFMRERDMRGI
FT                   "
FT   gene            23855..24325
FT                   /locus_tag="KPK_B0032"
FT   CDS_pept        23855..24325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0032"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12265"
FT                   /db_xref="GOA:B5RKJ1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKJ1"
FT                   /protein_id="ACI12265.1"
FT                   /translation="MKKNQFVIRACSPSDAEQLTKLAFLSKAHWGYPKEWLDFWQDDLT
FT                   ITPELIEDSIAYIAEAEQQIIGFWVRAAIDSGEPTCGWLFVHPDHMGKGVARALWSEVK
FT                   KEAEARGIKRFVIEADPNAVPFYLSLGAEKIGEKESTLIAGRFFPIILLPVA"
FT   gene            24665..25369
FT                   /locus_tag="KPK_B0033"
FT   CDS_pept        24665..25369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0033"
FT                   /product="transposase, IS6 family"
FT                   /note="identified by similarity to GB:AAM08030.1; match to
FT                   protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12295"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKJ2"
FT                   /protein_id="ACI12295.1"
FT                   /translation="MNVFKGRHFQQDIILWAVRWYCKYGISYRELQEMLAERSVNVDHT
FT                   TIYRWVQRYAPEMEKRLRWYWRQASGFSSWHLDETYVKVNGRWAYLYRAVDSRGCTIDF
FT                   YLSSRRNTKAAYRFMGKLLNNTKRWQIPRLINTDKAPTYGRALALLKREGKCPQDVEHR
FT                   QIKYRNNVIECDHGKLKRIINATLGFKSMKTAYATIKGIEVMRALRKGQAESFYFGHPL
FT                   GEMRLVSRVFEI"
FT   gene            25369..25497
FT                   /locus_tag="KPK_B0034"
FT   CDS_pept        25369..25497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0034"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12293"
FT                   /db_xref="GOA:B5RKJ3"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKJ3"
FT                   /protein_id="ACI12293.1"
FT                   /translation="MSFSNARGFTITIFATVPFIVPLSLPFIIIEERSENRKCRIQ"
FT   gene            complement(25688..27685)
FT                   /locus_tag="KPK_B0035"
FT   CDS_pept        complement(25688..27685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0035"
FT                   /product="putative transketolase"
FT                   /note="identified by match to protein family HMM PF00456;
FT                   match to protein family HMM PF02779; match to protein
FT                   family HMM PF02780; match to protein family HMM TIGR00232"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12220"
FT                   /db_xref="GOA:B5RKJ4"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKJ4"
FT                   /protein_id="ACI12220.1"
FT                   /translation="MDHKQLANAIRILSIDAIQKANSGHPGAPMGMADVAEVVWRGHLR
FT                   HNPANPGWFNRDRYVQSNGHGSMLQYSLLHLTGYDLTINDLKNFRQLHSRTPGHPEYGY
FT                   TPGVETTTGPLGQGVANAVGMAIAEKTLAAQFNKPGREIVDHHTWLFLGDGCLMEGISH
FT                   EACSLAGTLKLGKLIAVWDDNGISIDGHVDAWFSDDTPARFRAYGWHVIEGIDGHNAEA
FT                   VNKAVTEARAVTDKPSLLCCKTIIGFGSPNKANSHDCHGSALGADEVALVRKELHWPYE
FT                   PFVIPDEIYRAWDAKQTGAKVEAEWNEKFAAYARDYPELAKEFTRRMEGKLPQGWHEEV
FT                   NAWIRDLQAHPASLATRQVSQKCLSYFARSLPELFGGSADLSPSNLTRHQLSVDFSDQN
FT                   PSGNYLSYGVREFGMSAIMNGMALHGGLLPYGGTFLMFMEYARNAVRMAALMKAHSIFV
FT                   YTHDSVGLGEDGPTHQPVEQLASLRLTPNMETWRGCDQVEAAIGWQQAIERSDGPSALI
FT                   MTRQPLAQQPRSEQQLKDVRRGGYILLEPEGEPELIILSAGSEIELAVYAAGELNREGR
FT                   RVRVVSMPCTERFDRQEQAYKDAVLPQHIRKRLAVEASTEGFWQRYTGLDGEVIGMQTF
FT                   GESAPAAVLFEHFGFSKENVLERAKALLTS"
FT   gene            complement(27712..28152)
FT                   /gene="cmtB"
FT                   /locus_tag="KPK_B0036"
FT   CDS_pept        complement(27712..28152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cmtB"
FT                   /locus_tag="KPK_B0036"
FT                   /product="PTS system, mannitol-specific EIIA component"
FT                   /EC_number="2.7.1.-"
FT                   /note="identified by similarity to SP:P69824; match to
FT                   protein family HMM PF00359"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12229"
FT                   /db_xref="GOA:B5RKJ5"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKJ5"
FT                   /protein_id="ACI12229.1"
FT                   /translation="MITELLTEERIAVVDDVSDWQSAIALAVAPLIADGTVRESYLQAI
FT                   IESTFSNGPYYVLAPGIAMPHARPETGVNQNGLAFLLVKNGVNFPDQADPVKLHFLLAA
FT                   RDPHQHIALITQLSELFCSETDLDALFNANDVAEVLKVISRY"
FT   gene            28375..29112
FT                   /locus_tag="KPK_B0037"
FT   CDS_pept        28375..29112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0037"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07702"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12273"
FT                   /db_xref="GOA:B5RKJ6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKJ6"
FT                   /protein_id="ACI12273.1"
FT                   /translation="MADNITEKQQEVIDYIFKKIKDDELLPGDKLDTEIAIAKALKLTR
FT                   ATVREATRILIEQERIYRIKGSGLYIGSIGKSNHSGKFHALSPFDYQAQKSGHKGVRKV
FT                   ISASIIKVPDAAMAQALRIKNSDSVYKILRLMCFDDIPVSLEYIHFPATLFSSMEFKEL
FT                   EISKYSYIERITGKGVQRRAQNVRAFNATDEEMIRLLNIQPHDAMMELYEVVYLDDGTP
FT                   FEVNISIVNTNILHLKQISERSE"
FT   gene            complement(29173..30204)
FT                   /locus_tag="KPK_B0038"
FT   CDS_pept        complement(29173..30204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0038"
FT                   /product="oxidoreductase, zinc-binding dehydrogenase
FT                   family"
FT                   /note="identified by match to protein family HMM PF00107;
FT                   match to protein family HMM PF08240"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12278"
FT                   /db_xref="GOA:B5RKJ7"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKJ7"
FT                   /protein_id="ACI12278.1"
FT                   /translation="MKSVKITAIKEIEIFDLPAPVAAPGQALVDIAYSGICGSDMHFYL
FT                   GHHPSLKPPTNFIQGHESVGIIREINGSSPKFKVGDKVAINPLVGCGECFNCLDNQPNI
FT                   CRVSRKVMGFRLDGTMCESLAVGTEQLIKLDARIDMKLAAMIEPFAVGYHAVSLVHYRD
FT                   LVNTPVIVTGGGTIGVMTALVLKHIHHANPLVVEKDAKRIELLQRLGFTVYASIEEVDA
FT                   VNLRKRPVAFECTGYYPVLQALVAANRKPEHIVIIGQYTSGSTIGLHEIMSSEITITSS
FT                   HMYNSDDLEKSATAIRQKEIADALQQIVYPKVYDLAEAADAFQKATSGSLDGKLKVLLG
FT                   SHA"
FT   gene            complement(30248..31729)
FT                   /gene="cmtA"
FT                   /locus_tag="KPK_B0039"
FT   CDS_pept        complement(30248..31729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cmtA"
FT                   /locus_tag="KPK_B0039"
FT                   /product="PTS system, mannitol-specific EIICB component"
FT                   /EC_number="2.7.1.191"
FT                   /note="identified by similarity to SP:P50852; match to
FT                   protein family HMM PF02302; match to protein family HMM
FT                   PF02378"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12240"
FT                   /db_xref="GOA:B5RKJ8"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR029503"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKJ8"
FT                   /protein_id="ACI12240.1"
FT                   /translation="MNKTSLRARMQSFGGFLTAMVIPNIGAFMAWGFITALFIPAGWLP
FT                   NKEFGSLVEPMIRYMLPMLVGYTGGNMVGGKRGAVIGTVGTMGVIVGTNVPMLLGAMAM
FT                   GPLGGLVSKYIDRLLENRIPAGLENVVQNFAMGLAGMVLALLGYEFIGPFMLAITNVIA
FT                   YAIDSLLKTGYLPTLALLIEPTRVLFLNNAIDQAIFYQLGMKDAAVNGSSIFFMVFASP
FT                   GPGLGLLLAFCLFGKGMAKKSAPAATIIHIFGGIHEMYFPYVYMKPLMIIPLMIGSAAG
FT                   IEVFSLMHAGLVAGATPGSIFAFMALTPPGKFLATLSGIGSAAIVTFIGASIVLKFDRS
FT                   AEENDSFSSSQEIMQTTKAAGMSEAYANAKQEIQATSSRDKERAVPVSSLRFIAFACDA
FT                   GAGSSAMGATTFRKKLQKLGLPYEITVKHFAIESIPDEADLVVVHQNLAERVRMSKDVP
FT                   IIEIKNYLGDPRLEELLQEMKKLALDTSENTLSNA"
FT   gene            32016..32303
FT                   /locus_tag="KPK_B0040"
FT   CDS_pept        32016..32303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0040"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12234"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKJ9"
FT                   /protein_id="ACI12234.1"
FT                   /translation="MSSVAAAETGADYAGSPRYEMPGPVATRDIERWLLEQCGDTSVYV
FT                   TKLRASCRRIGSPLSAPNLQLVVELTDTDRNHKCVHRIYCLLKLNFRLEG"
FT   gene            complement(32446..32877)
FT                   /locus_tag="KPK_B0041"
FT   CDS_pept        complement(32446..32877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0041"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12267"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKK0"
FT                   /protein_id="ACI12267.1"
FT                   /translation="MTKKGLLVRKKMKSINQFEYTLTNQFLEIASEMWGSASFLKSQTE
FT                   SLNNELKASNTDEVLKNSYAMKLNRHRIRYETELAQVIGEKEVFDEIIIDFPEHELEFM
FT                   TISDELNKQAFRLMGKISAIGRIKNQISEEVFKENISIS"
FT   gene            complement(33065..33898)
FT                   /locus_tag="KPK_B0042"
FT   CDS_pept        complement(33065..33898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0042"
FT                   /product="IS3 family element, transposase OrfB"
FT                   /note="identified by similarity to GB:ABG56821.1; match to
FT                   protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12274"
FT                   /db_xref="GOA:B5RKK1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKK1"
FT                   /protein_id="ACI12274.1"
FT                   /translation="MEVMCETTGLSQRRACRLAGLSLSTCRYSAQRPAADAQLSLRITE
FT                   LALERRRFGYRRIWQLLRREGLHVNHKRVYRIYHLNGLGVKRRRRRKGLATERLPLLRP
FT                   DAPNLTWSMDFVMDALASGRRIKCLTCVDDFTKECLTITAAFGISGIQVARILDSIALF
FT                   RGYPETIRTDQGPEFTCRALDQWAFEHSVELRLIQPGKPTQNGFIESFNGRFRDECLNE
FT                   HWFSDVLHARKIINDWRQDYNECRPHSSLNYQTPSEFAAGWRNGKHEEKSTDITN"
FT   gene            complement(33922..34185)
FT                   /locus_tag="KPK_B0043"
FT   CDS_pept        complement(33922..34185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0043"
FT                   /product="IS3 family element, transposase OrfA"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12243"
FT                   /db_xref="GOA:B5RKK2"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKK2"
FT                   /protein_id="ACI12243.1"
FT                   /translation="MKKRFSDEQIISILREAEAGVSARELCRKHAISDATFYTWRKKFG
FT                   GMEVPEVKRLKSLEEENARLKKLLAEAMLDKEALQVALGRKF"
FT   gene            complement(34267..34584)
FT                   /locus_tag="KPK_B0044"
FT   CDS_pept        complement(34267..34584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0044"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAG20213.1"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12249"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKK3"
FT                   /protein_id="ACI12249.1"
FT                   /translation="MFVLAQFNVNQRQRLWVLMDTHTCLPLLYPLQYLVDHLALRTAAT
FT                   QSASLQAIKFFYEFWYQKHGVTFCFSFYSSNHNPLIAIDELTAYFIIWKMGIHVYRTIS
FT                   L"
FT   gene            34839..36248
FT                   /locus_tag="KPK_B0045"
FT   CDS_pept        34839..36248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0045"
FT                   /product="transposase"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12262"
FT                   /db_xref="GOA:B5RKK4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKK4"
FT                   /protein_id="ACI12262.1"
FT                   /translation="MTAHAAEFFTLDEVNRLKIIQDVVDRRLTTQMAAQRLGISDRQCR
FT                   RLLSRYRESGPLGMANRRRGKPSNNHLPDGLARYALSIIHERYTDFGPTLACEKLAELH
FT                   DVYLSKETVRSLMVKAGLWVPRKQRAPKIQQPRYRRACCGELIQIDGCDHHWFENRAPA
FT                   CTVLVYVDDATSRLMQLRFVKSESTFTYFEATRGYLEKHGKPLALYSDKASVFRINNKN
FT                   ATGGDGFTQFGRAMHELNIQTICTNTSSAKGRVERAHLTLQDRLVKELRLRGISSVDAA
FT                   NEYADEFMDDYNRRFAKAPLHDFDVHRPLEHNDDLAAFFTWREPRRVSKSLTVQYDKVL
FT                   YLIEDSEISRKAIGKYIEVWHYPDGLKELRLNGVALPYSTYDRLSEIDQGAIVDNKRLG
FT                   RTLEYIKLVQDKRDNNRSQAIPAGDGPSRRRRKPTDKKSQRSLNGDDMLEALKVLQSRS
FT                   DEIFGSNTQKT"
FT   gene            complement(36292..36810)
FT                   /locus_tag="KPK_B0046"
FT   CDS_pept        complement(36292..36810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0046"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAZ28416.1; match to
FT                   protein family HMM PF04229"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12246"
FT                   /db_xref="InterPro:IPR007344"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKK5"
FT                   /protein_id="ACI12246.1"
FT                   /translation="MRMLTVVDYDEMWPTLFENERYLLQMALGKVISQIHHIGSTSVPG
FT                   LSAKPVIDILIEVTNLEELDRLNQAMERAGYTVRGENGISNRRYFTKGGDQRSHHIHAF
FT                   TTGDAQIIKHLAFRDYLIKNNDIANQYALMKKKAVLLCENDTHRYSIYKADFIRKHLRM
FT                   ALIDAGHLS"
FT   gene            37145..37606
FT                   /locus_tag="KPK_B0047"
FT   CDS_pept        37145..37606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0047"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12260"
FT                   /db_xref="GOA:B5RKK6"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKK6"
FT                   /protein_id="ACI12260.1"
FT                   /translation="MILIFFIYFRNEDSYIISYLFDIANGYQRDFSEQYLTVSTIASAY
FT                   TKTAPLFVMLMYMICWNKFDIKTIKLDLKQWFKLLPGLLLLTTGAYYLTYVGVENMSDS
FT                   IYRTKRVIAGNEYFLFIYYILLFLTNYFFIWLFFIYLYMLKGLPYFQKR"
FT   gene            complement(37666..38130)
FT                   /locus_tag="KPK_B0048"
FT   CDS_pept        complement(37666..38130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0048"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli yedK; identified by
FT                   similarity to SP:P76318; match to protein family HMM
FT                   PF02586"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12219"
FT                   /db_xref="GOA:B5RKK7"
FT                   /db_xref="InterPro:IPR003738"
FT                   /db_xref="InterPro:IPR036590"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKK7"
FT                   /protein_id="ACI12219.1"
FT                   /translation="MCGRFSQAMTREDYLSLIANEADRNIAYDPAPIGRYNVAPGTKVL
FT                   LLSERDEQLHLDPVHWGYAPGWWDKAPLINARVETAASSRMFKPLWQHGRALCFADGWF
FT                   EWKKEGDKKQPYFLHCKDGQPIFMTAIGSIPFERGDEDLHLISMLIKPKH"
FT   gene            38205..38345
FT                   /locus_tag="KPK_B0049"
FT   CDS_pept        38205..38345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0049"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12226"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKK8"
FT                   /protein_id="ACI12226.1"
FT                   /translation="MEYCVQMAPSPGAAGCCFDRFCLTASPSLKAGIVFNDEGLKQVLS
FT                   T"
FT   gene            38527..38946
FT                   /locus_tag="KPK_B0050"
FT   CDS_pept        38527..38946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0050"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06171"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12296"
FT                   /db_xref="InterPro:IPR007374"
FT                   /db_xref="InterPro:IPR009326"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKK9"
FT                   /protein_id="ACI12296.1"
FT                   /translation="MAKLEELKNIYPGALAWKFGDSPELADELVQLVLSGSKTATCSSI
FT                   ASFHHEHERGEAPCVGSYNIILNGAGQPMCVIRTLRMQVIRFNEMTSELASKEGEGDLS
FT                   LEYWNEGHKRYFEREGTYSEEMELIFEEFELTEIL"
FT   gene            39009..39158
FT                   /locus_tag="KPK_B0051"
FT   CDS_pept        39009..39158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0051"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12233"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKL0"
FT                   /protein_id="ACI12233.1"
FT                   /translation="MEAPDEAACICGVKWRRKPGVAGYLAINSATLPPALISLNPLTAM
FT                   KKLK"
FT   gene            complement(39194..39340)
FT                   /locus_tag="KPK_B0052"
FT   CDS_pept        complement(39194..39340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0052"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12216"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKL1"
FT                   /protein_id="ACI12216.1"
FT                   /translation="MVANHHKLLDTSYRVKFPGVAEITEEHPPKRQQQAAAAKAPEITP
FT                   FTS"
FT   gene            39475..39648
FT                   /pseudo
FT                   /locus_tag="KPK_B0053"
FT                   /note="IS3 family element, transposase orfA, fragment;
FT                   identified by similarity to SP:P62552; match to protein
FT                   family HMM PF01527"
FT   gene            40222..40764
FT                   /locus_tag="KPK_B0054"
FT   CDS_pept        40222..40764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0054"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12239"
FT                   /db_xref="GOA:B5RKL2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKL2"
FT                   /protein_id="ACI12239.1"
FT                   /translation="MYWESERLLYRPVIMSDVEALFRIYGDERTHAFNPRGPHRDIEQS
FT                   RSVILQRTADRELYGFDDWAVSEKTAPERIIGFGGVFVSHFNGRQTNNLGYRFEPESWG
FT                   KGYATELSCRALIYGFDELKLPEIVGVTRENHIASRRVLEKAGLLFTQRVDNPEDPPAN
FT                   LMFTLTIEQWKRLKRQA"
FT   gene            41053..41343
FT                   /locus_tag="KPK_B0055"
FT   CDS_pept        41053..41343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0055"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12311"
FT                   /db_xref="GOA:B5RKL3"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKL3"
FT                   /protein_id="ACI12311.1"
FT                   /translation="MMQVADIFDLFIKLTPSGLALLVWAYGVYNQFSLKKLEAMQLQKR
FT                   WPELPDGLTIQDKKEALHAMISAEERKTRASLKWRFSLLPSPFSGQFISEK"
FT   gene            complement(41379..41681)
FT                   /locus_tag="KPK_B0056"
FT   CDS_pept        complement(41379..41681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0056"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAE16354.1"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12289"
FT                   /db_xref="GOA:B5RKL4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKL4"
FT                   /protein_id="ACI12289.1"
FT                   /translation="MEKKLFDALISSMEEMVAIENGQIQPAAEQVHRHTLPDVKAIRKH
FT                   AGMKQAEFAEVVGASVDLVRSWEQQRRIPSGIALKMLCLIEREPALIDTLRGIHV"
FT   gene            complement(41730..42053)
FT                   /locus_tag="KPK_B0057"
FT   CDS_pept        complement(41730..42053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0057"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAE16353.1"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12255"
FT                   /db_xref="InterPro:IPR009387"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKL5"
FT                   /protein_id="ACI12255.1"
FT                   /translation="MNYLEFVETSAFSGLRKELMDDDEFRELQTYLLEAHDRGDTISHT
FT                   GGCRKIRWGRPGMGKRGGVRVIYYVRLASGRLYLLLIYPKNAKDDLSEKEKAVMKALTQ
FT                   QLK"
FT   gene            42341..42829
FT                   /pseudo
FT                   /locus_tag="KPK_B0058"
FT                   /note="transposase, IS110 family, degenerate; this region
FT                   contains one or more premature stops and/or frameshifts
FT                   which are not the result of sequencing error; identified by
FT                   match to protein family HMM PF02371"
FT   gene            complement(42966..43601)
FT                   /locus_tag="KPK_B0059"
FT   CDS_pept        complement(42966..43601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0059"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAG75875.1"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12312"
FT                   /db_xref="InterPro:IPR018728"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKL6"
FT                   /protein_id="ACI12312.1"
FT                   /translation="MSQMNLHILNAQKKLTAHCEWLQINLTDTYEQAKRLMPIHSLDVV
FT                   VKAGKFVIPEKGHLGFCPEAGVIYITVDPENSAFCKNDAHSIERMFVHELHHAVRWTGP
FT                   GYGSTLGEVLVSEGLAGHFSIELFGGEPEPWESLQSDTIQPYYPQMLENWHRTDYDHNA
FT                   WFFGTGDLPRWLGYTAGFNLISRYLASSPNLKASMLANINAEELKDFI"
FT   gene            43703..43828
FT                   /locus_tag="KPK_B0060"
FT   CDS_pept        43703..43828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0060"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12264"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKL7"
FT                   /protein_id="ACI12264.1"
FT                   /translation="MSAFGTKQTLKTTASDAALAAWRRQMKLHVSVESNGAESPA"
FT   gene            44095..45090
FT                   /locus_tag="KPK_B0061"
FT   CDS_pept        44095..45090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0061"
FT                   /product="transposase, IS110 family"
FT                   /note="identified by match to protein family HMM PF01548;
FT                   match to protein family HMM PF02371"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12235"
FT                   /db_xref="GOA:B5RKL8"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKL8"
FT                   /protein_id="ACI12235.1"
FT                   /translation="MFPFGIDVSKNTLDLCMLYDGIKGRIKTRNIQNNRHSVENILRWL
FT                   RLQHCGPEDVHVVMEATGVYHERLATELHDAGFYVSLANPHRSREFARGMGIITKTDKV
FT                   DAYMLACYAFLKNPHRWEPPAPEIRYLGALLRRRDVLLGDALREENRLEKYLSTDTPAD
FT                   IISSCMHMAQLLREEVSNIERQIKAHIKASPALRRDYTLLTSIKSVGPQLGMHMLVVLR
FT                   SHDFSSAEQAAAFLGVVPIEKRSGTSVRSRPRMSKIGPPQLRAKLYMSALCGKIYNKRM
FT                   RNIYDEMCLRGKPKMVAIGALMRKLVHWCYGVLKTGIVFNDEGLKQVLST"
FT   gene            complement(45211..46005)
FT                   /locus_tag="KPK_B0062"
FT   CDS_pept        complement(45211..46005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0062"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12305"
FT                   /db_xref="GOA:B5RKL9"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKL9"
FT                   /protein_id="ACI12305.1"
FT                   /translation="MPVNKKPVTSPEEFNADDFSQAAIALHVSSSGEYAGQRPHAHRKG
FT                   QLILSMRGAVRCEVDDALWLVPPGHAVWVPGEIPHRCRITKNADTCFLFIEPGAAAMPE
FT                   ICCTIAVTPLVRELVLYLAEQEHTYSPDSKTARLAAVLLEHIPDVPVEALHLPVSDHPK
FT                   IRIMAEALFNEPDDRRTLKQWAAHLAISERSLARLIKEATGMSFGRWRQQLHLMIALSH
FT                   LSEGQPVQRVAGTLGYDSVSAFITMFRKALGKSPTQYFSSLD"
FT   gene            46093..47283
FT                   /locus_tag="KPK_B0063"
FT   CDS_pept        46093..47283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0063"
FT                   /product="transporter, major facilitator family"
FT                   /note="Similar to Escherichia coli yeaN; identified by
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12287"
FT                   /db_xref="GOA:B5RKM0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKM0"
FT                   /protein_id="ACI12287.1"
FT                   /translation="MSHTTNKWSSIILVIGILFIAINLRVPFTAIAPVLESIRHDFGLS
FT                   ITAVGLLNSLPLLAFAAFSPLSASISRKYGLERTLFGALVVISAGILLRSTDSVWALYG
FT                   GTVLIGIGIALGNVLLPGLIKRDFSGNVASVTGAYSITMGTAGAIGSTIVIPLTQSWGW
FT                   NIALAMLVIAPLLAMLLWLPQLKKKHQLPVAGEKKAATVAVWRSSLAWQVTMFMGLNAM
FT                   PFYVAVGWLPVILTGSGLSSAQAGEVHGILQLTTAIPGLILAATLRRLNDQKLAAAGVS
FT                   LLTAVSFIGILYLPNLAMLWAAFLGFGSGASMMLGLTFIGLRTTNAGDAAALSGMAQSI
FT                   GYLMAAMGPLLLGKVQELSGGWTVPLLMTTAISVAGACTGMAAGRDVHLEPVQQPG"
