(data stored in ACNUC7421 zone)

EMBL: CP000972

ID   CP000972; SV 1; circular; genomic DNA; STD; PRO; 8909 BP.
XX
AC   CP000972; ABAQ02000000-ABAQ02000005;
XX
PR   Project:PRJNA19469;
XX
DT   21-MAR-2008 (Rel. 95, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Escherichia coli SMS-3-5 plasmid pSMS35_8, complete sequence.
XX
KW   .
XX
OS   Escherichia coli SMS-3-5
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Enterobacteriaceae; Escherichia.
OG   Plasmid pSMS35_8
XX
RN   [1]
RP   1-8909
RX   DOI; 10.1128/JB.00661-08.
RX   PUBMED; 18708504.
RA   Fricke W.F., Wright M.S., Lindell A.H., Harkins D.M., Baker-Austin C.,
RA   Ravel J., Stepanauskas R.;
RT   "Insights into the environmental resistance gene pool from the genome
RT   sequence of the multidrug-resistant environmental isolate Escherichia coli
RT   SMS-3-5";
RL   J. Bacteriol. 190(20):6779-6794(2008).
XX
RN   [2]
RP   1-8909
RA   Fricke W.F., Wright M.S., Lindell A.H., Harkins D.M., Baker-Austin C.,
RA   Ravel J., Stepanauskas R.;
RT   ;
RL   Submitted (14-MAR-2008) to the INSDC.
RL   J. Craig Venter Institute, 9712 Medical Center Dr, Rockville, MD 20850, USA
XX
DR   MD5; 48f453b74a2594c0ec32c5b6532a1320.
DR   BioSample; SAMN02604066.
DR   EnsemblGenomes-Gn; EBG00001068348.
DR   EnsemblGenomes-Tr; EBT00001670394.
DR   EuropePMC; PMC2566207; 18708504.
DR   EuropePMC; PMC5382810; 28663823.
DR   RFAM; RF00106; RNAI.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..8909
FT                   /organism="Escherichia coli SMS-3-5"
FT                   /plasmid="pSMS35_8"
FT                   /strain="SMS-3-5"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:439855"
FT   gene            complement(257..496)
FT                   /locus_tag="EcSMS35_B0001"
FT   CDS_pept        complement(257..496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcSMS35_B0001"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:EcSMS35_B0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACB20371"
FT                   /db_xref="UniProtKB/TrEMBL:B1LRY6"
FT                   /protein_id="ACB20371.1"
FT                   /translation="MWVVCIATGAWNAFRFFCNRRQNAFNASSDGIREELLELFLLATE
FT                   RNYLLFRSTRGYVRIGTEQGLLKDTVCQKKNPHT"
FT   gene            complement(661..2214)
FT                   /gene="mbeA"
FT                   /locus_tag="EcSMS35_B0002"
FT   CDS_pept        complement(661..2214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mbeA"
FT                   /locus_tag="EcSMS35_B0002"
FT                   /product="mobilization protein MbeA"
FT                   /note="identified by similarity to SP:P13658; match to
FT                   protein family HMM PF03432"
FT                   /db_xref="EnsemblGenomes-Gn:EcSMS35_B0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACB20376"
FT                   /db_xref="InterPro:IPR005094"
FT                   /db_xref="UniProtKB/TrEMBL:B1LRY7"
FT                   /protein_id="ACB20376.1"
FT                   /translation="MIVKFHARGKGGGSGPVDYLLGRERNREGATVLQGNPEEVRELID
FT                   ATPFAKKYTSGVLSFAEKELPPGGREKVMASFERVLMPGLEKNQYSILWVEHQDKGRLE
FT                   LNFVIPNMELQSGKRLQPYYDRADRPRIDAWQTLVNHHYGLHDPNAPENRRTLTLPDNL
FT                   PETKQAIAESVTRGLDVLYRAGEIKDRQDVIQALTDVGVEVVRVTRSSISIADPNGGKN
FT                   IRLKGAFYEQSFTDGRGVREKAERESRIYRESAEQRVQEARRICKRGCDIKRDENQRRY
FT                   SPVHSLDRGIAGETPGRGERGDEAAQEGRVKAGREYGHDVTGDSLSPVYREWRDALVSW
FT                   REDTGEPGRYQEAGRDIAETEREDMGRGVRAGREQEISGPSVREISRGDSLSGERVGTS
FT                   EGVTQSDRAGNTFAERLRAAATGLYAAAERMGERLRGIAEDVFAYATGQRDAERAGHAV
FT                   ESAGAALERADRTLEPVIQREQEIRDELLIQEREHELFLERERHLEIQERTLDGPSLGW
FT                   "
FT   gene            complement(2204..2551)
FT                   /gene="mbeC"
FT                   /locus_tag="EcSMS35_B0003"
FT   CDS_pept        complement(2204..2551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mbeC"
FT                   /locus_tag="EcSMS35_B0003"
FT                   /product="mobilization protein MbeC"
FT                   /note="identified by similarity to SP:P13657; match to
FT                   protein family HMM PF05713"
FT                   /db_xref="EnsemblGenomes-Gn:EcSMS35_B0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACB20370"
FT                   /db_xref="InterPro:IPR008687"
FT                   /db_xref="UniProtKB/TrEMBL:B1LRY8"
FT                   /protein_id="ACB20370.1"
FT                   /translation="MIPMKRERMLTIRVTDDEHARLLERCEGKQLAVWMRRVCLGEPVA
FT                   RSGKLPTLAPPLLRQLAAIGNNLNQTARKVNSGQWSSGDRVQVVAALMAIERELRSLRQ
FT                   VVREQGARDDS"
FT   gene            2558..2782
FT                   /gene="rop"
FT                   /locus_tag="EcSMS35_B0004"
FT   CDS_pept        2558..2782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rop"
FT                   /locus_tag="EcSMS35_B0004"
FT                   /product="regulatory protein Rop"
FT                   /note="identified by similarity to SP:P03051; match to
FT                   protein family HMM PF01815"
FT                   /db_xref="EnsemblGenomes-Gn:EcSMS35_B0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACB20375"
FT                   /db_xref="InterPro:IPR000769"
FT                   /db_xref="InterPro:IPR035962"
FT                   /db_xref="UniProtKB/TrEMBL:B1LRY9"
FT                   /protein_id="ACB20375.1"
FT                   /translation="MNRNPPYTEASVTKQEKTALNMARFIRSQTLTLLEKLNELDADEQ
FT                   ADICESLHDHADELYRSCLARFGDDGENL"
FT   gene            complement(2848..3096)
FT                   /locus_tag="EcSMS35_B0005"
FT   CDS_pept        complement(2848..3096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcSMS35_B0005"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:EcSMS35_B0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACB20367"
FT                   /db_xref="UniProtKB/TrEMBL:B1LRZ0"
FT                   /protein_id="ACB20367.1"
FT                   /translation="MSRHRSPQPNDRAQRVSERGSGRASASACSPYASVRHFTPYMVHF
FT                   SYNPHRCRMTKPVYTPLSLRDWVRAAPRHPLKPADAP"
FT   gene            3153..3524
FT                   /locus_tag="EcSMS35_B0006"
FT   CDS_pept        3153..3524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcSMS35_B0006"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAS58761.1"
FT                   /db_xref="EnsemblGenomes-Gn:EcSMS35_B0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACB20369"
FT                   /db_xref="UniProtKB/TrEMBL:B1LRZ1"
FT                   /protein_id="ACB20369.1"