FT   gene            47284..47448
FT                   /locus_tag="KPK_B0064"
FT   CDS_pept        47284..47448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0064"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12304"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKM1"
FT                   /protein_id="ACI12304.1"
FT                   /translation="MGLHWRVPAELLKRMLSIEVLKRLNSTGAICTIPMSGLFGEKAVQ
FT                   GERNIQRPP"
FT   gene            complement(47544..47777)
FT                   /pseudo
FT                   /locus_tag="KPK_B0065"
FT                   /note="putative oxidoreductase, degenerate; this region
FT                   contains one or more premature stops and/or frameshifts
FT                   which are not the result of sequencing error; identified by
FT                   similarity to GB:CAG69081.1"
FT   gene            48032..48223
FT                   /locus_tag="KPK_B0067"
FT   CDS_pept        48032..48223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0067"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12257"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKM2"
FT                   /protein_id="ACI12257.1"
FT                   /translation="MPLFIDECYGLTGAYKNAGCGRRKAASPAGSEATSPLSQQGTERH
FT                   VNNQPLHFTVSVQAVLAY"
FT   gene            complement(48220..48792)
FT                   /locus_tag="KPK_B0066"
FT   CDS_pept        complement(48220..48792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0066"
FT                   /product="putative flavin reductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12284"
FT                   /db_xref="GOA:B5RKM3"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKM3"
FT                   /protein_id="ACI12284.1"
FT                   /translation="MSLQPVELNKAYRLLQVGPTTMISAKHNGNANVMAAAWVSLVGIN
FT                   KVMAYISPQAYTRGLVEESGLFAVQIPVVSQMETVLYAGEHSYRDRPDKNHKIPMFYLK
FT                   EFDVPLVEGCAGWLVCNVIPNAAYELEHNLFMGEIAGAWSDDRVFRNGHWIFDEAPDEL
FT                   RTIHYVAGGQFYAIGKGTRFDHGPGKD"
FT   gene            complement(48887..49402)
FT                   /locus_tag="KPK_B0068"
FT   CDS_pept        complement(48887..49402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0068"
FT                   /product="glutathione-regulated potassium-efflux system
FT                   ancillary protein KefF homolog"
FT                   /note="identified by similarity to SP:P0A754; match to
FT                   protein family HMM PF02525"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12285"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKM4"
FT                   /protein_id="ACI12285.1"
FT                   /translation="MKTTVFVTHPNINQSRVNSALAKGAASLTDVEVRYLYDQYPDGKI
FT                   DVAAEQAALEKTDRIVLQFPMQWYSTPPLLKQWLDDVLTYGWSHGGETQALRDKQLMLA
FT                   VSLGGAESAYQPDGAAGHTVGEYLLSFETISGYLGMNYIKPFITGGSATITDEEIAAQV
FT                   EQYKTVLA"
FT   gene            complement(49419..50384)
FT                   /locus_tag="KPK_B0069"
FT   CDS_pept        complement(49419..50384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0069"
FT                   /product="oxidoreductase, aldo/keto reductase family"
FT                   /note="identified by match to protein family HMM PF00248"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12213"
FT                   /db_xref="GOA:B5RKM5"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKM5"
FT                   /protein_id="ACI12213.1"
FT                   /translation="MKMRRLGSQGLHVSEMGLGCMGMDHGYGYSVEIRERTELIDKAVE
FT                   LGCNLFDTAPIYGFENEELLGVALSKHRDNVIIATKFGVTGMENIDGQLVPVLDSRPAS
FT                   VREQLEGSLSRLQTDHIDLFYQHRVDPKVEPEVVAGLMKELIAEGKIKYWGLSNAPVSY
FT                   IRRAHAICPVTAVEDQYSMMWRKPEQDLFKVCDELDIGFMAYSPLGNGFLSGQVTADTT
FT                   YGEGDYRGMMGRFKPEVMENNQALLDLIAQIAERNNATSAQIVLAWELAQKPYIVPIPG
FT                   TTKLHRLEENFHAANVQLSDAELNDINEALSRLEIDETFF"
FT   gene            50498..51394
FT                   /locus_tag="KPK_B0070"
FT   CDS_pept        50498..51394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0070"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12314"
FT                   /db_xref="GOA:B5RKM6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKM6"
FT                   /protein_id="ACI12314.1"
FT                   /translation="MMNKLDALKFFVAAAETMNFREAAVRLAISPSVVTRTIAELENQL
FT                   GEPLFKRNTRSIVLTSFGELFLPKAMRLLEDSEALFQTARDDNDMKGVVRITLFRFPGH
FT                   EQVLYELLTSLDPYPELFIDWRLDMMKLDTVQNRIDMGIRIEREPNPNFIVRPITLVHH
FT                   ALMTSPRLIEKLGAPENFDDLRQRYPFSGLLNPETGKVFEYMLDGVDTFVPRHLEFFTT
FT                   DSQSEIQAALAGKAVIQSSNLACRKYLEDGRLVNVLPELKLETWQLYLYRPYQTLVPQR
FT                   IRTVFHILESILLRHFS"
FT   gene            complement(51591..52478)
FT                   /locus_tag="KPK_B0071"
FT   CDS_pept        complement(51591..52478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0071"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12203"
FT                   /db_xref="GOA:B5RKM7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKM7"
FT                   /protein_id="ACI12203.1"
FT                   /translation="MDRIQAMQVFIRVAEAGSFVRAAETLSLPSSTVTSTIKNLEKYLQ
FT                   VRLLNRTTRRVSLTPEGLQYLAQCREILALVEHTEASLADLNRRPRGRLRVDMPGGIAH
FT                   FIVMPNLKEFYSRYPDIYLMIGVSDRQVDLVQEGVDCVIRTGELINSTLVARPLGEFRW
FT                   ITCASPDYLREYGIPQSPEDLSHHRAIHYFSGQSRRTDELRFVKGTETLSVSVSGQAAV
FT                   NETGLYIKMCLEGFGLAQLAENVVAEHLEKGTLVEVLADWQPPSVPVTLLYPHQRFLSP
FT                   AVRAFADWIGEIFS"
FT   gene            52621..54018
FT                   /locus_tag="KPK_B0072"
FT   CDS_pept        52621..54018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0072"
FT                   /product="amidohydrolase family protein"
FT                   /note="identified by match to protein family HMM PF01979;
FT                   match to protein family HMM PF07969"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12277"
FT                   /db_xref="GOA:B5RKM8"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKM8"
FT                   /protein_id="ACI12277.1"
FT                   /translation="MTDYIRDIVNNHTDNATVTLIRGATILSMDENVGNHERGDILVIG
FT                   STITAIGKDLNAEGAHVIDATNMIAMPGMVDSHRHAWEGQLRRINPNATCLDDYSNATH
FT                   FSFAKYYRPADIYVGNLLTALGAIDAGITTMIDNSHNSRTAAHSDAAVEALLDAGIRAI
FT                   HASGAPVAGEWDKAHWPGNWQRLQEKYFRDNPDSLVTLGVMAQLEPELWAEARRLGLPI
FT                   VTEFFGAEMASELESLHQQGLLGPDNIFNHCTALPDEGWEILREAGVRVNVCPRSDSHY
FT                   GIESGMFAIEAAQRHGITPGLSVDNETSYSTDMFMEMRVAFYLQRVMGMHKQHCCDSDH
FT                   SLTTIPAAQLLKSATVDGAFCAGLQDKVGSLTPGKQADLILINAADLNLYPNGNAFGTV
FT                   VHAAERSNIDTVMIGGRIVKQNGKVLGVDSERLRAAIDESREHLFAAAGYEPDIFAEKF
FT                   LPLVQAN"
FT   gene            54033..54506
FT                   /locus_tag="KPK_B0073"
FT   CDS_pept        54033..54506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0073"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF04657"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12268"
FT                   /db_xref="GOA:B5RKM9"
FT                   /db_xref="InterPro:IPR006750"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKM9"
FT                   /protein_id="ACI12268.1"
FT                   /translation="MSAIYYVIAFAAGLGITLQTTLNSQLAKGLGGDPVTAAFFSFTAG
FT                   ALSLGIYSLLRGGLFSSLAAIPSQPAWSLAGGLIGACALFSYVVLAPKIGFSALLGLAI
FT                   VGQLLSSQMIDHFGLLGAVRRPVSLLKLGGMLVMLAGLAIMLFGDKLSARFLP"
FT   gene            54605..55465
FT                   /locus_tag="KPK_B0074"
FT   CDS_pept        54605..55465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0074"
FT                   /product="SMP-30/gluconolactonase/LRE family protein"
FT                   /note="identified by match to protein family HMM PF08450"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12303"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="InterPro:IPR039096"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKN0"
FT                   /protein_id="ACI12303.1"
FT                   /translation="MFSVAADARNLLGECPIWCERTRRIYWTDIEGSELLALEEDTSVV
FT                   MRWSLPERLGSFALTENPDVLLMGLASRFAFCDLNTGTFMPIVASPGGPGTRTGDGRCD
FT                   REGNFVFGTMDDGYPAKVIGRFHRLNAATLSIETLPLPEVAIPNSICFSPDGSTMYYCD
FT                   SMQGRIMCCDYPSMNNQRVFTVTEGKGAPDGSCVDAMGYIWNAEWGGSRVVRYRPDGTT
FT                   DRILPSPGIQSTCPTLAGEAFTTLYCTSASVGLSVPSRHDGALLRAKSAVFPGLPESRF
FT                   SAHTA"
FT   gene            complement(55571..56524)
FT                   /locus_tag="KPK_B0075"
FT   CDS_pept        complement(55571..56524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0075"
FT                   /product="NmrA family protein"
FT                   /note="identified by match to protein family HMM PF05368"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12300"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKN1"
FT                   /protein_id="ACI12300.1"
FT                   /translation="MNKTDLNATSEKILVLGAGELGLPVLRNLALRAKDVEGTKISVLL
FT                   RESTVTSDEPVKKLVITEIRNLGINIVTGDLVMSSVDDLASLFAQFDTVVGCTGYAAGI
FT                   NTPMKLAQAALQARIPRYFPWQFGADFDAIGRGSPQDIFDAQIDVRDLLRSQHETEWVI
FT                   ISTGIFMSYLFEPDFGVVDLQNDTVHALGSIDNTMTLTTPDDIGVLTAAIVFTTPRIRN
FT                   EIVYIAGDTLTYAEVADKLQSALGRPFDCTVWSEEYLIDKLALNPQDMMSKYRAVFAQG
FT                   RGVAWDKKQTFNERHNIRVTDVAAWINANLTPGSSL"
FT   gene            56594..57028
FT                   /locus_tag="KPK_B0076"
FT   CDS_pept        56594..57028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0076"
FT                   /product="putative transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF01638"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12212"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKN2"
FT                   /protein_id="ACI12212.1"
FT                   /translation="MIPGICEMDRDEILQYSQAVCKGLRDDDDGLRREVLAHAGSRWSL
FT                   GIVNTLGVYGRLRHAEIGRRMHGVTQRMLTRTLRQLERDGLVIRHDFSEIPPRVEYELS
FT                   DTGMELLVRMIPLWTWIVDNADRFREDRLRYEKNNNNPRA"
FT   gene            57358..58314
FT                   /locus_tag="KPK_B0077"
FT   CDS_pept        57358..58314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0077"
FT                   /product="alpha/beta hydrolase fold domain protein"
FT                   /note="identified by match to protein family HMM PF07859"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12224"
FT                   /db_xref="GOA:B5RKN3"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKN3"
FT                   /protein_id="ACI12224.1"
FT                   /translation="MISKENNEISSNYHDLPGYVHGAKIIQVALTKTPIDNISDVVYET
FT                   VKKTRSVRQLHMSFLVPRTNILKPGIIYFPGGGFMTAEHNKFVEMRMALAEAGFVVAAA
FT                   EYRTIPDTFPAPVIDAKAAVRYLRQHAHDYGIDPSRIGVIGDSAGGWLAQMLGTTNGDK
FT                   SFDHGDFLSQSADVQAVATLYGISDLRNIGDGFPDLRQKVHQSPAVTESLLINGVAFKN
FT                   FAGASISSVPEKAINASPIGRLKGCKPPFLIMHGSKDTLVSPKQSATLYKALLESGNKA
FT                   DYVLIEGAEHGDDHWYQPVVINRVVDWFRVHLCPENI"
FT   gene            complement(58393..59631)
FT                   /locus_tag="KPK_B0078"
FT   CDS_pept        complement(58393..59631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0078"
FT                   /product="transposase, IS110 family"
FT                   /note="identified by match to protein family HMM PF01548;
FT                   match to protein family HMM PF02371"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12245"
FT                   /db_xref="GOA:B5RKG9"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKG9"
FT                   /protein_id="ACI12245.1"
FT                   /translation="MTAKDQFAAYVGLDWADKKHDVCVQFKNGDRIFHVIEHTPEALDI
FT                   WLNELHQRAKGRIAIAVELKKGPVVYALQKYPFVTVFPVHALSLARYRQAFWPSGAKDD
FT                   PQDAELALDLMLRYPHKIKAIEADNPDIRLLQQLVEQRRLLVEDKRRFVNRLINTLKQY
FT                   YPQPLEWFSHRDSSLFCELIIRWPSLQQLKRARSDTVRHFMNAKGGPAVAYTEQRVASI
FT                   ASAIPLATDKTVIEANALMATALASQIKLTGDLVRTYDERIESLFDTLPDAELFKSLPG
FT                   MGPCMGPRMLAALGDNRNRFNSAEEIQNYAGIAPVTERSGQKSWVHWRWQCAKFVRQTF
FT                   VEWTAKTVNSSYWARLYYQGQREKGKSHQSAIRALAFKWIRIIYRCWKTRTRYDEAKYL
FT                   LALEARKSPLLKP"
FT   gene            59897..60055
FT                   /locus_tag="KPK_B0079"
FT   CDS_pept        59897..60055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0079"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12242"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKN5"
FT                   /protein_id="ACI12242.1"
FT                   /translation="MPDVRLDVQGENDGDRFVAKTRSNDFSTQSNNKFFSFLKDNNPLS
FT                   AIIRRFL"
FT   gene            60247..61077
FT                   /locus_tag="KPK_B0080"
FT   CDS_pept        60247..61077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0080"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:ABE58096.1"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12204"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKN6"
FT                   /protein_id="ACI12204.1"
FT                   /translation="MRYTRTSTATDVTDTLRQYQADLLAGPCWMSVWPLIERLLSRENE
FT                   MQSVWQNIARQALTWQQCYCLLEQIILAGRFSRTDIVSRLKADYHQLEELNRTISKTAA
FT                   ELAEMILARDAILNRNAFTLKRTTHIVDLMGMAEDNEGLYHSYLHETLDGLTCRYEGKY
FT                   WPGLPGVLQVIAREHPEIGCLSESDRAIINGRGKILPDYLRELFSSIENVRQGPWGLPK
FT                   DFTLTDSSLATLATVTLEYTEVISADTVKVRRSEFSKRGERGAWPFKRLEAVDM"
FT   gene            61140..61253
FT                   /locus_tag="KPK_B0081"
FT   CDS_pept        61140..61253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0081"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12225"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKN7"
FT                   /protein_id="ACI12225.1"
FT                   /translation="MATAIITVTELPGECFYSGMTLCTAWKRNNDGRITLV"
FT   gene            61228..63915
FT                   /locus_tag="KPK_B0082"
FT   CDS_pept        61228..63915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0082"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:ABI56889.1"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12241"
FT                   /db_xref="GOA:B5RKN8"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKN8"
FT                   /protein_id="ACI12241.1"
FT                   /translation="MTVGSRWFKFDFHNHTPASDDYRVPDLQPREWLLAYMRQQVDCVV
FT                   ISDHNSGAWVDVLKAELANMYRDASSGELADFRPLTLFPGVELTATGNVHILAVLHTKS
FT                   TSAEVERLLAQCNNNCPISRETPNHQLVLQLGPAGIISNIRRNPEAICILAHIDAAKGV
FT                   LTSLTNQGELTAAFQSKPHAVEIRHREEDITNGTHRRLIADLPWLRGSDAHHPEQAGAR
FT                   TCWLKMSAPDFDGLRHALLDPENCVLFDDNPPEAPASHLRSLTFRTRLCKPVDQNGASV
FT                   EFSPFYNAVIGSRGSGKSTLIESIRLAMRKTEGLTASQINKLNLFSQTGMGMDTDSFIE
FT                   CVFHKEGTDFRLSWRPGGCHELHIFSEGQWVQDNHWSADRFPLSIYSQKMLYELASDTG
FT                   AFLRVCDESPMVNKRAWKERWDQLERDYLNEQITLRGHLASQTIAGKLQGELSDAERAI
FT                   SQLRSSAYYPVCTRLATARAELSAATLPLDHNEQRVAALRAQEKEPVQVPELQVESSAP
FT                   LTAFMTRLLDVQQKYDQRLDTLLSDYAAELRTIKQEPPFLALEEAVRNQEETVQREAMV
FT                   LREQGLNPDVLDELMTRSESLKSELRNYADLDGTIAASAARSKGLLAEMRNHRMVLTEK
FT                   RKAFLSSLSLSALEIKILPLCAPHEDTVSGYQAVTGIGNFADRIYDNGDGSGLLHDFIS
FT                   LRPYSPLPSATENKYLALDTLKALHLAIHREEPGVGAELHGAFRNRLKGLNEAQLDALQ
FT                   CWYPDDGIHIRYQTPGGGMEDISSASPGQKGASMLQFLLSYGTDPLLLDQPEDDLDCLM
FT                   LSMSVIPAIMANKKRRQLIIVSHSAPIVVNGDAEYVISMQHDRSGLYPGLCGALQETLV
FT                   KELICRQMEGGEKAFRSRYERILS"
FT   gene            complement(64084..65913)
FT                   /locus_tag="KPK_B0083"
FT   CDS_pept        complement(64084..65913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0083"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12236"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKN9"
FT                   /protein_id="ACI12236.1"
FT                   /translation="MRIDRRLSRDVLTEHQLYFIECWSNFCHKNSPDTDRVGYSNPLST
FT                   IRELLFLYEMEDRFSADKKRLRVATELLELLETDHVLRREAFEDIPAQLVSLLDRDLLV
FT                   DPTRSPVEKRPRLICSLCVQLADIIEASYITEALEMLEQELFTEPPLDENHARDIYSLT
FT                   NGVMSLLLTRGMTLTECYLLYINIFRTVSPEPDAFRAAFHSFRQKLVTPTRDVTVRMFI
FT                   TSEKLHTLLNTQGPTLQFNGCVFQPLDEARQRFSLAVDIPVCSMSDTSARNMAGQMLRE
FT                   SLDVIAYMVGKGDITVQKQFMIIRDEDETEVPRFDNEIEANADRLTDEEFARFMVAMNR
FT                   LFTDTPDVSRKKISSAFRFFRNGIESQVQESRFTAYWSALESLTLGVAPGTPSHEQHVI
FT                   SVVAPCMVLDYIVKQLFSLRKVLRFILREPGHTLRTPDIASLPLGQLYALLKDADRARE
FT                   LQTDLQHFPYVMYRVRKLAGICASPEKMADKLGQHAEKVTRHLHRLYLLRNTIVHNAGT
FT                   SPHIDLLTVNLEHYLRATISALFNIVVIHPTVSTAEEAFTRCQFTSESVFRELNPLHGI
FT                   TEKKVYTAIDNQLKNGTLSRSDARLIAWLNAHP"
FT   gene            complement(66089..66742)
FT                   /locus_tag="KPK_B0084"
FT   CDS_pept        complement(66089..66742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0084"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12310"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKP0"
FT                   /protein_id="ACI12310.1"
FT                   /translation="MHHIKYLNSVIIKKNKVLSQDAKMKDESKDKLSAAKGTLTVRHLP
FT                   ADVDAAITAQAKAAGRSKSDFIQEFLSASFGDIIGNFSRSSELVALMDRELSGVTGLPL
FT                   TENWYDAGRTLAENREYCQLLNIRNDTDLQRIMMAGVPWLSLRMQQLDSGIPLLPQGIS
FT                   LTCALFIEAAGRERPQLNIFRRHLFWYMDEALFWREIDAIRVARLLPALEHPDF"
FT   gene            66737..66916
FT                   /locus_tag="KPK_B0085"
FT   CDS_pept        66737..66916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0085"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12271"
FT                   /db_xref="GOA:B5RKP1"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKP1"
FT                   /protein_id="ACI12271.1"
FT                   /translation="MQKLKIASYLSLLIVITFRAALLSLSSLYISPEFPLIRFLVVPDL
FT                   LSGLRRAAARKHKI"
FT   gene            complement(67040..67207)
FT                   /locus_tag="KPK_B0086"
FT   CDS_pept        complement(67040..67207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0086"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12252"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKP2"
FT                   /protein_id="ACI12252.1"
FT                   /translation="MQLTHARLKHTVMSPFISHREIHIQNNHLRDNKQPYSHAVKLPDA
FT                   RSGQIRLFTF"
FT   gene            67259..67477
FT                   /gene="ccdA"
FT                   /locus_tag="KPK_B0087"
FT   CDS_pept        67259..67477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccdA"
FT                   /locus_tag="KPK_B0087"
FT                   /product="post-segregation antitoxin CcdA"
FT                   /note="identified by similarity to SP:P62552; match to
FT                   protein family HMM PF07362"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12256"
FT                   /db_xref="InterPro:IPR009956"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKP3"
FT                   /protein_id="ACI12256.1"
FT                   /translation="MQQRITVTIDSDSYQLLKSADVNISALVNRAMQNEARRLRAERWQ
FT                   AENQEGMAEVARFIDMNGSFADENRDW"
FT   gene            67479..67784
FT                   /gene="ccdB"
FT                   /locus_tag="KPK_B0088"
FT   CDS_pept        67479..67784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccdB"
FT                   /locus_tag="KPK_B0088"
FT                   /product="cytotoxic protein CcdB"
FT                   /note="identified by similarity to SP:Q52043; match to
FT                   protein family HMM PF01845"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12248"
FT                   /db_xref="GOA:B5RKP4"
FT                   /db_xref="InterPro:IPR002712"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKP4"
FT                   /protein_id="ACI12248.1"
FT                   /translation="MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDK
FT                   VSRELYPVVHIGDDSYRLMTTDMASVTSSVTGEEVADLSHRENDIKNAINLMFWGI"
FT   gene            67875..68975
FT                   /locus_tag="KPK_B0089"
FT   CDS_pept        67875..68975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0089"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12292"
FT                   /db_xref="GOA:B5RKP5"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKP5"
FT                   /protein_id="ACI12292.1"
FT                   /translation="MPCRLSWGQLKRTAHTKNLKPVTFTQRDKKAGMEAKTETFIKTSV
FT                   DDNGMWLLTVPAGRAGDETVVVVVRRVEECRYGSEDSPGAHVSITSSLTLYGEGQGTPQ
FT                   TIVAKFVPGTVELFSVEFMLKEFLPRGRGVGSWIMQQMVLWTRSLPPETLVGRIDISSV
FT                   DAKDIRNLYRRSRMWRGLGFRFPAGETCSMPLRADELQLPRGRCSTLRVEPLVSAVRRL
FT                   EDCYHGLQEKIVQLEGKKRSQKQLIDSLKNRPFYHLLHRKGGQLPDEKCDTLPLRAEKL
FT                   SLPQSGDSDLVVAQRATGVIRLATLCAQSQKRILELERDLASQSEELVDLQAHPFFNLR
FT                   DKYRDQILFWGWGMCFLCFIYWMLVS"
FT   gene            69019..69180
FT                   /locus_tag="KPK_B0090"
FT   CDS_pept        69019..69180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0090"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12227"
FT                   /db_xref="GOA:B5RKP6"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKP6"
FT                   /protein_id="ACI12227.1"
FT                   /translation="MPENIVSTVIDGVVLFATSSVFWLAVAGWLVILTPVILRRKFSAK
FT                   KKVNRNYE"
FT   gene            69173..69952
FT                   /pseudo
FT                   /locus_tag="KPK_B0091"
FT                   /note="resolvase, fragment; identified by match to protein
FT                   family HMM PF00589"
FT   gene            complement(70010..70267)
FT                   /locus_tag="KPK_B0092"
FT   CDS_pept        complement(70010..70267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0092"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12266"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKP7"
FT                   /protein_id="ACI12266.1"
FT                   /translation="MKLETIQIDNTVRSGLNSFTDGVIIRDTKVLITLNLPDGQKTTIE
FT                   GEWRHMSDANRLSERITMLQHAIYEQYEEYRADIPVSWSR"
FT   gene            complement(70396..70509)
FT                   /locus_tag="KPK_B0093"
FT   CDS_pept        complement(70396..70509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0093"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12283"
FT                   /db_xref="GOA:B5RKP8"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKP8"
FT                   /protein_id="ACI12283.1"
FT                   /translation="MRSFTIMTLLETFLTASPASQGATILFLAMLIYWQKR"
FT   gene            71143..71898
FT                   /gene="repE"
FT                   /locus_tag="KPK_B0094"
FT   CDS_pept        71143..71898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="repE"
FT                   /locus_tag="KPK_B0094"
FT                   /product="replication initiation protein"
FT                   /note="identified by similarity to SP:P03856; match to
FT                   protein family HMM PF01051"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12253"
FT                   /db_xref="GOA:B5RKP9"
FT                   /db_xref="InterPro:IPR000525"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKP9"
FT                   /protein_id="ACI12253.1"
FT                   /translation="MAEIAVINHKKRKNSPRIVQSNELTEAAYSLSRDQKRMLYLFVDQ
FT                   IRKSDGSLQEHDGICEIHVAKYAETFGLTSAEASKDIRQALKGFAGKEVVFYRPEEDDG
FT                   DEKGYESFPWFIKRAHSPSRGLYSVHINPYLIPFFIGLQNRFTQFRLSETKEITNPYAM
FT                   RLYESLCQYRKPDGSGVVSLKIDWIMERYQLPQSYQRMPDFRRRFLQASVDEINSRTPM
FT                   RLSYIEKKKGRQTTHIVFSFRDITSLTTE"
FT   gene            71900..72028
FT                   /locus_tag="KPK_B0095"
FT   CDS_pept        71900..72028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0095"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12276"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKQ0"