FT                   /translation="MSKKRRPQKRPRRRRFFHRLRPPDEHHKNRRSSQRWRNPTGLKDT
FT                   RRFPPEAPSCALLFRPCRLPDTSPPFSLREAWRFLIAHAVGISVRCRSFAPSWAVCTNP
FT                   PFSPTAAPYPVTIVLSPTR"
FT   gene            3992..4333
FT                   /gene="imm"
FT                   /locus_tag="EcSMS35_B0008"
FT   CDS_pept        3992..4333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="imm"
FT                   /locus_tag="EcSMS35_B0008"
FT                   /product="colicin-E1 immunity protein"
FT                   /note="identified by similarity to SP:P02985; match to
FT                   protein family HMM PF03526"
FT                   /db_xref="EnsemblGenomes-Gn:EcSMS35_B0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACB20368"
FT                   /db_xref="GOA:B1LRZ2"
FT                   /db_xref="InterPro:IPR003061"
FT                   /db_xref="UniProtKB/TrEMBL:B1LRZ2"
FT                   /protein_id="ACB20368.1"
FT                   /translation="MSLRYYIKNILFGLYCTLIYIYLITKNNEGYYFLASDKMLYAIVI
FT                   STILCPYSKYAIEHIFFKFIKKDFFRKRKNLNNAPVAKLNLFMLYNLLCLVLAIPFGLL
FT                   GLFISIKNN"
FT   gene            complement(4330..5895)
FT                   /gene="cea"
FT                   /locus_tag="EcSMS35_B0007"
FT   CDS_pept        complement(4330..5895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cea"
FT                   /locus_tag="EcSMS35_B0007"
FT                   /product="colicin-E1 protein"
FT                   /note="identified by similarity to SP:P21178; match to
FT                   protein family HMM PF01024"
FT                   /db_xref="EnsemblGenomes-Gn:EcSMS35_B0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACB20372"
FT                   /db_xref="GOA:B1LRZ3"
FT                   /db_xref="InterPro:IPR000293"
FT                   /db_xref="InterPro:IPR038283"
FT                   /db_xref="UniProtKB/TrEMBL:B1LRZ3"
FT                   /protein_id="ACB20372.1"
FT                   /translation="METAVAYYKDGVPYDDKGQVIITLLNGNPDGSGSGGGGGTGGSKS
FT                   ESSAAIHATAKWSTAQLKKTQAEQAARAKAAAEAQAKAKANRDALTQHLKDIVNEALRH
FT                   NSTHPEVIDLAHANNAAMQAEAERLRLAKAEEKARKEAEAAEKAFQEAEQRRKEIEKEQ
FT                   AETERQLKLAEAEEKRLAALNEEARAVEVAQKNLAAAQSELAKVDEEIKTLNTRLSSSI
FT                   HARDAEMNTLSGKRNELAQASAKYKELDELVKKLSPRANDPLQSRPFFYATSRRTGAGK
FT                   IMEEKQKQVTASETRINQLNAEINGIQGAMSQANNNRNTAVLRVHESEENLKTAQTNLL
FT                   NSQIKDAVDATVSFYQTLSEKYGEKYSKMAQELADKSKGKKISNVNEALAAFEKYKDVL
FT                   NKKFSKADRDAIFNALESVKYEDWAKHLDQFAKYLKITGHVSFGYDVVSDILKIKDTGD
FT                   WKPLFLTLEKKTVDAGVSYIVVLLFSVLAGTTLGIWGIAIVTGILCAFIDKNKLNTIND
FT                   VLGI"
FT   gene            6155..6592
FT                   /locus_tag="EcSMS35_B0009"
FT   CDS_pept        6155..6592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcSMS35_B0009"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAB59142.1"
FT                   /db_xref="EnsemblGenomes-Gn:EcSMS35_B0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACB20373"
FT                   /db_xref="UniProtKB/TrEMBL:B1LRZ4"
FT                   /protein_id="ACB20373.1"
FT                   /translation="MGHCHFMAWHTLQNALKMTGRSRSQFYRDMRAGLVSYRTGQDGRR
FT                   EFETSELIRAYGELKQDETPERHSAGQAENPHDQQTERILRELNELRQCLTLMLEDKQA
FT                   QATERRRQEAEREQLHKEIEQLRQALEQEKKRGFWARLFSR"
FT   gene            6676..7095
FT                   /locus_tag="EcSMS35_B0010"
FT   CDS_pept        6676..7095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcSMS35_B0010"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:EcSMS35_B0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACB20374"
FT                   /db_xref="UniProtKB/TrEMBL:B1LRZ5"
FT                   /protein_id="ACB20374.1"
FT                   /translation="MRRSGGTLYLIALLTAATVLTACTPKGSVEQHTRHYVYASDDGFD
FT                   PNFSTQKADTTRMMVPFFRQFWDMGAKDKATGKSRSDVQQRIQQFHSQEFLNSLRGTTQ
FT                   FAGTDYRSKDLTPKKSRLLAETISAVYLDGYEGRQ"
FT   gene            7621..7839
FT                   /pseudo
FT                   /locus_tag="EcSMS35_B0011"
FT                   /note="IS1203 transposase, truncation"
XX
SQ   Sequence 8909 BP; 2359 A; 2339 C; 1834 G; 2377 T; 0 other;
     taaaagaata atattctaaa ctacagttat ttatgcagaa cataacatca aactcacaat        60
     aaatataaaa caattatttt ataactgttc acttattata ttcagacata tcagaaacac       120
     gactcaattc ttttttattt aacaaaatcc ataaaaaact tatggttgaa atcacattta       180
     aactgtgaag gatatcatcc ggagaaattt ttcaatccga cactccatag aatggacctt       240
     taagacttta tcctcatcat gtatgaggat tttttttctg gcaaacagta tctttcagta       300
     atccttgctc agttccgatt ctgacgtatc cccgtgtgga tctgaaaagg agataattac       360
     gctctgtggc caacaggaat aactcaagca gctcctctct gataccatca gaagaagcat       420
     taaacgcatt ctggcgtcga ttacagaaga agcggaacgc gttccaggct cctgttgcta       480
     tacacactac ccacactaac cccatggttt ttgagcgcca gaaacgcgtc cgtatgcgtt       540
     ttaacgcgtt cctgtgtttt cagcaaggcc tgactgaagc tagttcctag tgccctgaac       600
     caaccattat ccaaaaaaat gcaccggaaa cgcgctgaca acactttagc ctgtctttgg       660
     ttaccatccc agcgacgggc catccagtgt ccgttcctgt atttccagat ggcgctcacg       720
     ctctaggaat agctcatgtt cacgttcctg tatcagtagt tcgtccctta tctcctgctc       780
     tcgctgtata actggctcaa gtgttctgtc tgctcgctca agtgctgcac ctgctgactc       840
     aactgcatga cccgctcgtt cagcatcgcg ttgtcccgtt gcgtaagcga aaacatcttc       900
     tgcaattcca cgaaggcgct ctcccattcg ttcagccgct gcatatagtc ctgttgcagc       960
     tgctctaagg cgttcagcaa atgtgtttcc agctctgtca ctctgtgtca ctccttcaga      1020
     tgtacccact ctttcccctg aaagggaatc acctctgctg atttcccgta cggaaggacc      1080
     agaaatttcc tgttcccgtc ctgcacgaac tccacgcccc atgtcttcgc gttcagtttc      1140
     tgcaatgtct cttcctgctt cctgatatct tccaggttcg cctgtatcct cccgccaaga      1200
     taccagagcg tcccgccact cgcggtaaac aggagaaaga ctatccccag taacatcatg      1260
     cccgtattcc ctgccagctt taacacgtcc ttcctgtgct gcctcatcgc ctctttcacc      1320
     ccttcccggt gtttctccag cgattcctct gtcgaggctg tgaacagggc tatagcgtct      1380
     ctgattttcg tctcgtttga tgtcacagcc tcgcttacag attcgccgag cctcctgaac      1440
     tcgttgttca gcactttctc tgtagattcg gctctctctt tcagcttttt ctcgaactcc      1500
     gcgcccgtct gtaaaagatt gctcataaaa cgctcctttc agcctgatat tcttcccgcc      1560
     gttcgggtct gcaatgctga tactgcttcg cgtcaccctg acaacctcaa ctcccacatc      1620
     tgtgagtgcc tgaatcacat cctgacggtc ttttatctct ccggcacggt aaagcacatc      1680