FT                   /protein_id="ACI12276.1"
FT                   /translation="MRVICHRFEGGSSHLIRQVEGYLSQFRCYLPGSLRLFIVFWL"
FT   gene            72664..73869
FT                   /gene="parA"
FT                   /locus_tag="KPK_B0096"
FT   CDS_pept        72664..73869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parA"
FT                   /locus_tag="KPK_B0096"
FT                   /product="plasmid partition protein A"
FT                   /note="identified by similarity to SP:P07620"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12217"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041250"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKQ1"
FT                   /protein_id="ACI12217.1"
FT                   /translation="MDNIEQLRKVATRAGKLLTSLSESIRQQKEELKLTEFYQEYSKAA
FT                   LYKLPKLSKGSVEYAVSEMEAGGYIFKKKPSGNTMKYAMTIQNVIDLYNHRKVPKYRDR
FT                   FDKAFTIFVCNLKGGGSKTVSTASLSHAFRAHPQLLFEDLRILAIDFDPQASLTMFLSH
FT                   ENSVGLVENTAAQAMLQNVSREELLSDFIVPSIIPGVDVIPASIDDAFLAEGWKGLCEE
FT                   HLPGKNIHAVLKENIIDKLQHDYDFIFLDSGPHLDAFLKNCIGAADLMLTPLPPATVDF
FT                   HSSLKFVASLPALIDSIEMDGHTCNLIGNVGFMSKILNKSDHKICHSQAKEVFGADMLD
FT                   MVLPRLDGFERCGETFDTVISANPATYDGSTEALKSAKSAAEDFAKAVFDRIEFIRTNG
FT                   GM"
FT   gene            73869..74843
FT                   /gene="parB"
FT                   /locus_tag="KPK_B0097"
FT   CDS_pept        73869..74843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parB"
FT                   /locus_tag="KPK_B0097"
FT                   /product="plasmid partition parB protein"
FT                   /note="identified by similarity to SP:P07621; match to
FT                   protein family HMM PF02195; match to protein family HMM
FT                   PF08775; match to protein family HMM TIGR00180"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12297"
FT                   /db_xref="GOA:B5RKQ2"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR014884"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKQ2"
FT                   /protein_id="ACI12297.1"
FT                   /translation="MSNEKRKTIGRQLNTQASMAEMTDTGRSQVFTLKTGRKVTFRFVR
FT                   VPASEVESKTFVNQENNGRDQLALTRESLKSIIQTIKFQQFFPCIGIKQSERIEILDGS
FT                   RRRASAIFVRTGLDVMVTEEHLSADEARQLAKDIQTAKEHNLREIGLRLIALKESGFNQ
FT                   KEIAELEGLSQAKVTRALQAAAVPQDLISLFPVQSELSFSDYKLLLEVNEKLSEKGLTP
FT                   EELIQSVSAQLDAILSDGERPEDEQKASILKLISQASQALIDPSPKEKSVVSPLWSFEE
FT                   KDKFARKRVKGRTLTYEFSRMSKVIQDELDKAINEVLDRNLSQ"
FT   gene            complement(74925..75752)
FT                   /pseudo
FT                   /locus_tag="KPK_B0098"
FT                   /note="ImpB/MucB/SamB family protein, truncation;
FT                   identified by match to protein family HMM PF00817"
FT   gene            75651..76340
FT                   /locus_tag="KPK_B0099"
FT   CDS_pept        75651..76340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0099"
FT                   /product="putative TraU protein"
FT                   /note="N-terminal truncation; identified by similarity to
FT                   SP:P18471; match to protein family HMM PF06834"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12258"
FT                   /db_xref="InterPro:IPR009649"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKQ3"
FT                   /protein_id="ACI12258.1"
FT                   /translation="MVNLGGFSINLGKIGMGTARKDDKQVNGAFYHVHWYKYPLTYWLN
FT                   IITSAGCLEGGDMDIAYLSEIDPTWVDSSLTTILNPEAILFANPIAQGACAADALASAF
FT                   HMPLDVLFWCGGSHGSLYPFNGQVSNESSPLQSSVLVSERMAFKLHRQGQIMESIGKDK
FT                   AVCYEYPSPIIPKERWRYQMVNMYPDSGQCHPLGRSVMRWEAGKNPPNSRKNYGYLMWR
FT                   KRNCVFL"
FT   gene            76364..76540
FT                   /locus_tag="KPK_B0100"
FT   CDS_pept        76364..76540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0100"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12218"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKQ4"
FT                   /protein_id="ACI12218.1"
FT                   /translation="MKEEQKQCNSQPAQFRKISPYTSRGTFSMEEKVLTAEQYRDWQFI
FT                   GATLSDKISRYAE"
FT   gene            76558..77100
FT                   /locus_tag="KPK_B0101"
FT   CDS_pept        76558..77100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0101"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12230"
FT                   /db_xref="GOA:B5RKQ5"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKQ5"
FT                   /protein_id="ACI12230.1"
FT                   /translation="MLKNYAFVKTSIHTVGMTLKSPPLASIPGISDASQACDKISARLR
FT                   YGIIPRPEGVNRLNAILWLARMREAGIHGQSSATAHELGRLNVLLGQVSGVLKACWIYR
FT                   GWEASRASTIVSILLIIPAFLVFWLALYVGGTILVCSVSMALFLGVGIVVNLWIKDPVG
FT                   LFWSLYSYIPLYAIIYM"
FT   gene            complement(77120..77794)
FT                   /locus_tag="KPK_B0102"
FT   CDS_pept        complement(77120..77794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0102"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12214"
FT                   /db_xref="GOA:B5RKQ6"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKQ6"
FT                   /protein_id="ACI12214.1"
FT                   /translation="MTGLLIFLVLLTAALRFRFKDNHSLFIKLRRPFPAELTLLILSSA
FT                   LCFTAQKTLYLFTENVYLFYSMTFVSVVAVWFVSYFLSSSILKTPITDMVLTPCLSNLR
FT                   VDINRGYTEAMSQSGSYEDIAEKTAADISYLLSHFPCKTITFESHLLRPGLRKVLCNNL
FT                   RERGISFTVKERITHLPEAMVLNLRYGGKTRYRLFTYCKHPNGFKVHRNGGAFKIYNDK
FT                   TL"
FT   gene            77851..78447
FT                   /locus_tag="KPK_B0103"
FT   CDS_pept        77851..78447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0103"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12206"
FT                   /db_xref="GOA:B5RKQ7"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKQ7"
FT                   /protein_id="ACI12206.1"
FT                   /translation="MYDCDPVNEFTYVRDRLNGIFLRLSEEPFIRLSKKRIIQRHLSDI
FT                   QWMLNHNHYPTPGQVDFFISLLRDGKFSVVREEGRHTKSAADIQLMIDALKDIRDFLKL
FT                   ITRYETEGDIIRLTSCSAWKNTALYLCLAAFFALFIAQVVIFLGYSPLAVYFSGFAFFF
FT                   ITSLVLENEVLIFSFIGLVVFTLCILFAWTSHYPG"
FT   gene            78487..79134
FT                   /gene="trbC"
FT                   /locus_tag="KPK_B0104"
FT   CDS_pept        78487..79134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbC"
FT                   /locus_tag="KPK_B0104"
FT                   /product="type-F conjugative transfer system pilin assembly
FT                   protein TrbC"
FT                   /note="identified by match to protein family HMM TIGR02742"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12308"
FT                   /db_xref="InterPro:IPR014113"
FT                   /db_xref="InterPro:IPR019106"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKQ8"
FT                   /protein_id="ACI12308.1"
FT                   /translation="MNKGITGLAWGLSLLCTTVSAADNINTPADQQWLKQQENLSEQLR
FT                   QHPDKQLQQELEAQINRNPLTKSDRQFIDNLVSQQKAANQEKQAEGALYFVSFSIPEEG
FT                   LKRMLHETRQYGIPATLRGLVNNDMRTTTDAVLQLVKDGVTDGVQIDPTLYTQYGIRSV
FT                   PSLVVRCQAGYDVVRGNIHVKQALEKVAQTGDCAQVARRMLDVPSNAAGSQP"
FT   gene            79193..81148
FT                   /gene="traN"
FT                   /locus_tag="KPK_B0105"
FT   CDS_pept        79193..81148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traN"
FT                   /locus_tag="KPK_B0105"
FT                   /product="type-F conjugative transfer system mating-pair
FT                   stabilization protein TraN"
FT                   /note="identified by match to protein family HMM PF06986;
FT                   match to protein family HMM TIGR02750"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12299"
FT                   /db_xref="InterPro:IPR014121"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKQ9"
FT                   /protein_id="ACI12299.1"
FT                   /translation="MKTVISVLTAHFFVLSAFIWLASPACADSGSDYKAGSDFAKQVQG
FT                   NGLNSLKNFSGEQNLPGYTANPDQTKYYGGVTASGDSSLKSDSALEFSQGDTGKTITES
FT                   FTNRPPDQISQDAPFIQAARDTESRADSIVGDTGQSCTAQVVNRSEFTNHTCERDLQVE
FT                   NFCTREATLKDNATTQKVNRTYQQVVTLNYARSTRQWSGNLTIPTSGRLLNASVDGEPL
FT                   VIPWIEECDSEGKVRDSCKSAVSESLTLFERTFPIDVISWPRSESICSGGQNTHCTKYT
FT                   YDGKAKIHQSFGVDKVVTAGQNFAVSKISRTVSSASQKPVQVTVTLVMEETETVYAPEV
FT                   VWVESCPFSKDEGKKTGEECISPGGTRTITLGGRDYSFTEACWKYKDTWLTQPADNGSC
FT                   ESLMKNTACTLSSRQCAFSSEEGTCLHEYATYSCETRTSGKQMVCGGDVFCLDGECDKA
FT                   TSGKSNDFGQAVSELAALAAAGKDVAALNGVDVRAFTGKAKYCKKFAAGFSNCCKDGGW
FT                   GQDVGLARCSSEEKALAKAKKDKMTVSIGEFCSKKVLGICLEKKRSYCQFDSKLAQIVQ
FT                   QQGRNGQLHIGFGGASSPDCRGITVAELQGIDFNELDFTNFMEDLINNQKIPDNSELTE
FT                   KTKARIKELLTQSSAK"
FT   gene            81181..81462
FT                   /locus_tag="KPK_B0106"
FT   CDS_pept        81181..81462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0106"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12313"
FT                   /db_xref="GOA:B5RKR0"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKR0"
FT                   /protein_id="ACI12313.1"
FT                   /translation="MAASLMVVVLLVLFLFIPACIALFMSGRSLLLIFLGAVACQAAVA
FT                   VAFAGLSARGWSESMGMGAASLIFYVIGLHKADGVKQNTHNGRQKNES"
FT   gene            81452..81679
FT                   /gene="trbE"
FT                   /locus_tag="KPK_B0107"
FT   CDS_pept        81452..81679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbE"
FT                   /locus_tag="KPK_B0107"
FT                   /product="TrbE protein"
FT                   /note="identified by similarity to SP:Q05807"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12306"
FT                   /db_xref="GOA:B5RKR1"
FT                   /db_xref="InterPro:IPR020150"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKR1"
FT                   /protein_id="ACI12306.1"
FT                   /translation="MKVNFHKHPAVDFSLRLTLTVIIISPVIYFSWDAVKGTSGSDYVE
FT                   SVVFILCMGGVGLMNYLFFSALTRLLQKGK"
FT   gene            81690..82016
FT                   /locus_tag="KPK_B0108"
FT   CDS_pept        81690..82016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0108"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12237"
FT                   /db_xref="GOA:B5RKR2"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKR2"
FT                   /protein_id="ACI12237.1"
FT                   /translation="MEERKSYGMVVLFVSVFVVFLVSIMSYSLWRDRQVNAFMTTNRAW
FT                   GIQCDTVSQAAWVIRDGERVDLQINHLPLYCSGYRFEARDDAGKIQRQLDKYSVYQHLS
FT                   RQSQ"
FT   gene            82037..82804
FT                   /gene="traF"
FT                   /locus_tag="KPK_B0109"
FT   CDS_pept        82037..82804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traF"
FT                   /locus_tag="KPK_B0109"
FT                   /product="type-F conjugative transfer system pilin assembly
FT                   protein TraF"
FT                   /note="identified by similarity to SP:P14497; match to
FT                   protein family HMM TIGR02739"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12286"
FT                   /db_xref="InterPro:IPR014110"
FT                   /db_xref="InterPro:IPR039555"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKR3"
FT                   /protein_id="ACI12286.1"
FT                   /translation="MRTIHAAMLAGCLCCALMPAFAKDAGWQWYNEKLKPRDEDRKAVP
FT                   AAPPPQMDILEKLATLQAATKRSLYEAILYPSSENFVKYFRLQNYWTQQAGLFSMSAKK
FT                   AMLENPELDYNLQYSHYNGTVKNQLAADYAEQRQAISTLAQHYGVMFFYRGREAIDGQL
FT                   VQVIKNFRETYGLSVIPVSVDGVINPMLPDSRTDQGQAEQLGVKFFPAMMLVTRFQQHP
FT                   VPARRELNGGAGRYGKSPLPHRRWRWTGGVQWG"
FT   gene            82725..84761
FT                   /pseudo
FT                   /locus_tag="KPK_B0110"
FT                   /note="protein TraI, truncation; identified by similarity
FT                   to SP:P22706; match to protein family HMM PF07057"
FT   gene            84841..85566
FT                   /gene="traX"
FT                   /locus_tag="KPK_B0111"
FT   CDS_pept        84841..85566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traX"
FT                   /locus_tag="KPK_B0111"
FT                   /product="type-F conjugative transfer system pilin
FT                   acetylase TraX"
FT                   /EC_number="2.3.1.-"
FT                   /note="identified by similarity to SP:P22710; match to
FT                   protein family HMM PF05857; match to protein family HMM
FT                   TIGR02755"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12281"
FT                   /db_xref="GOA:B5RKR4"
FT                   /db_xref="InterPro:IPR008875"
FT                   /db_xref="InterPro:IPR014125"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKR4"
FT                   /protein_id="ACI12281.1"
FT                   /translation="MRAQHTFPGATDRWLHRLLTWTPGQTDMIKTVALVLMVTDHTGLL
FT                   LAGNNEVMRLLGRGCFPLFGLAWGMNLARYAEIRQSQLNSLWGWALVAQVSFMLIGYPW
FT                   YTGNILFAFAVTGQVLRWVSQPSWSYTLPAAGLLVAWIPLSTASYGMAGVGMLTASWLL
FT                   CRTQHAPERLGYGVLWALMVLLMNMHDVSESVAGLAIALLTLMVCSSAGERVKRFWPRH
FT                   FFVMFYAVHLAVLGIVVSM"
FT   gene            85638..86234
FT                   /gene="finO"
FT                   /locus_tag="KPK_B0112"
FT   CDS_pept        85638..86234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="finO"
FT                   /locus_tag="KPK_B0112"
FT                   /product="fertility inhibition protein"
FT                   /note="identified by similarity to SP:P22707; match to
FT                   protein family HMM PF05286"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12247"
FT                   /db_xref="GOA:B5RKR5"
FT                   /db_xref="InterPro:IPR016103"
FT                   /db_xref="InterPro:IPR021065"
FT                   /db_xref="InterPro:IPR036442"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKR5"
FT                   /protein_id="ACI12247.1"
FT                   /translation="MAEEKRPVLSLKRKPAEDSTAPAEATPVPGVVRRKKVVVVSSPPA
FT                   WKAKKAKLEKVKQAAEAAARNAAPAPVKAVKTPPPVRYLRLLPPEQAIMTLKAFWPQLF
FT                   DGNAPRLLATGMREQLFADIVNRDLPLSHKQVIKCLKSLTRSAGYLSRMKAGVSRYDLQ
FT                   GNAVATVTAEEAQYASERMMKELLRTERMRSQSAG"
FT   gene            86254..86601
FT                   /locus_tag="KPK_B0113"
FT   CDS_pept        86254..86601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0113"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12272"
FT                   /db_xref="GOA:B5RKR6"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKR6"
FT                   /protein_id="ACI12272.1"
FT                   /translation="MDFEARKQKALAIMASRKMWKSNYAPLLIRLLWRLGINIPPLPFA
FT                   PLWQVFVVMTGYFSLGYGLWMYWTVWRAQGMPLLFACEISLIAGVLFGLTMALFHLWRR
FT                   KVNKLPDWKDL"
FT   gene            86828..86953
FT                   /locus_tag="KPK_B0114"
FT   CDS_pept        86828..86953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0114"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12280"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKR7"
FT                   /protein_id="ACI12280.1"
FT                   /translation="MCVARVWADAKNDKPFGAVNGCFGTATSRGDVTLISAQFSI"
FT   gene            87073..87717
FT                   /locus_tag="KPK_B0115"
FT   CDS_pept        87073..87717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0115"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAA69586.1"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12209"
FT                   /db_xref="GOA:B5RKR8"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKR8"
FT                   /protein_id="ACI12209.1"
FT                   /translation="MFKYFILRKQQQLFCYFCGIVLAMVLMLLFPSVFRGSGFYLLLSS
FT                   VALFWAGLALYTRHIDRMRKPEVSPLVSIRDGNQVVAEVPRHEKARLEWEIFRDDEVFR
FT                   QQRWELTGLTGRVISRGLLYTPAVMLVGIGILAWGSPQDAIQLINALRNMPAAELVHQI
FT                   GFVLCLVLQISVISVLIADVVAGRGLPNVFRRALLNRLPAEFCLIRKGTER"
FT   gene            87773..88423
FT                   /locus_tag="KPK_B0116"
FT   CDS_pept        87773..88423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0116"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12221"
FT                   /db_xref="InterPro:IPR024402"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKR9"
FT                   /protein_id="ACI12221.1"
FT                   /translation="MAKILMMAGSTVVVLSLLGFLVLLLKGRAVTKTSPVLMSLKALGI
FT                   RPSEAEQRLCRQRVWVGNDTLMTPREQHFFRELLRHTSRNRWLLCPQVRVADIATLSSH
FT                   IRPRSRTWWQLFRMASQWHCDVVIVDIHTFAIVGAVELDDASHLKKHRIRRDILLEEVL
FT                   RQAGIPLLRDRDSERLVRRVGEFLKYRGADAAEKSITGMNSTTEHTERKENEK"
FT   gene            88420..88728
FT                   /locus_tag="KPK_B0117"
FT   CDS_pept        88420..88728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0117"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAD91808.1"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12254"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKS0"
FT                   /protein_id="ACI12254.1"
FT                   /translation="MIIAAEVKRDEQGYWTHPALARSGCETSAELSYWLRTHKLQCFVM
FT                   TMRDEAPEAFAAGFTDEAPDARGWIPEPPDDDGWFLGSVHDTGDGPVCYWFRHTTKS"
FT   gene            88905..89384
FT                   /locus_tag="KPK_B0118"
FT   CDS_pept        88905..89384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KPK_B0118"
FT                   /product="phospholipase D family protein"
FT                   /note="identified by similarity to PDB:1BYR_A"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12261"
FT                   /db_xref="GOA:B5RKS1"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKS1"
FT                   /protein_id="ACI12261.1"
FT                   /translation="MYAASIETGYSPEGTALQLVLKTIDSAQQEIRLMGYSFTSPEVAG
FT                   ALVRAKRRGVDVKVVLDWKANTGKQNQASLAAMNLLVNAGIPVRTVSQYKIMHDKVIIA
FT                   DGRNIEVGSFNYTRAADRVNSENVLVVWDVPVVAQRYLQHWQSRWNGGTDWHSSY"
FT   gene            89521..89772
FT                   /gene="repA2"
FT                   /locus_tag="KPK_B0119"
FT   CDS_pept        89521..89772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="repA2"
FT                   /locus_tag="KPK_B0119"
FT                   /product="replication regulatory protein RepA2"
FT                   /note="identified by similarity to SP:Q7BSX2"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12228"
FT                   /db_xref="GOA:B5RKS2"
FT                   /db_xref="InterPro:IPR019661"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKS2"
FT                   /protein_id="ACI12228.1"
FT                   /translation="MSQVVNGVTSSSKRPYRKGNPLSDADKQRSSVAKKRATHKEVKVF
FT                   LEPQLKDILMKMCHDDGLTQAEVLSRLIQREALARNIS"
FT   gene            90001..90072
FT                   /gene="tap"
FT                   /locus_tag="KPK_B0120"
FT   CDS_pept        90001..90072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tap"
FT                   /locus_tag="KPK_B0120"
FT                   /product="RepA leader peptide Tap"
FT                   /note="identified by match to protein family HMM TIGR03475"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12238"
FT                   /db_xref="InterPro:IPR012605"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKS3"
FT                   /protein_id="ACI12238.1"
FT                   /translation="MPRKVQDLLCSLLPCNISAGSGD"
FT   gene            90065..90922
FT                   /gene="repA"
FT                   /locus_tag="KPK_B0121"
FT   CDS_pept        90065..90922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="repA"
FT                   /locus_tag="KPK_B0121"
FT                   /product="replication initiation protein RepA"
FT                   /note="identified by similarity to SP:P03066; match to
FT                   protein family HMM PF02387; match to protein family HMM
FT                   TIGR03474"
FT                   /db_xref="EnsemblGenomes-Gn:KPK_B0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACI12232"
FT                   /db_xref="GOA:B5RKS4"
FT                   /db_xref="InterPro:IPR003446"
FT                   /db_xref="InterPro:IPR017837"
FT                   /db_xref="UniProtKB/TrEMBL:B5RKS4"
FT                   /protein_id="ACI12232.1"
FT                   /translation="MTDILQNHYSQVKNPNPVFTPREGKKTLPFCRKLMAKAGGFTSRF
FT                   DFSIHVAFLRSLGKRHRMPPLLRRRAIDALLQAMCFHYDPLANRVQRSITNMAIECGLA
FT                   TESRSGNLSVSRATRALKFLAELGLITYQTEYDPQIGCNIPTDITFTPALFSALDVSEV
FT                   AVVAARRSRVEWENLQRKKQKLKPLEMDELIAKAWRFVRERFRSYQAERKSHGRKRDTA
FT                   RRDASRQRHDIETRVRQQLTREYATGRFRGDKEALKREVERRVQERMLLSRGNNYTRLA
FT                   TVPI"
XX
SQ   Sequence 91096 BP; 22441 A; 22867 C; 23676 G; 22112 T; 0 other;
     ttatccacat ataactgcaa gggagtattt catatagcgc gaaccgatat ttttgtagag        60
     cgccagccgt cggactttca gggcgcatgg ttccttttaa acatcagctc tgtatctctt       120
     ttaaagatcc tttaataaat cctgtaaaca cataacctgt tcatcgcctg ccctgtggac       180
     aggctcagga gaatgcccgc ccttgcagcg acctgccggt cgcgccggtt cggcaacatc       240
     agagagagct cccatcgctt cgcgacgggc cccgaccgga gaaccacatt agttacagca       300
     ttcaaaagga aatccatcat aaaaccggcg ccggtctgcc ggccaggtgc ccctccccac       360
     cactgaaaag cgccgccgcc cccggccgaa ggccgggagt agtgtcgctt ttaatgatgg       420
     gtgttgtaac tattcttctt cgtcgctgtg ggtggagctg cggtcagttg tctggtacac       480
     gctcgtaagc ggccctacgg cccgctaacg cggagatacg ccccgactgc ggctaacgcc       540
     ttgtcgggac cactccgacc gcgtacagag acgtctgtga tgttttaagc gggtatggct       600
     tatcagggcg ggggaaggga ttggcagaac ctgtcaaaac agcagccggc tgcgccgggt       660
     aacggcgcca tttacccgcg gtactccatt caacttcagc tggcgcctcc atgccgctga       720
     cgcggcatcc ggaagtttcc catgctgtag actttaacgt ctgctttgtg ccaaaagcgg       780
     acctttcata cttcttggta tattcaggcg aataagcctt aatgcgatga aacaaatatc       840
     gacgcttgct gtacaggcgg aacggcgaag tatcgctgca tacgtttaat ctcctctgcg       900
     ggtggcagac caaacaggcg tttaaactcg cgattaaatt gcgacggact ttcataaccg       960
     acggcgtaac tcgctgcagc agcagttatt tgctgacgca ccatcaacat ccgcgcctgg      1020
     tgcaggcgta ccgatttaac atactgcatc ggcggcatcc gggttatcgc tttaaaatgg      1080
     ctgtgaaacg tcggcacact cattccggct tccatcgcca gttgcgtcag cgttaacggc      1140
     tcagcgtagg tagcatggat gcgctgtagc actttaccga ttttgccaaa ttgcccttgc      1200
     aaggtcagcg cggcgcgcat ggcatttccc tgtgcgcctg ttaatacgcg gaaatagagc      1260
     tcacgtaccc gtgcaggacc gaggatcgcc gcttcaagcg gattgttaag gacttcgagc      1320
     aagtgccgca cggccgtttt taccgcgtcg tccattgggc tcgacatcat gctttgcggc      1380
     gcggcgagag gatatcgggc gtcatgctgt tcaatctgca acatcagttc agcggccaaa      1440
     tgaaaatcca gatgcatata aatcgccagc aacggatgtt cagcggacgc gtcggtttcc      1500
     atcacaaacg gcaccggcac cgaaaccgcc aggtagtgct gttcatcata taaataggtc      1560
     tgctgaccaa aatagccgcg tttgctcccc tggcagacaa tcacgatccc cggatcgtaa      1620
     agcactggcg ttctggcaag tggacgatcg gcacgcaata ttcgcacatc aggcaatgcg      1680
     gtaaggttat atccctcctg caccgcaagt gctttaacta aggtaatcat cccgggcatc      1740
     acagcacctc ataaaatcag gcaagaaaaa tagaagatac ggcctaaaaa tgcggcagga      1800
     cgtagaatac catgcaacct tcattgttca tgggagttct tttatgacat ctgcaaaaac      1860
     gattttaatc accggcgtca gcagtggctt tggccgtgca ctggcgcagg aagccctcgc      1920
     cacaggccat cgggtcatcg gtaccgtgcg cagccgcgaa gcacagcacg atttcgaggc      1980
     gcttcattcg cagcgggctt tcggccgtct gctcgatatc acggactttg agcatattga      2040
     tgaggtggtt gcggagattg agtctaccgt cggtccggtt gatgtgctgg taaacaatgc      2100