     aagcccccgt gtaacgctct cagcaatcgc ctgtttcgtt tccggcaggt tatcagggag      1740
     tgtcagcgtc ctgcggttct ccggggcatt cgggtcatgc agcccgtaat ggtgattcac      1800
     cagcgtctgc caggcatcaa ttctcggcct gtctgcgcgg tcatagtacg gctggaggcg      1860
     ttttccgctc tgtagctcca tgttcggaat gacaaaattc agctcaagcc gtcccttgtc      1920
     ctggtgctca acccacagga tgctgtactg atttttttcg agaccgggca tcagtacacg      1980
     ctcaaagctc gccatcactt tttcacgtcc tcccggcggc agctccttct ccgcgaacga      2040
     cagaacacct gacgtgtatt tcttcgcaaa tggcgtggca tcgatgagtt cccggacttc      2100
     ttccggatta ccctgaagca ccgttgcccc ttcccggtta cgctcccttc ccagcaggta      2160
     atcaaccgga ccactgccac cgccttttcc cctggcatga aatttaacta tcatcccgcg      2220
     ctccctgttc cctgacgacc tgccgtaagc tgcgcaactc tctctcgatg gccatcagtg      2280
     cggccaccac ctgaacccgg tcaccggaag accactgccc gctgttcacc ttcctcgccg      2340
     tctgattcag gttattcccg atggcagcca gctgacgcag taacggcggt gccagtgtcg      2400
     gcagcttccc ggaacgggca accggctcac ccaggcatac ccgccgcatc cataccgcca      2460
     gttgtttacc ctcacagcgt tcaagtaacc tggcatgttc atcatcagta acccgtatcg      2520
     tgagcatcct ctcgcgtttc atcggtatca ttaccccatg aacagaaatc ccccttacac      2580
     ggaggcatca gtgactaaac aggaaaaaac agcccttaac atggcccgct ttatcagaag      2640
     ccagacatta acgctgctgg aaaagctcaa cgaactggac gcggatgaac aggcagacat      2700
     ctgtgaatcg cttcacgacc acgccgatga gctttaccgc agctgcctcg cacgtttcgg      2760
     ggatgacggt gaaaacctct gacacatgca gctcccggag acggtcacag cttgtctgtg      2820
     agcggatgcc gggagcagac aagcccgtca gggcgcgtca gcaggtttta gggggtgtcg      2880
     gggcgcagcc ctgacccagt cacgtagcga tagcggagtg tatactggct tagtcatgcg      2940
     gcatcggtgc ggattgtatg aaaagtgcac catgtacggt gtgaaatgcc gcacagatgc      3000
     gtaaggagaa catgcagatg ccgatgctct tccgcttcct cgctcactga ctcgctgcgc      3060
     tcggtcgttc ggctgtggcg agcggtgtct gctcactcaa aagcggtgat actgttatcc      3120
     acacaatcag gggataacgc cggaaagaac atgtgagcaa aaaacgaaga ccccagaaaa      3180
     ggccgcgccg gaggcgcttt ttccataggc tccgcccccc tgacgagcat cacaaaaatc      3240
     gacgctcaag tcagaggtgg cgaaacccga caggacttaa agataccagg cgtttccccc      3300
     cggaagctcc ctcgtgcgct ctcctgttcc gaccctgccg cttaccggat acctctccgc      3360
     ctttctccct tcgggaagcg tggcgctttc tcatagctca cgctgttggt atctcagttc      3420
     ggtgtaggtc gttcgctcca agctgggctg tgtgcacgaa ccccccgttc agcccgaccg      3480
     ctgcgcctta tccggtaact atcgtcttga gtccaacccg gtaagacacg acaaagcgcc      3540
     actggcagca gccgttggta acttggttag cagagcgatg atggcgcaaa tggtgcaaca      3600
     gagttcttga agtagtggcc cgactacggc tacactggaa ggacagtatt tggtatctgc      3660
     gctctgctga agccagttac ctcggttaag cagttcccca actgacttaa ccttcgatca      3720
     aaccgcctcc ccaggcggtt ttttcgttta caggcagcag attacgcgca gaaaaaaagg      3780
     atctcaagaa gatcctttga tcttttctac tgaacagaga tccccgtcag tttagaagaa      3840
     gatgatggag ccacagtccc tccctgaaca tcacgtatat agttagcctg acatccaaca      3900
     aggaggttta tagctaatat tcccacaaaa aatcttttcc tcataactcg atccttataa      3960
     aatgaaaaga atatataacg aggtttaatt tatgagttta agatactaca taaaaaacat      4020
     tttgtttggc ctatattgca cacttatata tatatacctt ataacaaaaa acaacgaagg      4080
     gtattatttc ctagcgtcag ataagatgct atacgcaatc gtgataagca ctattctatg      4140