     cggttacggt catgaaggca taatggaaga atcctcgctc gcagagatgc gccgccagtt      2160
     tgaagtcaat gtgtttggcg cagtggcaat gatcaaagcc atgctaccgg gcatgcgcca      2220
     gcgtcgtcat ggccatatta ttaatatcac ctcgatgggc agtttcatta ccctgcccgg      2280
     catcagctat tactgcggca gcaaatttgc gctggaagga atatcagaaa cgttaagtaa      2340
     agagctggct ccgttcaaca tacacgtaac cgccgtggca cctggctcgt ttcgcaccga      2400
     ctgggccgga cgatcgatgg tacgcagcgc tcgcagcatc ccggactacg acgctttatt      2460
     tgatccgatt cgtcaggcac gtgaagaaaa aagcggtaag caactcggcg atcccgttaa      2520
     ggccgcacat gccatgctgg caatgattga gagtcagaac cctccaacac atttattgtt      2580
     aggcagtgat gcattaagtt tagtgcggca aaagctcgag gcattaggta aggaaataga      2640
     acaatgggaa gaaataacac gttcaacgga tggctgatca gctgctgaga cagagagcat      2700
     actggataat ggattatggc tggtcgcaca agcgctcatt tcgctcgggc atcatgctga      2760
     tgcccttgca gttcagcctt tttactttca ggcttccagg cttgcggtga aatcaacttc      2820
     cgctcctcgc tcaaagctgc ctgtcaacgt gatcgatcgc tcttaactcg gcctggaagt      2880
     acaaaaaatg gccttaacgt acaataattt tcgatatcca aactgacccc tcacaggccc      2940
     aggatgcggt gaaaatgacg ccctccggaa gcgaacacat cacctcaggt tccggagaga      3000
     agcaaacaca tacagccgcg ctgcgtacat cgctgcagca ggaggacaga ctcctcaggg      3060
     ctgaagagca gggcataatc gaccagggct ccagaaccgc tatccatatc cgggaacagg      3120
     aggtacagcg agacatccgg gaactgcgct aacaacccgg gctctatggg gatactttat      3180
     ggtatgtggg aagggcccac tcaccagttt ctgatggtag ctaatcggga ccagtccgac      3240
     cgcgcacaga ggcgtctgtg gcgttttaag agggtatggc tttgcagcta ccgtgttaag      3300
     ttccctggtg ttgctgaaat aactgaagaa catcccccta agcgtcagca gcaagctgcc      3360
     gccgctaagg ccccggaaat cacgcccttt acgtcgtaaa cgccgtaaag cccgctcacc      3420
     ggggttaaaa gggattactt taacttcttc attgctgtaa gcgggttaag gctaatcagg      3480
     gcagggggga gggtggcaga atttatagcc aggtaaccgg ctacgccggg ctttcggcgc      3540
     catttgactc cacagataca tgcagcttca tctggcgcct ccatgccgct aacgcggcat      3600
     ccgatgctgt agtctttaat gtctgctttg tgccaaatat agtcattcac accctgagag      3660
     ttacactttt aagtgattca gggtatgcgc ttattggtta cgaatattgt gccagaatca      3720
     tgtaatttga tgattgccgc tttgctttcg agccagtaag tgctccacgt tcgctaacga      3780
     atactcaggg catgcagaaa aactgctgac tatatttctt tcgaagagcg tggaatgcat      3840
     accaatcccc gataaaaagg agttggtgat gactgcgaaa gatcagtttg ctgcttatgt      3900
     tggtttggac tgggcagata aaaaacacga tgtctgcgtt cagtttaaaa acggtgatcg      3960
     catatttcat gtgattgaac atacgcctga ggcacttgat atctggctca atgagttaca      4020
     ccagagggcg aaaggcagga ttgctattgc cgttgagctg aagaaaggcc cggtggtgta      4080
     tgcactccag aagtacccat ttgtcactgt ttttccagta cacgcgttgt cactggcccg      4140
     ctaccgacag gctttctggc ccagtggtgc gaaggatgat ccgcaggatg ctgagctggc      4200
     attagacctg atgctacgtt atccccacaa gataaaagcc attgaagccg acaatccgga      4260
     tatccgatta ctccagcaat tagttgagca gcgccgactg ctggtcgaag acaagcgtcg      4320
     ctttgttaat cggctcatca atacgcttaa gcagtattac ccccagcccc tggaatggtt      4380
     ctcccatcgg gacagctcac tgttctgcga gctaatcatt cgctggccga gtctgcaaca      4440
     actcaaacgg gctcgcagcg atactgtccg tcattttatg aatgctaaag gtggtcctgc      4500
     tgttgcatat accgaacagc gggttgcaag tattgccagc gctattcccc tggccacaga      4560
     taaaactgtc atcgaggcaa atgcattgat ggcaacagca cttgcatccc aaatcaaact      4620
     gacaggcgac ctagtcagaa cctacgatga acgtattgaa tccttattcg atacgcttcc      4680
     ggatgcagaa ctgttcaaat cactacctgg aatggggccg tgtatgggcc cacggatgct      4740
     tgcagcactg ggtgataacc gcaaccgctt caacagcgcc gaagaaattc aaaactacgc      4800
     tggcatcgca ccagtaaccg agcgaagtgg tcaaaaatct tgggtacact ggcgttggca      4860
     gtgtgccaag ttcgtccggc agacattcgt ggaatggact gcgaagacgg ttaactcatc      4920
     gtactgggcc agactttatt accagggcca gcgagaaaaa gggaaatctc atcagtcagc      4980
     gatccgggct ctggcattta aatggataag gatcatttac cgctgctgga agacccgaac      5040
     ccggtacgac gaagcgaaat atttgctggc actggaagcg cgaaagtcgc ccttactgaa      5100
     gccataaaaa gcttgtcgaa tgtctcaggg cgtgaagcgg acattactgc acaccgtaag      5160
     tagtcttatg tgtctgaaat gaaaccgcag cccgatagtt actttctctc ctgcccgtta      5220
     tttgaactga aatacgcaat gtcctaaata accaccataa tcgtcattta cgacatttct      5280
     ttctcactta tgattctctc atcgaatcaa tggtgatcga aaggagtctg caatgagtct      5340
     cgcaacacaa ccaggtaaag gcactgccgt aatcactggt gcatccaccg gcatcggtgc      5400
     tgtttacgcc agtcgactgg cgcgcatggg atacgacctg atcattatcg cccgtaatca      5460
     taacctcctg aatcagatgg ccagccacat tactgctgac accgcccgca atgtggaagt      5520
     ggtgacaacc gatctggggg atgctcaaca gcttgctgct ctggagaaaa aactgcgtgc      5580
     cgatgccagc attaccctgc tggtgaacaa tgccggtgtc ggaactcata cgccgttgtt      5640
     gtcgagcgat gtcgatcaaa tgcaggcgat gattaatctc aatgtcgtcg ccctgacccg      5700
     tctgacttac agcatggtcc ctggttttgt cgcgcgaggt gtgggtgcca tcatcaacat      5760
     ctcatcgatt gtcagccttg cgccggaact gcttaacggc gtgtacggcg gcacaaaagc      5820
     ctttgtgctg gcattcagtc agtcactgca ccatgaactc tccgaaaagg gcattcacat      5880
     tcaggccgtg ctgccgggtg cgacagcaac gccgttctgg gataacgggg gtttacccct      5940
     tgaacaactc gataagtcaa cagtgatgag cgcttacgac ctggtggatg cggcgctggc      6000
     gggttttctt aacggggaac ttgtcaccat cccgtcactg cataacgacg cttactggca      6060
     ggcgatggaa agtagtcgcc aggccatgat tccgcacctc tccagtaatg tacccgccgg      6120
     ccgttatcgc gccggattta ctcactaagc ttgtatttag ccaacaggaa taaccgtatg      6180
     aaactgacag gaaacactat ttttatcact ggcggcacgt cgggtattgg gcgcgcgatg      6240
     gcagaaaaat ttcatcaact gggtaatcag gtgatcattt caggtcgtcg taaagctctt      6300
     cttgacacgg ttacgtccgc caatccgggg atggattccg tggcactgga tgtcaccaat      6360
     gcatccagca ttaaatcggc ggcgaaagag gtgctctccc gctatccggc actgaatgtg      6420
     gtgatcaata acgctggtat tatgcccttc gataatgccg ctgctgaact ggatgacgat      6480
     atggctacca ccttactgaa taccaacctg ttgggcactg ttcgggtcag ttcagccttt      6540
     gttgagcacc tgaaacaaca accggatgca gtattgatca acaacagttc gattctggcc      6600
     tttttacccc tggtgacgaa tgcactctac tcagcaacca aagcggcgat tcattcttac      6660
     accctttcgc agcgtttttt actgcgcgat gtcggcgtga aggtcattga aatttcaccg      6720
     ccctgggtcg acaccgattt gatctacaaa agcggtgatt cccgcgcgat gccattagcc      6780
     gattttatcc agcagacctt tgacaaactg gcgacagatt ccattgaagc aattgttgac      6840
     agtgtgctgc cagcccgtgc gaatcagggt gttaatgaac acgagatggt gaacacgttt      6900
     aatcagtcaa tggtggataa cccgataccg gttgcctgac ctgctctggg gcaggcaact      6960
     gccccccttt ctggagttta tgatgcaaaa tcacctgtcc gcatttcaaa agcgtgcatt      7020
     atgggcgctt agcctggcct attttattca ggcgaccggt tcactttccg tagcgggtag      7080
     tctggtcccc atttcccagg aatggggcat cagcgatgcg caaagtgccc gcctgctctc      7140
     cattttcggt ctgacgtttg cactgggcgc gccactggca caggttatgt tcggcaagct      7200
     catgcgcaga acacaggtgc tggcaggcat gctggtattt gggctgggag ccctgatttt      7260
     tgccatcgct ccggactaca aagtactggt ggcttcgcgg attgtaatgg ggctgggtgc      7320
     ttcactgata gggccggtac tgattgcgct cggtgcagag ttagtcgccc ctgaggagcg      7380
     tggcagcgct attgccatga tcctgctggg tgtatctatg gccagtatgg tcggtattcc      7440
     gctggcggca tggctggcca tggttctggg cgcgcgtatg ttattcacgc ttatcgcgct      7500
     ggtgagtatc ctcactgcgg gtgccgtatt tttgctggta ccggacgttg tcaaaggtgt      7560
     tgatatccgc ttacgccagg tcggcatggt actcagggag ggcaaatcac tggcagcctt      7620
     tctggtcgtc ttttttatca cctccggtgt gtacgatatg tacgccttta tctcgccgat      7680
     gatccgcgat cactggcagg gtgatgcgtc ggctatctcc atcgcactgg ctgttatcgg      7740
     tgcagcgggt attgtgggga atctttttgt tgcccgtgca gcacgctact tcagcgcgga      7800
     acacttactg gttaccggtc tgacgttact ggtgacggat atgctgctcg tcatgctgct      7860
     gccggcccag ctgtcattgc tgtatttcct gctggtcgtc tgggcctttt ccactgacct      7920
     gctatggcct actcaacagc ggcgtattgt ggagatctcg acagcggaaa cacgtggaat      7980
     ttcgctggca ttaaccagcg cctttatgtt ctgcggcatt ggttttggat cggcggtagc      8040
     atcatggctt tatcccctgt cgggttttta cggtgtaatg ataagctcag taatgttcct      8100
     gctgctggca ttgaccagcc tgtggacttc tgagcggtta cgggcccgct ccgcgaaata      8160
     tcaggcggtc cgcctgtcat aaaggagttc caatgcaccg tataggatta atcattgccg      8220
     atcattttca gatgctggcg ctgtccacgc tgacggtatt tgagtttgcc aatctggtgg      8280
     ctgaacatcc gttttaccag ccggtggtct actccgaaca cggcggaacc gtacgttctt      8340
     cttcgggtat cggcgtggat tcgacgaagt tgactgagga aactctggtg gatacctggc      8400
     tggtagcagg tgtgctttca cccgttgagg atcccgccag ccccggagtg attcattttc      8460
     tgcaaaccac cgcccgtcag gctcgcagga ttgccggagt ctgtaccggt gcatttgtgc      8520
     tggcacaggc tggcctgctg gagcaaaaac gtgccaccac gcactgggca cactcgcaca      8580
     gtcttgcctc tcgacatccc acgattcagc ttgaagatga tcgtattttt attattgatg      8640
     acactatctg gacgtctgca ggcatgaccg ccggactgga tatggcgctc ggtatggtgg      8700
     agaaagatct cggtgcagac attgcccgta cggtcgcgca tcgcctggtg atgaatcagc      8760
     gccgttccgg cggtcagaca cagcattcgg aaatgcttgc cctggcaccc cgttcagatc      8820
     gtctgcaaac agcgctggaa tatgcccgcc acaatctgca caaaacgctg acggtggaaa      8880
     ttcttgccga tgcggtgcat gtcagcgctc gccagctcag ccgcctgttt cgtcaggaga      8940
     cgggcaaatc tccggcaaaa gccattgaag gactgcggct tgaggccgcg cgcttaatga      9000
     ttgagcaaag ccgcctgtca ctggatgcca ttgcccgcga gtccggtttt cgcgataggc      9060
     ggcatatgcg ggaggtgttt attcgcgggt atggcattcc acctcagtcg cttcgcgcag      9120
     ggcgttaata tacggcgtgg ttcactactc tacccacgtt tacggtgcag agcaggcgtt      9180
     atgccatagg tttttttgaa cgctttagaa aaagacgaca gagacaaaaa accacactgt      9240
     tcagccactc tctctgctgt caggtttttc tcttctgaaa gcagtcttgc cgctaacacc      9300
     atacgtaact ggttgagcca gacctggggc gtctgatgat agctgtgtga aaagtggcgg      9360
     gcgaaggtgg cgcgtgacag gaaacagcgt tgtgccatcg actccatcgt ccatggcaat      9420
     gcaggatcag cgatgacggc cagaacggca ggagcaagac gtttgtcgct cagtagccgt      9480
     aaaacacccg ctggaggctc gtgcagcgac agcaaaatac gcaggattag cgcgagcaac      9540
     gtatctgcca gccccttaac gatactcgca ctgcccggta aataccggca cgctgagcgg      9600
     cccggtggac agcgcgaatc cggtcataaa cccgacaatc gccccggcca aactcatgtg      9660
     ccagagattc aagtggaggt tcgatcgtct gatgagacgg cgcagcggga tcatcgcaag      9720
     gaagaaagct gccaggaata cctccactgt gccaggagaa atcgtaagta acgtgtgcgc      9780
     cccgagaaca gctgcaggaa ctcccgccaa cgaataggca aacaccggtc gccaacgaat      9840
     ctcatgccac cagacaatca cccgtccgat gttgccgaaa agggaagcga tcgccataac      9900
     aggcacagca atccgtggcc cgtacgtggc gacgaggacg ggcagcatga ttagcgacga      9960
     gccagtgccg acgacaccgc tgagtactcc ggcaccgaga gcgacgaaga agagaagtaa     10020
     gagtgcaatc atcggcttta agatcaacca gggccatcgc tcgcagccgc aagaagcggt     10080
     accaggatgt cgctgatcgg cgttggaatg ctgtgaaccc ggccgcgacg cgcaatgacg     10140
     ccgttgcgga tatcccattc aagcggtcgg ccagcttctc gatccgtgag gatggaggtg     10200
     ctcatgtctg caggagccgc ccggaactta tcgaggatct cctgcggcac ttcgtctccg     10260
     agttcagcgc cctctgcacg tgccacggcc aggcattcct gcagataagc cagcgtaagc     10320
     ctggctatat cagcacggcc aaacatgcct gagcggcggt gcgtgagtgc catgagtcca     10380
     gccaccgcat tctgcatcag cttgcgccag gccagggagc tgaaattcgc ggccagatct     10440
     acggagcacc acgtgccttg cagcgctgcg gccactacac gggaagctgg tgcgtctggc     10500
     acgctgaggc gcgcctcacc acgcaagcgt accgagccat cggactgcgc ttgcgcaggg     10560
     aaccacacga cagcgggaac gatctgtccg ggcagagagt acgtagcgag cctgtccaac     10620
     tgttcgaccc cgttctggag cacgcatata accgtctccg ggccagtcaa cgccctgagc     10680
     cattctgctg ccgcgtcgat ttgtgtggac ttgactgcca gaaagataag atcaaccgtg     10740
     cgagtgattt gtgccggatt cgtctgtacc ggaccgggta cggtgataaa gcggttgcca     10800
     tcttgcaagg tcaggcgatc gcggggagta cgtccacaca gcaatggtgt gcggctgact     10860
     tcgtgtaacg ccgccgcgac tgtggtgccg atggcacccg gaccaacaac agcgacaacc     10920
     gtattgattt cagtgttcat gaatgcggac tccttgcaac agaatctaat tacgtggtgg     10980
     ttgtgccctt cccaaaggac atgtaatata ttacatatga ataaagaaaa tggtaatata     11040
     atttcagaag gtgagcagcg gttacagcaa tggcttggca gcattcacgc ccgaagcggc     11100
     gacctcgctg caagtgaggc taaagttgtc gatctcctgc tagtcgatcc tttatttgtc     11160
     ggtacaagca cggcagcaca ggttgccacc cgtgctggtg tatcaccgcc gacagtaata     11220
     cgcgctgcac gagcgatcgg gttcaccggg ttcactgaac ttaagataga gattgcccgg     11280
     gctcgtggca ctgcccaatt ctttgccccg cctgaagttc ttacagcgga tgcgacgctg     11340
     gcatcagtgc tggaaacatc aattcgtgct ggtgtagacg cactgactgc gctcagcggt     11400
     gctatcgaaa tctccgcact tgatgaggcg gtcgatttaa tccggagcgc acgccaggta     11460
     tttgcatttg gtgctggtcc ctctgcgacg gttgccgctg atgcggtctt tcgtttgcgg     11520
     acggcgggtg tgataaccgt cagtatccag gattatttat cagcgatgat tgctgctcgt     11580
     ctactcggtc caggcgatgt catcatcgtc gtcagttcaa cagggcgcac atcatccaca     11640
     ctctccatcg ctgatgcagc atcctcggca ggagcatcgc ttattgcaat aactaaccag     11700
     tacgataccc cactggcgac actcgccaac gtttcgctcg ttgttggcgg aatgccactc     11760
     ccggcacaga tggccgctgc cgggagtcga ctggcccagc tcgtcgttat tgatacgctg     11820
     gtcgctgctc tcactctgcg ggataaagaa caaagtcgcc gggctgaacg ggcgggtatt     11880
     gatttgcccg atatgtcctg atgcagttca gcacggtagc aatgattctt actgctgcgg     11940
     tagctcatgc agtatggaat atagcctcaa aatacaagag ggaagacact cttgtgttcg     12000
     tctgggcgta cagctgtgcc tcagcattgc tgtgggtccc gttcagcctc attctgatag     12060
     ttgagggaaa acaggaactc gactggagac tcgctgtcgg cgcagttatc tcgtctgcac     12120
     ttcatatcgc ttattctcta atcttgcagg ctggctacga gcgcgccgaa ctgggtgttg     12180
     tttatccgat tgcccgagga agtggaccag ttctgacgat actgtttgca acccttctca     12240
     tgggagaacg gatttcacca ggcgctttac tcggcgcttt tatggttatc gctggtattt     12300
     tcgttgtcac cggcaatccg ttcaggagcg gaagccggcc actacaggga atgctttggg     12360
     gggcagcgac aggcaccgcc atcgctggct atacactctg ggacggttat tcggtaatct     12420
     ctatgcacct ggatccagtg cgctactacg ccagcacact cctgctacag agtctgattc     12480
     ttacccctgg tgcgatgcgg cgacgaaatc gcattccaac tgctgtacgt gtggatctca     12540
     tcccaatcct tatcattgct gtatgctctc cccttgccta catccttgta ctgacagcca     12600
     tgcagagcat gccactggca cttgtcgctc ctctcaggga aacatccatt attgtcggct     12660
     ctcttctttc gtactggctg tttcgtgaaa atcatctggc acgccggatt gccggtgcag     12720
     tggtagtgct agccggaatc gcagtgatta gtctttgatc gcttcgttgg atgccaatac     12780
     tatgagtgac aaagtctcag ggttgctatg ttccttaaag gcaacagcgc aggagaatat     12840
     accctcgcag gaaacacact aatccattga aaatgttgcc tggacgatgt gttgcaagag     12900
     acggatatgg aactagatat cgcaatagcg gcaccgtaat tcctcacagt gcttgcaaca     12960
     atgatacatt cgctagtcgt cgtctcattg tcagcgtgga tcgttcgtcg atatactctg     13020
     ttaatggtac aggtagcaag tctgattcat ctgtctgtgg ctgttagcgc cattgagata     13080
     agacggtata aacagctatc agtcttggca ttggcatccc gtaccaccat tatttaaatg     13140
     ttctatggac acacgctgtt attggaaggt taatcctaaa tagctgcgcc taataccgct     13200
     acacttttgc ctgaccatgt tttcctccgg ggaatgggct ggcggtttcc ataaaatggc     13260
     ggaccttttt cagtaactgc cacattgagc ggcactgatg attacgggtt atcgtgtcat     13320
     gaagtgcctg ccatagccgt tccacatgat tcacccacgg cgagtaaacc ggctggtaaa     13380
     ttaccctgaa cttgggattt gctttcaacc agcgctgtgt ttcgcggctt ttatggataa     13440
     tgtagttatc aacgatcagc gtgattgttt tcgcccgccg gtaagtggct ttcaggtgct     13500
     tcagcagagc gataaacagc gctgaacttt tgctgttgcc gcccacgtag ctgactttac     13560
     ccgtgccact gtgcagtgcg ccggccagat agtatttttc gttctgcccc ggcgtcacta     13620
     cccgtttctg ctgtccgcgc aactgccagt ccgcaccgat tttaggatta aggtggatat     13680
     ccacttcatc ttcataaaat accggatgct ctgcgctgca ttcatccagc gctttgcgga     13740
     ttaccgccat cttttcatct ttatgtgggt cacggatacg cagagttggc gcggccctgc     13800
     gccatacaag ccccgcagat ggcaaccagc ggcgaacggt tcctgcatgt aactggcaac     13860
     cggttatctc attgattttt attgccagta attcggtgct ccagcgtgaa cgttgataac     13920
     caaaatcgcc gggagaatgc tttatcagct cacgtaacag ggtgcagata tgttcaaaag     13980
     gccagcgtcg ggagcgccct gcgggtaagg atttcaagcc ttcaatacct gagtgcggct     14040
     ttgttgaata aatcgaactt ttgctgagtt gaaggatcag atcacgcatc ttcccgacaa     14100
     cgcagaccgt tccgtggcaa agcaaaagtt caaaatcacc aactggccca cctacaataa     14160
     agccctcatc aaccgtggct ccataacttt ctggctggat gatgaagcta ttcaggcctg     14220
     gtatgagtca gcaacacctt cttcacgagg cagacctcag cgctattctg accttgccat     14280
     cacgactgtg ctggtcatta aacgcgtatt caggctgacc ctgcgggctg cgcagggctt     14340
     tattgattcc attttttctc tgatgaacgt tccgctacgc tgcccggatt acagctgtgt     14400
     cagcaggcgg gcaaagtcgg ttaatgtcag tttcaaaacg cccacccggg gtgaaatcgc     14460
     acacctggta attgattcca ccgggctgaa ggtcttcggt gaaggcgagt ggaaagtcaa     14520
     aaagcatggc caggaacgcc gccgtatctg gcgtaagctg catctcgccg ttgacagtaa     14580
     aacacatgaa atcatctgcg ctgacctgtc gctgaacaac gttacggact cagaggcctt     14640
     ccccgggtta atccggcaaa cccaccggaa aatcaggtca gccgccgccg atggcgctta     14700
     cgatacccgg ctatgtcacg atgaactgcg gcgtaagaaa atcagcgcgc ttatccctcc     14760
     ccgaaaaggt gcgggttact ggcccggtga atatgcagac cgtaaccgtg cagtggctaa     14820
     tcagcgaatg accgggagta atgcgcggtg gaaatggaca acagattaca accgtcgctc     14880
     gatagcggaa acggcgatgt accgggtaaa acagctgttc gggggttcac tgacgctgcg     14940
     tgactacgat ggtcaggttg cggaggctat ggccctggta cgagcgctga acaaaatgac     15000
     gaaagcaggt atgcctgaaa gcgtgcgtat tgcctgaaaa cacaacccgc tacgggggag     15060
     acttacccga aatctgattt attcaacaaa gccgcatata gttcaagagc ttacaatctc     15120
     taagttctgc ataaatcctc aatagaaacc atacttttta ttatggtgtg atggatatac     15180
     tcgcagacag tccagccacc aattcaactc cctccggcaa tctgtcaata tgaatccgaa     15240
     ccgggatacg ctgcgcgagc cgcacccagc taaaggttgg ctcgacatta ggcaggccaa     15300
     gccccccggt ctcgtcattg ttatcatcta ttccgcgccc gatactctca acatgccccg     15360
     tgatcaccgg cttaaatccc atcagcgtaa tgtgtgcagt atttcccgtg cggatatgtt     15420
     gcaacttagt ctcttcaaaa tagccaacca cccaaaaact attggcatca atgatggaaa     15480
     gtttagtttc tcccgctgtg gcatagtcac cagggcgaag ccgcaaatgt gtgacatagc     15540
     ccgtaaccgg agagcgaaca atagcatgcg ataagttaag ctctgcaagg tccagcgcag     15600
     ccagtgcacc gtggtaatta gccgcagcga cgcttgctgc gctggctgtt tgttgtaaat     15660
     cctcgctgga aatcacccct ttaatctgag agcgtcgcct cgccgcatcc tggcgcatca     15720
     gcatttcatg acgtttcgcc tcaacatcag cctgggcgct gaccactgcc aacctcaacc     15780
     agtgcgggtc aatggaatag agcacatcgc cccgattaac ccactgatta tcgcggacgg     15840
     ccacattcag aaccggtcca gagacatccg gcgcaatctg gaccacatcc gcacgaaccc     15900
     gaccatcgcg ggtccaggga gtttgcacat aatgtttcca gagaataaaa gccaaaagcg     15960
     tagcaaccgc cacagcgctg agcgtcagca aatagcggcc cagtagagaa agtaacgatt     16020
     tcattttaaa aaccccagtt cggtcagtcc ctgcaacaac aggtaaaaag taataataaa     16080
     gatggaaaaa tcgatcatcg ggcgaaacgg caagcgacgg taacccttgc ttagcgagaa     16140
     aagctgcacg agtaatagcg tacaggtgag cgcgacgagg gaaattaaca gtagaccggg     16200
     tacaaaaacg ccctcaatat tgaaatcatt gatcatcggc atgctccatt tcctgagtgc     16260
     ttaatgcgca gtacagatca accagttgat taacatgatg ccgcgatagt tcatctgcta     16320
     cggacaggct acgctcagtc aggctgacaa tccgttcaag taaggtgtta atatccgtcg     16380
     agtgtgtaag acaagtgaga acctctttta tttctttgtc tgcatgcgca tcccatcggc     16440
     gtaatcgcat tacacacagg cctatacgca gggtgtgcaa aagatgattc aatgcctgtt     16500
     ctgatgactg tccgctgcgc ggcaaacgcg gtagtatcaa cgcagcccga tcgatcatca     16560
     ggttgatcca gagagtttca tcagtattca acacaccttt cacgctgcgg ttaatatcgc     16620
     gctggcataa tttaagcagg cgttttattg ccgcatctgc ctgcacagtc tgcagaaagc     16680
     ccatgctgaa taccgcaaag ccagttgcag aaaataatgc gatagaggta ttcaccgcca     16740
     cggcaaaatc cccgctgtaa tgagcaccca gctcgcacaa aataggcagc gtcagtgtga     16800
     tccccatcgc cataaaagta gtgggcggcc gtgcctggag cgatccggca agcagatata     16860
     ccggagctag aaccactacc agcacgataa aatcactgac ttgcggtagg agaacgaagc     16920
     tgtagatcag gcttatcaca actccccaga gggaaccaat gatgtatttc acaatatgcg     16980
     gggcaggcgt atcgaagctg ccaaacagtg tgcaacaaac gccaaggata gatactgccg     17040
     taccgccatc aggccatgcc gagaaaatcc acaccatgca gccgctcaaa atgatggtga     17100
     aagcgcccaa tgcggtgcgg gcagcagtaa gaggatcgcg gtggaataca taccctttca     17160
     cgttattcat ttctgagtgc gcaggcatct gattcgcgtg atgaatggca tccgaaagac     17220
     gatagcactg ctgcacgagg acaatggcct ctgtcaggta gcgcataaaa cttacatgca     17280
     gtgcttctac aaacgtcaac tcatgtacga catagcgctg cagtaatttt tcactgcgtt     17340
     ttttgagcgc ttccccctcg cttttaaatt ttccttcatc tttgcaggcc agccagacct     17400
     caacatcatc cattaaaatt tgcacatcga aaggtatctt cgctatcagc gctaaacggt     17460
     cacgtaactc acagttaaca atgactaatc gcgcaagcct gtcatgaagc ctttttctcg     17520
     cttgccggac cggtacagag aacgcaaaat cataagggat atgatggctg atgccctgca     17580
     ggaactgcaa tgccagtgcc atatgcagcg gcgaggaaac aggatcgggt ttgcctgtta     17640
     aagtctctgc gatacgctgt cgcgccgcga gcagcgtctg cgataattta ctgttgaact     17700
     gacctgagat gcgcgcgggc aatacatagc gatgaataag tgccgcgcag aagataccgg     17760
     tcatgatttc ctgtacccga gtgatagcga tgtcaaaaat cgcgccagga tcggatacag     17820
     cagggaagcc aatcagactc gcagtgtaac cagcaaggac aaaaccatag gcccggggcg     17880
     tacgttccag caaggacaga tagaggcaga atgtaatcca gcctgccagt atcacgctgc     17940
     aaaatacggg tgaattcacg aacgtgggta caattaatac cgtcatgcca gcgccaatta     18000
     ccgttcccac cagacgatac aaacttctgc ttagcgatgc tccgacggag gtttgggaaa     18060
     caatatatac ggtgataatt gcccaggaag gccgctccag gccaattgat aatgcaatat     18120
     agtatgcgag catcgcagcg gtaaaactct tcgccgaata gagcagagcg ttcgcatcat     18180
     tcagtagtga aggagaagcc ataccgcgaa gacgatggca tatcgtgtgt aaaaaaatga     18240
     aagtaactcg cgttaatttt ttcatgccgg aaattattac cggcttgcat atccacttaa     18300
     atactctatt ctgtcaaaaa atacctaaat gttgccaatc tatgttaccg ccactcgcca     18360
     atacactgtt tgatccagat gccatcccct gccccgcagt cgcgcgtcat ttggattttg     18420
     tcgattacgc ggccgaagta cctgtgcata cgcaccgcaa agggcaattg attattgccc     18480
     tctatggggc ggtcatttgt cgcgccgaaa atgatatctg gatcgtgccg cctgattgtg     18540
     ccgtctggat ccctggggga gtgccgcaca gcgccaaagc tacctggaat gcgcatctca     18600
     actatctttt tatcgagcct ggagccgccg cgctgccgga gcgatgctgc actctggcca     18660
     tttctggtct gatcaaagaa ctcgttgccc gtttaacccg cgagggcgtc ggatacccac     18720
     cagaaagcca tctcgccaga ctgaccagag taacacttga tgaattagcc accatgcctc     18780
     agcagaaact gagcctccct gtgtcgtcgc atcctaaaat ccgcgccatg gccgatgctc     18840
     tggtcagtca acctgatgac cgaagcacat tcaaaacatg ggcaaaaaga ctggcactta     18900
     gcgagcgttc tctcgcgcgt ttaatgctgc gcgaaaccgg gttgacgttc ggacgctggc     18960
     gtcagcaatt gcaactgata attgctctcc gggaactggc tagcggcgtt tcggtccaga     19020
     atgttgcagc taatctgggg tatgaatcgg ttaatgcgtt tatcaccatg ttcaaaaagg     19080
     caatgggcag tactcctgcg cactattttt ctgagcggaa aataagtaca catttatccg     19140
     atagttagcg ttatcacgtc attcattcaa cctcaagcga ctcaacatca cttaagctgg     19200
     ctgcatgaac gattctgcta atgtcaaacg ttgtgaaatt cattgaactg ctcaatctga     19260
     gtacatcggt tatgtgacac tgttataaga cgttaagaac agactggtgc cctctaatta     19320
     cttcctgact tatcagcgcg acgaacagcc tgcggtggct tgccataaat cttaatgaaa     19380
     gcccgccgca tccgttccgg gtcaccgaag cccaccgcgc cggcgatccg ctctataggc     19440
     tcggagcctg cctgcaaccg caccatggct gcttcactgc gcagacgttc caccgcccgg     19500
     gcaggagttt cacccgtttc acgacgaaag ttacgcccga actggcgagg actaagattg     19560
     acagcctccg caatcctttc gatcgatagc ggttcgtgaa ggtggtcgcg cataaagctt     19620
     aatgccatac gcatacggtc ggtttcagga tccatcaatg acattggaga gaactgcgac     19680
     tgaccgcctg atcggcgatg atagacaacg agctcactgg ctaccctgcg cgccacatcg     19740
     acgcccaggt cagtctctat taatgccagc gcaaggtcta taccggcagt caccccggcc     19800
     gatgtccaga tcccgctgtc ctcagtgaaa atccggtcag attcaacttt cacagcggga     19860
     tattcctgct gcaaccggtg agccatccgc cagtgagtgg ttgcccgcct gccgtcaagc     19920