     cccatattca aaatatgcta ttgaacacat attttttaag ttcataaaga aagatttttt      4200
     cagaaaaaga aaaaatctaa ataatgcccc cgtggcaaaa ttaaacctat ttatgctata      4260
     caatctactt tgtttggtcc tagcaatccc atttggattg ctaggactgt ttatatcaat      4320
     aaagaataat taaataccca acacatcatt tatagtatta agtttattct tgtcaataaa      4380
     ggcacataga atgcctgtaa caatagcaat cccccagata cctaatgtag ttccagcaag      4440
     cacactaaaa agtaaaacaa caatataact aactccagca tctacagttt tcttctctaa      4500
     tgtaagaaat agtggcttcc agtcacctgt atccttaatt tttaggatat cagataccac      4560
     atcatatcca aaagaaacat gtcccgtaat cttcaagtac ttagcaaact gatctaaatg      4620
     cttagcccag tcttcatact taaccgattc cagtgcattg aaaatcgcat cacggtctgc      4680
     tttgctgaat ttcttattta aaacatcctt gtatttttca aaagcagcta gagcttcatt      4740
     cacattgctg attttcttac ctttagactt atcagcaagt tcctgtgcca tttttgaata      4800
     tttttcacca tatttttcag atagcgtttg ataaaagcta actgttgcat ccacagcatc      4860
     cttaatctgc gagttcagga gattagtctg cgctgttttc aaattttctt cagattcatg      4920
     aacacgtaaa acagctgtat tacgattatt attagcctga gacatagccc cctgaattcc      4980
     atttatctca gcattaagtt ggttaatacg cgtttctgat gctgttacct gtttttgttt      5040
     ttcctccata atcttaccgg ctcccgtccg tcgactggtg gcatagaaaa aaggacgact      5100
     ctgaagcgga tcattagctc ttggtgacaa ttttttgacc agttcatcaa gttccttata      5160
     tttagcagat gcctgagcca gctcatttcg ttttccggac agcgtattca tttctgcatc      5220
     acgggcatga atactggagc ttaaacgggt attgagagtc ttaatctctt catccacttt      5280
     cgccagctca gattgtgcag cagcaagatt tttttgtgcc acctccactg cccgggcctc      5340
     ttcattcaat gctgccagcc gtttctcttc agcttcagcc agtttcaact ggcgttctgt      5400
     ttcagcctgc tccttctcta tctctttacg tcgttgttct gcctcctgaa aagccttttc      5460
     cgcagcttcc gcttctttac gggctttttc ttctgctttt gcaaggcgca accgctctgc      5520
     ttctgcctgc atcgctgcat tattggcatg agccaggtca ataacctccg gatgagtgga      5580
     attatgacga agcgcctcat tcacaatatc cttcagatgt tgagtcagcg catcccggtt      5640
     tgcttttgct ttagcctgtg cttctgcggc agcttttgcc cgggcagcct gttctgcctg      5700
     cgttttcttc aattgagcag tagaccattt agctgtggca tgaatggctg cagaactttc      5760
     acttttgcta cctccagttc caccaccgcc gccagagcca ctcccgtctg gattaccatt      5820
     caaaagagta atgattacct gccccttatc atcataagga acaccatctt tatagtacgc      5880
     tacagctgtt tccattataa aatcctcttt gacattaaaa acaaatagtt aaaagcaata      5940
     tactgtatat ataaccactg gttttatata cagcttaaaa ttacgccgct gcattttccc      6000
     tgtcaaccct gtggattttc atttttgtga aaacgatcaa aaaaacagcc acccacacca      6060
     cgtgctattc ccacccgatg ccacaaaaac cagcacaaac attaccgttc tccggcccca      6120
     gtatgtttta ctgaaaccat gatatgagac attaatggga cactgtcact tcatggcatg      6180
     gcacacactc cagaacgcac tgaaaatgac aggcagatcg cgttcacagt tttaccgtga      6240
     tatgcgcgca ggccttgtca gttatcgtac aggccaggac ggacggcggg agtttgaaac      6300
     cagtgaactg atccgggcat acggcgaatt aaagcaggat gagacaccag aaaggcacag      6360
     tgcgggacag gcagaaaatc cacatgatca gcagacagaa cgcattctcc gggagctgaa      6420
     tgagctgaga caatgcctga cactgatgct tgaggacaaa caggcacagg ctacggaacg      6480
     ccggcgccag gaagccgaac gggaacagct acataaagag atagagcagc tcaggcaggc      6540