     aatcccgctt ttgcaagaag gaatgctccg gtgcagacgc tggcgacacg tgcagtccgg     19980
     ccagcaagtg ctgcgaccac ctcagcctca ccgctatcga gcatggtgac agtatcaccg     20040
     ccgacgacaa tcagcgtgtc tgtctctgct gaggttgcga gggagctctc aaccggaaga     20100
     ccgccgcttc cgcacaccct tcccccggca cgcgacacag tgctgagctc atagaaagag     20160
     tgtccaagaa tacgcgtcac agattcaaat gcgccgaatg gcccggcaag gtcaagaatc     20220
     tggtgaccgg gataaatgta aaaaccgaca gtatgcatga tgacctattt taagggatct     20280
     atgtccttta cgcaattcag gcatcgcgcc atcattgagc cagttcgata accaaactca     20340
     acccacgagg cagcctaaaa tgactaccgt tgttatcccg ctctatgagg gcattacaca     20400
     cctcgatttt accggcccgc atcagatgtt aagtctcgtt ccggacgtac agataattgt     20460
     tgcatcactg gatggcttac ctgttaagtc acacggttta accttcggtg agttagcctg     20520
     tcttgaggcg atagagcatt gcgatatcct gtgtgtccct ggcggtgcag gttgtgtatc     20580
     ggcaatcgaa gacccgcgct ttgttactgt tatccaacga cttggcagcc acgcagaata     20640
     tctgacgtcc gtgtgcaccg gttcactcat cctggcagca gcaggcctgc tggagggacg     20700
     ccgtgctgcc tgccactggg cctggcgcga tatgcttacg ttatttggcg caatcgccga     20760
     tgacagacgc gtggtacgcg acggccatgt gatcaccggc gggggcgtca ctgcaggaat     20820
     cgattttgca ctcacgttga tctcggaatt acgagggaca gacatagcac agtccattca     20880
     gttaatactt gagtatgccc ctgaaccgcc cttcaacgca ggcctgcccg atacagctcc     20940
     atcatctgtc cgtcatttgg ttcttaacaa aatggcaaat acgctcacag aggctaagca     21000
     gcgtatcggc caggtggcgc aacaacatcc tgactcactc acaatttagg aaacattaca     21060
     agttcctgat taaccaaaac ttctttcttg aggagagggt atgagactta agggaaagac     21120
     cgcgctgata accggcggaa ccagtggcat tggacttgcc actgcacagc ttttcgtgcg     21180
     tgaaggtgca cgcgtcattg ttactggccg tgacaccagc aaattcgatg aagttcaaac     21240
     aatactaggt aaaaacgcag tcgttctttc tgctgatgtg ggttctgtcg aagacatgcg     21300
     cctgataagc catagaacca gagaaaccct tggcggactt gacatctttt ttgccaatgc     21360
     cggtatcgcg tatgccacgc cattggccac aaccgatgaa aaccactacg atgagattat     21420
     ggatatcaat gtgaaaggcg tattcttttc tatgcaggca atggctccga ttctgaataa     21480
     aggcgcctcg gtaattttaa ccacgtcttt tatcattcat gtcggcagac caggaatctc     21540
     acttctcgcc gcgtccaagg ctgctctgcg ttcgctggct cgcagctggt cccgcgaatt     21600
     actggatcgt cagattcggg tgaatgctat cagtccgggc agcatcgaca ccccgttgat     21660
     tagcaggcac cgaaccccgg agcagcttgc agactttaaa gatcagatgg cagatcagat     21720
     cccagtggga cggatgggtg aggcagcaga tattgctgcg gcggcacttt atcttgccag     21780
     cgatgattct gcgtatgttc tcggggcaga aatagtcgtc gatggcggaa tttctcagat     21840
     ctgatacaca agtcaggctg gaggtttgtc atccttagtc catttgtcgc aagggggaca     21900
     atcgtcccca tcgctgttag tttttcacgg tatagcggct gaagaatcgg atgacagccc     21960
     cggggagtag aataaaacta atctacatga tgttgtggca tcataatgtt gattcttttc     22020
     gttggtaccc gcttcattca atgcagcaat gctgggctga ccaggccacc cggtaaccta     22080
     atatattgcc tctactctat tcaggtcccc agcgccctcg cagcaggatt gaaatacgag     22140
     ggcagcgtga gatcggagag gagactggct tcgagtggaa cccaacccag tcgctcacgt     22200
     gtcagtttgc ttgatgcagg tacgtccgcc attgcaaaca ttgcaagcca gccaaattgg     22260
     gctgcggctt cctctttggg aatacttttc accggaatcc ccagcccctg accaatcgcc     22320
     ttagcaatat cccggaacgg aataccctca tcctgcaccg cgttgtagcg ctgaccgggc     22380
     tgcccgcgct ccagggcatc gcagaagagt cttgccgcat catggcgatg gacggcaggc     22440
     caacggtttt caccttcatc aatatagggg gcagtttgga tatcgaaaat tattgtacgt     22500
     taaggttatt ttttgacctt tcaactttag cagacctcag ccgacgaaac ttaccggagg     22560
     ccggtattct gttgcttttc cagatgtaat cgcctttcag attgatatgc tcccagccta     22620
     acggcgacaa atgtgacagc agttgctcgt tgatcttcac ccctttacgc ttcagggcat     22680
     cgaccgctct ttccatatag acggtattcc acagcgagat agccgctggc gggtttacgg     22740
     tgagcactga taagcgccag atcatgctca ctaaaatacg ccattcgcgt cagcgttaac     22800
     tcatcgtccg gtaatgccag taatgattct ctttccgaaa gagaaagaat ctgcctcctt     22860
     gccatatagt ttccctcata aattattcgg tacggtattt ttaacaaaaa tgcttatcgc     22920
     ataagggtac accctgacgc cataatcaaa acgtgatgga gcacgatgaa tgagataacc     22980
     tatatgctat agaataaata caataaccta aatgcgataa tatggtggaa aaatgttcat     23040
     cagagcttat ttgagggcat cgacggaaga tcagttcgcc gaccgggcaa aagagatgct     23100
     ggagcagttc gttcaggaac gagggcataa aatcgccagc tattaccggg agaatatcag     23160
     cgggacaaaa cttgaccgcc cggagctggg acgcttgctg acggacagtc accgtaatga     23220
     tattttgctg gtcgagcaga tagaccggct gacccgcctg agcaacagcg actggatgac     23280
     gctgaaaaag cagatcgaac aacacgaact gcggattgtc agccttgatg tccccacatc     23340
     atggcaggca ctatcagata aagacccttc gcaggctgat ccgataaccc gcgccgtgat     23400
     aagcgccatc aacaatatgt tgatcgacct gatggccgca atgtcgcata aggactggct     23460
     gagccgccgc cagcggcaaa agcagggaat tgaacgggcg catacactgg gtaaataccg     23520
     gggtaagcag gccgatcagg agcgacatca gaaagttctg tactatcgcc aggtcaagaa     23580
     actgagtatc cgtgaaactg cagatgcaac aggatacagc ccttcccaga tctgccgtat     23640
     ccaggcactg taccgacagc gtgctctttg acggccgcag ccagaatgcc agtaacaacg     23700
     atggcctggc ttaacggctc agtagaagcc tggcgcgttt ttgagaaatt tttagatcag     23760
     agcagggtaa tctgtcctcc aaagttctta ttcatgcgag agcgggatat gcgcggaatc     23820
     tgatagcatc acacaagcca tatggaagtt ttatatgaag aaaaatcaat ttgtcatacg     23880
     tgcctgcagt ccttcggatg ctgagcagct cacgaagtta gcattccttt cgaaggcgca     23940
     ctggggatac cctaaagagt ggctggattt ttggcaagac gacctcacga ttacacccga     24000
     gttgattgaa gattcaattg cctacatcgc cgaagctgaa cagcagataa ttgggttctg     24060
     ggtcagggct gcaattgatt ccggcgagcc tacctgcggg tggttatttg ttcacccgga     24120
     tcatatgggt aagggcgtcg ctcgtgcatt atggtccgaa gttaagaaag aggcagaagc     24180
     aagaggaatt aaaagattcg tgatcgaagc tgatcccaat gccgtgccat tttacctgtc     24240
     actgggagca gaaaaaatag gcgaaaaaga atcgactctt attgccggaa gatttttccc     24300
     tatcattctg ctgcctgtcg cataggatac gtttattaac gtggattgaa cctgcatagt     24360
     gcggacatca ggaatgttaa tctggtgcag cccccgacat ggcggataaa gtcatcaccg     24420
     cgcagtacaa ataccagcaa atttcaccct gcccagtgcg gcattggtgg tggctataat     24480
     cctgatgaac acgaagcaat taagttctgg aggactgtcc gaagatcctt cagggcttag     24540
     tggtcaactt ttagccttaa cgtacaataa ttttcgatat ccaaactgac ccctaagggc     24600
     actgttgcaa agatcgtcgc attgataaac ttagcctcca tttccaccag tcaccacgct     24660
     actcatgaac gtatttaaag gccggcattt tcagcaagac atcatcctct gggcagtacg     24720
     ctggtactgc aaatatggca tcagctatcg tgagctgcag gagatgctgg ccgaacgcag     24780
     cgtgaatgtt gatcacacca ccatttatcg ctgggttcag cgttatgcac ccgaaatgga     24840
     aaaacggctg cgctggtact ggcgtcaggc ttctgggttt agctcatggc atcttgatga     24900
     aacctacgtg aaggtgaacg gacgctgggc ttatctgtac cgcgccgtcg acagcagggg     24960
     ctgcaccatt gatttttacc tgtcttcacg tcgtaacacc aaagccgcat atcgctttat     25020
     gggtaaactt ctgaacaata cgaagcgctg gcaaattcca cggttgatca acacggataa     25080
     agccccgacc tatgggcgtg cgctggcgtt gctgaagcgc gaaggaaaat gtccgcagga     25140
     tgtggagcac cggcagataa agtaccggaa caacgtgatt gagtgtgacc acggcaaact     25200
     gaaacggata atcaatgcca cactgggatt caaatcgatg aagacagctt acgccacgat     25260
     taagggcatt gaagtgatgc gtgcgctgcg taaaggccag gctgaatcat tttactttgg     25320
     ccatcccctg ggcgaaatgc gtctggtgag ccgagtgttt gaaatttgat gtccttcagc     25380
     aacgccagag gcttcactat cacgatcttt gcaacagtgc cgtttatagt accgctgtct     25440
     ctccccttta ttattattga agagcgatca gaaaaccgta aatgccggat acaataactt     25500
     ccgtttccca aacggagacc tcattaccaa ccactctgat catgcttatg ttatttactc     25560
     tcgtagcaaa cgcagacagt aaaaatatga cactgactgc ttcaggaaag ggcgtccatc     25620
     accactacaa agggagcttg gctccctttc tcagcatcat attcttaact cactgactac     25680
     gctgtcgcta tgaggtaaga agcgcttttg cccgttcaag cacgttctct ttgctgaagc     25740
     caaaatgctc aaacagcact gcggcggggg ctgattcgcc gaaggtctgc atgccgataa     25800
     cctccccgtc gagtccagta taacgctgcc agaagccctc ggtactggct tctacggcca     25860
     ggcgcttacg aatgtgctgc ggtaaaaccg catccttata cgcctgttcc tgccggtcaa     25920
     aacgttcggt gcacggcatt gacacgacac gcacccggcg gccttcgcgg ttcagttcgc     25980
     cagcagcata caccgccagc tcgatttccg atcccgctga cagaataatc agttcaggct     26040
     ctccctccgg ctcaagcaaa atatagccgc cgcggcggac atcctttaat tgctgctcgc     26100
     tgcgcggctg ctgggcaaga ggttggcggg tcataatcag cgccgagggt ccatcagatc     26160
     gctcaatcgc ctgctgccag ccgatagccg cttctacctg atcgcacccg cgccacgttt     26220
     ccatattggg cgttaggcgt aatgaggcca gttgctcgac cggttgatga gtcgggccat     26280
     cttcgcccag cccgacagaa tcatgagtat aaacaaagat cgagtgcgct ttcattaagg     26340
     ccgccatgcg tacggcattg cgggcatatt ccataaacat caggaacgtg ccgccataag     26400
     gtagcaggcc tccgtgcagc gccatcccat tcattatcgc cgacatacca aattcgcgta     26460
     cgccatagga gagataattg cccgatggat tttgatcgga gaaatcgacc gacagctgat     26520
     ggcgggtcag attggaagga gacaggtctg ccgaaccgcc aaataactcc ggcaacgacc     26580
     gggcaaagta gctcagacat ttttggctga cctggcgggt ggccaagctg gctggatgag     26640
     cctgaaggtc tcttatccag gcattgacct cttcgtgcca gccctgaggc agctttcctt     26700
     ccatacggcg cgtaaattct ttcgccaact ctggataatc acgcgcataa gcagcaaatt     26760
     tttcgttcca ttctgcctct actttcgcgc cggtctgttt tgcatcccac gcccggtaga     26820
     tttcatctgg aatgacaaag ggttcgtatg gccagtgtaa ttctttacgc accagtgcaa     26880
     cttcatccgc acccagtgcc gacccatggc agtcatggct gttggcctta ttgggggaac     26940
     caaaaccaat aattgtctta cagcacagaa gggatggttt atccgtaacg gcgcgggctt     27000
     cggttaccgc tttattcacc gcctcggcgt tatgaccatc aatgccttcg atcacgtgcc     27060
     agccatatgc ccggaagcgg gcaggggtat catcggagaa ccaggcatcc acatgaccat     27120
     cgatcgatat tccattgtcg tcccatacgg cgatcagctt gccgagtttc aacgtaccgg     27180
     ccaggctaca ggcttcatga gagatcccct ccatcaggca accatccccc aggaatagcc     27240
     aggtgtgatg gtcaacgatc tccctgccgg gtttattgaa ctgagccgcc agcgtttttt     27300
     ccgcaatagc catgccgacc gcattcgcca cgccttgtcc taatgggccg gtagtggttt     27360
     caacgccggg ggtgtaacca tattccgggt ggccgggggt gcgggaatgt agctggcgga     27420
     aatttttcaa atcattgatg gtcaggtcat aacctgtcag atgcagcagt gagtattgca     27480
     gcatggaacc gtgcccgttt gactggacgt aacgatcgcg gttgaaccat cctgggttag     27540
     ccgggttgtg acgcagatgg cctcgccaaa ccacttcagc cacgtccgcc attcccatcg     27600
     gcgcgccggg atggcccgag tttgcttttt gaatggcatc gatgctcaga atacggatcg     27660
     cattagcgag ttgtttatgg tccatttttt tctcctgaca tttcacaata attaataacg     27720
     agaaataacc ttcagcactt ctgcgacatc gttagcgtta aacagagcgt ccagatccgt     27780
     ttcgctacag aacaattctg agagctgagt gatgagagcg atatgctggt gcgggtcacg     27840
     ggccgccagc aggaaatgca gctttactgg gtcagcctga tccgggaaat ttaccccgtt     27900
     tttaaccagc aggaatgcca ggccattttg attgacccca gtctcaggac gggcgtgcgg     27960
     catggcgata ccgggtgcca gcacatagta aggaccattg ctaaaggtgc tctcaataat     28020
     ggcctgcagg tagctttccc ggacggtgcc gtctgcaatc agtggggcga cagctaaggc     28080
     aatcgcgctc tgccagtcgc tgacgtcgtc aacgaccgcg attctttctt cagtaagtaa     28140
     ttctgtaatc attaacaccc cgtacagaca aattaaagat gtatagtcat ctttaggatg     28200
     ctcctcgacg tgtccagaca caagcgataa actcagcaac atgctcagtc aggttgggct     28260
     aaatgaagag ttgttaacca ggtcacaatt atcgtgatgg cggggaacag cctgaactgc     28320
     aaaataacct ttgaaaccag ctgacaagcg cgcaggcaga cagggatacc attgatggcc     28380
     gataacatta ctgagaagca acaagaggta attgactaca tctttaagaa aattaaggat     28440
     gatgagttgc tgcctggaga taagctcgac acggaaattg cgattgcaaa agcgttaaag     28500
     ctgaccagag ccacggtgag ggaagccacg cgaatcctta ttgaacagga aaggatctat     28560
     cgaattaaag ggtctggcct gtacatcggt tcgattggca agagcaacca ttccggtaaa     28620
     tttcatgcac tttcaccttt tgactatcag gcgcaaaaaa gcggtcataa aggggtaaga     28680
     aaggtgattt cagccagcat tatcaaggtg cctgatgctg caatggcaca agcgctgcgc     28740
     atcaaaaaca gcgattcagt ttacaaaata ctgcgcctga tgtgttttga tgatatcccc     28800
     gtctcgctgg agtacatcca tttcccggcg acgctgttta gctcaatgga gtttaaagag     28860
     ctggaaatct ccaagtattc ctacatcgag aggattaccg ggaagggggt acagcggcgt     28920
     gcgcaaaatg tccgcgcttt caatgctact gatgaagaga tgatcaggct gctgaacatc     28980
     caacctcatg atgcgatgat ggaactgtat gaggtggtat atctggatga cggcacgcct     29040
     tttgaggtca atatctcgat tgttaatact aacatcctgc atttaaaaca gatttctgag     29100
     cgttccgaat aaaaaatgag agccggtaaa tgctctcatt atcatcagat gtctgaacag     29160
     agggggccag gatcaggcat ggctacccag taagacttta agcttgccgt caaggctccc     29220
     tgaggtagct ttctggaacg catcggctgc ctcagccaga tcgtaaactt tcgggtaaac     29280
     aatctgttgc agtgcatcgg caatctcttt ttgcctgatg gccgtcgcgc ttttttcaag     29340
     atcgtcgctg ttatacatat ggctggaggt gatggtgatc tctgaagaca tgatctcatg     29400
     caggccaatg gtggaacctg aggtgtactg accaatgatc acgatatgct caggcttgcg     29460
     attagccgcc accaacgctt gcaacaccgg atagtagccc gtgcattcaa acgcaacagg     29520
     gcgcttgcgc aggttcacgg catccacttc ctcaatcgag gcatagacgg taaagcctag     29580
     gcgctgtaac agttcgattc gcttcgcgtc tttctctact accagcggat tggcatgatg     29640
     aatatgctta agtaccaaag cggtcattac gccgatagtt cctcctccgg tgacgatgac     29700
     cggcgtattg accagatcac ggtaatggac aagagaaacg gcgtgatagc ccacggcaaa     29760
     gggttcgatc attgccgcca gcttcatatc aatccgggcg tctaatttaa tcagttgctc     29820
     agtccccacg gccagcgatt cgcacatggt gccatccagc ctgaagccca tcaccttgcg     29880
     actgacccga cagatattcg gctgattatc caggcagtta aaacactcac cgcagccaac     29940
     cagtggatta atggctacct tatcacccac cttaaacttc ggtgatgagc cgttaatttc     30000
     cctgataatc ccgacagatt catggccctg aataaaattt gttggtggct ttaaggaagg     30060
     atgatgcccc agataaaaat gcatatctga accacaaatt ccactgtagg cgatatctac     30120
     cagcgcttgc ccgggggcgg ctactggtgc ggggagatca aaaatttcga tctctttgat     30180
     agcggtgatt tttacgcttt tcatgaccaa ctcctgcgtt taaacggccc tgaagggccg     30240
     ggataaccta ggcatttgac agggtatttt ctgaagtatc cagcgccagc tttttcatct     30300
     cttgcaatag ttcttcaaga cgaggatctc cgaggtaatt ttttatctcg ataatcggta     30360
     cgtccttgct catccgcacg cgttcggcaa gattctgatg cactaccacc aggtctgctt     30420
     catcagggat actctcgata gcaaaatgtt tgaccgtaat ctcatagggg aggcctaatt     30480
     tttgcagttt cttacggaag gtggtggcgc ccatagcgct ggaacccgcg ccggcatcac     30540
     aggcgaaggc aataaaccgt aagctactga ccggaaccgc tctttctttg tcgcggcttg     30600
     aggttgcctg aatttcttgt ttcgcgttgg cataggcttc gctcatccca gcggctttgg     30660
     tcgtttgcat gatctcctga gaggaagaga aactgtcgtt ttcctccgct gagcgatcaa     30720
     atttcagcac gatgctggca ccgataaagg tcacaatcgc tgccgatcca atgccgctga     30780
     gcgtggcgag gaatttaccc ggaggggtca gcgccataaa ggcaaaaata gagccagggg     30840
     tcgcaccggc caccagtccg gcatgcatca gcgagaagac ttcaatccct gcggcagagc     30900
     ctatcatcag gggaataatc attaacggct tcatataaac gtacgggaag tacatttcat     30960
     gaatgccgcc gaagatatgg atgatggtag cggccggggc ggattttttc gccatccctt     31020
     taccgaataa acagaatgcc agcagcagtc caaggccagg accagggctg gcaaacacca     31080
     tgaagaagat agagctgccg ttgaccgcgg catctttcat ccccagttgg tagaagattg     31140
     cctgatcgat ggcattattc aggaacagca ctctggttgg ttcgatcagt aaggccagcg     31200
     tcggcagata gcctgttttt aacaggctat caattgcata agcgataacg ttggtgatcg     31260
     ccagcataaa cgggccaata aattcataac ccagcagcgc cagcaccatg ccggcaaggc     31320
     ccatggcaaa gttctgcacc acgttttcca gccccgccgg aatgcgattc tcaagcagac     31380
     gatcgatata tttgctaacc agccctccca gcggccccat cgccattgcg ccaagcagca     31440
     tggggacatt cgtccctaca atcacaccca tggtgccaac ggtgccaatt actgcaccgc     31500
     gtttaccgcc caccatgtta cccccggtat agccaaccag catcggcagc atgtagcgga     31560
     tcattggttc gacaagagaa ccaaattctt tgtttggcag ccaaccggct ggaataaaca     31620
     gcgcggtgat aaacccccag gccatgaatg cgcctatatt ggggatgacc atagcggtga     31680
     gaaagccgcc gaagctttgc attctcgcgc gtagggatgt cttgttcata gtggttatcc     31740
     tgttatgttg tcatcaacac tgactcgtaa cctggtgtcg acgtgggtag ggtcgcggca     31800
     tgttatctgt tcagagtaag attttgttaa taagactgta caagataaag atgtctagtc     31860
     atctttgatg atacgcttta cctaagggct ttcaatagca atctaaactc ttcgggcgct     31920
     tttttctgaa gatgccggaa tggtcacatt ttacgttttt ctctgaaaac gagtttgacg     31980
     acggggaatc ggctgacggt gaccactaag aaagtgtgtc gtccgtcgct gctgcagaga     32040
     cgggggctga ttatgctggc agccctcgat acgaaatgcc cgggccggtg gccacgcggg     32100
     atattgaacg gtggttactg gagcagtgtg gggacacctc ggtatacgtc accaaactgc     32160
     gcgcctcctg ccgtcgtatt ggcagccccc tgagcgctcc gaacctgcag ctggttgtcg     32220
     agctgacgga cactgatagg aaccataaat gcgttcaccg aatttactgc ctgctgaaac     32280
     tgaattttcg tctggagggg taggtagcat tcataaccgc tccagaggag atggatgcac     32340
     ggcatctcta tgttgccatg acgcgcggct aagcaaagct ggtcatttgt tcgacatcac     32400
     cagtgattac gccgagttaa ttagctgttc caataaatta tagtgttaac taatagagat     32460
     gttttctttg aaaacctctt cagaaatctg gttttttatt ctaccaattg cgctaatttt     32520
     gcccattaaa cgaaaagcct gcttattaag ttcatctgaa attgtcatga actccagttc     32580
     atgttctggg aaatcgatga taatttcgtc aaatacctct ttctcaccaa ttacttgagc     32640
     aagttcggtt tcatatctga ttctgtgacg gttcagtttc attgcatagc tgttttttaa     32700
     aacctcatcg gtattactcg ctttcagttc attatttagg ctttctgtct gagactttag     32760
     aaacgatgca gaaccccaca tctcagaagc aatttcaagg aattggttag ttaatgtgta     32820
     ttcaaattgg ttgatacttt tcatcttttt tctgacgagt aagccttttt tggtcatctt     32880
     ctggaattgg tgatatacaa aagttctagc attaccggca ttttttttga ctaaaaattc     32940
     accgacaaca atagatgcaa tttcattaac tgtgaagcta tctctatctg cctttttgat     33000
     cgcagcataa atataagctt cagcattggc taccctgacc tgcccccagt attagataca     33060
     accttcagtt agtaatgtcg gttgattttt cttcatgctt cccgtttcgc cagcctgctg     33120
     caaattcaga tggcgtctgg taattcagcg atgaatgagg tcgacactcg ttataatcct     33180
     gccgccagtc attaatgatt ttccgggcat gaagaacatc gctgaaccag tgctcattca     33240
     ggcattcatc ccgaaagcga ccgttgaaac tctcaataaa tccgttctga gttggcttgc     33300
     ccggctggat taagcgcaac tcaacactat gttcaaaggc ccattgatcc agcgcgcggc     33360
     aggtaaattc cgggccctga tcggttctta tcgtctcagg atatccacga aacagcgcaa     33420
     tgctgtccag aatacgcgcg acctgaatac ctgaaatccc gaaagcggcg gtgatcgtca     33480
     gacactcctt cgtgaaatca tccacacagg tcaggcactt aatccggcgg ccgctggcaa     33540
     gagcatccat gacaaaatcc atcgaccatg tcaggttcgg cgcatccggg cgaagaagcg     33600
     gaagccgttc agtcgccaga cccttacggc ggcgcctgcg ttttacaccc agaccgttaa     33660
     ggtgatagat gcggtaaacg cgcttgtggt tgacgtgaag gccctcccgg cgcaataact     33720
     gccagatgcg ccggtaacca aaccggcggc gttcaagtgc cagctctgtg atgcgtagag     33780
     acagttgtgc gtcagcagcc ggacgctgag ccgaataacg gcaggttgaa agtgacagac     33840
     cagccagcct gcaggcacgg cgttgcgaca gacccgttgt ctcacacatg acttccacgg     33900
     cttcccgctt ctggtctgtc gtcaaaactt tcggcccagg gccacctgaa gcgcctcctt     33960
     atccagcatg gcttcagcga gtagcttctt gagacgagcg ttctcctctt caagtgactt     34020
     gagccgcttc acttcgggga cttccatgcc accgaacttc ttacgccagg tgtagaaggt     34080
     ggcgtctgaa atggcatgct tgcggcagag ttcccgggcc gaaaccccgg cttcagcctc     34140
     gcggagaata ctgatgatct gttcgtcgga aaatcgcttc ttcatgggga tgtcctcatg     34200
     tggcttatga agacattact aacatcgcgg tgtattaatc aacggggagc aggtcaaccc     34260
     gagtattcat aacgatatgg ttctgtaaac atgaatgccc attttccaga taatgaaata     34320
     ggctgtcagt tcatcaatgg cgatcagtgg attgtggttt gaggaataga aactgaagca     34380
     aaacgtcacg ccatgtttct ggtaccagaa ttcatagaaa aacttgatcg cttgaagtga     34440
     agcggattgg gtagctgctg tacgcaaagc caggtggtct acaagatatt gtaacgggta     34500
     caaaagcggc aggcatgtat gagtatccat caggacccat aggcgctgcc gttggttgac     34560
     attgaactgt gcgagtacga acatgcggta tttatactta caaatagtaa gcgtatgaat     34620
     aaaataaccg gcaaacataa cgcgtagcaa ggagaagatg aagtgtaggg taagtgtatg     34680
     attgatcgtg gtctgcaggt ggttatgaac taaagggatg gtggacaaga tttaacataa     34740
     aacgcattaa gcgtagttgc actgtagtag caaagttgta atgtccgcct tgggctaagt     34800
     taagatgtcc gtcatgtata atcaacaaga agatcaccat gacggctcat gcagcggagt     34860
     tttttacatt ggatgaagtt aaccgactca aaatcattca ggatgttgtt gatcgccgtc     34920
     tgacaactca aatggcagct cagcgactgg gcatctcgga tcgccagtgc agacgccttc     34980
     tgtcgcgtta ccgtgaatct ggcccacttg gtatggctaa tcgtcgtcgc gggaaaccca     35040
     gcaataatca tttgcctgat ggtcttgccc ggtatgcact cagtattata catgagcgct     35100
     atacagactt tgggccgact ctggcgtgtg aaaagcttgc agaactgcac gatgtctacc     35160
     tgtccaaaga gactgtccgg tcgctcatgg ttaaagccgg tctctgggtc cctcgtaagc     35220
     aacgtgcgcc aaaaattcag cagccacgct atcgccgggc ctgttgtggc gaactgatac     35280
     agatagatgg ctgtgaccac cattggttcg agaaccgtgc tccagcctgt accgtgctgg     35340
     tttacgttga tgatgcaacg agccgactga tgcagctccg ctttgtaaaa tcggaatcaa     35400
     cattcaccta ttttgaggcc acacgaggct acctggaaaa acatggtaaa ccgctggcgt     35460
     tatacagcga caaagccagt gtattcagaa taaacaacaa aaatgccact ggtggcgatg     35520
     gctttaccca gtttgggcgt gcgatgcatg aactgaatat ccagactatc tgcacgaata     35580
     ccagctctgc caaaggccgc gtggaacgcg ctcatctgac gcttcaggac cgactggtaa     35640
     aagaactccg gcttagggga atttcttctg ttgacgcagc caatgagtat gctgatgagt     35700
     ttatggatga ttataaccgg cgctttgcca aagctcccct acatgacttt gatgtgcatc     35760
     ggccacttga acataatgat gatctggctg cctttttcac atggcgggaa ccgcgccgcg     35820
     tttcgaaatc tctgacggtt cagtatgaca aagtgctcta tcttattgaa gacagtgaaa     35880
     taagtcgcaa agcaatcggg aaatatatag aggtctggca ctatccggat ggcctaaaag     35940
     aactcaggct taacggcgta gctcttccct actccactta tgatcgcctg tcggaaatcg     36000
     accagggagc tatcgtggac aacaagcggc tcggacgtac actggaatat atcaaactgg     36060
     ttcaggacaa acgcgacaat aaccgttctc aggcaatacc tgctggcgat gggccttcac     36120
     ggcggcgcag gaaaccaact gataagaaat cccagcgatc actgaacggc gacgatatgc     36180
     tggaagcttt gaaagtttta cagagtcgtt ccgatgaaat attcggttct aatactcaaa     36240
     aaacataggg catgatatag aaaaagacat gggctgtagt ttatttaagg gttagctcag     36300
     atgccccgca tcaataagcg ccatacgaag atgttttcga atgaaatctg ctttataaat     36360
     gctgtatcgg tgggtatcat tttcacataa aagcaccgct ttttttttca ttaaagcgta     36420
     ctgatttgct atatcattgt ttttaatcag ataatcacga aatgccagat gttttattat     36480
     ttgagcatcc ccagtggtaa aagcatgaat gtgatgactg cgctgatctc caccttttgt     36540
     gaagtaccta cgatttgaaa tgccattttc accacgcaca gtatatccgg cacgctccat     36600
     tgcctgattc agtctgtcca gttcctcaag attagtaact tcgattaata tatctatcac     36660
     tggtttagct gatagtcctg gcacagaggt gctaccaata tggtgaatct gggatatcac     36720
     tttaccaagc gccatctgca atagataacg ttcgttctca aataatgtag gccacatctc     36780
     atcataatca acaacagtca acattcgcat attcaacaat cacacctttt aaggtaattt     36840
     gagcattcac aataacataa atcggatctg ctggcttgaa gacaatatct gtcttcataa     36900
     cgttttagga catttctact ttgctgacat gcggacatct gaacttagct ttgacatgca     36960
     ctgtagtagc taaattgaga tgtccgtctc ggggctgcgg atgttttcct gggctgttat     37020
     gggttgcgct ctgttccaga aaagttatga ttaagtatca gtcatagaaa ctacaggaaa     37080
     ggatatgcaa ggtaaggggc tatttaaata tactttaata tcattatcat taggaatagt     37140
     ccccatgata ttaatttttt ttatttattt caggaatgaa gactcatata taatttcata     37200
     tctttttgat atcgccaatg gatatcaaag ggacttttca gaacaatatt taacagtgag     37260
     cactatagct tccgcatata ctaaaaccgc accacttttc gtcatgttaa tgtatatgat     37320
     ttgctggaac aagtttgata taaaaaccat caaactagat ttgaagcaat ggtttaaact     37380
     tctgcctggt ctgctccttt taacgacagg ggcatattat ttaacttatg taggtgtgga     37440
     aaatatgtcg gatagtattt atcgcaccaa aagagttatt gctggcaatg agtactttct     37500
     atttatttat tacatccttt tatttctgac aaattatttt tttatatggt tattttttat     37560
     ttacctctat atgttaaaag gtctacctta ctttcaaaag cggtgataac ctccgcttta     37620
     cactaaacat aaatatttat ttaaacaaac taagtactga attattcagt gctttggctt     37680
     tatcagcatc gatataagat gtaagtcttc gtcaccgcgc tcaaagggta tactgccgat     37740