     actggagcag gaaaaaaaac ggggattctg ggccagactg ttcagccggt gagcaccgac      6600
     tgcaagtgat gataagatag tcagcggtta aatataagtc actgagtaca aagatttaaa      6660
     ggtaaggaga cactcatgag acgttccggc ggcacactgt atcttatcgc cctgctgaca      6720
     gcggcaacgg tcctgacagc ctgcacgcca aagggcagtg tggaacaaca tacccggcat      6780
     tacgtttatg catcagacga tggttttgat cctaactttt ccacccagaa ggccgacaca      6840
     acacgaatga tggtgccttt tttccggcag ttctgggata tgggagcaaa ggataaagcg      6900
     acaggaaaat cacggagtga tgtgcagcaa cgcattcagc agtttcacag ccaggaattt      6960
     ttaaactcac tccggggcac aactcaattt gcgggtactg attaccgcag caaagacctt      7020
     accccgaaaa aatccaggct gctggctgag acgatttctg cggtttatct cgatggctac      7080
     gagggaagac agtaagtgga tttaccataa tcccttaatt gtacgcaccg ctgaaatgca      7140
     ttcagcgcaa tcacggcagc agacaggtaa aaatcgcaac aacccccccg aaaaactacc      7200
     gcgatcgcgc ctgataaatt ttaaccttat gcatacctat gcatccaggt gaatcacaag      7260
     cgaatttcct tactgagacg actgaaacgg ttttttttca caattttcag ctgttttcga      7320
     ttccacaaaa tagaagttac aggataggga ttaatcccct tcgccgccaa ggggagcagg      7380
     atgagtcagg ggaatgtcta ttcacctgcg ctgtacaggc tgccaggtaa aagtattcgc      7440
     tgcggcacga tactcttttg ccctcatagc ctttgcgctt cttacttttc gttcttccag      7500
     aatcattctt aagacatttt cccgcacttt tctctaactt cccgtggcaa tttatctctg      7560
     ccggactgaa ccgccccgga aatcctggag actaaacttc ctgagaaaga tgtaaacagg      7620
     atgactaaaa atactcgttt ttcccccgaa gtccgtcaac gggcagttcg tatggttctg      7680
     gaaagccagg gcgaatatga ctcacaatgg gcggcaattt gttccattgc tccaaagatt      7740
     ggctgtacgc cagagaccct gcgtgtctgg gttcgccagc atgagcggga taccgggtat      7800
     tacctttcga agaaattttt gacatcctct acgccctgaa ggaccgggtt ttacggcgta      7860
     ccagataaaa aaacccctct actgaagagg ggtagtgtaa ggaacttgct gattttcttg      7920
     atattattaa ccatcaataa ctgagcatac aaaaaataac aaaactctga cacagataca      7980
     accatccctc tttgtataag accgatgtgc atctcaaaaa agaagcgtgt ttctggaaca      8040
     cagaacaaca atgcacattg tagccaacaa attcacacca gaaacacgct ctgtttttta      8100
     atttacacaa gaatatatgt ctggaaaatc aggaagaaga aattaatggg cattctgtat      8160
     acgaagggag agcgcgtttc cggtgcccca tattagatat tatccctgca acaaacacca      8220
     gagacgcgct cataattctt ctagcgtaaa tgatcctttc aggcaagaaa aaagccgtga      8280
     ttctgtatca cggccttaat tttatcgaaa acacggattt tagtatgcac atgactgtac      8340
     tcctgtggag tacaaggaaa tcataatcag cgaccaaacc atttatcaac agaaaaccaa      8400
     catattgatg ttatttttgt gacaaatgtt acaaattcga aaccactgta tttttactgc      8460
     aacaaaatct ggttgatcta caagttacac tggggtaaaa agttgtccgg aatgtttctg      8520
     cgtagtaaag cctctagccg gattgccttt gcaaaaacgc aggaacgttc cccccttcat      8580
     cagtactcct gacgctgtaa ggagctgact gatgcagaca gggctgatga tatctaataa      8640
     aagctatctc atttttgcgc gtacataaaa taaatcaggc acttccctac actccccctc      8700
     cggaattgag ggggttttct ttacaatgta aataaattgc ttgcgtaaag ttcaaaaaaa      8760
     ctgcaaattt ttactgtagt gtcgagcttc atgtagctca ccagggcatg gactaaaaag      8820
     aagtaaaccc atcttttacc cccccttata cggggggttc tttatagcac aaagaacact      8880
     tataatttat catctcacag ctataaata                                        8909
//

If you have problems or comments...

PBIL Back to PBIL home page