     cgcggtcata aatattggct ggccatcttt gcagtgtagg aagtagggtt gttttttatc     37800
     tccttccttc ttccactcga accagccgtc agcaaaacaa agcgcccggc catgctgcca     37860
     taacggttta aacattctgc tcgatgcggc tgtttccacc ctggcattaa tcaacggcgc     37920
     tttatcccac cacccaggcg cataccccca gtgaaccgga tcgaggtgca gctgttcatc     37980
     acgttcgctc agcagtaaca ccttggttcc tggggcgacg ttgtagcgac cgattggtgc     38040
     cggatcataa gcaatattcc gatcagcttc attggcaatc agtgacaggt aatcttcgcg     38100
     ggtcatcgcc tgggaaaaac gtccacacat acacaccacc tctggccaga cttaaagtat     38160
     agataatgcc gcgtcagcgg catggaggcg cctgcagcag ttgaatggag tactgcgtgc     38220
     aaatggcgcc gtcgcccggc gcagccggct gctgttttga caggttctgc ctcaccgcct     38280
     ccccttccct taaggccgga atcgttttta atgatgaagg cctgaaacaa gtactgtcaa     38340
     cctgactgta ccaggctggc actaaactca aaataacgct cgctgcagta agtgagcgca     38400
     gtctgctatg agcgaggagc ggacgttcgc ggtagcgcaa caaagatgaa tatttgaatc     38460
     agatagttca tattaaacgg aaataggtta cttcctctaa acgtatcaga gtaacaaagg     38520
     ctgaaaatgg caaagcttga agaattaaaa aacatttatc ccggtgcact ggcatggaaa     38580
     tttggcgaca gcccagaact tgctgacgaa ctcgtacaac tggttttgag tgggagtaaa     38640
     acagcgacat gctcttcgat agcatctttt caccatgaac atgaacgagg cgaagctccc     38700
     tgcgttggaa gttataatat cattcttaac ggagccgggc agccaatgtg cgtgatcaga     38760
     actctcagga tgcaagttat ccgcttcaat gaaatgacga gtgaacttgc cagtaaggaa     38820
     ggtgaaggtg atttaagtct ggagtattgg aatgaaggtc ataagcgtta ttttgagcgt     38880
     gaaggcactt attctgaaga aatggaactt atatttgagg aatttgaact tacagagatt     38940
     ttgtaactgt cagctactgg cacaaagcag acattaaaga ctacagcatc ggatgccgcg     39000
     ttagcggcat ggaggcgcca gatgaagctg catgtatctg tggagtcaaa tggcgccgaa     39060
     agcccggcgt agccggttac ctggctataa attctgccac cctcccccct gccctgatta     39120
     gccttaaccc gcttacagca atgaagaagt taaagtaatc ccttttaacc ccggtgagcg     39180
     ggctttacgg cgtttacgac gtaaagggcg tgatttccgg ggccttagcg gcggcagctt     39240
     gctgctgacg cttaggggga tgttcttcag ttatttcagc aacaccaggg aacttaacac     39300
     ggtagcttgt atctaacagt ttgtggtgat tagctaccac cactacagca gagtgagccg     39360
     ctcccttcgc ttaatggact gaccccgctc tggtagacga tcctgcccta tagtttggag     39420
     tgcccccgag cccgtagaca aatctgccct atagtttgag cataggagga gagtatgggc     39480
     acaccacgat ttacccctga atttaaggaa gaagccgtcc gtcaaataac ggaacgcggt     39540
     tataccgtcg ccgaagtatc tgactgtctg ggcgtctctg gacacagcct ctacaagtgg     39600
     ctacgggcta tcaaacctga taacagcgtg cagcatcccc gaatttgaag ctgatgacgg     39660
     tagcattgta ccgacttaca agagtcttat ggcctactca gaatcataag agcacggcgt     39720
     gcttcagctg taagaccaag cactacagaa gctactcatt ggatgaagga cgtcgatgtc     39780
     taccattaat aggtgttctc atctacatgt gaaggctgta ccttgataat attaattatc     39840
     attcacgata ttggtgttgt catgaaaacg ggatttatca gtacgatctt cctgtgcggt     39900
     atgcttctgg ggtgttccag ccccgctaaa aacccgcatc caaagctgct atattcgcca     39960
     acccctgcat atccgtatta cgcactggct aacaggattg aaggatatgt gacggttaga     40020
     tacaacctag gtgctgacgg gaagatatca aaggtttgga tcctaaaatc agaacctcaa     40080
     cacctcttcg actctgcagt cattgcggca atggcacaat ggcgttatga aaccaataaa     40140
     ccgagtcaag ccttaacaaa aacaatatat tttaaactcc aggctccgtc caactaaatt     40200
     ttacatggaa aataggagtt tatgtactgg gagtcagaaa gactacttta cagaccagta     40260
     attatgtccg acgtggaagc gctgtttcgc atatatggtg acgaaagaac gcacgcgttt     40320
     aacccacgtg ggccacaccg ggacatcgag caaagtcgca gtgttatcct gcagcgaact     40380
     gcagatcgtg agctatacgg gtttgacgac tgggctgtct ctgaaaagac ggctccagaa     40440
     cgaatcattg gatttggagg cgtatttgtc agccatttca atggccgaca aacgaataat     40500
     ctgggctacc ggtttgaacc agaatcatgg gggaaaggtt atgcaactga actttcctgt     40560
     cgagctttga tatatggatt tgacgagcta aaactgcctg aaattgtcgg agtgacacgc     40620
     gaaaatcata tcgcctcccg ccgcgttctt gaaaaagcag gtttgctgtt tacccaaagg     40680
     gtggacaatc cggaggaccc cccggctaac ctgatgttca ctctgactat agagcaatgg     40740
     aagaggttaa aacgacaggc ttgaggcatg gttacagctt ttgactactt aatgttatgt     40800
     ccgctaattg ccttctgctc tggagtgtag ttaatgcgag ttcttcgttt cattgcaacg     40860
     tcccccttga ttaaggatag cgttgcatcg acccattgaa ctcacaaggc atacctgatg     40920
     atggatggta tcaatcagct catgaaagca ctggcggaag agggttatgc accacggtaa     40980
     ggatggttgt tcgtcgtcag aatccctcta ttatagagtt ctgtactgcc tgacgaagac     41040
     aaaggaaatc agatgatgca agtagctgat atttttgatt tattcattaa acttacgcca     41100
     tcgggactgg cattactggt gtgggcgtat ggggtttata atcagttttc actgaagaaa     41160
     ctggaagcca tgcagttgca gaaaaggtgg cctgagctgc ctgacggttt aaccatacag     41220
     gacaaaaaag aagcactcca cgcgatgatt tctgcggagg aaaggaaaac cagagcatcg     41280
     ttaaaatggc gattttcttt actgccatcg ccattttctg gacagtttat ctctgagaaa     41340
     taaagacagg ccctgtcgcg ctgacagggc ctgttttttc agacgtgaat accacgcaac     41400
     gtatcaatca gtgcaggctc acgctcgatg aggcagagca ttttcagcgc tatacccgac     41460
     ggaatacgcc gttgctgttc ccagctgcgg acaaggtcaa cgctggcacc caccacttct     41520
     gcaaattcag cctgtttcat gccggcatgt ttacgaatgg ctttcacatc cggcagtgta     41580
     tggcggtgaa cctgttctgc agcgggctgg atctggccat tttcaatggc caccatttcc     41640
     tccatgctgc tgatcagggc atcaaaaagt ttcttttcca taaatttttc ctcgttatgg     41700
     agaggcctgc caccatttga gtggcgccat tacttcagct gctgtgttaa tgccttcata     41760
     acggcttttt ctttctcgct gagatcatct ttcgcattct tcgggtatat cagcagcaga     41820
     tacagtctgc cgctggcaag acgaacgtag taaatcaccc tgaccccacc tcgcttaccc     41880
     atccccgggc gcccccagcg aatcttcctg catccaccgg tatgactgat tgtgtcaccc     41940
     cgatcatggg cttccagtaa ataggtctgc agttcgcgga attcatcatc atccatgagc     42000
     tccttacgca gtccactgaa agcgctggtt tcaacaaact ccagatagtt catccctctg     42060
     gctcctttag ctttctggtg ccaataatac tggtaccacg tactaaaatc aatcttttta     42120
     gtaccctgta ctaaaatcga ggttaccagg gttacacgat gctggttttt atgtttctct     42180
     gggcaaccct ccccgctggg agccgccggc ccacgaaatc agatatctcg gtgcgcgcct     42240
     gctacggcgg gacgttctgc tgggtgatga acttcgtgag gcgaacagac tagaaaaata     42300
     cctgtccaca gacacacctg cagagattat tagttcctgc atgcatatgg cgcagcagct     42360
     gcgcgaggag ataagtaata tcgagcggca gattaaagcg catatcaaag ccagccctgc     42420
     actgaggcgt gataatacac tgctgacctc aattaaatct gttggtcccc agctggggat     42480
     gcatatgctg gtcgtgcttc gcagtcatga ctttgcatca gcagaacagg ctgccgcatt     42540
     tctgggcgtg gtgccgatcg agaaacgctc aggcacatcg gttcgtagcc ggcccggatg     42600
     tcgaaaatcg atccacctca gttgagagcg aagctttaca tgtctgcact gtgcggaaaa     42660
     atctacaata agcgaagcgt aatattacga cgagatgtgc ctgcggggta aacctaaaat     42720
     ggtggccatt ggcgcgctga tgcggaaact ggtgcactgg tgttatggcg tcctgaagac     42780
     cgggatcgtt tttaatgacg aaggcctgaa acaagtactg tcaatctgac tgtaccaggc     42840
     tggcattaaa ctcaaagtaa cgctcacagc agtaagtgag tgtagtccgc tatgagcgaa     42900
     tagctgacat tcagcttccg cttatgagta gaataatggc tttagagaaa tgaggaatct     42960
     gaactttata taaaatcctt taactcctca gcattaatgt tcgccagcat tgaagctttc     43020
     aagtttgggg atgatgcgag atacctcgag atcaggttga atcctgcggt atatcctagc     43080
     cacctgggca aatctcctgt tccgaaaaac caggcattat ggtcgtaatc agtgcgatgc     43140
     cagttttcaa gcatttgtgg atagtagggc tgaatagtat cggattggag gctttcccaa     43200
     ggctcaggtt caccaccaaa aagctcaata gaaaaatgcc cggcaagccc ttctgagact     43260
     aacacctctc ccaacgttga gccatatccc ggccctgtcc acctaactgc atggtgcagt     43320
     tcatgcacaa acattcgttc aatagagtgc gcatcatttt tgcaaaatgc agaattttca     43380
     ggatcaacag ttatatagat aacgccagct tcagggcaaa aaccaagatg ccctttttcc     43440
     gggatgacaa acttcccagc tttaaccacc acatccagtg aatgaatcgg cattaacctt     43500
     ttggcttgtt cgtaggtatc agtcaggttt atttgaagcc attcacagtg agcggtgagt     43560
     ttcttctgcg cattcagaat gtggagattc atttgagaca ttacggtacc acgccaaaag     43620
     cgtcactaaa tcgccacaca ttaacacaca aagcgaatgt catggtgttg ctcaacagtt     43680
     gagggccaaa ccattaacag caatgtccgc atttggcaca aagcagacat taaagactac     43740
     agcatcggat gccgcgttag cggcatggag gcgccagatg aagctgcatg tatctgtgga     43800
     gtcaaatggc gccgaaagcc cggcgtagcc ggttacctgg ctataaattc tgccaccctc     43860
     ccccctgccc ttgtatctaa cagtttgtgg tgattagcta ccaccactga agcagagtga     43920
     gccgccccct tcccttaagg tcagaaaagt ctgcaccgct gaaccttgtt tagcagcata     43980
     tggccctccg cttcaccttt cacgccagca catcaggttg aacggttacc gggagctcga     44040
     ctccgtatgt acaaggcgaa caggcgtgac ggtttatgtg agaggagttt aaccatgttt     44100
     ccattcggca ttgacgtgag taaaaacacc ctggatcttt gcatgcttta tgacggtatc     44160
     aaaggacgca taaaaacccg taacatccaa aataacagac attcagttga aaatattctt     44220
     cgctggctca ggctccagca ctgcggtccg gaagatgttc atgtggtgat ggaggctacc     44280
     ggagtttatc acgaacggct ggctactgag ttacatgatg ctggtttcta tgtctctctg     44340
     gccaaccctc accgtagcag agagtttgca cgcggcatgg gaataatcac aaaaacggat     44400
     aaggtggatg cgtatatgct ggcctgctac gcattcctta agaaccctca ccgctgggag     44460
     ccgccggcac ccgaaatcag atatctcggt gcactcctgc gacggcggga tgttctactg     44520
     ggtgatgccc tgcgtgagga gaacaggctg gaaaaatacc tgtccacaga cacacctgca     44580
     gatattatca gttcctgcat gcatatggcg cagctgctgc gcgaggaggt aagcaatatc     44640
     gagcggcaga ttaaagcgca tatcaaagcc agccctgcac tgaggcgtga ttatacactt     44700
     ctgacctcaa ttaaatctgt tggcccccag ctgggaatgc atatgctggt cgtgcttcgc     44760
     agccatgact tttcatcagc tgagcaggct gccgcatttc tgggtgtggt gccgatcgag     44820
     aaacgttcag gcacatcggt tcggagccgg ccccggatgt cgaaaatcgg tccgcctcag     44880
     ttgagagcga agctttacat gtctgcgctg tgcggaaaaa tctacaataa gcggatgcgt     44940
     aatatttacg acgagatgtg cctgcggggt aaacctaaaa tggtggccat tggtgcgctg     45000
     atgcggaaac tggtgcactg gtgttatggc gtcctgaaga ccggaatcgt ttttaatgat     45060
     gaaggcctga aacaagtact gtcaacctga ctgtaccagg ctggcactaa actcaaaata     45120
     acgctcgctg cagtaagtga gcgcagtctg ctatgagcga aaagcggacg ctggtgttat     45180
     ttagataaat tcgacttctg tgcttgtgca ctaatccagg gaagagaaat attgcgtcgg     45240
     tgatttaccc agcgcttttc tgaacatcgt aataaacgca cttaccgaat cataccctag     45300
     agttccggct acgcgctgca cgggctgacc ttcagacaga tggcttagtg caatcatcaa     45360
     atgcagctgc tgacgccagc ggccaaagct cattccagtc gcctctttta tcagcctggc     45420
     cagagatcgc tcgctgatgg ccagatgagc agcccattgc tttaacgtcc gccggtcatc     45480
     tggctcatta aagagtgcct cagccataat cctgatttta ggatgatctg atacaggaag     45540
     atggagtgct tcgaccggca catccggaat atgctccagc agcaccgctg caagcctggc     45600
     ggttttactg tcaggagaat aagtatgttc ctgctctgca agatacagaa caagctcgcg     45660
     gaccagaggt gtaaccgcta tggtacagca aatttccggc atcgctgctg cgccgggctc     45720
     gatgaataaa aagcacgtat ctgcattctt cgtgatccgg caacggtgcg ggatctctcc     45780
     cggaacccag acggcatgcc ccggtggaac aagccacagc gcatcgtcaa cctcacagcg     45840
     cactgcaccg cgcatagaga gaataagttg ccccttgcga tgagcgtgcg gacgctgccc     45900
     ggcatactcg cctgacgatg atacatgcag ggcgatagcg gcctgactga aatcatcggc     45960
     attaaactct tccggtgagg tcaccggttt tttattaact ggcatgattt agctatatgt     46020
     tgtcagatta tctatattct gtaactcatg cgtcctttaa agtctttctt tttttcagag     46080
     aaagcaaaac ttatgtccca cacgacgaac aagtggtctt caatcatact tgtgatcggc     46140
     attcttttta ttgccattaa cctgcgtgtt ccttttaccg ctatcgcacc cgttttagag     46200
     tccattcgcc atgattttgg gctgagtatc acagccgttg ggttgcttaa ctcgctgcct     46260
     ttactggcct ttgccgcctt ttctccactg agcgcatcga tttcccgcaa gtatggtctg     46320
     gaacgcaccc tttttggtgc cctggtcgtg atttcagcgg ggattctgct tcgctcaaca     46380
     gacagcgtct gggcgcttta tggcggaaca gtattaattg gtatcgggat tgccctgggc     46440
     aatgtcctgc tgcctggcct gattaaacgt gacttttccg gaaacgtggc ttccgtgacg     46500
     ggagcatatt ccatcaccat gggcaccgct ggcgctatcg gctctaccat tgtcattcct     46560
     ctgacgcaga gctggggctg gaacatcgcg ttagctatgt tggttattgc accgctcctt     46620
     gcgatgcttt tatggttgcc gcagttgaag aaaaagcatc aattgccagt agcaggtgag     46680
     aaaaaagcag cgaccgttgc ggtctggcgc tcgtctctgg cgtggcaggt caccatgttt     46740
     atgggcttga atgcgatgcc tttttatgtt gcggtcggct ggctgccagt cattctgaca     46800
     ggcagtgggc tatcctcagc tcaggctggt gaggtacatg gcatccttca gctcaccacc     46860
     gctattcccg gcttaattct ggcagccacg ctgcgtcgtc ttaacgatca gaaattagcc     46920
     gctgctggtg tcagcctttt aaccgcagta tcctttattg gcatccttta tttgccaaat     46980
     ctggcgatgc tgtgggctgc attcctcggc ttcggctcgg gtgccagcat gatgctgggt     47040
     ctgaccttca tcgggttgcg cactacaaac gcgggtgatg ctgccgcgct gtcaggcatg     47100
     gcgcagagta tcggttatct gatggcggcg atgggaccgc tattgctggg taaagtacag     47160
     gagttgtccg gaggctggac cgtaccatta ctgatgacca cagcaatctc agttgcagga     47220
     gcctgcaccg gaatggctgc cggacgagat gtacacctgg aacctgtaca gcagccgggc     47280
     tgaatgggct tacactggag ggtaccagct gaacttctaa agcggatgct ttccattgag     47340
     gttctgaagc gtcttaatag taccggagcc atctgtacta tcccgatgag cggacttttc     47400
     ggtgaaaagg ccgttcaggg cgagcgtaac attcagcggc cgccctgaaa ctcagggcgg     47460
     ccgcggtcag taataatata ataagaaagc ctcaggactg tttggcaacg atgaatcgct     47520
     tttcatcacc cataaaggct ttttcactgg cgggtgaaag gatagcaccg aaattcatgt     47580
     gcgcggagtt tcaatgatgg aggaacattc cactcagtgc gaatatcttc atcgatcaga     47640
     ggattataat gctgcaggtt ggcaccaatt cctttttcag ccagcgccag ccagaccgca     47700
     tactgagcga tagctgtgct gtgccgggaa attgtccgca taggccgcaa actgctcctg     47760
     tagtgacttg acaacatact gatcctcgaa aaaagtattg agccggcagc cgctgcaaac     47820
     ccgtctattt tatctgaggt gccggagaaa cgttctaaag gaacttgaaa gcaggaatct     47880
     tgttacgcgc actgtctttc gagaagtacc gcccaaagtc gaatatgcac tcgcggaact     47940
     gggaacgtcc ctcaggcagc gaatgaactc aaccggtggg tagaacaaaa ctgtcacttt     48000
     ctgattaaag acactgatcc ttccctgtga catgccattg ttcattgatg agtgctacgg     48060
     gctaacagga gcatataaga atgcagggtg cgggcgccga aaagcggcgt cccctgctgg     48120
     ctcagaggcg acatcgcctc tgagccagca gggaacagaa aggcatgtta acaaccagcc     48180
     cctgcatttt actgtatcag tacaagcagt actcgcgtat tagtctttgc ccggaccatg     48240
     gtcaaaccgg gttcctttgc cgatggcata aaactgtccc ccggcgacat aatgtatggt     48300
     tcgtaattcg tcaggtgctt catcaaatat ccagtgccca ttgcgaaaaa cccgatcgtc     48360
     actccacgcg ccggcaattt ctcccataaa cagattatgt tccagctcat atgccgcgtt     48420
     aggtatcaca ttacatacaa gccagccagc acagccttct accagcggaa catcgaactc     48480
     tttcaggtag aacatcggta ttttatgatt cttgtcaggc ctgtcacggt agctgtgttc     48540
     acctgcgtac aaaacggttt ccatctggct gactacgggt atctgtacgg caaacagacc     48600
     actttcttcc accaatccac gggtgtaagc ctgcggactg atatacgcca tgactttatt     48660
     gattcctacc agactcaccc atgcggcggc catcacattg gcattaccat tatgcttagc     48720
     ggaaatcatt gtagtagggc cgacctgcaa taatcggtat gctttattca gttcaactgg     48780
     ctgtaaagac aaaggatttc tccttcccat tgataaaaaa atgtgccgtt aacggcaacg     48840
     gcacatttga gggcgtgtta aaacactgat ggtcgcccga aggtaatcag gctaataccg     48900
     ttttatattg ttcgacctga gctgcgattt cttcgtcagt tatcgtcgcg cttccgcctg     48960
     taataaacgg cttgatgtag ttcataccca gatacccgga gatggtttca aaagacagca     49020
     ggtactcgcc taccgtatgt ccggcagcgc catcaggctg ataggcagac tctgcaccac     49080
     caagcgaaac ggccagcatg agttgcttgt cgcgcagcgc ctgtgtttct ccaccatgtg     49140
     accagccgta cgtcagtaca tcgtcaagcc actgtttaag aagtggcggc gtgctgtacc     49200
     actgcatagg aaactgcagc acgatacgat ccgtcttttc cagtgcagcc tgttcagcgg     49260
     ccacgtcgat tttgccatcc ggatactggt catacagata acgcacttca acgtcggtca     49320
     gtgatgctgc accttttgcc agggctgagt ttacccgtga ctgattaatg ttggggtggg     49380
     taacaaatac agttgttttc atgtcgatct cttatttttc agaagaatgt ttcgtcaatt     49440
     tcaagccggg ataaagcttc attgatatca tttaattcag cgtcactgag ctgaacgttt     49500
     gcggcgtgaa aattctcttc gagccggtgt aatttcgttg ttcccgggat cggtacgatg     49560
     taaggcttct gagccagctc ccaggcaaga acaatctgtg ctgaagttgc gttgtttctt     49620
     tccgcgattt gagcaatcaa atccagtagc gcctggttat tttccattac ttcaggtttg     49680
     aagcgcccca tcatgccccg gtaatcgcct tccccgtaag ttgtatcagc ggtaacctga     49740
     ccactcagga atccattacc cagcgggctg taggccataa agccaatatc aagttcatcg     49800
     cagactttga acaaatcctg ctcaggttta cgccacatca ttgaatactg gtcttcgact     49860
     gcggtgaccg ggcagatcgc atgagcccgg cgaatataag atacgggcgc attggataag     49920
     ccccagtact taattttccc ctccgcgatc agctctttca ttaatcccgc caccacttcc     49980
     ggctcaactt ttgggtcgac acgatgctga taaaacaggt cgatatggtc ggtttgcagg     50040
     cgactgagtg aaccttccag ttgctctctg acagacgccg gacggctgtc taataccggc     50100
     accagctgtc catcaatgtt ttccattccg gtcacgccga atttggtcgc gatgataacg     50160
     ttgtccctgt gtttgctgag cgcaacaccc agcagttctt cgttttcaaa tccgtaaatg     50220
     ggggcagtgt cgaaaaggtt gcagcccagt tctacagcct tgtctatcag ctctgttcgc     50280
     tcacggattt caactgaata accatagcca tggtccatgc ccatgcaccc cagtcccatt     50340
     tccgagacat gaagcccctg gctacctaac cttctcattt tcatgattat ttaacccttt     50400
     tttaaagcgt ttctgattct gagacgtaca gtatacggct ggatttattg ctgaaaaatt     50460
     gttaatttag aaagtcagaa ttgctaaaat cacaataatg atgaataaac ttgatgcgct     50520
     gaaatttttt gttgccgctg cagaaacgat gaactttcgt gaagcagcag tcagactggc     50580
     catttcccct tcagtggtga cgcggactat tgctgagctg gaaaatcagc tcggcgagcc     50640
     actttttaag cggaataccc gatcaattgt gctgaccagc tttggtgagc ttttcctgcc     50700
     gaaggctatg cggctgcttg aagactcaga ggcccttttt cagacggccc gagatgacaa     50760
     tgacatgaag ggagttgtga ggatcacgtt attccgattt cccggtcacg agcaggtgtt     50820
     atatgagctt cttacctccc tcgatcctta tcctgagctg tttatagact ggcggttaga     50880
     catgatgaag ctggatactg ttcagaaccg cattgacatg gggattcgta tagaacggga     50940
     gccaaacccg aattttatcg tcaggcccat tacgcttgtt catcacgcgc tgatgacgtc     51000
     accccggctc attgagaagc tgggcgcgcc ggaaaatttc gacgatctgc gccagcgcta     51060
     ccctttcagt ggcctgttga atcctgaaac aggaaaagta ttcgaatata tgctcgatgg     51120
     cgttgatact tttgtaccgc gccacctgga gttttttacc accgactccc agtcggagat     51180
     ccaggctgcg ttagccggta aagctgtcat tcagtcgagt aatctggcct gcaggaaata     51240
     ccttgaagac ggcaggctgg tcaatgtcct gcccgaactg aaactggaaa cctggcagct     51300
     ttatctttac aggccctatc agaccctggt accgcagcgc atcaggaccg tttttcacat     51360
     ccttgaaagt attttactca gacacttcag ttgaaagcgg gcccggatat tgctggcgct     51420
     cttagctggc atcctccata aaccggagat gtgaattatt gagtagtgcc tttctccggg     51480
     aagtcgctgc tccgggagga tcttacccgc agaaacaaag tctgccgctc gttcaggggc     51540
     cctgaatact ggcgactttt aatgtgcaac ggggagctgt gacaggcgta tcaactgaat     51600
     atttcaccta tccagtctgc aaatgcacgt acagcagggg aaagaaaacg ttgatgagga     51660
     taaagtagcg tgacaggaac agacggcggc tgccagtcgg ccagaacttc aaccaacgtt     51720
     cctttctcca ggtgttctgc tacaacattt tcagcaagct gcgccagtcc gaacccttca     51780
     aggcacattt ttatataaag ccccgtctcg ttgacggctg cctgcccact gacggatacg     51840
     gacagcgttt ctgttccctt tacaaaacgc aattcgtctg tacgccggct ttgtccggaa     51900
     aaataatgaa tagcccggtg atgagataaa tcttcaggtg actgcggaat accgtactcc     51960
     ctgagatagt cgggagaggc gcaggttatc cagcgaaatt ccccgagcgg acgggctaca     52020
     agcgtggagt taattaactc tccggttctg atcacgcagt ctacaccctc ctgaaccagg     52080
     tcaacctgcc ggtcgctgac gccgatcatc aggtaaatgt caggataacg gctgtagaac     52140
     tctttcaggt ttggcatgac gatgaagtgc gctataccgc cgggcatatc aacgcgtaaa     52200
     cggccacggg ggcgcctgtt caaatcggcc agactggctt ccgtatgttc aactaaggcc     52260
     agaatttccc ggcactgcgc cagatattgc agaccttccg gagtaaggct gacacgtctt     52320
     gtggtccggt tcagcagacg cacctgcaga tatttctcca ggtttttgat ggtgctggta     52380
     acagtagaag aaggcaggga aagtgtttcc gcggcccgga caaagcttcc ggcctcagcc     52440
     acccttataa aaacctgcat agcctgaata cgatccacct gactgcgctc ctgaatagta     52500
     tgtaacggtg attattctca ttattcgtaa attctgaatg atgaaaacaa gttagtcatc     52560
     tttttcagtt taaacaggag gcatattgtt tcccttctga acctgaaaga gacacttcaa     52620
     atgaccgatt acatcagaga tattgttaat aatcatacag ataatgcgac ggtgacgctg     52680
     atccgcggtg caaccatact gagtatggat gagaatgttg gtaaccatga acgtggcgat     52740
     attcttgtca taggttcaac catcaccgca atcggcaagg acctgaacgc cgagggtgct     52800
     cacgttattg atgcaacaaa tatgattgcc atgccgggaa tggtcgattc tcatcgtcac     52860
     gcctgggaag gacagctgcg ccgcatcaac cccaacgcca cctgtctgga cgactacagc     52920
     aatgccacgc atttctcgtt cgcgaaatat taccggcctg ccgatatcta tgttggcaac     52980
     ctgctgacgg cgctgggcgc gattgatgcg ggtatcacta ccatgatcga taactcgcac     53040
     aacagccgta ccgcagcgca ttcagacgcc gccgttgaag ccctgcttga tgccggtatt     53100
     cgcgctattc atgcgtccgg tgcgccggta gcaggcgaat gggataaagc gcactggcct     53160
     ggcaactggc agcgtctgca ggaaaaatat ttcagggata atcctgatag tcttgtgacg     53220
     ctcggcgtca tggcccagct ggagccggaa ttgtgggccg aggcccgcag gctggggctg     53280
     ccaatcgtga ccgagttctt tggtgctgag atggcctccg agcttgaatc gctgcatcag     53340
     cagggcctgt tgggtccgga caatatcttt aaccactgta ccgcgctgcc tgatgagggc     53400
     tgggaaatcc tgcgtgaagc cggcgtgcgg gtaaacgtct gcccgcgctc agattcgcac     53460
     tacggtattg aaagcgggat gtttgctatt gaggctgcgc agcgtcatgg cattacaccg     53520
     ggtctgagcg tggataacga aacgtcttac agcaccgaca tgtttatgga aatgcgcgtg     53580
     gcgttttatc tgcagcgcgt aatgggtatg cataagcagc actgctgtga ttcagatcat     53640
     tctttgacaa cgatcccggc agcgcagctg cttaaatcgg caacggtcga tggtgcattt     53700
     tgtgccggtc tgcaggataa agtaggcagc ctgacgccgg gcaaacaggc cgatctgatc     53760
     ctgattaacg cggctgacct caacctttac ccgaacggaa atgcattcgg aacggtggta     53820
     catgcagctg aacgcagcaa catcgatacc gtgatgatcg gcgggcgcat cgtcaagcag     53880
     aacggcaaag tgctgggtgt ggacagtgag cgccttcgcg ccgccattga tgagtcacgc     53940
     gagcatctat ttgcggcagc agggtatgag ccagacatct ttgcggaaaa attcctgccg     54000
     ctggtccagg caaactgaca gggaataaca gcatgagcgc gatttattac gtaatagctt     54060
     ttgcagcggg cctgggtatt acccttcaga cgacactgaa cagtcagctc gcaaaagggc     54120
     tcggcggaga tccggtcacc gccgcgttct tttcctttac ggccggggcg ttgagcctcg     54180
     ggatttactc gctgctacgt ggagggttat ttagctctct cgctgctatt ccttcgcagc     54240
     ctgcgtggag tctggcgggc ggcctgatcg gtgcctgtgc gttgttcagc tacgtggtgc     54300
     tggcaccgaa aatcggtttt tcagctctgc tagggctggc aatcgttggg caattactct     54360
     cgtcgcaaat gattgaccat ttcggtctgc tgggtgctgt taggcgaccg gtttcgctgc     54420
     tcaaactggg gggcatgctg gtcatgctgg caggtctcgc catcatgctt tttggtgaca     54480
     aactttcagc gcgttttttg ccctgacagg gtgagaatta ctccttacgg cgctctgcca     54540
     tagtgcagat ggccgtaagt ttttggtcag gcgatgcgaa acttttatat gcgggagaaa     54600
     taacatgttt tcagtggctg ctgatgccag aaatttgctg ggagagtgcc caatctggtg     54660
     cgagaggaca cgcaggattt actggactga cattgaaggc agcgaactgc ttgcccttga     54720
     agaagacacc agtgttgtga tgcgctggtc cctgccggag cgcctcggtt cgtttgcact     54780
     tactgaaaat cctgacgttt tactgatggg gctggcatcc agattcgcct tctgcgatct     54840
     gaatacaggt acctttatgc cgatagtggc gtcaccagga ggaccgggaa cacggacagg     54900
     ggatggtcgg tgcgaccgtg agggtaattt cgtcttcggg accatggatg acgggtaccc     54960
     cgcgaaagtc ataggaagat ttcacaggct aaatgcagcg acactcagca ttgagactct     55020
     acccctgcct gaggtggcca tcccgaacag catctgcttc agtccggacg gcagcacgat     55080
     gtattactgt gactcgatgc agggccgtat aatgtgctgt gattacccct ctatgaataa     55140
     ccagcgcgtg ttcactgtaa cagaaggaaa gggggcgcct gacggctcct gcgtggacgc     55200
     aatgggctat atctggaatg ccgaatgggg aggaagccgt gttgtacgtt atcgtccgga     55260
     cggaacgacg gaccgtatac tgccctctcc aggaattcag agcacttgtc cgacactcgc     55320
     gggagaagca ttcacaacgc tgtattgtac cagtgccagc gtgggtcttt ctgtgccgtc     55380
     aaggcatgat ggagcgctgc tgagagcgaa atcagccgta ttccccggtt taccggagag     55440
     ccggttttca gcgcacacag cataaccgct ttgctatcag tgccaacagg gggaacagag     55500
     tctttctcat caccgtattc ggataggcag gagaaagact ctggtattta ttacagcagc     55560
     ttaaatacgt ttatagcgag ctgcccgggg tcaggtttgc attaatccag gctgccacat     55620
     cggtgacccg aatgttatgg cgttcattga atgtctgctt tttatcccat gcaactcccc     55680
     gcccctgcgc aaaaacggca cgatacttag acatcatgtc ttgtgggttg agcgccagtt     55740
     tatctatcag atattcttcg ctccataccg tgcagtcgaa agggcggcca agcgctgatt     55800
     gcagcttatc tgcaacctct gcgtaggtca gtgtatcacc ggcgatatac acaatttcat     55860
     tacggatgcg aggagttgta aatacgatcg ctgccgtcag caccccgata tcatcaggtg     55920
     ttgtcagcgt catggtgttg tcaatgctgc cgagtgcgtg aacagtatcg ttctgcagat     55980
     cgaccacacc gaagtctggt tcgaacaaat agctcatgaa gatgccggtc gaaatgatga     56040
     cccactcagt ttcatgctgg ctgcgtagta aatcacgcac gtcaatctgc gcgtcgaaga     56100
     tgtcttgtgg actgccacgt ccgatggcat caaaatcggc accaaactgc catggaaaat     56160
     agcgtggaat tcgcgcctgc agggccgcct gcgccagttt cattggtgta tttattccgg     56220
     ccgcgtaccc cgtgcagcca acgactgtgt caaattgcgc aaagaggctg gccaaatcgt     56280
     cgacagaact catgacgaga tcgcccgtga ctatattaat accgaggttt ctgatttccg     56340
     tgataactaa tttttttaca ggttcatctg acgttacggt actttcgcgc agcagtacgc     56400
     tgattttcgt tccctccaca tcttttgccc gaagggcaag atttcgcaga acggggaggc     56460
     ccagctcacc ggcaccgagc acgaggattt tctcagacgt agcgttaaga tcagttttgt     56520
     tcataatctg gccttacatg aattgttgcg ccactctagc aattcataac aggctaaaaa     56580
     agaaggtaca cgtatgatac cgggaatctg tgaaatggat cgggacgaaa ttcttcagta     56640
     ttcgcaggct gtttgtaagg gtctgagaga cgatgatgat ggcttgcggc gggaggtact     56700
     ggctcatgca ggcagtcgat ggtcactggg tatcgtcaac acgcttggcg tttatggcag     56760
     actacgtcac gccgaaattg gcaggcgtat gcacggagtg actcagcgca tgctgacacg     56820
     tacattacga cagcttgagc gcgacggact ggttattcgc catgatttca gtgaaatccc     56880
     gccacgagtc gaatacgagc tgtccgatac aggtatggag ttgcttgtgc gaatgatccc     56940
     gctgtggacc tggattgtcg ataatgctga tcgctttcgt gaagaccggt tgagatatga     57000
     aaaaaataac aataacccaa gggcgtaact ggctatgaat ataaatatca ctttttgtga     57060
     tttgtagata atacaagtgt ttgaattgat gagcctttcg atatgtatgt atacagtagt     57120
     catccggaga cagaaccgat ttcaccaagc ttggtcggga tggtgtaatt acagaggatt     57180
     atattttacg tatgtctgac atcaatgtta gtctgtacat atttcaaatg ggtgttaaag     57240
     cgaattttat tttttgctac cattaattcg gccttgaaaa ttatctgaca ggatggccta     57300
     ccctttcaga attataggtg ggctggtgaa acaatattta aaaactggtg tttttttatg     57360
     atttctaaag aaaataatga aatatcttct aattatcatg atcttcctgg ttatgttcat     57420
     ggggcgaaaa ttatccaagt cgccttgact aaaaccccta tagataatat tagtgatgtg     57480
     gtttatgaga cagtaaaaaa aactcgttct gtcaggcaat tgcatatgtc ttttcttgtt     57540
     cctcgtacca acattttgaa accaggtatc atttattttc ctgggggagg gtttatgacc     57600
     gctgaacaca acaaatttgt ggagatgcgc atggctttag cggaggctgg ctttgttgtt     57660
     gcagcggcag aatacaggac aattcctgat actttccctg cgccagtgat agatgctaaa     57720
     gcagcagtaa gataccttcg tcaacatgcc catgattatg gcattgaccc ctcacgaatt     57780
     ggtgtaattg gcgattctgc tggaggctgg ctggcgcaga tgcttggtac cactaatggc     57840
     gataagtcat tcgatcacgg cgattttctc agccagtccg ctgatgtgca ggctgtcgct     57900
     acgctttacg gaatatcaga tctgcgtaac ataggtgacg gttttccgga tctccgacaa     57960
     aaagtgcatc agtctcctgc agtcacggag tcactgctaa ttaatggtgt ggctttcaag     58020
     aattttgcag gtgcctcaat cagttctgta cctgaaaaag cgataaatgc aagccccata     58080
     gggcgtctca agggatgtaa acctccgttc ctaataatgc atggaagtaa ggatacatta     58140
     gtatcaccta aacagagcgc aacgctttac aaagcccttt tggaatcggg aaacaaagcg     58200
     gactacgtcc ttatcgaagg cgcagaacac ggtgatgatc actggtatca acccgttgtc     58260
     ataaataggg ttgttgactg gttccgcgtg catctttgtc ctgaaaatat atgacgactg     58320
     acgctttgct gaatcactca gactgtttgg tagcaacgtc cgcttcacgc cctgagacat     58380
     tcgacaagct ttttatggct tcagtaaggg cgactttcgc gcttccagtg ccagcaaata     58440
     tttcgcttcg tcgtaccggg ttcgggtctt ccagcagcgg taaatgatcc ttatccattt     58500
     aaatgccaga gcccggatcg ctgactgatg agatttccct ttttctcgct ggccctggta     58560
     ataaagtctg gcccagtacg atgagttaac cgtcttcgca gtccattcca cgaatgtctg     58620
     ccggacgaac ttggcacact gccaacgcca gtgtacccaa gatttttgac cacttcgctc     58680
     ggttactggt gcgatgccag cgtagttttg aatttcttcg gcgctgttga agcggttgcg     58740
     gttatcaccc agtgctgcaa gcatccgtgg gcccatacac ggccccattc caggtagtga     58800
     tttgaacagt tctgcatccg gaagcgtatc gaataaggat tcaatacgtt catcgtaggt     58860
     tctgactagg tcgcctgtca gtttgatttg ggatgcaagt gctgttgcca tcaatgcatt     58920
     tgcctcgatg acagttttat ctgtggccag gggaatagcg ctggcaatac ttgcaacccg     58980
     ctgttcggta tatgcaacag caggaccacc tttagcattc ataaaatgac ggacagtatc     59040
     gctgcgagcc cgtttgagtt gttgcagact cggccagcga atgattagct cgcagaacag     59100
     tgagctgtcc cgatgggaga accattccag gggctggggg taatactgct taagcgtatt     59160
     gatgagccga ttaacaaagc gacgcttgtc ttcgaccagc agtcggcgct gctcaactaa     59220
     ttgctggagt aatcggatat ccggattgtc ggcttcaatg gcttttatct tgtggggata     59280
     acgtagcatc aggtctaatg ccagctcagc atcctgcgga tcatccttcg caccactggg     59340
     ccagaaagcc tgtcggtagc gggccagtga caacgcgtgt actggaaaaa cagtgacaaa     59400
     tgggtacttc tggagtgcat acaccaccgg gcctttcttc agctcaacgg caatagcaat     59460
     cctgcctttc gccctctggt gtaactcatt gagccagata tcaagtgcct caggcgtatg     59520
     ttcaatcaca tgaaatatgc gatcaccgtt tttaaactga acgcagacat cgtgtttttt     59580
     atctgcccag tccaaaccaa cataagcagc aaactgatct ttcgcagtca tcaccaactc     59640
     ctttttatcg gggattggta tgcattccac gctcttcgaa agaaatatag tcagcagttt     59700
     ttctgcatgc cctgagtatt cgttagcgaa cgtggagcac ttactggctc gaaagcaaag     59760
     cggcaatcat caaattacat gattctggca caatattcgt aaccaataag cgcataccct     59820
     gaatcactta aaagtgtaac tctcagggtg tgaatgacta tatttggcac aaagcggact     59880
     ttactgaccg gacacgatgc ctgatgtcag gctggacgtt cagggtgaaa atgatggaga     59940
     ccgcttcgtc gctaaaaccc gttcgaatga cttttccact caaagcaaca ataagttttt     60000
     ttccttcctg aaagacaata atcccctgtc cgcaataatc cgaagatttt tatgacaata     60060
     atgcaataat tcttattatt ccttcactgg atccgaaaaa aggtaatacc ggaagtggca     60120
     ggtaccctga tggttttgag aaaaacgcta ggtaatgtat gcccgctgga atttatctcg     60180
     ctacgttacc gacatgtctg gctctggtat ggataatgag gcaacagaga ttttggagaa     60240
     aaaaagatgc gttatacccg caccagcact gcaactgatg tcactgatac actcagacaa     60300
     taccaggctg atttgctggc aggtccctgc tggatgtcgg tatggccact gatagagcgg     60360
     ctactgagtc gtgagaatga aatgcagtcg gtctggcaga acattgcccg tcaggcacta     60420
     acctggcagc aatgctattg tcttcttgag caaatcatac tggcgggccg tttcagtagg     60480
     actgatatcg tttcccgatt gaaagcggat tatcaccagc ttgaagaact gaatcggact     60540
     atcagtaaga cggccgctga actggcagag atgatattgg cccgagatgc gatcctgaac     60600
     cggaacgcat tcacacttaa gagaaccacg cacattgtgg atctgatggg gatggctgaa     60660
     gataatgagg gactttacca ttcttatctt catgaaacgc tcgatggcct gacctgtcgt     60720
     tatgaaggta aatactggcc agggctccct ggcgtcctgc aggttatagc cagggagcac     60780
     ccggaaattg gttgtctgtc agaaagcgat cgggccatca ttaacgggcg cggcaaaata     60840
     ctccccgatt atctccgcga attattcagt agcatcgaga acgtcaggca gggcccatgg     60900
     ggtctgccga aagactttac attgacggac agtagcctgg caacgctggc cactgtaacg     60960
     ctggagtata ctgaagtgat ctccgctgat acggtaaaag tacgccggag tgaattcagc     61020
     aaaagaggcg aacggggagc gtggccattt aagcgactgg aggctgtcga tatgtagatt     61080
     cctgatgtgg acggagatct tattgccttc tgactgttct gccagaccga ctgaagttca     61140
     tggcaacagc aatcataacg gttactgaat taccaggtga atgcttctat agtggtatga     61200
     ccttatgcac cgcatggaaa agaaacaatg acggtaggat cacgctggtt taaatttgat     61260
     tttcataacc ataccccggc ctcagatgat tatagagtac cggatctcca gccccgggaa     61320
     tggctgctgg cttacatgcg ccagcaggtc gactgtgttg tcatcagtga ccacaacagt     61380
     ggggcctggg ttgacgtgtt gaaagcggaa ctggcaaaca tgtatcggga tgccagttcc     61440
     ggtgaactgg cagacttccg gccactgact ctgtttccgg gggtagagct cacggccacc     61500
     ggcaatgttc atatcctcgc cgtgttgcac actaagagca ccagtgccga ggtggaacgg     61560
     ctactggcac agtgcaacaa caactgccct atttcgcgtg aaacccctaa tcatcagctt     61620
     gtgcttcagc tgggacccgc aggtatcatc agtaatatcc gtcgtaaccc ggaagcgatt     61680
     tgtatcctcg cacacattga tgcggcgaaa ggcgttctga caagccttac taatcaggga     61740
     gaactgacag ccgcttttca gtcaaagcct catgcagtgg agatcagaca ccgggaggaa     61800
     gatattacga acgggactca ccggcgtcta attgcggatt tgccatggct ccggggatca     61860
     gatgcgcacc accctgaaca agcgggagcg cgcacctgct ggctgaagat gtcagcccct     61920
     gattttgacg gtctcaggca tgcattactc gatccggaaa actgcgtgct gttcgatgat     61980
     aatccaccgg aggcaccagc ttcacattta cgcagcctga cattcagaac ccgtctttgc     62040
     aagccggtgg atcagaatgg agcctccgtt gagtttagcc ctttttacaa cgcggtgatt     62100
     ggctcccggg gcagtggtaa gtccacgctt atcgaaagta ttcgtctggc catgcgaaaa     62160
     accgaagggc taactgcgtc acaaatcaat aagctgaacc tgtttagtca gacaggaatg     62220
     ggcatggata cagattcttt catcgaatgt gtgttccaca aagagggcac cgattttcgg     62280
     ctcagctggc ggcccggtgg ttgtcatgaa ttacatatct tcagcgaagg tcagtgggtg     62340
     caggacaatc actggtcagc agaccgtttt cccctctcga tatacagcca gaaaatgctc     62400
     tacgaactgg catcggacac aggggcattc ctgcgcgtct gtgacgagag tccgatggtc     62460
     aacaaacgag cctggaaaga gcgctgggat caactggaaa gggactacct gaatgagcaa     62520
     atcacgctgc gtggtcacct ggccagtcag acgattgcgg gaaaactaca gggggagttg     62580
     tctgatgctg aacgggccat cagtcagttg cggtcgagcg cttactatcc tgtttgcacc     62640
     cgtctggcca cggcccgagc tgaactgtct gcggcaacgc ttcctctgga tcataatgaa     62700
     cagcgtgtcg ctgctctgag ggcgcaggag aaagaacccg tgcaagtccc tgagctccag     62760
     gtggagtcgt ctgcgccact gacagcattt atgacgcgtc ttttggacgt acagcaaaag     62820
     tatgaccagc gtcttgacac tctgttgtcg gactatgccg cggaactccg taccattaag     62880
     caggagcccc cttttctcgc attggaagag gcggttcgca accaggagga aaccgtacaa     62940
     cgtgaggcca tggtgttacg agaacagggg ctcaatccgg acgtcctcga tgagctgatg     63000
     acgcgcagtg agtcgctgaa atcggaactg agaaattacg ccgatcttga tgggacgatc     63060
     gcggcctccg cagcgaggtc caaaggatta ctggctgaaa tgcgtaacca tcggatggta     63120
     ttgacggaaa agcgaaaggc gtttctgtcc tctctgtctc tcagcgcact ggaaattaaa     63180
     attctgccgc tctgtgcccc gcatgaagac accgtatctg gttatcaggc agtaaccggc     63240
     atcggaaact ttgccgatcg tatctatgat aatggtgacg gtagcgggct gcttcatgac     63300
     ttcatcagcc tgcgcccgta tagtccgcta ccgtcggcta cggaaaacaa atatcttgcg     63360
     ctggatacgc ttaaagcgct gcatcttgct atccatcgcg aggagccggg ggtcggggct     63420
     gagctccacg gtgctttcag aaatcgcctt aaaggtctga atgaagcgca actggatgcc     63480
     ctgcaatgct ggtatccaga tgatgggata cacattcgct accagacacc cggaggaggg     63540
     atggaagata tttcctctgc ttcaccggga caaaaaggag cgagcatgtt gcagttcctc     63600
     ttgtcgtatg gcaccgatcc cctcctgctg gatcaaccag aagacgacct ggactgcctg     63660
     atgctgagca tgagtgtgat ccctgccatc atggcaaaca agaaacgccg gcagctgatt     63720
     atcgtgtcgc attctgcccc aatagtggtc aatggtgatg cggaatacgt tatcagtatg     63780
     caacacgatc gctctggcct gtacccggga ctttgtggag cgcttcagga aacgctggtg     63840
     aaggagttga tttgccggca aatggagggt ggggaaaaag catttcgttc ccgctatgag     63900
     cggatactca gctaagaaac cgccaactcc ctggggccga cagacgagta aaaagagtac     63960
     acctgtgagc cactgagtgt ctgaaaaccc gaacacaggc cccgatcagg cagttacaac     64020
     atcttgatcg gggcctatgt atccggtgat tgaccctttc ccttgtctac cctctccagc     64080
     gcgtcaggga tgagcattga gccatgctat cagacgtgca tcgctacggg aaagcgtccc     64140
     atttttcagc tgattatcaa tggctgtgta tactttcttt tccgtgatcc cgtgaagagg     64200
     gttcagttcc ctgaaaactg actcactggt aaattggcac cgggtaaatg cctcctctgc     64260
     ggtactgacg gttgggtgga tcaccacaat attaaacaac gcgctgattg ttgctcgcag     64320
     atagtgttca aggttcaccg tcagcaggtc aatgtgcggg ctggtacctg cattgtgcac     64380
     aatggtattt cttagcaggt acaggcggtg aagatgtcgg gtgactttct cggcatgctg     64440
     ccccagttta tccgccattt tctcgggtga cgcacagatc ccggcaagct tacgcacccg     64500
     gtacatgaca tagggaaaat gctgtaaatc tgtctgaagt tcacgggccc gatccgcatc     64560
     tttaagaagg gcatagagct gtcccagcgg aagtgaagca atgtccggtg tgcgcaaggt     64620
     gtgtcccggc tcacgcagga taaagcgcag aacttttcta agtgaaaata gttgcttaac     64680
     aatataatcc agcaccatgc agggagccac aacactgatg acatgttgtt catgtgatgg     64740
     tgtgccaggg gcaaccccta gcgttaatga ttcaagcgcc gaccagtaag ctgtgaaacg     64800
     actctcctga acctggcttt caataccgtt acggaaaaaa cgaaatgcgg agctgatttt     64860
     tttacgggac acatccggtg tatccgtgaa tagtctgttc atcgccacca tgaagcgcgc     64920
     aaactcctcg tccgttaacc ggtccgcgtt tgcctcgatt tcattatcga agcgcggcac     64980
     ttcggtttcg tcttcatccc ggattatcat gaactgtttc tggacggtga tatctccctt     65040
     acccaccatg taggcaatga catccagaga ttcacgaagc atctgaccgg ccatgttacg     65100
     ggcagacgtg tcagacattg agcaaaccgg tatatcgaca gcgagggaga agcgttgccg     65160
     ggcttcatca agtggctgga atacacatcc attgaactgt aatgtgggac cttgcgtgtt     65220
     aagcagggtg tgcagtttct cactggtgat aaacatccga actgtcacgt cccgagtagg     65280
     cgtgaccagt ttctgccgga acgaatgaaa ggcggcccgg aaagcgtctg gttcaggact     65340
     cacagttctg aaaatattga tgtacagcag gtaacattcc gtcagcgtca ttccccgggt     65400
     gaggagtaaa ctcatcactc cgttcgtcag tgagtaaata tctcgcgcat ggttttcatc     65460
     cagagggggt tctgtaaaca actcctgttc aagcatctca agagcctcag tgatataact     65520
     ggcctcgatg atatccgcca gttgtacaca gaggctacag ataagacgag gtcgtttttc     65580
     caccgggctg cgagtgggat caaccagtaa atctctgtcc agaagactca ctagttgagc     65640
     gggtatgtcc tcaaatgcct ctctcctgag aacgtgatcg gtttcgagta actcgagtag     65700
     ttcagtggca acccggagtc ttttcttatc ggcactgaaa cgatcttcca tttcgtaaag     65760
     aaacagcagt tcgcggatag tgctgagcgg attgctgtat ccgacccggt cagtatccgg     65820
     actgtttttg tggcagaagt tggaccagca ttcaataaaa tagagctgat gctcggtgag     65880
     tacatccctg ctcagacgtc ggtcgatacg cataggtctg gaaatctctt gtacagtgag     65940
     ttattattca ttcataccat atttaaatca tctgccgcca tgcgggggat gtcaccgaaa     66000
     aaaacggctc tcccttctgt cagtggctta atcccgggaa ggttcagggc ctcatattca     66060
     gaaagccacc cctgcgggtg gttttttttt agaagtccgg atgttccagt gcgggcaaca     66120
     atctggcgac ccggatggcg tctatctccc gccagaacag tgcttcatcc atataccaga     66180
     acaggtgacg acggaagata ttcagctgag gtcgttcccg gccagcggct tcaatgaaca     66240
     gggcacaggt tagtgagatc ccctgcggta gcagcggaat gcctgaatcc agctgctgca     66300
     tacgcagtga aagccagggc acacccgcca tcatgatccg ctggagatcg gtgtcattac     66360
     ggatgttcaa caactgacag tattcccggt tctcggccag agtgcgcccg gcgtcatacc     66420
     agttttccgt cagcggcagg ccggtgacac cagatagctc ccgatccatc agggcaacca     66480
     gctcgctgct gcgcgaaaaa ttgccgatga tgtcgccgaa cgacgctgac agaaattcct     66540
     gaatgaagtc gcttttcgat ctaccggccg ctttcgcctg cgccgtgatc gccgcatcga     66600
     cgtcggcagg cagatggcgt accgtcagcg tcccttttgc ggcagataat ttatctttgc     66660
     tctcatcttt catttttgca tcctgagaaa gaactttgtt tttttttatt ataacgctat     66720
     ttaaatattt tatatgatgc aaaaattaaa aattgcatca tatttatcct tgttgattgt     66780
     gattacattc cgtgcagcat tactgagtct gtcttcactt tatatctctc ctgaatttcc     66840
     cctgatccga tttctggtgg ttccggatct gctttccggc ctccggcgcg ctgcggcccg     66900
     taaacacaag atatagcggt tttcccagct gacagtgacg ctatatgttg tatccctccc     66960
     ctgccccgtg accggccgct caccactgga aaacgccgct ttgcttattc cctgaccgtg     67020
     gtacacttcc ggaaacttat caaaatgtga aaagtcggat ctgaccggaa cgggcgtccg     67080
     gtaatttaac ggcgtggctg tatggctgct tgttatctct aaggtgatta ttttgtatgt     67140
     gaatttcacg gtgtgaaatg aatggcgaca taacagtatg tttcaggcgg gcgtgagtca     67200
     gctgcatcct tacgctatac tgatatgcat atcattagta tgtattccgg agtgcattat     67260
     gcagcagcgc atcaccgtca ccatagacag cgacagttat cagttactga aatccgcgga     67320
     cgtcaatatc tccgccctgg tgaacagggc catgcagaat gaggcccgtc gtctgcgtgc     67380
     cgaacgctgg caggctgaaa atcaggaagg gatggccgag gttgcccgct ttattgatat     67440
     gaacggttca ttcgccgacg aaaacaggga ctggtgagat gcagtttaag gtttatgcct     67500
     ataaaagaga gagccgctat cgtctgttcg tggatgtgca gagtgacatc atcgataccc     67560
     ccgggcgacg gatggtgatc ccgctggcca gcgcccggct gctgtcggat aaggtttccc     67620
     gtgaactcta tccggtggtg cacatcgggg acgacagcta ccgcctgatg accacggaca     67680
     tggccagcgt cacgtcctcc gtcaccgggg aggaagtggc cgatctcagc caccgggaaa     67740
     atgacatcaa aaatgcgata aacctgatgt tctggggaat ttgacagcct ccccgccctg     67800
     aaagacatcg aggatgtcaa aacgaagcat tgccgcagag cttaaccctc agcatgaact     67860
     gccctacgga gcggatgccc tgcaggcttt cgtggggtca gcttaaacga acggctcaca     67920
     caaaaaacct taagccagta acatttacgc aacgggacaa aaaggccggt atggaagcga     67980
     aaacggaaac cttcataaaa acgtctgttg atgataacgg catgtggctg ctgaccgtcc     68040
     cggcggggag ggcgggcgac gaaacggtgg ttgtggtcgt cagacgggtg gaggaatgtc     68100
     gttacgggtc agaggactcg ccaggggcac atgtgtcgat cacctccagc ctgacgctgt     68160
     acggtgaagg acaaggaaca ccgcagacca ttgtcgcgaa gttcgttccc ggcacggtgg     68220
     aactgttcag tgtcgaattt atgctgaaag aatttttacc ccgtggtcgc ggggtgggca     68280
     gctggatcat gcagcagatg gtgctctgga cccgctccct gccgccggaa acgctggtcg     68340
     gaagaatcga catctcgtcc gtggatgcga aagacattcg caatctgtac cgccggagca     68400
     gaatgtggcg cgggctgggg ttccggttcc cggccggtga aacctgctcc atgccgctgc     68460
     gggcagacga actgcagttg ccgcggggca ggtgttcaac gctccgggtg gagcccctgg     68520
     tatccgcggt tcgccggctg gaagactgtt atcacgggct gcaggaaaaa atcgtgcagc     68580
     tcgaaggcaa aaaacggtcg caaaaacagt tgattgattc acttaagaat cgtccatttt     68640
     atcatctgtt gcacaggaaa gggggccagc tcccggacga gaaatgtgac accctgccgc     68700
     tgcgggcaga aaaactgtct ctgccgcaga gcggggattc agacctggtg gtggcgcaac     68760
     gggcaaccgg ggtcatccgg ctggctaccc tgtgtgctca gtcgcagaaa agaatcctgg     68820
     agctggaaag ggatcttgcc tcgcaaagtg aggagctcgt tgacctgcag gcacatccct     68880
     tttttaacct gcgggataaa taccgcgacc agatcctgtt ctggggatgg gggatgtgtt     68940
     ttctgtgctt tatctactgg atgttggtgt catgaatgtt cccgttccat agcaacccac     69000
     tgaagaggag tgaaacctgt gcccgaaaat atcgtgtcta ccgtcattga cggggtagtt     69060
     ttgtttgcga cttcgtctgt tttctggctg gccgtcgctg gctggttagt catcctgact     69120
     ccggtaatat tacgaagaaa attctcggca aagaaaaaag ttaacagaaa ttatgaataa     69180
     cctggttcca gttggatctc cggcatctcc cggaacattg ctcccggtgg ccatcgatta     69240
     ccctgccgcc ctcgccctgc gccagatggc gctcgtgcag gatgaactgc cgaaatacct     69300
     gctggcgccg gaagtcagcg ccctgctcca ttacgtgccg gaccttcatc gcaagatgct     69360
     gctggcgacg ctgtggaaca ccggcgcgcg cattaatgag gcgctcgccc tgacccgggg     69420
     agatttttcg ctggcgccgc catatccgtt cgtgcagctg gccacgctca agcagcgcac     69480
     cgagaaagcg gccaggacgg caggtcgtgc ccccgcgggt agtcagatcc atcgtctggt     69540
     tcccctttcc gatcaccact atgtcagcca gctgcagatg atggtggcca ccctgaaaat     69600
     tccgctggaa agacgaaaca agcgcaccgg cagaatggag aaggcgcgta tctgggagat     69660
     cacagaccgt accgtgcgca cctggctttg cgaagcggtg gaggccgcag cggccgacgg     69720
     ggtgacgttc tcagtaccgg ttacccccca tacgttccgt cactcctacg cgatgcatat     69780
     gctgtatgcc ggcataccac tgaaggtttt gcagagcctg atgggccaca aatcgattag     69840
     ctcgacggaa gtctatacga aggtgttcgc acttgatgtt gctgcgcggc atcgagttca     69900
     gtttcagatg cccgaagcgg atgcggtagc catgctgaaa gggaatattt aagtacttag     69960
     gagaatgatg ctggcgaacg tcctgctcgc cggtgaggtc tgtcagacgt tatctggacc     70020
     agctgacggg aatatctgct ctgtattcct catactgctc atagatcgca tgctgaagca     70080
     tcgtaatacg ttctgacaac ctgttggcgt ccgacatatg ccgccattcc ccctcaatag     70140
     tggttttctg tccatcaggg agattgagcg tgatcaatac ctttgtatca cgaataatca     70200
     ccccgtcagt gaaagaatta agaccactcc ttacggtatt atctatctgt atagtttcaa     70260
     gtttcatctt gttacctcct gttgaccgga tcccaagcat agatatctga attcaaattg     70320
     cctagtgaaa tgtctggatg tgccgcattt ttccccttat acagcgaagc tggccaaagg     70380
     ccagcccgca tggatttatc gcttttgcca gtagatcagc atggcaagga acaggattgt     70440
     tgccccctga gaagcgggag aagcggtcag gaaagtttcc agcaaggtca ttatcgtaaa     70500
     actccgcatt attaatttca ggtgtgtgat tcaggggcct tagtccccct tttacaggaa     70560
     gtagtgttct gtcacgacgg gagccagggt taataaaaac gattcgaata tgtctgcagg     70620
     gacgatagaa atcttcgtgc gggttgtctc gctgtagcgg gctctggaga gcgactcggg     70680
     ggaggagtag tatcttccgg ccacggatat gatcgagcca gcagtgctcg ccgcagccga     70740
     gcgacagggc gaagccccga gtgagcgagg aagcaccagg ggagagtact tttcatattc     70800
     tgctgacgct caatgcctga aaaatcacct ccccctcggg gttatccact tatccaccga     70860
     gatattttta taagatcttt tttaatagtt gttagatctt tatttttaga atgcccgcag     70920
     gcctttatcc atgcgggtta cagaggggga tctgtgacaa accgcccttt cagtgtgaca     70980
     aatcaccctc aaatagccgt cctttctgtg acaaattgcc cttaaccctg tgacaaattg     71040
     ccctcagaag acgttgcatt tcacaaagtt atccatgcct gttgactctg ttttatgaag     71100
     tgtgacaatc tgaaaacctg tcacacttca catggacctg tcatggcgga aatagcggtt     71160
     ataaaccaca aaaaacgtaa aaatagcccg cggattgtcc agtcaaatga gctgactgag     71220
     gcggcatata gtctctccag ggatcaaaag cgtatgctgt atctgttcgt tgaccagatt     71280
     aggaaatccg atggttcact gcaggaacac gacggtatct gcgaaattca tgttgctaaa     71340
     tacgctgaaa cattcgggct gacctccgct gaagccagca aggatatacg acaggctttg     71400
     aaaggttttg ctggtaagga agtggttttc tatcgccctg aagaggatga cggcgatgaa     71460
     aaagggtatg aatcctttcc ctggtttatc aaacgtgccc acagcccatc cagagggctt     71520
     tacagcgtac atatcaaccc ttatctcatt ccctttttca tcggactaca gaaccggttt     71580
     acgcagttcc ggctcagtga aacaaaagag attaccaatc cgtatgccat gcgtttatac     71640
     gaatccctgt gtcagtaccg taaacctgat ggctcaggtg tcgtgtccct gaaaatcgac     71700
     tggatcatgg agcgctacca gctacctcaa agttaccagc gtatgccgga ctttcgccgc     71760
     cgcttcctgc aggcaagtgt tgatgagatc aacagccgga caccaatgcg cctctcttac     71820
     atcgagaaaa agaaaggccg ccagacaact catatcgtat tctctttccg tgatatcacc     71880
     tccctgacaa cggaatagtt tgagggttat ctgtcacaga tttgagggtg gttcgtcaca     71940
     tttgatccgg caggttgagg gttatttgtc acagtttcgc tgttaccttc ctggcagcct     72000
     gcgcttattc atagtttttt ggctgtaacc ggtagtgaat ccaaatttga gggcaatttg     72060
     tcacaataca tgagggcagt ttgtcgcagt taaatgagtg cagtttgtca cagttgaatg     72120
     agtgcagttt gtcacagttg atttcccctc tttccctctt ccctttagtc actagacctg     72180
     aggcagtggt cgagctcgtc atgattgatg agggcagatt gtcacactta ttaccctgaa     72240
     caggctatct gggtgtgtgc ctgcgtttgg ggtgtttccc gcagacccgg cctgactcgt     72300
     atccctccgt cagggctgcc tgcgaagttg acctgtttca aacagaggat ggaaacctat     72360
     tcatgtattg ggcgtaagag ctatctgcct gaacggctcc tctttgcttc ctcgccagtt     72420
     cgctcgctac gctcggtctc atggctgcgg cgagcactgt tacagaagag ctatctttga     72480
     acggtcgtaa caaaaatcag ctcctgagcg taaaattgca attcagtact gtgtttgagt     72540
     ggaacaccct tcgtgcttgt ccaaaccctc cccttgttga gagcgaaatc aaaacaatat     72600
     gattttttgc ttgcaacatg actctttttg ttcaaaatga caaaaaacgt catgaggtga     72660
     taaatggaca atattgagca gttacggaaa gtcgctacac gtgcaggtaa gcttctgaca     72720
     tctttgagcg aaagtatccg acagcaaaaa gaggaattga agcttaccga gttctatcag     72780
     gaatacagca aagccgctct gtataagctg cctaagctca gtaaaggcag tgttgagtat     72840
     gctgtgtccg aaatggaagc cggtggctac atttttaaaa agaaaccttc tggtaatacg     72900
     atgaaatacg cgatgacgat tcagaatgtc atcgatctgt ataaccatcg taaagtaccg     72960
     aagtacaggg atcgcttcga taaagccttt acgatttttg tatgtaatct taaaggtggt     73020
     ggttccaaga cagtttctac cgcttcatta tcacatgctt ttcgagctca tcctcagctt     73080
     ctgttcgaag acctgcgtat tctggccatc gatttcgatc cgcaggcatc tctgacaatg     73140
     tttctgagcc atgagaattc agtgggcttg gttgaaaata cggctgctca ggccatgctc     73200
     cagaacgtgt ctcgtgaaga attactttcc gattttatag taccgtctat tatccctggt     73260
     gttgatgtaa tccccgcttc cattgacgat gcattccttg ctgaaggctg gaagggattg     73320
     tgtgaagaac atctgccagg gaaaaatatt catgcggtgc ttaaagagaa cattatcgac     73380
     aagctccagc atgactacga ctttattttc cttgatagtg gtccccacct tgatgcgttc     73440
     ctgaaaaact gcattggggc ggcagacctg atgttgaccc ctcttccacc ggcgacggtt     73500
     gattttcatt cttccctgaa gtttgtggcc agcctccctg ccctcataga ttccatcgaa     73560
     atggatgggc acacctgcaa tctcatcggt aatgtcggct tcatgtccaa gatcctgaac     73620
     aagtctgatc acaaaatttg ccatagtcag gccaaagagg ttttcggtgc cgatatgcta     73680
     gacatggtac tgccgagact ggatggtttc gaacgctgtg gggagacttt tgacacagtt     73740
     atttcagcaa atccagcaac ctatgatgga agtactgagg cactaaaaag cgcaaaatca     73800
     gcagcggaag actttgcgaa ggcagtcttt gatcgcatcg agttcattcg tactaacgga     73860
     ggtatgtgat gtcgaatgag aaaagaaaaa ccatcggcag acagttaaat acccaggcgt     73920
     caatggcaga aatgacggac accggtagaa gccaggtatt taccttaaaa accggcagga     73980
     aggtaacgtt caggtttgtt cgggtgcctg catctgaagt tgaaagtaag accttcgtaa     74040
     accaggaaaa caacggaaga gatcaacttg cactgaccag ggagtccctg aaatccatta     74100
     tccagacgat taagtttcag cagttctttc cctgtattgg tattaagcaa agtgaaagga     74160
     ttgagatact ggatggttca agacggcgag cctcagcaat ttttgtccgt acaggccttg     74220
     atgtaatggt taccgaagaa catttatcag ctgatgaagc tcgccaactg gctaaagata     74280
     tccagacagc taaagaacat aatcttcggg agattggcct gagattgatc gctcttaaag     74340
     agtccggatt taatcaaaag gaaattgctg aactggaggg gttatctcag gctaaagtta     74400
     ccagggcgct gcaggcggcg gccgtaccgc aagacttgat ttctctgttc ccggttcagt     74460
     cggagctatc gtttagtgac tataaacttc ttttagaagt taatgaaaaa ctcagtgaaa     74520
     agggattaac gcctgaagaa ctcattcagt ctgtatcagc tcagctcgat gcaattttga     74580
     gtgatggcga gcgaccagaa gacgaacaga aagccagtat tctgaagctg atttctcagg     74640
     catctcaggc attgatagat ccatctccca aggaaaagtc agtggtttcc ccactctggt     74700
     cttttgaaga aaaggacaag ttcgcgcgta agcgtgtgaa agggcgcacg ctgacttatg     74760
     agtttagccg tatgtcaaaa gtgattcagg atgaactgga caaggctatc aacgaggtcc     74820
     ttgacagaaa tttgagtcaa taatttcgcc atggtgattt cacatctaac ttattgtaat     74880
     taggcagttt aggctgagaa tttcaaggtg aaatcgccat agtttcacgc cagtttcgct     74940
     gcaggaatat ctgaccatcg tgtcgtataa gcaggagaaa gcatctcccg tttcatctgc     75000
     cattccgggg ccataccccg ccccgcaaac catactttac ccaaccctga gttgttgatc     75060
     ccgtccagaa ccctcatcag ctcagcactg tgagggcgtg gcgggcgttc gtcgaacagc     75120
     tgcagctgcg aaacgccgga gccggtgaag tcattcagca taactccggc tttggcatac     75180
     cggtgcccat ccctccagat acgctccaga gccgttgtgg cggctgcaat gatgtccctg     75240
     gtgtcctgag tgggtgtaag cagtttttcc gtagccacgt tgccgtagta aggctcttta     75300
     atggcgaacg gagacgtttt gatgaaaacg gaaatatgcc ggcaatactg gtgctcttta     75360
     cgcagttttt cagaggcccg ctctgcgtgc tgacagatag cctgacggag tgactcgtac     75420
     tccgtgatct taacgccaaa actgcggctg cagacaattt gctgtttcgt cggaggggct     75480
     tcctcaagcg aaaggcagct ttccccgttc agttcccgta ccgttcgctc aaggacgaca     75540
     gaaaaatttt tgcggatgaa ggccgggttc gtcagagcca gatcgagcgc ggtttttatg     75600
     cccagcacat ttagcttgcg tgcaatacgg ttagccgttc gccaggctgt atggtcaatc     75660
     tggggggctt cagtatcaat ctcggcaaga tcggcatggg gaccgcgaga aaggacgata     75720
     agcaggtgaa cggcgccttc tatcacgttc actggtacaa gtacccgctg acatactggc     75780
     tgaacatcat cacttcggca ggctgtctgg aaggcggaga catggatatt gcctacctgt     75840
     ccgagattga tccaacctgg gtggacagca gcctcaccac catcctgaat ccggaagcga     75900
     tcctgtttgc caaccccatc gcgcagggcg cctgtgcagc ggatgcgctg gccagtgcat     75960
     tccatatgcc gctggatgtg cttttctggt gtggtggcag ccacggctca ctttacccgt     76020
     ttaacggcca ggtcagtaat gagtccagcc cgctgcagtc gtcggtactg gtcagtgagc     76080
     gtatggcctt caagctccac cggcagggac aaattatgga gagtatcggg aaggacaagg     76140
     cggtctgtta cgaatatccc tccccgatca tcccgaaaga gcgctggcgc tatcagatgg     76200
     tgaacatgta tccggacagt ggtcagtgcc atccgcttgg acgcagcgtg atgcgctggg     76260
     aagctggcaa aaatccaccc aactcccgca agaactatgg ctacctgatg tggcgtaaac     76320
     gtaactgcgt atttttgtaa gtctgacaag aaaagggtaa ttcatgaagg aagaacagaa     76380
     acagtgcaac tcacaaccgg ctcagttccg gaagatttct ccatatacat cacggggcac     76440
     tttcagcatg gaagaaaagg tactaacggc tgagcaatac agagactggc aattcattgg     76500
     cgcaaccctc agcgataaaa tcagccgata cgctgaataa gtacgactgg aggcaacatg     76560
     ttgaagaact atgcgtttgt gaaaacgtcg atacatacag tcggtatgac cctgaagtct     76620
     ccacctctgg catcgatacc gggtatatcc gacgcctctc aggcatgtga taaaatctct     76680
     gccaggctgc gttatggcat cattccccga ccggaggggg tcaaccgtct gaatgccata     76740
     ttgtggcttg caagaatgcg agaggccggg attcatgggc agtcatcagc gacggcacat     76800
     gagcttgggc ggctgaatgt tttgctcggg caggtcagcg gtgtgctcaa agcatgctgg     76860
     atttaccggg gatgggaggc ctcgcgtgca tcgactatag tgtccattct gctgattatc     76920
     cctgcattcc tggtattttg gctggcgcta tatgtcgggg ggacgattct ggtctgttct     76980
     gtcagtatgg cgttgtttct tggtgttggc atcgtggtta acttatggat caaagatcct     77040
     gtggggcttt tctggtcgct gtacagctat atacctttat atgccatcat ttatatgtga     77100
     ttgagtgatg atgaaattat caaagggttt tatcattata aattttaaat gcgccgccat     77160
     tgcgatgcac tttgaatccg ttggggtgtt tgcagtaggt gaaaagacga tagcgtgttt     77220
     taccaccgta tctcagattg agaaccattg cttcaggaag atgagttatt ctttctttta     77280
     cggtgaatga tattcctctt tctctcaggt tgttacataa gactttgcgt agtcccggcc     77340
     ttaagaggtg tgactcgaat gtgatggtct tacaaggaaa gtgactcaaa aggtagctga     77400
     tatctgctgc ggttttctcg gcgatgtctt cataagatcc tgattgagac atagcttccg     77460
     tatatccacg gttgatatct acccgaaggt tcgacagaca gggagtcagc accatatcgg     77520
     taatcggggt ttttaatatt gatgacgata aaaaataaga aacaaaccag acggctacaa     77580
     ctgacacaaa tgtcatagaa taaaaaagat aaacattctc tgtgaataaa tagagggttt     77640
     tctgtgctgt aaagcacaac gctgaagaca gtattaataa cgtaagctcg gcaggaaatg     77700
     gtcttctcaa ttttatgaaa agagaatggt tatctttgaa gcgaaagcga agggctgcag     77760
     ttaacaaaac taaaaagata agcaacccag tcattctgca ctctccccaa tatgttactg     77820
     ccaatgagca gtctgataag gaaatgatac atgtatgatt gtgatcctgt aaacgagttc     77880
     acttatgttc gtgataggtt aaacggcatt tttcttcgcc tctcggaaga accttttatc     77940
     cgactgagta aaaaaagaat catacaacgc cacctctcgg acatacagtg gatgttgaac     78000
     cacaaccatt accctacacc gggacaggtg gattttttta tcagtctgtt gcgggatggt     78060
     aaattcagtg tggtcagaga ggaaggacga cacacaaaaa gtgcagcaga tattcagctg     78120
     atgatcgatg cactaaagga tatccgggat tttttaaagc tgattacccg gtatgaaaca     78180
     gagggggata ttatcaggct tacatcgtgt tcagcctgga aaaatacagc gttatatctc     78240
     tgtcttgctg ctttctttgc attgtttata gctcaggttg ttatattttt aggctattcc     78300
     cccctggctg tttactttag tggtttcgcc ttctttttta taacatcgct ggttctagaa     78360
     aatgaagtgc tgatattttc tttcatcggt ctggttgtct ttactctatg catccttttt     78420
     gcatggacaa gtcattatcc cggataacat aaatatcagt cattataatc ggtaatagag     78480
     gcaattatga ataaaggaat caccgggctg gcctgggggc tgagtctgct ttgcacgacg     78540
     gtgtcagccg ctgacaatat taatactccc gcggaccagc agtggctgaa acagcaggag     78600
     aacctcagcg aacagctgcg ccagcatccg gataaacagc tgcagcagga gcttgaggcg     78660
     caaatcaatc gcaatcctct gaccaaatct gaccgccagt ttatcgataa tctggtcagc     78720
     cagcagaaag cggcgaatca ggaaaagcag gcagaaggag cgctgtactt tgtctccttc     78780
     tcgatacctg aagaggggct gaagcggatg ctgcacgaaa cccggcagta cggcattccg     78840
     gcgacactgc gtgggctcgt caataacgac atgaggacca ccactgacgc ggtgctgcag     78900
     ctggtgaagg atggcgtgac cgacggcgtg cagatcgacc cgacactgta cacgcagtac     78960
     ggcatccgga gtgtgccgtc tctggtggta cggtgtcagg ccgggtatga cgtggtacgc     79020
     ggtaacattc acgtcaaaca ggcgctggag aaagtcgcac aaaccggtga ctgcgcacag     79080
     gtggcacggc ggatgcttga tgtgccctcg aatgccgccg ggagtcagcc atgaaagata     79140
     aaccgtactt catggcgtta ccggaaatgg tgagggatga gggagggggg aaatgaagac     79200
     ggttatttcc gtactgaccg cgcatttttt tgtcctgagc gcctttatct ggctggcgtc     79260
     tcccgcctgc gctgacagcg gaagcgacta taaagccggt tcggattttg cgaaacaggt     79320
     gcagggcaat ggcctgaact cactgaaaaa tttcagtggt gagcaaaacc tgccggggta     79380
     taccgccaac ccggatcaga caaaatacta cggcggcgtc actgccagcg gagacagctc     79440
     cctgaaaagc gattcagccc tggagttcag ccagggggat accggcaaaa cgattacgga     79500
     gtcgttcacg aaccggccac cggatcagat atctcaggat gcgccgttta ttcaggccgc     79560
     cagggatacc gaatcccgtg ccgacagcat tgtcggtgat accggacagt cctgtaccgc     79620
     ccaggttgtg aaccgcagcg agttcacaaa ccatacctgc gaacgtgatc tgcaggtgga     79680
     aaatttttgc acacgggaag cgaccctgaa ggataacgcc accacgcaga aagttaaccg     79740
     aacctatcag caggtggtga cgctgaatta tgcccggagt acccggcaat ggagtggcaa     79800
     cctgacgatc ccgaccagtg gtcgtcttct gaatgcctcg gtggatggtg agcctctggt     79860
     gatcccctgg attgaagaat gcgattccga agggaaggtg cgggatagct gcaagagtgc     79920
     agtgagtgaa agcctgaccc tctttgaacg aacgttcccc attgatgtga tcagctggcc     79980
     acgttcagaa tcgatatgtt caggcggcca gaacacgcat tgtacgaaat atacctatga     80040
     cgggaaggcg aagattcatc agtcgtttgg tgtggacaaa gtggtcactg cagggcagaa     80100
     ctttgctgta agcaaaatat cacgaaccgt atcatcggcc agccagaaac ccgtacaggt     80160
     cacggtcacc ctggtgatgg aggaaaccga aaccgtctac gcacctgaag tcgtctgggt     80220
     ggaaagctgt ccgttcagta aggatgaagg aaaaaaaacg ggcgaggaat gtatcagccc     80280
     gggaggaacg cgaaccatca ccctcggagg cagggattac tcgttcacgg aagcatgctg     80340
     gaaatataag gatacctggc tcacacaacc ggcggacaac ggctcctgtg aaagcctgat     80400
     gaaaaatacg gcttgtaccc tgtcatcccg ccagtgcgcc ttctccagcg aggaaggcac     80460
     gtgcctgcat gagtatgcaa cgtattcctg cgaaaccagg acgagcggga aacagatggt     80520
     ttgtggcggg gatgtgttct gcctcgatgg ggagtgtgac aaagccacgt ccgggaagag     80580
     caacgacttt ggccaggccg tgtctgagct ggcagcgctg gcggctgcag ggaaggatgt     80640
     cgcggcactg aacggggtgg atgtcagggc cttcaccgga aaagcgaaat actgcaaaaa     80700
     attcgcggct ggcttcagta actgctgcaa agacggcggc tggggccagg atgtggggct     80760
     ggcacgctgc agcagcgagg aaaaggcgct ggccaaagcg aaaaaagaca agatgacggt     80820
     cagtatcggg gagttctgct ctaaaaaggt tctgggtatt tgcctggaga aaaaaaggag     80880
     ctattgccag ttcgactcaa aactggcgca gatcgttcag cagcagggca gaaacggcca     80940
     gctgcatatc ggttttggcg gcgccagcag tcctgactgt cggggcatta ccgtcgcgga     81000
     actccagggg attgatttta acgagctgga tttcacaaac ttcatggagg atttaatcaa     81060
     taaccagaaa atcccggata acagcgaact gaccgaaaaa acaaaagcgc gtattaaaga     81120
     acttctcacg cagtcttcag caaagtaact ctccattaat aacatatcaa aggtgactaa     81180
     atggctgcgt ccttgatggt cgttgttttg cttgtgctct ttcttttcat tccggcctgt     81240
     atcgccctgt tcatgtcagg ccgcagtctg ctcctgatat tcctgggtgc cgtggcgtgc     81300
     caggcggctg ttgccgttgc gtttgcagga ctgtctgccc ggggctggtc tgagtcgatg     81360
     gggatggggg cggcatcact cattttctac gttatcgggc tgcacaaggc tgacggtgta     81420
     aaacagaata ctcataacgg gagacaaaag aatgaaagtt aattttcaca aacatcctgc     81480
     cgtcgatttt tctctgagac tgacgctgac ggtaattatc atatctccgg tgatttattt     81540
     ctcctgggat gccgtcaaag ggacatcggg gagtgattat gttgagagtg tggtctttat     81600
     tctctgcatg ggcggtgtcg ggcttatgaa ttatctgttt ttttcggcgc tgaccagact     81660
     tttacagaag ggaaaataaa ggagcaggga tggaagagag aaaatcgtat ggaatggtgg     81720
     tgctgtttgt cagcgtgttt gttgtttttc tggtgagcat tatgtcgtac agcctgtggc     81780
     gggacaggca ggttaacgca tttatgacca ccaaccgggc ctgggggatc cagtgcgaca     81840
     ctgtttctca ggccgcgtgg gtgatcaggg acggggagcg ggtggacctt cagataaatc     81900
     atctgcctct gtactgcagc ggttaccgct ttgaagcccg tgatgatgca ggaaagatac     81960
     agcgccagct cgataaatac agtgtctatc agcatctgtc acgccagtcg caataattca     82020
     taaaagggta ttagccatgc gaacaataca tgccgccatg ctggcggggt gcctttgctg     82080
     cgccctgatg ccggctttcg ccaaagacgc gggctggcag tggtacaacg agaaactgaa     82140
     gccccgtgat gaggacagga aagccgtacc agcggcacca ccgccgcaaa tggatattct     82200
     ggagaaactc gccacactcc aggcggccac caaacggtcg ttgtacgaag ccattctgta     82260
     tccatcgtct gaaaacttcg tgaagtattt ccggctgcag aactactgga cgcagcaggc     82320
     aggtttgttc tcgatgagtg cgaagaaagc gatgctggaa aaccccgaac tcgattacaa     82380
     cctgcagtac agccactaca acggcacggt aaaaaaccag ctcgctgccg actatgccga     82440
     acagcgacag gctatctcca ccctcgcaca gcactacggc gtgatgttct tctaccgggg     82500
     ccgggaagcg atcgatggcc agctggtcca ggtgattaaa aattttcgcg aaacctatgg     82560
     cctgagcgtg ataccggtgt cggttgacgg agtgattaac cccatgctgc ccgacagccg     82620
     gacggaccag ggccaggcag agcagcttgg cgtgaagttc ttccccgcga tgatgctggt     82680
     cacccgattt cagcaacacc ctgttcctgc tcgacgagag ctcaatggtg gggctggccg     82740
     atatggcaaa agcccactcc ctcatcgtcg ctggcggtgg acgggcggtg tccagtgggg     82800
     ataacgacca gctgcagccc atcgcgccgg gccagccgtt caggctgatg cagcagcgca     82860
     gcgccgccga cattgccatc atgaaagaga ttgtgcgcca ggtgcctgag ctgcgaccgg     82920
     cggtctacag cctgattgaa cgggatgtgc accgcgccct gaccaccatt gagcaggtca     82980
     cgccggagca ggtgccgaga aaagaaggcg tctgggcgcc gggcagttct gtggtggaat     83040
     tcacgccaaa gcaggaaaag gcgatagaaa aggcgctaag cgaggggaaa atcctgccgg     83100
     caggtcagcc cgcgacgctc tacgaggcgc tggtgaagga ctataccgga cggaccccgg     83160
     aggcacagtc gcagacgctg gtgatcaccc atctgaataa ggaccggcgg gcgctgaaca     83220
     gtctgatcca tgacgcccgg cgggataacg gggaaaccgg caaagaggaa atcaccctgc     83280
     cggtgctggt cacgagtaac atccgtgacg gtgaactgcg caaactgtcg acctggacgg     83340
     ctcacaagga ggcggtggcg ctggttgata acgtatacca ccgtatcagc aaagtggata     83400
     aggataatca gctgatcacc ctgacagaca gtgacggaaa ggagcgattt atctctcccc     83460
     gtgaagcctc tgctgaaggt gtgacgcttt atcgccagga aaagatcacc gtgtctcagg     83520
     gggaccgaat gcgcttcagt aaaagtgacc tggagcgcgg ctatgtggcc aacagtatct     83580
     gggaggtgca gtctgttgcg ggtgacagtg tcacgctgtc tgatggcaaa accacccgca     83640
     cgctgacccc gaaggcggat caggcgcagc agcatatcga cctcgcctac gccatcacgg     83700
     ctcacggcgc ccagggggcc agcgaaccgt atgccatcgc gctggaaggg gtggccggtg     83760
     gtcgggaaca gatggccagc tttgagtctg cctatgtggc tttatcccgc atgaaacagc     83820
     atgtgcaggt ttacaccgac agccgtgagg gctggataaa ggccatcaag cattcacctg     83880
     agaaagcgac ggcgcacgat attcttgaac cccgtaacga ccgggcggtg aaaaccgccg     83940
     atctgctgtt cgggcgggca agaccactgg atgaaaccgc cgctggccgg gcagccctgc     84000
     agcagtccgg tctggcacag ggaaattcac cgggaaaatt catttctccg gggaaaaagt     84060
     accctcaacc acatgtggcg ctgccggcat ttgataaaaa cgggaaagcc gccggtatct     84120
     ggctcagccc gctgaccgat cgggacggac ggctggaggt tatcggcgga gagggacgaa     84180
     ttatgggcaa tgaagacgcc cggttcgtgg cgctgcagaa cagccgcaac ggtgaaagtc     84240
     tgctggccgg gaatatgggg gagggggtca gaatggcccg cgacaatccc gataccgggg     84300
     tggtggtgcg gctggccggt gatgaccgcc cctggaaccc cggggccatg accggcgggc     84360
     gggtatgggc tgatccggca ccggtggctc cggtaccgca ggccggtgct gacattatcc     84420
     tcccgccaga ggtactggcg cagcgggcgg cagaagagca gcagcgccgg gaaatggaaa     84480
     tacaggcgga acagactgcc cgggaagtgg ccggggaagc gcgtaaagcc ggtgagccgg     84540
     cggaccgggt gaaagaggtt atcggggacg tcatccgcgg gctggagcgt gaccggccgg     84600
     gtacggagaa aacgacgcta ccggatgatc ctcagttccg gcgccaggag gcggcgattc     84660
     agcaggtggc ctcagaaact ctgcagcgtg agcgtctgca ggctgtggag cgggacatgg     84720
     ttcgtgacct gaaccgcgag aaaaccctcg ggggcgactg acgcgcctgc ggcttgtctg     84780
     ctccggcagc ctccccgatt aaaatcgggc agtctgccgg agcgctaaaa ggaaaaaaac     84840
     atgagagcac aacacacatt tccaggtgcg acagaccgct ggcttcatcg cctgctgacc     84900
     tggacaccgg gacaaacgga tatgattaaa acggtcgcac tggtactgat ggtgactgac     84960
     cacaccggct tactgctggc cggaaacaat gaagtgatgc gcctgctggg acggggctgt     85020
     tttccactgt tcggtctggc atggggaatg aatctggccc ggtacgcgga aatacgccag     85080
     tcgcagctca acagcctgtg gggctgggcg ctggttgccc aggtgtcgtt tatgctcatc     85140
     gggtacccgt ggtataccgg gaatattctg tttgcctttg ccgtcaccgg ccaggtcctg     85200
     cggtgggtca gccagccgtc ctggtcttac accctcccgg cggctggact gctggtcgcc     85260
     tggatacccc tgtcgaccgc cagctacggc atggccggag tgggtatgct caccgccagc     85320
     tggctgcttt gccgcacaca gcacgcaccg gaacggctgg gatacggggt gctgtgggcc     85380
     ctcatggtgt tgctgatgaa tatgcatgac gtgagtgaat cggtggccgg gctggcgatc     85440
     gcgctgctga cgctgatggt gtgctcatct gccggagaac gtgtgaaacg cttctggcca     85500
     cggcatttct tcgtgatgtt ctatgccgtg cacctggcgg tactgggtat tgtcgtctca     85560
     atgtgaatgc aggagcagga aagggcgacg ctgttcaggt atagtagccc ttattagcta     85620
     agcgataggc acttgttatg gcagaagaaa aacgccctgt actgagcctg aaacgaaaac     85680
     cggcggaaga cagtacggcc cccgcggagg cgacgccagt tcctggtgtg gtgcgccgaa     85740
     agaaagtcgt ggtggtttcg tccccgccgg cctggaaggc aaagaaagcg aaacttgaga     85800
     aggttaaaca agcggccgaa gccgccgcgc gtaacgcggc gccggcgccg gttaaagcgg     85860
     taaagacgcc ccctccggtg cgttatcttc gcctgctgcc gccggaacag gccataatga     85920
     ccctgaaggc attctggcca cagctgttcg acggaaacgc gccacgtctg ctggcgacgg     85980
     gcatgcgcga acagttgttt gcggatatcg tgaaccgtga cctgccgctg tcgcataaac     86040
     aagtgattaa atgcctgaag agtctgaccc ggtctgcggg ctatctgtcc cggatgaagg     86100
     caggggtctc ccgctatgat ctgcagggga atgccgtcgc gaccgtcact gcagaggaag     86160
     cgcagtacgc cagcgagcgc atgatgaaag aactcctgcg aactgagcgt atgcggagcc     86220
     agtcagctgg ctgaatacaa tcgaggagag gaaatggatt ttgaagcgcg gaaacaaaag     86280
     gcgctggcga taatggccag ccgtaagatg tggaaaagca attatgcacc gcttctgata     86340
     cgactgttgt ggcggctggg gataaacatt cccccgctgc cgtttgctcc gctctggcag     86400
     gtttttgtcg taatgacagg ctatttctcc cttggatatg ggctgtggat gtactggacg     86460
     gtgtggcggg cccaggggat gcctctcctg ttcgcctgcg aaatcagtct tatcgcgggc     86520
     gtgttatttg gcctgacgat ggcacttttt catctgtggc ggcgaaaggt gaataaatta     86580
     cctgactgga aagatctgta atgaaataaa tatatgctgt caggttgtga atattcctgg     86640
     cctgacagac ccctcgtgtt cttaaaaaca tttaccctgt atggtgtggt tattatacgt     86700
     gactacgtcc gttctggtat tactcctgtc cggaaggggc tgttgtgttt cttattgtcg     86760
     tatatagtca gaacaaatat attcaaacga aagagaggta aagggtgaaa ggcattgtgg     86820
     ctgaggcatg tgtgttgccc gggtatgggc agacgcgaag aatgacaagc cattcggtgc     86880
     cgtgaatggc tgcttcggga ctgccacgtc ccggggcgat gtgacgctta taagtgctca     86940
     attttcaatt taagtcatcc actgtcagta tttaactgat ttcaatattt ttattacatc     87000
     acgacgtgcg atatatgaaa tgcacaggct ttcatatcgt gcgtaaatca tcaaataaaa     87060
     aggaaaaaaa ctatgtttaa atattttatt ctgcgcaaac agcagcagct gttctgttat     87120
     ttctgcggta tcgtgctagc gatggttctt atgctcctgt tcccttccgt ttttcggggg     87180
     agtgggtttt atctgctttt atcgtctgtt gcgctgttct gggcaggcct tgccctatat     87240
     acccgtcaca tcgaccggat gcgaaagcca gaggtctcac cgctggtcag tattcgcgac     87300
     ggtaatcagg tggtggccga ggtgccgcgc catgaaaagg cccggctgga atgggaaatc     87360
     ttccgggacg atgaggtgtt tcgccagcaa aggtgggagc ttacaggcct gaccggacgg     87420
     gttatcagcc gggggctgtt gtatacgccg gcggtgatgc tggttggtat cggtattctc     87480
     gcctggggtt ccccacagga tgccatccag ctgattaatg ctcttcgtaa tatgcctgct     87540
     gcggaactgg tgcatcagat tggttttgtc ctgtgcctcg tcctgcagat tagcgtcata     87600
     tcagttctga tcgctgatgt tgtagccggg agaggattgc cgaatgtatt tcgccgcgcg     87660
     ttgctcaaca ggctgccggc agagttctgc cttatcagaa aagggacaga aagatgagga     87720
     cgacgacagg aaaacgcatc gggaaagaaa ggaacatcag ggaataaaat acatggcaaa     87780
     gatattaatg atggcgggca gtaccgttgt tgtgctgagt ttgctggggt ttctggtgct     87840
     gcttctgaaa ggacgcgcag taacgaagac ttccccggtt ctgatgtcac tcaaagccct     87900
     gggtattcgc ccctcagagg ctgagcaacg gttgtgtcgc cagcgggtct gggtgggtaa     87960
     tgacacactg atgacgccac gggaacaaca ttttttccgg gaattactga ggcataccag     88020
     ccgaaatcgc tggctgttgt gtcctcaggt ccgggtggca gatattgcca cactctcttc     88080
     ccatatccgg ccacgatccc ggacctggtg gcaactcttc cggatggcat cacagtggca     88140
     ctgcgatgtg gtcatcgttg acatccatac cttcgctatc gtcggcgcag ttgaactgga     88200
     tgatgcctca cacctgaaaa aacaccgtat ccggcgcgat attctgctgg aagaggttct     88260
     gaggcaggcc ggtattccac tattacgcga tcgggattca gagaggctgg taagaagggt     88320
     cggagagttt ctgaaatacc gcggagccga tgctgccgaa aaatccataa ccggtatgaa     88380
     ttcaacgaca gagcatactg aacgcaagga gaatgaaaaa tgattatcgc cgccgaagtg     88440
     aaacgtgatg aacaggggta ctggacgcat cctgcactgg cacgcagtgg ctgtgaaact     88500
     tccgcagaat taagctactg gctcagaacc cataaacttc agtgctttgt gatgacaatg     88560
     cgcgatgaag cgcctgaagc tttcgctgcc ggatttacgg atgaagcccc ggatgcccgt     88620
     ggctggatac cggaacctcc ggatgatgat ggctggtttc tgggctctgt ccacgatacc     88680
     ggcgacggac ctgtctgcta ctggtttcgg cataccacaa aatcctgacg cctccgcatg     88740
     gcgtcgttgt ccaaccccgg gaacggggaa aagccagttt cccccgctcc cggcgtttct     88800
     taaacacccg ttaaggaaat actgtgaaaa aaattaaccg tacactccac aaatgttgtc     88860
     tgtcggggct tatcagcctg gctttgtgtg cacctgttcc ggccgtgtat gccgccagca     88920
     tcgagacagg atattctccg gaaggaacgg ctctgcagct ggtcctgaag actattgatt     88980
     ctgcgcagca ggaaatccgg ctgatggggt attcctttac ctcacctgaa gtcgccggtg     89040
     cgcttgtcag ggcaaagcgg cgtggtgtcg atgtgaaagt ggttctggac tggaaagcca     89100
     ataccggcaa gcaaaaccag gcgagcctgg cggccatgaa tcttctggtc aatgccggca     89160
     tcccggttcg cacagtgtcg cagtacaaaa tcatgcacga taaagtcatc attgccgatg     89220
     gacgcaatat tgaagtcggg tcttttaact acacccgcgc cgctgatcgg gtcaattcag     89280
     agaacgtgct tgtcgtatgg gatgttccag tcgtagctca acgctatctg cagcactggc     89340
     agtctcgctg gaatggcggt actgattggc attcatcgta ctaacgatca cattgaacac     89400
     attttttctg cgccaacagg aaaaatgtat tttacattaa attaatgtgt gcactcgctg     89460
     cctataaaga catgtagtat ctttgtccag gtattttgtt aaatgcttga ggaggcagag     89520
     atgtcacagg tcgttaacgg agttacttcc tcatcgaaac gtccctaccg gaaagggaac     89580
     ccacttagcg atgctgataa acagcgatct tcagtggcaa agaaaagggc cacccataaa     89640
     gaagttaaag tgttcctgga accacagctc aaagacatat tgatgaaaat gtgtcatgac     89700
     gatgggttaa cacaggctga agtactgtcc cggttgatcc aacgcgaagc attagccaga     89760
     aacatatctt aatgggctta ctttcttgaa cctttacccg atgagtgtta aattgctgcg     89820
     agattagagc ttttggtgtg ccacgccgta aggtggcagg gagctggttt tgtggatgtt     89880
     tacccggaac cagaaagcaa aaaccccgat aatcttcttc aatcttggcg gacagaaaag     89940
     attaacgggg ccttcataaa ctgcatagaa cgtgttgctc tatgcaggga gtatagaatt     90000
     atgcccagaa aagttcaaga ccttctgtgc tcactccttc cgtgcaacat aagcgcagga     90060
     agcggtgact gatatccttc aaaaccacta ttcacaggtt aaaaacccga acccggtttt     90120
     cacgccgcga gaagggaaaa agaccctgcc gttctgccgt aagctgatgg cgaaagccgg     90180
     cggcttcacg tctcgttttg atttttccat tcatgtggcg tttttgcgtt cgctggggaa     90240
     gcgtcaccgg atgccaccgc tgttgcgccg gcgtgcaatt gacgcgctac tgcaggcaat     90300
     gtgttttcac tacgatccgc tggccaatcg tgtgcagcgc tcgattacca atatggccat     90360
     cgagtgtgga ctggccaccg agtccaggag cggcaatctg tcagtcagtc gtgccacccg     90420
     ggcgctgaag tttctggcag agctgggtct catcacctat cagactgaat atgacccgca     90480
     gatcggctgt aatatcccga ccgatatcac gttcaccccg gccctgtttt ccgcgctcga     90540
     cgtttctgag gtggctgtgg tggccgcgcg ccgcagccgt gtggagtggg aaaacctgca     90600
     gcgcaaaaag cagaaactga aaccgctgga gatggacgaa ctgatcgcaa aagcatggcg     90660
     gtttgtgcgt gagcgttttc gcagctatca ggctgagcgt aaatctcacg gccggaagcg     90720
     ggatactgca cggcgggatg catcacggca gcgtcatgac attgagacgc gcgtgcgtca     90780
     gcaactgact cgcgaatacg ccaccggccg cttcaggggt gataaagaag cgctgaagcg     90840
     tgaggttgag cgccgtgtgc aggagcgcat gctgctgtcg cgcgggaaca actacacgcg     90900
     actggccact gtccccatat aacatcacct tccttaaaaa atccggccgg cgccggaggc     90960
     tttcgcacgc ctgttggccg gctactacgt attatctcat cttcagacct gcattcctca     91020
     ccataattcc ggtcttcctg gcgtcaaagt ggccttaaat gttatcgcct gcgtcacttc     91080
     tgacggccga attctg                                                     91096
//

If you have problems or comments...

PBIL Back to PBIL home page